GenomeNet

Database: RefSeq
Entry: NC_010133
LinkDB: NC_010133
Original site: NC_010133 
LOCUS       NC_010133             584452 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 7, complete
            genome.
ACCESSION   NC_010133
VERSION     NC_010133.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 584452)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 584452)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006489.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..584452
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="7"
     gene            complement(<1347..>5297)
                     /locus_tag="CYME_CMG221C"
                     /db_xref="GeneID:16993337"
     mRNA            complement(<1347..>5297)
                     /locus_tag="CYME_CMG221C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005535766.1"
                     /db_xref="GeneID:16993337"
     CDS             complement(1347..5297)
                     /locus_tag="CYME_CMG221C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005535823.1"
                     /db_xref="GeneID:16993337"
                     /translation="MGSTNQPTNRYLFSSMAKGTALSQKKRFTTARRRHQRAFRFMLM
                     LVLVMFWLEKVIIVQPTAAATSTPTATPTPSPTPTATPTPTPTPTPTPTPTATKTPTP
                     TATPTPTPTPTATKTPTPTATPTPTPTPTPTPTATKTPTPTATPTPTPTPTATPTPTP
                     TATPTPTHTPTATPTPTPTATPTPTPTPTATPTPTPTPTHTPTATPTPTPTATATPTP
                     TPTATATPTPTPTATPTPTPTPTATPTPTPTPTHTPTATPTPTPTATPTPTPTATATP
                     TPTPTATATPTPTPTATPTPTPTPTPTATPTPTPTPTPTATPTPTPTPTATPTPTPTA
                     TPTPTPTPTPTATPTPTPTATATPTPTPTPTPTATPTPTPTPTATPTPTPTPTPTATP
                     TPTPTATPTATPTPTATPTATPTPTPTPTPTPTPTATPTPTPTPTATPTPTPTPTPTA
                     TPTPTPTPTATPTPTPTATPTPTPTPTPTATPTPTPTATATPTPTSTPTPTPTATPTP
                     TATPTPTPTPTPTATPTATPTATPTATPTPTPTATPTPTPTPTPTPTPTPTPTPTPTA
                     TPTPTPTPTPTPTATPTPTPTPTATPTPTPTPTATPTPTPTPTPTATPTPTPTATPTA
                     TPTPTATPTATPTPTPTPTPTPTPTPTATPTPTPTPTATPTPTPTPTPTATPTPTPTP
                     TATPTPTPTATPTPTPTPTPTATPTPTPTATATPTPTSTPTPTPTATPTPTVTPTPTP
                     TPTPTATPTATPTATPTATPTPTPTATPTPTPTPTPTPTPTATPTPTPTPTATPTPTP
                     TPTPTATPTPTPTPTPTATPTPTPTPTATPTPTPTPTPTATPTPTPTATATPTPTPTP
                     TAHHAYAYDNRDTDTYTDANTNCDTDTTPTATPTPTPTPTATPSPTPTPAIAGVAFSA
                     VVSVVNKTVCVDVAVVLQDNLETKLNGTGANVTVSDNCDSIFVSIASRFADWYERSSL
                     DVQRVFSATSAVNASYNISILAPTALVSNVTKISTNFTSSVPSILPSGASHVAISTPK
                     VVPTPTPTPTPTPTPTPTTSATPTPTVSVTPSPTANVTQVSVGGGAAVCFPAGASVLI
                     DGLGKTRRISELRPGMTVIGVDSRGRLVEDTVLGWLHKETRATAEILLIKTRSGKELR
                     LTRQHLVYRMNENPRVPGRKMTAVSSLSHEKEQHIQKILELETSVGEAVFAEDIRIGD
                     ALFDIAAHLPDPVVAIDTLVTSDGLYAPLTRSGHLVVDGILVSCYGTYASHTVAHAVL
                     WPARVELLRKIWGSALGSDSTEGIMPYAEGLYRVWTSAARILKDSRVNAIAVAC"
     misc_feature    4994..8399
                     /note="repetitive element"
     gene            <8645..>9103
                     /locus_tag="CYME_CMG003C"
                     /db_xref="GeneID:16993196"
     mRNA            <8645..>9103
                     /locus_tag="CYME_CMG003C"
                     /product="similar to ubiquitin conjugating enzyme E2"
                     /transcript_id="XM_005535767.1"
                     /db_xref="GeneID:16993196"
     CDS             8645..9103
                     /locus_tag="CYME_CMG003C"
                     /codon_start=1
                     /product="similar to ubiquitin conjugating enzyme E2"
                     /protein_id="XP_005535824.1"
                     /db_xref="GeneID:16993196"
                     /translation="MLLQKRLLTELRELREDPTNFCLEPEEGNPLRLQGYLRGPAATP
                     YEGGCFRVALTLPPAYPLVPPTVRFLTPIFHPNINFRTGEVCLDILQSAWSPAWSLAS
                     CLRAIQLLLSEPEPSSPLNCDAGNLLRCGDKRGFWSMARMYTLLLATSNE"
     gene            complement(<11165..>11845)
                     /locus_tag="CYME_CMG004C"
                     /db_xref="GeneID:16993336"
     mRNA            complement(<11165..>11845)
                     /locus_tag="CYME_CMG004C"
                     /product="mitochondrial F1FO ATP synthase subunit ATP5"
                     /transcript_id="XM_005535768.1"
                     /db_xref="GeneID:16993336"
     CDS             complement(11165..11845)
                     /locus_tag="CYME_CMG004C"
                     /codon_start=1
                     /product="mitochondrial F1FO ATP synthase subunit ATP5"
                     /protein_id="XP_005535825.1"
                     /db_xref="GeneID:16993336"
                     /translation="MVRSNLGLLARYGAAYWRRLATSAGSAASADANSAVAATKQLTG
                     VAGRYAGSLLRVAMKANQLNEVHRDVDALERLLRENPRIEEFLRDPTRSQVAKQRALE
                     KLLDAAGVQTVFVRRLLDLLADNRRLSHVSQVLHSFQSVIAAQRGSTQAVVTSAVPLT
                     EWQLALLRQRLQRRFYPDMPDARVDLITRIDRDLIGGFTVQLGDKFMDLSLKSEVRRL
                     RDELAQQV"
     gene            <12907..>14523
                     /locus_tag="CYME_CMG005C"
                     /db_xref="GeneID:16993335"
     mRNA            <12907..>14523
                     /locus_tag="CYME_CMG005C"
                     /product="chaperonin containing TCP1, subunit 6a"
                     /transcript_id="XM_005535769.1"
                     /db_xref="GeneID:16993335"
     CDS             12907..14523
                     /locus_tag="CYME_CMG005C"
                     /codon_start=1
                     /product="chaperonin containing TCP1, subunit 6a"
                     /protein_id="XP_005535826.1"
                     /db_xref="GeneID:16993335"
                     /translation="MSAAPAVKFLNPHAEVSRRGLALHASINAAGGLEDILRSNLGPR
                     GTLKLLVSGSGELKLTKDGAVLLHNMEIIHPTAKIIARAATAQDDECGDGTTSVVLLV
                     GEILRQAERPLVDGIHPRHLVDGIELARTELLRSFIPRVQIAVDRNDREQLGRAVRCA
                     LATKLSDDALVAHISDLVADAALIVHHDNEPIDLFMVEIMTIESRTAMHSSLVRGLVL
                     DHGTRHPDMPKDLENAYVLTCNVSLEYEKPELGGGFFYSSAGQRERLAQAEREAVAHQ
                     VEKILRLKRQVCDEVGTKAGFLIVNQKGISPDALEMLAREGIMALRRAKRRNMERLVL
                     ACGGTAVNSLDDLNPSVLGKAVRVFEETHGEDKYTFVEAPPTARSCTLVLRGSDKQTL
                     QQLKDAVRDGLHTARHFLDDAYVVPGGGAFECAAYQHLQAYSKTVQGRARLGVQTFAD
                     ALLVIPKTLAENSGLDAQETVLQMIEAHEAGRTVGLDAHSGELVEPLGRGIVDCCRPK
                     RHALSLASTITTQLLLVDELLKAGRDTRSK"
     gene            complement(<16645..>20148)
                     /locus_tag="CYME_CMG006C"
                     /db_xref="GeneID:16993334"
     mRNA            complement(<16645..>20148)
                     /locus_tag="CYME_CMG006C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535770.1"
                     /db_xref="GeneID:16993334"
     CDS             complement(16645..20148)
                     /locus_tag="CYME_CMG006C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535827.1"
                     /db_xref="GeneID:16993334"
                     /translation="MNLTAEPSLYIERRIASLGPIWGALGTGQESKFLRLVAEAKAAA
                     AKQPEGSARVQVYLDALTLVFYARKGKTTVALERAEVLLREHCTRADVETALDWSSFW
                     ILSIVLLSLVPYLPRAVCFRSQSSTVDPHQAATLRSTLTALAEQLSVRAPYDRGETTL
                     RCFVIALLCHRAEVAQKIALRYVRMSGNVASADSSKRAAGTGTAQQAYLLLRHVLACF
                     IPLYAARRRLPEARQVYGTHPEASSCTRDETSTRFRVQMQLSEQLCHRALDLLSTPFE
                     RDSGTRVAAEASDTRPVAMLEDRDAFDFLWRVLGAHGHLKCFTTWLDDAADDERHARY
                     LRRVLVDANERRRMMADACYATWLTEEAAHAADKDALAEKAARLYLELAETLESNVDT
                     RCAPIASALDWTAWNRLIELLSVERVEAADASRLELRQRFEQLLERLQHRSGLLVRLA
                     YNRASATLTCSLIMDAFAVLARYACGHLDMMPWVAAFCSPSSASGTWSASAYSALRTA
                     LRTRYPDPAASRTLSWSKPQWRLLLHRIWVEFWMDALNAGSGSVDGQSDVPQERLEKP
                     APLVLLQWSRMSRGTGDVPEDSSASIPNGFLLLAVLYLLRQAPADHDLRLSLCLLRYG
                     LAHNPDDYILRIASIGLLNALDASGSSLLEWHLLGCKSIQYDSLAFLLGDGVDMIPPF
                     YFGFLGDRWSRASSSSSSPPDRLSVQMAARTYIDAQRALLVSNVTEGAQALLDAVRGN
                     NIDTALHLWELVDRIERSIWTWDANIHADLYQWIRVACASDRVSPGGVLVSNGSQRTT
                     RLNVRKDEHAEDNGASRPHPLVVGMESLHLADAAAVAATSSITSKQEPTVPDLIDNSD
                     WSVVRLLIRPDVGAKNLRQHGILDPGLLPWNIEPAPHAIPHERSLWSRLWMLLVMGAH
                     ESGLDRARLQSLYEQLVATNEDETEKLAASGHSTGLVASEWARFLAPFDFGYRLVALQ
                     RESKRVAAALTRALYGIDTSGASEHDPLWAVEHRVLPVPVTDRLLFCEMRFLLVLALS
                     RRLWMRLERVDPLGQENPFPRDAVIIERVEDLARQSRERLALLAERSPEALYAGKQEA
                     HDCIEDLRTKETRAAEQVAGFAQALGDAALLEKLWHALVDEIAQNRQLNHALLQTLCQ
                     WVLMLIGADTEVPSSASCSDE"
     gene            complement(<20738..>21817)
                     /locus_tag="CYME_CMG007C"
                     /db_xref="GeneID:16993333"
     mRNA            complement(<20738..>21817)
                     /locus_tag="CYME_CMG007C"
                     /product="phosphatidylinositol transfer protein"
                     /transcript_id="XM_005535771.1"
                     /db_xref="GeneID:16993333"
     CDS             complement(20738..21817)
                     /locus_tag="CYME_CMG007C"
                     /codon_start=1
                     /product="phosphatidylinositol transfer protein"
                     /protein_id="XP_005535828.1"
                     /db_xref="GeneID:16993333"
                     /translation="MLIKEYRLLLPCSVDEYFRAQLYMVAKAAQQETGKRAGEGLVIE
                     ENRPYAADDPCNEYHMPPGQYTKKVFYLKSKVPAFVRFVMPESALTMVERSWNAYPHC
                     LTVYSNEWLGDKFRLSVETVHAPDAGTQTNPLNLKDDELRKRQVDFIDISCAVPRMEP
                     NEDPTSWQSRRTGRGPLVPGRWYYESQPVMCAYKLCKLEFRKWGLQTMVEEWGHKYGL
                     KYTFIRYHRKLVCWMDEWIDMTIEDIRRMEDETAAVTRYKYEYSLKHGGTHDGIESDW
                     EGDTTAVDDTTSQERPVAASNSAALPASSAAVGADAYPDTHLKSKWTPHHEEAVAEAS
                     AEAVHSDGEVRASAPAREADHDFSA"
     gene            <25214..>26308
                     /locus_tag="CYME_CMG008C"
                     /db_xref="GeneID:16993332"
     mRNA            <25214..>26308
                     /locus_tag="CYME_CMG008C"
                     /product="unknown Zinc finger protein"
                     /transcript_id="XM_005535772.1"
                     /db_xref="GeneID:16993332"
     CDS             25214..26308
                     /locus_tag="CYME_CMG008C"
                     /codon_start=1
                     /product="unknown Zinc finger protein"
                     /protein_id="XP_005535829.1"
                     /db_xref="GeneID:16993332"
                     /translation="MGQTLEKCAHTQHSAPKQLERSHAESSPSSRARHSNGGNSSPRN
                     SSGRDVAGSAVSITAASEPIAGARRSAQRSESRRTATVRTGAQQASEARRGLASPVSR
                     KAERSNKTNHSVGFSAGSPEPPPPPPLIPRPGIDVYNLLDEDDVDNSCPICLESYSHE
                     NPRIVAFCGHAFHLGCIYEWMERSPYCAICARAMQFSELASTESERVSRETRSESDSS
                     WTVQSDSDHSRSLENALAELGIDTGAIWGGSVLPPPPSSSVSNPVKSVTVTGDVSQSV
                     PEQRQMLRRSFSRQGLLTGSHGEINERANDDPLAVETVEMQDLIQWDEEHDVTAPELV
                     APAPVTGLETYTTDSKTCAVQNQVLEAQVR"
     gene            complement(<27614..>28699)
                     /locus_tag="CYME_CMG009C"
                     /db_xref="GeneID:16993331"
     mRNA            complement(<27614..>28699)
                     /locus_tag="CYME_CMG009C"
                     /product="similar to glucose inhibited division protein B"
                     /transcript_id="XM_005535773.1"
                     /db_xref="GeneID:16993331"
     CDS             complement(27614..28699)
                     /locus_tag="CYME_CMG009C"
                     /codon_start=1
                     /product="similar to glucose inhibited division protein B"
                     /protein_id="XP_005535830.1"
                     /db_xref="GeneID:16993331"
                     /translation="MSRVQGLDRKRLSCARLCFTALLLRNTGVSHGALRVAVQRWSDH
                     CLQRRARGVESFRTRVAWRPSALVNAAPVCRVFSSHGEGCEAGSAPSAQPERDGLLER
                     CQQGRLLSTPQKRRLSQLCDLLLERNRHVNLTAIRTEPEVYEKHFVDSLRFVDIIETL
                     CAGVSGERPRLAAPNHFRLLDLGSGGGFPGLVLGIARPSWEFVLLDATRKKCDWLREA
                     VEALQLSNVSVIWDRAELAAHKPALREAFDCVVARAVARLPALSELALPFVRIGGYFL
                     AAKEYRREASTVGDVHWPELASAMRSIEANGGRYMRTVATDTDGAPTACSTDMDDHRR
                     VIVIVHKQHPTPSMYPRAPGVPERKPL"
     gene            complement(<29937..>30641)
                     /locus_tag="CYME_CMG222C"
                     /db_xref="GeneID:16993330"
     mRNA            complement(<29937..>30641)
                     /locus_tag="CYME_CMG222C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535774.1"
                     /db_xref="GeneID:16993330"
     CDS             complement(29937..30641)
                     /locus_tag="CYME_CMG222C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535831.1"
                     /db_xref="GeneID:16993330"
                     /translation="MDPVTRAQALVLQLHELSYATLGSTVRSAGDAAVASIRVACGLD
                     AKAQPQASPVGSTATSTGEESAGIDEATGRPQPGDVQASFGAAPEPMRQTPEGVQSGV
                     VLAVNGTAAATEALPQHTEPAVAAELLLGKLRELEHVLEELAARFSLGGLGDAFAERQ
                     LPVPLVLQEASVLEWSLLEPVAAQLREMYKVLAAELSTAAEELCMDLESTAHGRALLE
                     VSPGRGDSERTPEYTT"
     gene            complement(<31649..>33187)
                     /locus_tag="CYME_CMG010C"
                     /db_xref="GeneID:16993179"
     mRNA            complement(<31649..>33187)
                     /locus_tag="CYME_CMG010C"
                     /product="similar to TFIIE large subunit"
                     /transcript_id="XM_005535775.1"
                     /db_xref="GeneID:16993179"
     CDS             complement(31649..33187)
                     /locus_tag="CYME_CMG010C"
                     /codon_start=1
                     /product="similar to TFIIE large subunit"
                     /protein_id="XP_005535832.1"
                     /db_xref="GeneID:16993179"
                     /translation="MTATCTADPSAGRVKSVSNQKHRFAAVPREYERFIRLYARTFLP
                     ARAVVLVDQLVRLRYCTEFQLLPILRANQKQCRSLLWQLRDRGMVRCEPRVYKRVFPG
                     RRPGAAPFVRQRRLLYWYVDYQNVLNNALYRVHRVQEILEERLRENASGATDSNGAVG
                     NYVCERCNRTYTALDVPALLQESTGELRCTQLVQRGVRCAGTVREVDRSQELAALRQL
                     RHAVEVELRPLVDAAAACLVVEAPKHPLDDMDEDQVGAFIAAHQPERPRREEAALTES
                     ERAADSFLGSHELDIEVEVTGLVENGSSAKDMEHVTGVQAKDRQGQPEQPAWFGNASS
                     RTTEHTGFKSSAEHSGPAPGRLEPGTLTTSSNAAEQSASADAEAFEDDYADVDFEEAV
                     DSGADGTWYDNLDKEDTYQPAWSPAPEADLEIADDSEAAPSSEALWHTSEAPDEAGDS
                     FATSDADATAVCLVGGERIPLQDITAAHTARMSVSEYQRYYELLQQRQRFLVRALHRS
                     EPES"
     gene            complement(<35345..>37159)
                     /locus_tag="CYME_CMG011C"
                     /db_xref="GeneID:16993329"
     mRNA            complement(<35345..>37159)
                     /locus_tag="CYME_CMG011C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535776.1"
                     /db_xref="GeneID:16993329"
     CDS             complement(35345..37159)
                     /locus_tag="CYME_CMG011C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535833.1"
                     /db_xref="GeneID:16993329"
                     /translation="MSLDCSAAQERIVAATGKRTGRRPEANPGRARDESAELTPPTSS
                     ESGLTGAALSPAQVAYALVDVERQCVGCSWRAEWTEAANESAYPRSLLRWPPIPTSAV
                     CRACRRLLEVGRNKWLHPAEVQRLEIISQLRTVGVCSYCDPVLFSALRHRHWRLLRLS
                     LGRGALPTPEDLRLEPVTPPSVAAESILSAAERLAGSEREGAAGIQVPELENPSMREP
                     LLVSKSERLQQLNKYRSSSVILPNGTSQTPRTEYPLVASKSAPEALASHPDTYALSKR
                     LQHYDISDCMDALRCKAPGAGYQTAESLASSPRSVRQLERAECACGDRATRSLLPALH
                     VALSRYGAEELRERLRDVNLPDHLLRETQSWTNCLQFHATITPSSQIYVSSACVKCFT
                     LMCHALHIDDESLLSLPNEVLKRANVQRLPPITELEPRGSAECVPSNHRHESGMPGPG
                     MEDGKLAAVPALYLPGLPTLPTSMLTSESAARQNTAGEQTERGSPLVIRMFCGDVHKS
                     YRIWSNRPLQRMFRRFLSTELGLDPEQTAARYRRWDARYLHRSPPVLAGATRHPHCRE
                     VFAWDTPASLQLQNHDLIQCELLDVAPQSAVGAERSRE"
     gene            37543..39544
                     /locus_tag="CYME_CMG013T"
                     /db_xref="GeneID:16993328"
     misc_RNA        37543..39544
                     /locus_tag="CYME_CMG013T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461269.1"
                     /db_xref="GeneID:16993328"
     gene            complement(<37637..>39160)
                     /locus_tag="CYME_CMG012C"
                     /db_xref="GeneID:16993326"
     mRNA            complement(<37637..>39160)
                     /locus_tag="CYME_CMG012C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535777.1"
                     /db_xref="GeneID:16993326"
     CDS             complement(37637..39160)
                     /locus_tag="CYME_CMG012C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535834.1"
                     /db_xref="GeneID:16993326"
                     /translation="MIYSCGSCGARRFRWNDEGRPVCAVCNAVQQSYETTGIDVFDSG
                     VHFTRQSLIDRARVAQRKQRKEAPELASPRRRARLWDRRRLGVAIAADLQSPDTTELM
                     NLSIVFGAIGEAIAYLVGQTAGSVALRYVSHWIHALLTSRFARHHQYVTRAFANGSGA
                     VKLRIGASTLTAAVFLGIVEARAETSDPSLNAYHSLCFLDQLQRGLMSRLRELLLPYI
                     HCKDHEYRTHRPRLVARAHQLVAKLGDERTLVSWDIAPEDIRSGSAPERRLAIDIPIE
                     QPEALVRWLRDRWAARCSEGSPQSSATTGAATEACIQRQVRDWSPRTELEAALDTVLA
                     TALHVDAGLIELAENVPTGIHAPAPTGEVADDIASVQQSVSDGWFADSLPHLNQHDDK
                     VWREIVLCMRRLPPATRMQPRVRAVLKAVDRQRLTTALWGSCPWRITAQGLGLSEMRQ
                     RASCPPEQSFAEHVSRVFGLSPSRFERCLRRRASELGLKFRVYSSESTEADSGICQS"
     gene            <39591..>40295
                     /locus_tag="CYME_CMG014C"
                     /db_xref="GeneID:16993327"
     mRNA            <39591..>40295
                     /locus_tag="CYME_CMG014C"
                     /product="similar to G10 protein"
                     /transcript_id="XM_005535778.1"
                     /db_xref="GeneID:16993327"
     CDS             39591..40295
                     /locus_tag="CYME_CMG014C"
                     /codon_start=1
                     /product="similar to G10 protein"
                     /protein_id="XP_005535835.1"
                     /db_xref="GeneID:16993327"
                     /translation="MLSWRAITASFPPPDDSWSGLAMHLDRCEQVRHQFLEQRTTSSE
                     RLLWPLHRIHYEQNRLIYEKRFRERTLSRATYAYLVRYRIADGDLIAKWRRRGYRALC
                     SLWAISRCTAARSHAICRVPLRKRRLSEGARAATPALRRLFHPSSVTGCVTCTDDDCV
                     DPRSKQVLGPIWFDDVQPDWEAMTPAQRTATARKLARKSALWSTSGDNAPIPGVSSRG
                     AGSGGDSVASRHAQYR"
     gene            complement(<40650..>41963)
                     /locus_tag="CYME_CMG015C"
                     /db_xref="GeneID:16993325"
     mRNA            complement(<40650..>41963)
                     /locus_tag="CYME_CMG015C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535779.1"
                     /db_xref="GeneID:16993325"
     CDS             complement(40650..41963)
                     /locus_tag="CYME_CMG015C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535836.1"
                     /db_xref="GeneID:16993325"
                     /translation="MEEAIEALHAAWERLERDVSLLEHRVAQELLRRDGDRALPDPVR
                     LIERLYDLQRAFPALRAHWERTVALKHDLISITQAILFKNREEIQKAIRELEDEGILP
                     ERAPNLDERLADPLSQFGASYRQWQAAMTQSIRIWERLDGETPQNGISCSGAGTGTFT
                     VPDLSLVDAATESLPLAMVQAGLVFDAADTGPVTVLNDGNDENDQPDNNSKSSDAFES
                     ASHETSAAHKYEPPSMQPEADTPDSWSMDGFVPIAKAAFQRLPLLLRRRVTSLDALNQ
                     AYEKLFCALHERGRTALSDAEAVELLGHQASEQLEVLRALAVLRKMREGWILATASSD
                     AFIRHRPHSVQVPFPKPQQDAHNSRPRSLPVPHGAVLNHAHCEFVQDTSAKSDQRSTR
                     PSPGSHTSQRALPQAPQQSERTRGTRRRSSTCRVSRNPLDNVAIM"
     gene            complement(<42622..>46350)
                     /locus_tag="CYME_CMG016C"
                     /db_xref="GeneID:16993324"
     mRNA            complement(<42622..>46350)
                     /locus_tag="CYME_CMG016C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535780.1"
                     /db_xref="GeneID:16993324"
     CDS             complement(42622..46350)
                     /locus_tag="CYME_CMG016C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535837.1"
                     /db_xref="GeneID:16993324"
                     /translation="MWQALRQEAFNRAIEARKRAEKVAEAARELLEDARAALEVADED
                     DTESPEEASVSKAMKQATSLQSSVVLPLRAGDALTRSNKPAKNPIRPVELQTETYPRE
                     HRSPATTTDDENGSSQAASIVPALVQLPKAVSAEPEGAGSTLRRPKRRVLGARPLGAS
                     AVKSSADEAPLVADHASPNAATAGASLADAPPSDLQATKRASGTPVSERQVSPRAALK
                     SSVVAGQVAHRASPDDAWQAPYNETAWQSRGPEGDAQAAIDHSSGYRTAPGKHPDVQL
                     KLKPADEHAVSDMERFMPLECKEAAQRAQGSAAIHAHLSTVQGQAPGNVFYFDSKAPP
                     VSSETTHTFEQGGSSVKSVSPQQTETNTIARRQAQLANRPISDATAKGDPDLARHDET
                     LQASMPTTDSITMMDSEQVFHTGTHADPIRSAKSSRAHGGSDQHPPEPSAPETGEALA
                     IKIAAAGAGTRKSATPPVSPGAVLDEPPLIHTPSPLAVHEAQAAVSKEPLLTPSTLPS
                     TVPEAAAASEAQEAQLDTEGSRDITAAIGESASVMSTETAAGHSEGSTRVAGSSSPRD
                     ARMLSSASPSEPEALRAPETRSMTPPTAAAAALDPAIDRASAAVAAVRLPGIGSASVA
                     VESPAAATSSNARTVDLQAGSLASADEELSYLLPESSIPVAGPFFGNDSGSDRLEDST
                     MTREQVPQSPGVSSPPGQGSTTPSARVQSPVSGVASIASGGSSCDRLAAAEDSTAWIT
                     ERRRAADGTLHSVPGSSRLTFESEMAFRTAAYVAETSAEHLRSAPETQRPRLEAASTA
                     AQSDDRAISPPAGASEQHLSREESVEAATHTSERVQGSDVGTSPSAGHESERVIGHQD
                     EIASIAARYAAAQKEAEHWAVRYEALHAEYILLQTEVEKLREHCLEQESNTESLEEAL
                     EQALEQLRIAKEEQEASRRAETSASTKMVDLQRSMASLEKRLLEFEERERRLTTALTA
                     MQQSHEAALARNQEQHRTQLSEIERRLLRSELALQEKDTELSALRARLEQTEAELVAA
                     RAENAQLTDTLAECRATLEEAQTRVARLSQERNWWKMLMLRQRYRPLIDPVLGDSSSE
                     HPVYFNAESGKRLALGEQGDGSVDTQQQQQQQQEPLVPELLDVDQVIESTAADEPVDR
                     PFLRQLLLVFLLSEKANQRREALDLLLRMLQCTEAERSQALGRVWPRSNAVSLGREFV
                     RFLLRETEPDPQRDTDTGNLETVPSNRAVSDDGSTAQR"
     misc_feature    46488..48286
                     /note="possible transcribed region"
     gene            complement(<49585..>51291)
                     /locus_tag="CYME_CMG018C"
                     /db_xref="GeneID:16993322"
     mRNA            complement(<49585..>51291)
                     /locus_tag="CYME_CMG018C"
                     /product="nitrate transporter"
                     /transcript_id="XM_005535781.1"
                     /db_xref="GeneID:16993322"
     CDS             complement(49585..51291)
                     /locus_tag="CYME_CMG018C"
                     /codon_start=1
                     /product="nitrate transporter"
                     /protein_id="XP_005535838.1"
                     /db_xref="GeneID:16993322"
                     /translation="MAEGAGQPVPTALDEKEILLRDDTLDSSLGPSRPNSKEWKDLEV
                     ESVAAPLYSYRLPVDALHRARRLEPWRFDRPHMRAFFFAWSSFFIAFFGWFAVPALLP
                     SISSDKALDLTKANKAHSNAIALSGTVFMRMVTGALVDRFGPRRVQALLLAVFSIPVY
                     LFGTVYNFASFATARFFIGGLGATFVVTEYWCALMFSRNIIGTANAVAAGWGNAGGGA
                     TNALMPQFYNLMKVFGLDEEKAWRVVMVIPGTMALIWAVVLFFFSDDCPDGDYKNLYR
                     IGNLRPISALEAFARAARNPRTYVLFCLYASSFGVELTMDNVLATYFNKVFNLDQSIA
                     GVAAGLFGLMNLFARAVGGIGSDLIARRYSMRGRVLWLFANLVLEGVFCLVFSRMTTI
                     GAAIPTLILFSLFTQASCGAVFAIVPFVDPIATGSVGGIVGAGGNTGGVTLSLVFSHM
                     SDPDAVRLISFVVLGISVLSFLLLWPLPVKVTTIGISDAELRALNRLSLQKDDLGVSE
                     QPPDDKAMSPIVAIGEPMNTGALQSVMRDSIEPVETTSALDRGTRPEAEHVSDVHPAQ
                     KP"
     gene            <52254..>55109
                     /locus_tag="CYME_CMG019C"
                     /db_xref="GeneID:16993321"
     mRNA            <52254..>55109
                     /locus_tag="CYME_CMG019C"
                     /product="nitrate reductase"
                     /transcript_id="XM_005535782.1"
                     /db_xref="GeneID:16993321"
     CDS             52254..55109
                     /locus_tag="CYME_CMG019C"
                     /codon_start=1
                     /product="nitrate reductase"
                     /protein_id="XP_005535839.1"
                     /db_xref="GeneID:16993321"
                     /translation="MHTVPEGCSSPRADEQTKLMRQQPHENGTKPAILSEASALLAAM
                     RHWEEQLAQRQLPIDKRDQNTPDDWVPRHQAMVRLTGRHPFNAEPPLCLLDQDLTSQE
                     LHYVRNHGAVPHLTLGTHRIHISGLVERPGAFSVEELLALGELVTIPVTLVCAGNRRK
                     ELNQIRQSIGFHWGAGGASTSFWTGVRLADVLRHCQVCESPKARYVCFTGADEPAKGP
                     YGTSIPLAMALDPHADVLLAVAQNGAPLHPDHGYPVRLLVPGWIGGRMVKWLSHVEVS
                     DRESQNHYHFFDNRIMPPHVDKERADSEKWWYRPEYLFNELNINSAVVRPLHDELLPL
                     HHASEQHSYRIEGYAYSGGGRPVTRVEITFDDGQLWNLCELRHPFEPNAAGRQWAWSR
                     FSFNASLVHLLCCTEFAVRAWDSSNNTQPHRWTWNVMGMGNNAWYRVRVSPVPDPGTG
                     RISLRFEHPTVPGPTAGGWMGSSTVPGASHSGQQPAVPAPATEHALRDAPEAKRDIAQ
                     MAERVQMPPVPNAVGSTVHGSNVYQQMMRKKTAEKLQQAQQRLYTSAQVERHQSETDL
                     WIVVRGRVYDVTRYLNEHPGGKAAIMMNAGQDCTEDFEAIHSEKAWKLLDDFYIGELA
                     PAGSSADASLSSSPHLAYTDSSTDLLREQFSRDAVIHADAADGACTESIDGCRPALDP
                     KKWKDFVLASKSYITKNTVRLRFALPDVNQVLGLPTGNHLLIRARIENKNVARAYTPT
                     SLGHEAGFFELVIKVYRAGAHPSYPSGGKMSQYLELLRIGDTVQVKGPLGHFSYVGLG
                     AYMLHGRAGRARRFAFLCAGSGITPAFQVMKAIQVELQEHAKQSSTPFLDAIYLVYAN
                     RNEDEILLFQELEAWRQCDARFQFCYVLSQPSEAISKTFPEAVVGHVNQELLAARLPG
                     PRSDLIIGICGPAGFQDDACIPALKALGYTSEQFFTF"
     misc_feature    55906..57425
                     /note="possible transcribed region"
     gene            complement(<56343..>58382)
                     /locus_tag="CYME_CMG021C"
                     /db_xref="GeneID:16993319"
     mRNA            complement(<56343..>58382)
                     /locus_tag="CYME_CMG021C"
                     /product="sulfite reductase, ferredoxin dependent"
                     /transcript_id="XM_005535783.1"
                     /db_xref="GeneID:16993319"
     CDS             complement(56343..58382)
                     /locus_tag="CYME_CMG021C"
                     /codon_start=1
                     /product="sulfite reductase, ferredoxin dependent"
                     /protein_id="XP_005535840.1"
                     /db_xref="GeneID:16993319"
                     /translation="MMFVTYAKPLVGARRGLAPTGSAAPGVYPLTEVLLRDRLRRQRQ
                     CRTARRNIIANLSSEQSRKKHTVVPITTRKHIEEAIRDGTLDQLKLNPYELPKLNSDY
                     LRHPLMEELGNDQIFISDDCIGLIKFHGGYLQDNRDQRVRGELKKYQFMLRLKMPAGE
                     CPPSLYTTLDDISETYGNKTLRLTTRSSFQIHGIHKSNLKTVVQSIVRAGGGLYGASG
                     DCSRNVIAPPAPFVDAAYAQARHVARMVAELFAIQSHAFADLWLDGELAASIEYWKKE
                     LDMDEVRRLMTEDNGRGQVLQDSVEPLYGKLYLPRKFKVGVTVPGDNSIDIYTHDIGI
                     VVFCDAQGQLEGANILVGGGMGRTHNKEETFARAADPLGYVPAAALYDTLKAILAAQR
                     DHGNRAVRTNARMKYLVHRLGIDRFRELVKSYMVGGGSALESIRSMPPWTFQDYLGWR
                     EQGDGRWFFGLYVQNGRIKDELKKALRALTDRFNFPLVCTPQQNLLITQVPATARPDV
                     ETLLASFGVETAASALDPLMRDAMACPALPLCPPAITEAERVMPRYVQRVRELLSKVG
                     ISPHASFVMRMTGCPNGCTRPYMAELGFVGSGPNCTYQVWLGGSPMQTRLAWPYIDRV
                     TDDQVERVLEPVFVFWKSAREPDESFGDFCDRVGKAQLEAYAQRYWDGVPAAPVS"
     gene            <57153..>58064
                     /locus_tag="CYME_CMG022C"
                     /db_xref="GeneID:16993318"
     mRNA            <57153..>58064
                     /locus_tag="CYME_CMG022C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535784.1"
                     /db_xref="GeneID:16993318"
     CDS             57153..58064
                     /locus_tag="CYME_CMG022C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535841.1"
                     /db_xref="GeneID:16993318"
                     /translation="MHQVLHPGVRANCTIAVVPLGSQDRFECVVQRRCRYVPQRIGST
                     REGLLFVMSATHAAADENIGTFQLTLRITKNDDSNVVCVDVDRIIPGNSDTNFELARK
                     VQLSVKRLDGILQNLTTPVILRHESSNFVHVQLLLPVLDAGGKLPIEPQIRKRVRLNR
                     EQLCHHSGNVSCLRIRGIDEGRRRRDDVARAVAARTIQPAARSHDALDDGFQIGFMDA
                     VDLERRARREPQRLVPIGFTDVVECRIQRRRTLAGGHFQTEHELVFLELPANTLISVI
                     LEISAMELDKSDAVIGDEDLVVAQFFH"
     gene            complement(<61032..>63440)
                     /locus_tag="CYME_CMG023C"
                     /db_xref="GeneID:16993317"
     mRNA            complement(<61032..>63440)
                     /locus_tag="CYME_CMG023C"
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /transcript_id="XM_005535785.1"
                     /db_xref="GeneID:16993317"
     CDS             complement(61032..63440)
                     /locus_tag="CYME_CMG023C"
                     /codon_start=1
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="XP_005535842.1"
                     /db_xref="GeneID:16993317"
                     /translation="MQRNFYGLAFQVWGANTNVGKTLVCAALARAHLRDSDRARGALL
                     YLKPLQTGFPSDHDARFVFRQALGTDTRINEPENALEYVSREHAFSCRTLYAWRLARS
                     PQEAAAAATAGEPFSHASLQRPAGGLASPELDSSTVLEHIENALKNAGLSLFMVETAG
                     GVLSPVSASGTLQADFYRAVRLPGVLVGDARLGGISTTLAAYEALRSRGYDVPAIVFG
                     MGPGLESADRNAAAIRAQLDPEETPIVEPYLRVFDAHAQASLAQPAQGLVSVDETAQR
                     FIEHLRHWWCRRAIRWQDMLRESDQVLWWPFTQHQARRMPSASEERAQTTLIDSAYGD
                     DYTIIKSVKRDVSGMSPQKRTSSSELTQERWFDGCGSWWTQSVGHGHPTLNRSIGNAL
                     GRYGHVMFPECVHEPAWLLSKRLLNSVGNGWASRVFFSDNGSTAMEIGLKMAFRLAQK
                     RGLFDLSRASDVGIVGLEGSYHGDTLGAMDCSPSSTFNQLQTPWYRGRGLFLKPPYCA
                     IWNGDWQPDAPQGLDAAAQRRRHERYREYHRSIAEELARHESMPLGALVLEPVVQGAG
                     GMRIIDVVYQQALIDACRQRAIPVVFDEVFTAFWRLGALTGASILDREPDIAAYGKLL
                     TGGALPLAVTLSSEEVFTAFLGEKRADALLHGHSYSAYPAGCAAANAALSIYERLTSA
                     ETRVFDGALLAPVRALSTKPGVGAVSAIGSVLAVQLTPLTSAEQADERLLAARQTRVL
                     SIARQQHGIYLRPLGTTVYALVAPAQTPLHRAADLVRALDRALDLAAVSKETANAATV
                     TPIV"
     misc_feature    complement(64247..64993)
                     /note="possible transcribed region"
     gene            <65245..>68700
                     /locus_tag="CYME_CMG025C"
                     /db_xref="GeneID:16993315"
     mRNA            <65245..>68700
                     /locus_tag="CYME_CMG025C"
                     /product="unknown RNA binding protein"
                     /transcript_id="XM_005535786.1"
                     /db_xref="GeneID:16993315"
     CDS             65245..68700
                     /locus_tag="CYME_CMG025C"
                     /codon_start=1
                     /product="unknown RNA binding protein"
                     /protein_id="XP_005535843.1"
                     /db_xref="GeneID:16993315"
                     /translation="MSVAKRKRRPAVQELHGHVEGWDGPEYAFLLPVGAAAWRLRFDA
                     WSGALAGSTVVPEREPVEGSAFPAQAGRQFSVEGFLTSTRRLSVHTAPKSQAEAEADV
                     QLRPCDPRKHPDSLGTGHCRLRLLPAFPSDANDANDERTLIVLHLNRAITEAYLVAQF
                     GRYGPVEQALVHCDERGTPMGFASIRMKSKDACRQALREMHNKILMGSRIQVFVDPGG
                     DTAAARRRALIDRRNRWEQEQRAQLEKHRRPVEAQALDAAAGARGVPHASQRPADRLS
                     LTSDQQGASPAANGARADTLGVQGPDDRLILASDQQRTSPVMTASSAQHAAVTRYASR
                     DERDPRQRATCAGRHGLVRSVQASLVNDASRRAFADAPELDRERPNHADRSVSGLDAY
                     RSATARGTIAGNASRTESGVSVARTGAPTAGGSFSEDARVIQVAGVPVKTPRSVLMSA
                     FRRFGKILRIKGCAEPGKRDASESAVTSTEAESQTRTFLMYFRTREQALEAAAHMDQH
                     MIMGKRVRVSCVVDQAVASGSRPEIGNVRDDAVEGAGHAQGLLSRASMGANGRLVHSG
                     ASGHPSWKRLSERGRSCTNAPSGVTEDAAVRGRVAGDRTLYNAAKPVCPTNFLVSTEI
                     HAVRLSTLPFNTPHYELNEALASAPCSVRTVARAPFWYVLFADAADLYRFTRWLRSRN
                     QELLGCSILFEACRVTLAEDGSGIHEVTLMRAERSFATRLELLDAIGDIFEGQVRHAL
                     LRDLHREILDKVAQQVMETFEARMREKLARQRLESGGDKAAKPPRMGSVSLDVLPELA
                     MRQRSRRSPGSQPGAPPDPQSAVEKGASASSAVAELARLSSRSSLDRAAHDSLSVSLL
                     EDVAPDEDQVYLQRVLECCFQPTDDVPPQLSASIVSTLDQDKSDIATRYREHWSPYLE
                     TLFDTHGICIKQKLQEPEPPANSTGCARTEGYAAFSRELKAFRWRPPKQVIIPADEAR
                     RWSATGSLRGTRVEQRQLLSAVSDREQTVLYLQQRERFLRFYRSGIHGYGLWALEDIP
                     AGDYIIEYRGELVRSAVADLRERAYRQQGMGDSFMFRIDADTVVDATHIGSVARFVNH
                     SCDPNAIARIVQLGGASHILFYSKRSICVGEEITYDYNFDIEDDASEKVPCLCGAPNC
                     RQYLN"
     misc_feature    69597..72556
                     /note="possible transcribed region"
     gene            complement(<73162..>73998)
                     /locus_tag="CYME_CMG027C"
                     /db_xref="GeneID:16993313"
     mRNA            complement(<73162..>73998)
                     /locus_tag="CYME_CMG027C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535787.1"
                     /db_xref="GeneID:16993313"
     CDS             complement(73162..73998)
                     /locus_tag="CYME_CMG027C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535844.1"
                     /db_xref="GeneID:16993313"
                     /translation="MFQPVTQKRLTNVSVVRMRKGGKRFEIACYPNMVMAYREGHVRD
                     LDEVIQVEDVFENVSKGKLAANADLERCFGTRDRHAVLLQILLHGDLQVSDRERQYQS
                     TRKLHEIASVVAAKTISRETKKPLPVGLIEKALREIHFAVQPNRPAKAQALEVIPLLR
                     AQSGLDLERARLRLRIHVPSQRDAKAVKARLEPLQQGETDGTHSSSRSDSVRMKDGSA
                     AVESESEEWLPGGALLWTVQADPGAFREIEEIVQRETNQQGIVEVASLRVLDDEDESI
                     LS"
     gene            <75981..>76604
                     /locus_tag="CYME_CMG028C"
                     /db_xref="GeneID:16993312"
     mRNA            <75981..>76604
                     /locus_tag="CYME_CMG028C"
                     /product="similar to meiotic nuclear division protein
                     Mnd1"
                     /transcript_id="XM_005535788.1"
                     /db_xref="GeneID:16993312"
     CDS             75981..76604
                     /locus_tag="CYME_CMG028C"
                     /codon_start=1
                     /product="similar to meiotic nuclear division protein
                     Mnd1"
                     /protein_id="XP_005535845.1"
                     /db_xref="GeneID:16993312"
                     /translation="MASGKRKGLSFDDKKTRLLELFNETCDFYTLKELEKIAPKLKGI
                     ITQSVKDVLQSLVDDDLVNSDKCGVQTIYWCLPSEAVAKRQRRLDALQQQLAEKRQKL
                     TALQRQLVQVQAGREDSVERTAVLERLAACEAAWRERQRTLESYLECDPDVLAQRETE
                     TKTLIEQANRWTDNLYVIRSYVQRNLGVDLDLFDQQFELKPALQYLE"
     gene            complement(76055..77804)
                     /locus_tag="CYME_CMG029T"
                     /db_xref="GeneID:16993311"
     misc_RNA        complement(76055..77804)
                     /locus_tag="CYME_CMG029T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461270.1"
                     /db_xref="GeneID:16993311"
     gene            <78722..>80434
                     /locus_tag="CYME_CMG030C"
                     /db_xref="GeneID:16993310"
     mRNA            <78722..>80434
                     /locus_tag="CYME_CMG030C"
                     /product="similar to beta-tubulin folding cofactor E"
                     /transcript_id="XM_005535789.1"
                     /db_xref="GeneID:16993310"
     CDS             78722..80434
                     /locus_tag="CYME_CMG030C"
                     /codon_start=1
                     /product="similar to beta-tubulin folding cofactor E"
                     /protein_id="XP_005535846.1"
                     /db_xref="GeneID:16993310"
                     /translation="MRVAYGSARGDLRWRGQLPEVDGGKYTWVGVEWDPGPDADKHGR
                     HDGTFRGKRYFSCERTPARASFVRADQVHFPQSLGYLLDAYQKPGTQTQPGDVSGSTE
                     QPAAGVAPLVSACLARSCVVWNPAESALVAERHGKSVRYLDISFGLIEYYEDVAEILQ
                     TFPRLEELDISGNRLRPRNSTTISPNHALSSIAWVSQSLRILRWNCAGVETSIAALAQ
                     LVLGCTVLEELRLHGNHIRLEVRSTNTTILPRSLTRLYLGANHLECVACLPSPELELL
                     DLSENPALDRLGAPASSTECFAPRLSSLNLTDTSFVCLEFLADPNHFPQLRNLRLRHL
                     PRDHIIARMPYLEKLNGSEITAAERREAELRFLADWSTAAQDAFASSPLKRRVEALCR
                     QYGVKAEAPLPLPSPLPHMERGYVPVVLGQLRMDAPVPTRIPLASLSQCQQQQQQQQL
                     LLQVPASTPWWLAERIAFTQLSGIRNQLVSPPSDDRHHVVVHLAYATAHELALQPQPD
                     WLTTLEELDSAGKSPVYVLVHIERNKSHVKCCDSKSAASAADGLDANAPATETPSQSV
                     PLES"
     gene            complement(<80682..>83840)
                     /locus_tag="CYME_CMG031C"
                     /db_xref="GeneID:16993309"
     mRNA            complement(<80682..>83840)
                     /locus_tag="CYME_CMG031C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535790.1"
                     /db_xref="GeneID:16993309"
     CDS             complement(80682..83840)
                     /locus_tag="CYME_CMG031C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535847.1"
                     /db_xref="GeneID:16993309"
                     /translation="MTALEQLLWSGADTRDLGAADLRRLVAENIGGDQTAPHLEDLAL
                     HLVRRDIETALGFVNAQEQVLVAESASNAHFWAHYLRAIALILAFVRDQWTGPPLPAT
                     WPLRVTRSTKEPERDTLAVDGEDWLAACAPACALLEATRCLAELDWTSAYQAWWYVRA
                     LWLYQQCLSGPSALLRDQILSIGKAIALSNTIEVQVVVPPFSRPRYRMQQVTASWTFD
                     GTLAETFLSSMEFSLMNHYYSFGEVAREFLEHAASRIGARICFSGERGIRLRYQKRPM
                     ALLRVRIDRSSSISTTSHDGTPAPDTHPVSGGRRCAEHATGHCGTHCNEDAVPPETAT
                     RVDRRETDCQNKEKHDNASSLDLSGATSRGATLECCGTTAEARSFGSEPRLESASKAS
                     CAVPSSQAVMIPDSSCRAVLPASAHDHQGTDAPPETESAAVVVRDAHSSPYAAGMPRA
                     IPLRDDEYLGHTVCIESVGSEQVSPHPLSVTDCILLSGLVAIDASQQVTTALSKENIR
                     SCVEYIIEATERSTEAQAEHALLRAYALLVRTRLELDRARFQERVMEQMEELVERFYN
                     DTQPRPELTKHLWYAFATAYPLRWQMQREWAGMLGRLGLVKSALDVFQSLEMWEHAVD
                     CHRLMGNWTRAYQMLIELLRVRDRSPRLLCVLGDVLVMMPERDRPLDEHRTPEALYNQ
                     AWQISGERYARAQRSLGRLAMRRGDWQRAYEHFRRALTVNPLHQDIWFACGFCAQKLG
                     RWDWASESYTSAVQYEPEHAEAWSNLGHALLRQTMAEEAGNPASMLKRHRVVKCFAEA
                     ARLRPESWQVWQNLLIAATGAKEWALALRAQSKLLEFRGRDGYDHAALAAILAAMSDV
                     LDETSVTDQDVHVDDPVRVRQMSALESLLRSVAATGISDPIVWDALRRCATRHGNLAE
                     ALEYSRKTIRALETATRPSQFGSKKMASAGAGLQQTAPQPPQQFTLAEAYLALAETLM
                     LVRQQRSSSHDRELENDDLLLRTIPDRSAASQVRLFLERYHVHDETNKVCIERLREIA
                     KQLGILSGSDFVSTSQANGETQ"
     gene            <85212..>86822
                     /locus_tag="CYME_CMG032C"
                     /db_xref="GeneID:16993308"
     mRNA            <85212..>86822
                     /locus_tag="CYME_CMG032C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535791.1"
                     /db_xref="GeneID:16993308"
     CDS             85212..86822
                     /locus_tag="CYME_CMG032C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535848.1"
                     /db_xref="GeneID:16993308"
                     /translation="METKNCGKHSDYESSEEDFFVLSRDAPELDADVLAGECEAVGAS
                     DDDAMFAGPSWEAKTTLSAAARERRRRRSCRLLGRYGPTWADLSPERGSACPSVHARI
                     AAATASVAPAQPVDRNAPAEDSCTPRGTAQSEEERGTTDESGRRVYPSPEASLEQLLR
                     RRRRPLRTEPDVCSQLGSERTSQASFGRNAARPMNVGDSSSDEDVKLVAEYPAESVEQ
                     QSRTTSNENPPVSQEPMITGLCRERAMNRRGSQSSGCTGTSGNLVSSEESDGRTRDKH
                     AEKSLVHHQNHQQQQQQHQVDIEAASRDTGRKTARSRHNKSGDRRTAKSLRSNPEATR
                     QETVHAPLNRPIPIRIMMQGMEEPMYFTVFPYTILDEIFATFARMHGFDWHNDPLHFY
                     READATLILSGTRTIDLALQAGETIRAVLRSGELSAPIQRNASTAVNALASSTRRTTT
                     SAGTVTWLRIRYSSTEAPRCYAFAMHGPEAAPLGVLFSRFCKDVGISEKQTRFLDPDG
                     EPLDPQSTAAEAGLEPDDLIEARVHNVP"
     gene            complement(<86853..>87119)
                     /locus_tag="CYME_CMG033C"
                     /db_xref="GeneID:16993307"
     mRNA            complement(<86853..>87119)
                     /locus_tag="CYME_CMG033C"
                     /product="mitochondrial intermembrane space complex
                     subunit Tim10"
                     /transcript_id="XM_005535792.1"
                     /db_xref="GeneID:16993307"
     CDS             complement(86853..87119)
                     /locus_tag="CYME_CMG033C"
                     /codon_start=1
                     /product="mitochondrial intermembrane space complex
                     subunit Tim10"
                     /protein_id="XP_005535849.1"
                     /db_xref="GeneID:16993307"
                     /translation="MASALAAGVNPVDLARREMSFYADLFQKMTDSCFRKCVTRYHDG
                     ELQTGEGVCVDRCVFKYMGAVQRIGELLQEGQPMPAAGGAPSVQ"
     misc_feature    complement(87127..90380)
                     /note="repetitive element"
     gene            <90615..>92084
                     /locus_tag="CYME_CMG035C"
                     /db_xref="GeneID:16993306"
     mRNA            <90615..>92084
                     /locus_tag="CYME_CMG035C"
                     /product="probable Ran GTPase activating protein"
                     /transcript_id="XM_005535793.1"
                     /db_xref="GeneID:16993306"
     CDS             90615..92084
                     /locus_tag="CYME_CMG035C"
                     /codon_start=1
                     /product="probable Ran GTPase activating protein"
                     /protein_id="XP_005535850.1"
                     /db_xref="GeneID:16993306"
                     /translation="MQSLVGSTANRDPDGVAEEARPGHVGFDPQRPSFCLQGEREKID
                     AERARALFTPLRDASIATTSGTEADPSFERVSLSGKSFDVEAAGVAAEHIALLRPGSV
                     RYLQLADVIAGQSEIEALQVLELLAAAFAAHQVVELDLSDNALGAKGVRACAALFQRS
                     ERLESLILCNNGLAADAIKLIVDALTGSEKRVYLKKLHLFNNLLKDEGALALVPLIER
                     APLLEDFRFASLRVSRGGSIAVAEALTRVAPTLRRLDMTDNVIGKDGAKALAQLLEQQ
                     THLEELYLRDCLLTDAGARCILEALMRQTEQPRLRVLDLSGNELIGAATGSLLGKFLE
                     HCAPTLTHLRLDENELGDGGALAIANALARDPQRFRLVELSLYLNDIGGRAAFMLVQR
                     CVRIASMCVLNLNGNRLGCIALEHIERLVAGTPLASSFVDLDENNESEDEDATSDIFQ
                     QLRIVEGSDSAEAEAEADAITAQLHDLQVTTAPNASEAS"
     gene            complement(<92299..>94689)
                     /locus_tag="CYME_CMG036C"
                     /db_xref="GeneID:16993305"
     mRNA            complement(<92299..>94689)
                     /locus_tag="CYME_CMG036C"
                     /product="similar to WD-repeat protein"
                     /transcript_id="XM_005535794.1"
                     /db_xref="GeneID:16993305"
     CDS             complement(92299..94689)
                     /locus_tag="CYME_CMG036C"
                     /codon_start=1
                     /product="similar to WD-repeat protein"
                     /protein_id="XP_005535851.1"
                     /db_xref="GeneID:16993305"
                     /translation="MTIPGAPTETEVGAVWRVVTKNAANSSADFVSVSPCLFYDEPCT
                     IQHWQLRDLLHVPSYPFGTGRFVYFVSEGSLRRLDLKYWHTLAQEGDTASVRAAALPA
                     GARVASRVRDALESLARERYLFLLRRELRERQRRADAGETARANLPEFHDASHLWDDA
                     DDNDVSSAYLPVPTRTATAGRIPSDRRDRSPRRSTAGANSEPDASVLPLFMPLTGAEA
                     ATMLAGSQIDELLRLELEQSARMLTQLIREAPSADTRIRLVRVGGTGPVSVQDRESGV
                     NNYRTVPARSRSRRSADPRQAMDPRPRLEPSGRTTALLNQDSWQRSSRQLETSTHPSA
                     LRRPPSASMPTEREMSPAPTDKRYRSQRLQKYSFWPTSLCVMEPYVAVGGQGGQLVVG
                     HLNHIASEGIQADHDGSPDAYPQEGENLTDDDDDDSYLNRRVERTPAHITRELEGSYR
                     WGYQQYDLAVEQSGFWGPHLGRTAEVTDSVHCTTLLCGELRAGVVNNALTMAPTPADA
                     ARTQSWYLEATSWDAPTTAWSGALPRYLLVSTNDESVKIFDLERVREGHVASTTNDAH
                     SASSGLPSSTLASQRRARTLEPDQVIRCSTNINYTAVSPDAKRLLAVGDSAEVFLFDS
                     LSPSTGGGFRLHTTLREALDAGISAAWHPSGRQFAVASQDGTCCVWDTRFLNKPLVRY
                     YTQSLFPIRSACRSVKFSPAEADVDLLVFAEHQKYVHIACARTYGDQVQTINLSSAGR
                     SDEASRRGSPWQEQEEHIAGLGFARHGSSLMVGTESGIREYHVHHRQRHQLGDFIW"
     gene            complement(<98639..>98896)
                     /locus_tag="CYME_CMG037C"
                     /db_xref="GeneID:16993304"
     mRNA            complement(<98639..>98896)
                     /locus_tag="CYME_CMG037C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535795.1"
                     /db_xref="GeneID:16993304"
     CDS             complement(98639..98896)
                     /locus_tag="CYME_CMG037C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535852.1"
                     /db_xref="GeneID:16993304"
                     /translation="MASFRSRLAAFCLGATVTGGLGFLRLHYDILKANALVRETFSGM
                     EEEIHNVDQRALRVETELERLRAQLEQVKSQTSSSRADAKV"
     misc_feature    100536..103628
                     /note="repetitive element"
     gene            <103830..>105404
                     /locus_tag="CYME_CMG039C"
                     /db_xref="GeneID:16993303"
     mRNA            <103830..>105404
                     /locus_tag="CYME_CMG039C"
                     /product="aspartyl aminopeptidase"
                     /transcript_id="XM_005535796.1"
                     /db_xref="GeneID:16993303"
     CDS             103830..105404
                     /locus_tag="CYME_CMG039C"
                     /codon_start=1
                     /product="aspartyl aminopeptidase"
                     /protein_id="XP_005535853.1"
                     /db_xref="GeneID:16993303"
                     /translation="MNAEPGVPNSDHNRTRQMPGGNTTEQDALADRLLRFLDASPSPY
                     HAVETAKLLLETAGYTELREDCSWLGRVHPGGRYYTTRNESTIVAFRVGRAFHVDAVN
                     GGELRLVGAHTDSPCFRVKPRSRVSDANYEKVAVECYGGGLWYTWFDRDLKCAGRVIW
                     RCASPTDPAQGTSRSTSWQCTLVHVREPILRIPSLAIHLDREVNQGFAPNRQTHLVPV
                     AATALNRTKLPQCQERHATALTGAVIHTLQQDIMPVKEDPMSITRDAGGIVIHDFDLC
                     LADAQPASIGGVQREFIFASRLDNLFSCFAALEALLSLDSEAGVESGAESAVCMVALF
                     DHEECGSGSAQGAASPLVSDLIRRVLACLWTGKTDAGAFEDAVQYTIRRSFLISLDMA
                     HAVHPNYAEKHESGHQPLLGHGPVLKVNANQRYATDGWSAHLLRAVAECCDSPIPLQE
                     YVVRNDMPCGSTIGPIVAAGTGVRTVDVGAPSLSMHSIREMAHVRDLWYTVKLLQAFM
                     RCFGEVRASHNTACVT"
     gene            complement(<106332..>106571)
                     /locus_tag="CYME_CMG040C"
                     /db_xref="GeneID:16993302"
     mRNA            complement(<106332..>106571)
                     /locus_tag="CYME_CMG040C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535797.1"
                     /db_xref="GeneID:16993302"
     CDS             complement(106332..106571)
                     /locus_tag="CYME_CMG040C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535854.1"
                     /db_xref="GeneID:16993302"
                     /translation="MALNDACLRKIEYGAMLGGAVGATFGALFGGYEASRYRSVSVAQ
                     RVGLAARATLGGAAVFGFFLAVGTAIRGCGGPDRF"
     gene            complement(<109719..>112397)
                     /locus_tag="CYME_CMG041C"
                     /db_xref="GeneID:16993301"
     mRNA            complement(<109719..>112397)
                     /locus_tag="CYME_CMG041C"
                     /product="unknown permease"
                     /transcript_id="XM_005535798.1"
                     /db_xref="GeneID:16993301"
     CDS             complement(109719..112397)
                     /locus_tag="CYME_CMG041C"
                     /codon_start=1
                     /product="unknown permease"
                     /protein_id="XP_005535855.1"
                     /db_xref="GeneID:16993301"
                     /translation="MQPRCFRGSCDPYSEVRVSGTLQPLLWCRGGERTRCRSHWVPIG
                     KPWSADRALGFVGSCVQCFQVVDAWYGTYRRSSWAPVDAKLGPKPCVKAVHRVRRLQV
                     RRGGFSTWRDCDVEPNANRARVHADPPAQTLDASESESTWGHALWMLRSQLFRARVRL
                     LGRYVSASWLAAYVLLFIWLVSPHFPAALRLERPVQLGILLLLIADVAWGLGWLFRGG
                     GSKPYEPLVQPSELDWKCTLGEYFPARSRAQHGFSLAFWWFTQTINNGALWLLCALNA
                     MSWAGAPIASQLAEKIASDGVAGSRYGGALPQLVQVLAWHGMSASVLTLTFASLALVL
                     LTALLVHPTTRYGTSTGVVSRAAFGHRGGRLIFCCTRIMIAVLIYSITSAFGAACLAE
                     AFAGMSPLLTALARHCPPWLSTVRVEPAIARSTGKLVFYVLQLVLLSQSGPLARQQTL
                     MTLTPYSEEPPLWGLFRLTPQQDARSAQTTLSVPRYARNVGRAVILSRTVAPVLWLSG
                     SFIAASGLVPGLVASLPATGWNRSVWSGVLERAAAYGVFDPSMMLPLTCLVGSALALP
                     IVTYGDVAKGAKDQTHQLMGVALGVVPTIFAMSYLSQLFWGASTLDSLERLFAPSTLI
                     ADAFAWTRPAAALCFAGAVLLSNNAVHLMPARRSLEKFFGHGLLTRAITAVLAIGATS
                     LAASSLGVTLFLGATGLRRIVLPVMGALAGTLTGIILADYFLLRRTSLRFLDLYREWN
                     STYWYDIRGKGENEVAYFAYKLTLGIAAIGLTQFLGAQLLSTMLDHLAQVHAFFLRWF
                     SAAIAYSITRFLQRLASMLLRRQLSWVDAAWRCAFLFSFVFSGGCYYLICFMQRRWHI
                     PFAALLRIIFLGSPFPYHENDSTERTGKSAKRLPAE"
     gene            complement(<114209..>115549)
                     /locus_tag="CYME_CMG042C"
                     /db_xref="GeneID:16993300"
     mRNA            complement(<114209..>115549)
                     /locus_tag="CYME_CMG042C"
                     /product="ubiquitin-specific protease"
                     /transcript_id="XM_005535799.1"
                     /db_xref="GeneID:16993300"
     CDS             complement(114209..115549)
                     /locus_tag="CYME_CMG042C"
                     /codon_start=1
                     /product="ubiquitin-specific protease"
                     /protein_id="XP_005535856.1"
                     /db_xref="GeneID:16993300"
                     /translation="MANGAVTMRSRLENHARSLPSSRRERYCGLVNYGNTCYANSIIQ
                     ALYFCEPFRREVLTFFAELQRRRERGRRTKSGVALGDLIPDNYPYRNNQAGYRENVLT
                     ALADLFAELHGLKGKNSNGPVVSVSVAALARHSPNTGVLDGTVLAPQTATYTGLVEPR
                     NFIARVRQTSDLFAGYMHHDSHEFLNFLLNQCSELLKEEHRMHLLASEPSQGGVSSEE
                     QFTTFVERIFQGELVNETRCLGCETITRREEHFLDLSLDIEQHSSISACLRNFSAHEM
                     LRSGDKFYCNVCRTLQEAEKRMLIRRVPQVLALHLKRFKFLEANMKLLYKKLNYRISF
                     PMELRVCNVSDDAEDVDGLYELFSVVVHVGAGPSHGHYVTLAKSSGGIWMLYDDDQVE
                     VVEDYSLQEVFGISESGQSVTGSCSSDCGYILFYIRRDAESSNGANDCEHHPVA"
     gene            <117143..>118339
                     /locus_tag="CYME_CMG043C"
                     /db_xref="GeneID:16993299"
     mRNA            <117143..>118339
                     /locus_tag="CYME_CMG043C"
                     /product="tryptophane--tRNA ligase, cytoplasmic"
                     /transcript_id="XM_005535800.1"
                     /db_xref="GeneID:16993299"
     CDS             117143..118339
                     /locus_tag="CYME_CMG043C"
                     /codon_start=1
                     /product="tryptophane--tRNA ligase, cytoplasmic"
                     /protein_id="XP_005535857.1"
                     /db_xref="GeneID:16993299"
                     /translation="MTEKPTGTPSSDGSVVTPWQVTGAVDYDRLIATFGTTPLTSTLV
                     ERVERLTGKKAHHFLRRGIFFSHRDLDQLLDAYENGQRFYLYTGRGPSSEALHLGHLI
                     PFIFTKYLQDAFRVPLVIQLTDDEKFLFSKHDVSSHPLESYIQLGRENSKDIIACGFD
                     RERTFLFADSDYIGWLYPNVVRIQRAVSFSQVRGIFGFQHSDNIGKIAFPAVQAAPAF
                     SSSFPHLFPTKQQIPCLIPCAVDQDPYFRMTRDVAPRLGYRKPALIHSKFFPPLQGAE
                     GKMSASDPNSAIFLSDSAAQIRKKVNKYAFSGGRDTVEEHRLYGGDCARDIAFQYLCF
                     FLEDDDRLEDIREAYSTGRMLSGEIKAELVRCLQPMLADLQARRQAVSNADVEEFMRI
                     RPLIVE"
     gene            complement(<119414..>123292)
                     /locus_tag="CYME_CMG044C"
                     /db_xref="GeneID:16993298"
     mRNA            complement(<119414..>123292)
                     /locus_tag="CYME_CMG044C"
                     /product="pre-mRNA splicing factor ATP-dependent RNA
                     helicase PRP22"
                     /transcript_id="XM_005535801.1"
                     /db_xref="GeneID:16993298"
     CDS             complement(119414..123292)
                     /locus_tag="CYME_CMG044C"
                     /codon_start=1
                     /product="pre-mRNA splicing factor ATP-dependent RNA
                     helicase PRP22"
                     /protein_id="XP_005535858.1"
                     /db_xref="GeneID:16993298"
                     /translation="MVGVAESPCVDFNCTARCLLGLGNPHLIDVLREAALESGSVNVF
                     LERISGTFGDKLAGTLDEALGWRLWVAAQREAGEVRVQCTEAKADALGADTGQTGKRQ
                     RKSRWQIVPSQPKSVKAGPCSCSGVDWTGFTLGALNQLDASAASTLAAAAAAAGYPQT
                     VSSISGCHREIPDEAERSCVELYEAAQDTTGRWSVSAAFRWAPFLDTLGLRESTSRSL
                     EHLVTKFSGDSSSRPRLWEAAVPKLWRTPGELCRASRNGSGLLLWWLQHGKDLVSSDS
                     LSLTEGIERYVEHGSAGFGAGIRSTTRTCALTSTAAPDENTASTRSAACSGQKSVGGD
                     ETASPDDKTTLQSGKKRQSPATNPAPAVADAAAQRILGKVATGIGLENVDATKRIASR
                     SRDSSHDRIAFPPNIVPIRCTSVPSIADSEPGDRLHISSHRMDKSTDNAGDVYEPRAL
                     GQIQIPSVPNACRLPCAGNSIVPCPPNASMCAEAERNRSSEPAAASAATCENRVSEMT
                     RAEVYGLLDQDPESTMTRNAVSRGIVHETHGGTAWVPGAGSTALPIAQCEAVLLDLVE
                     RFPVVLVVGETGSGKSTQIPQFLWKAGWTRRRHRHRFDGGEASTQLEEPGGRVVGRWI
                     GCTQPRRLAATRLASRVAAEMQTSLGGLVGYTIRFDDRTGPETEIKYMTDGVLLREAA
                     MDPTLSAYNVLIVDEAHERSLHTDLLLTVLKRRLYDSNAKAAHETVQQRLLIASATLD
                     AGHFTSFFANAPVLEIPGKAYPVEIHWVPLPRWRMPKQRTSGGGRFATDYLAAAVTLA
                     LDIHFREADGDILAFLPGQDDVEAAVGITRERAEAAERALDVSTSPKRRLVVLPLYAN
                     MSLAQQQQALARSAPGTRKCIFATNVAETSLTIDGVRYVIDSGLAKQKVFLPNGLAGV
                     ERLILSPISQASARQRAGRAGRTAPGHCFRLYSRGSWEQELLPQPIPEISRTDLSQLI
                     LNLLQLGVIERATELLERRNGRPVVEFLDPPPAARLVLAMQHLWMLAALEDATGQLTP
                     VGARLAQLPLDPRLGRFLLAAVDLRCLDEALTIVSMLSVGAGESSTGGDVWLRPRDPV
                     ERLAASRAQEQLFAAAGDIHRLLQVYSAWTAASCSTEWCEQHFVQCRALRRARSIRHQ
                     LERMLHLEALRKSQLQQTPRLSECGFEAGASSPITLPLEQRITLAFLSGFYTNIARLT
                     WFRGQPFYLVLSPFARPWRGVGRRMSKNPAPDASLASIHPSSCLRNVTPPLLAFAELV
                     ETQKLYLRCCVVVPNEQWLRRFFAQSQCRH"
     gene            <123712..>126249
                     /locus_tag="CYME_CMG045C"
                     /db_xref="GeneID:16993297"
     mRNA            <123712..>126249
                     /locus_tag="CYME_CMG045C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535802.1"
                     /db_xref="GeneID:16993297"
     CDS             123712..126249
                     /locus_tag="CYME_CMG045C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535859.1"
                     /db_xref="GeneID:16993297"
                     /translation="MASTGESAAALETPLAAEAFREMLKDLDTNAAPMINALAWIALE
                     NEDGAREIAALLLERLERGASALQSDKRANSRTSSLDKVSGAKDSAVAVSEDALLATL
                     YLIDSIIKRVGPFLDAAQRYRSYLQEQGLAALLRQLRKTHTALAPRIDKLVNLWQDAR
                     YFGRAFTEQVFERERDAPSVPASSAPSTEPGAPERASLQSTGTTTASAWSSVQLAPSS
                     SSMVDAGRLPDASGPNADIQVASERLIQFVQQGILPPAEDVTLFDRLVQAQLSVLGPR
                     DWSLRQYLEQLRMQMQVAIRSLAEAKRASWMGAGRAPGMTPDMPGALIGGVQQTVPPS
                     AAVPSTLPYGAVPPASLQRPLPGSNWNPMEHSAAPGYSLNWSVPGTAAAVSFWGGGTH
                     TASTHSHTSAVGAPPSTDEAESVSSGSERPRRKRRERCVSFCDIKRISPSHAVEQLYN
                     RLPLKADGTGIRFRTRTQLRDHLDWVFAENQRTRLRQRGGMSRNWFMNATEWMQHAGG
                     YPGTGFESPPADAVSGGLAPSRDAFVEAGLVFAAPASSDTETNLRGTGHDNVASMATE
                     VSSDRARRLADGSAAPASTSEAIPAIIEDAVCPVCHEELETFYDAERDQWLWRDAVMD
                     TETGFAFHRQCYGEGVNLLLDERAEHTAAATEEEEEEEESPTASESAYPAKRQRSKSG
                     DEPGKSELFAAATVPQAAVEYEKLHQSHHQLAEESRSVSQGDTAARDRNALLQNAANT
                     STDARKLNEQLLPHTLESSRTERQPHVVGDGSQATERFTEPSCSAEASSSQALRHSDA
                     EELEALTVRELRARLDRAGVPHRHLKRKADLVAALAADATSVAQEHP"
     gene            <128236..>133254
                     /locus_tag="CYME_CMG046C"
                     /db_xref="GeneID:16993296"
     mRNA            <128236..>133254
                     /locus_tag="CYME_CMG046C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535803.1"
                     /db_xref="GeneID:16993296"
     CDS             128236..133254
                     /locus_tag="CYME_CMG046C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535860.1"
                     /db_xref="GeneID:16993296"
                     /translation="MPPRKRRTTELERLGVHLEESVSDAVPVRRQVRSRTTERVRGGR
                     HDDETTEQVHLTGSDTSDTQKQPKPMPVQQKQPRAAVLQTPKETLSEQLDRALSPLLP
                     FLSWPLHDSKDSELEDAHWQAQLEAAATQTEHFVEELGKDASHESGIDAALAQALWCL
                     YLASASSFEAEPKRSVVTWPDVARTRWTQLLRRLLHRNLLSKAVLVRWLPPESWQQTG
                     LVSELDEPAQWTRSVRRLHTRIHYTQPVYQVFREQPLGFASLLSAFTIWMENADAFST
                     DTKLDASSNMKPDHALDAIVNEHLSTFHIETNRAYDLGIQMLIAIHEWKLRQHRKAAL
                     LNSGPAAGPGAELPQPRTPEEQQQQQQRHSLPDSGVCIRCRTLVEIEQALINWLRGVP
                     SRNAAQLLGFRLQQLQSAAACVTYQKAVPEERLPEAVFLVAARLIHERIVSLEQLWPH
                     VVNADYEDAATVGTDATLATSGQTSTTASPPPKRNTAADARSARAAPIDPASAVQSKP
                     WDELGAFITAQTKALARVRLVERDCSREQASASERGSQASAATASRETDNATKAVDAV
                     YDALSMRGILAPIAGELALLAALIDYDELHLVETWIQRVWLADLTENATLWHCRRELV
                     YAAAPLRYALFAYIMRHISQVTGNGSRVVMATGADAAAAEPSDENNHANDTRALLLRV
                     WRLLGGHLVQRPELFKAMWSIVSSTRAVKRADPAVDAHEAQVDSTVSAFWAGDGILPC
                     SPLLAVLFSQGSAAVPGWLFGDANAALSSLPYAYRYALYLNACATCVRLSSSAEPRAS
                     VLIPFWHALYRSMSRRLLRRLAGDTIGYIAKSLEPMLYSEPWAVARIILDQVQSYDNL
                     VEPVVEMLMWLLRARTDLSSASDGERVHALAFALDVFFALFVEELAGSAQNGTQRPRI
                     RSQESGGSLASWFLNTIELVVQLSRRMVEHLAALLPSNENEIHGYESVDPAFTLQQVL
                     QDCWRALLQLAERRIIRGDYAFYALIQRALECMGGIQPWDDEMLNNSGLESLARPAIE
                     QPTNAETWRFLQTVFEPETADASSPTLALLVALDAAKHELLQELAAGKWPLRTATVLL
                     DALHATFLQLASFGERQRAASTTVTQLSSTESASTCSAERSSSAPSLGLEKIGDSLCM
                     ESFLCLCRMWGYSRPSAPLAETSRVDVLERRLGVMIAEADTHHQDRLRKAGVASFAEL
                     VSLEWLHAFWRNEQPPDGPKSCALGTRPFDDIVNAENDPEQRNMRIQIVAEFLLERCF
                     LPWVLMKPAAYNSAIAWIELLAQDPNPTPFNVLLLLTLLFKTAFLQIVGMTRLECIRL
                     ARFVRQALRLTDRWLRYGPDAWQRYRCSRVTFQGRGGTPCQWAQYVLWHGIMREKMLN
                     TVCEALEKLPESLVHDPSMQDANAGSPLLSTTTASAPGPQDAPSRTDSLEEHRHMTLG
                     NMLRALNVMVEEFPSRNQTASERMEKALTKLIEHEQNATEDQQHTDILTLATSYLGHL
                     RSRQRCAAARQRATAPPAASSVPATSRMGSKERATNGALIEKASSKHLDVSTEAAAAT
                     HQPDSRHKTAPDHQTGAAAQRRSDETPQRNPDGRRPQRGARTSRPSRVRHWRGSGAQA
                     RSRVTALALAGTSWTQRTYHRLVLLRRRHHSVHTCAKRGRNLVELLTTPLKTAVVGKA
                     LGGP"
     misc_feature    135442..137133
                     /note="possible transcribed region"
     gene            complement(<135568..>139143)
                     /locus_tag="CYME_CMG048C"
                     /db_xref="GeneID:16993294"
     mRNA            complement(<135568..>139143)
                     /locus_tag="CYME_CMG048C"
                     /product="coatomer protein complex, subunit beta"
                     /transcript_id="XM_005535804.1"
                     /db_xref="GeneID:16993294"
     CDS             complement(135568..139143)
                     /locus_tag="CYME_CMG048C"
                     /codon_start=1
                     /product="coatomer protein complex, subunit beta"
                     /protein_id="XP_005535861.1"
                     /db_xref="GeneID:16993294"
                     /translation="MTTALEKQCTLLISYEKGVPILLRSSLGERRLGGSAMESTLEGP
                     TASDANVAEAGALPGVPVALTKLPARSTAAALSRESLSRIGGIQGSALAKVERFVGNV
                     LSAAAEAAAAATAAASNGYESGDGSEDGATGEDGLVESVLGLGLSRIRKLAAQGAAWT
                     VNDLRQGLESTDVADKVITLRVLILMQLNGEIPATQQGSLLMAVIRYVLPNEDNQLRK
                     LCFIYLEIVDKTGRDGKMLPEMILVCNLLRNELIHPNEYSRGCALRLCCKLNEAELLE
                     PLVPAIRQNLEHRHAYVRRNALLAIGAIQRRFPQLIPDAAEHIVQYLENENDQNCRRN
                     AFLVLIQADQRQAAKYLLQHAEQLPSWSEPMQLAALELVRRFRTDELAERGTFVKLIF
                     ALLQSSNASVAFEAAQVLVRLSAAPTAVRAAVSTYCNLLVTQSDNNVKLILLDRITDL
                     RQHFAPIIQEQLTELLRALSAPDLHVRQRVLDLVMDMIGPRNVEEVASALRKELHRLA
                     DNISAEDSASDAALNYRRMLIRAIHQSVIHYPEIAAKILGTLTDFMGDAVGLAGLDVV
                     SFLRELGERYVEMREPVLRHLLVALPLIRAVRVFRGVLWTLCEFCAKPSEAMEAFAAI
                     SQQIGHLPLTGSGSDKALAPTELEHEDSQMAVPPIELADRAWSATPTSASASMSSTAI
                     SSKKVTNTSSRPRVLPDGTYATETADAFQGSELSLGDSSYVTLRDADALSTPALRRML
                     LQGDHFLWVSVMTALTKLALRLSQVRSEAADLHCTPAVCRRAMAYALLLGASLLRLGR
                     DRLHAETVTRLDEDTAQRIQSCLQVLLQAMQGSLDALTYHVWLESSHLAFCEMLKRHR
                     ASEDAKAKARALDEQLPVEALVDFRLLQARRASSMAMNRGQRAQFATSIGALGRSGTP
                     AAVVPATDPNVDDIELAACGDQRRRAALRDLHLRHLHALSGLSDPVYVEAQITMHQFD
                     ILLDLWLLNQTEHLLQNVCVELFTLGDLRLCERPSPLVLGPHESKQIRVALKVSSTDT
                     GVIFGNLVFDYGRSAANSGVEDGSGCVIALHEIHLDVIEYLQPSEINEALFCSMWEEF
                     EWENKVTIRSRLGSLDAVLALVSETLHMRCQSPRHANNKSGFLAANLYATSVFGEHVL
                     ANLSAERLADGTIQGTVRIRSKTQGLALSLGERLGQTASLVDAMV"
     gene            139433..142648
                     /locus_tag="CYME_CMG049T"
                     /db_xref="GeneID:16993293"
     misc_RNA        139433..142648
                     /locus_tag="CYME_CMG049T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461271.1"
                     /db_xref="GeneID:16993293"
     gene            complement(<140098..>143406)
                     /locus_tag="CYME_CMG050C"
                     /db_xref="GeneID:16993292"
     mRNA            complement(<140098..>143406)
                     /locus_tag="CYME_CMG050C"
                     /product="alpha-galactosidase"
                     /transcript_id="XM_005535805.1"
                     /db_xref="GeneID:16993292"
     CDS             complement(140098..143406)
                     /locus_tag="CYME_CMG050C"
                     /codon_start=1
                     /product="alpha-galactosidase"
                     /protein_id="XP_005535862.1"
                     /db_xref="GeneID:16993292"
                     /translation="MVEVKERAGMLEAAGSSVYQQAGDQGNNPALVGAALSHLALESS
                     SNANTGMFTIGRMDGKSSLAGAEAALRPSQQSLLARPGVYFDPSTRIFRLYSRETLYA
                     FRIDDNRNLEHLYYGSWLQTDDNLTYLSLGNVPGPFDPHGIVPSAVEPNIMQTMGLDE
                     LQFSSEQELQQKWRLFTRAKNDSAVSGDFENTGRPRRLENASWRLWHMERMKGSAVDL
                     DKDLSDDVLERALQRGGKSLSQSASEKVTETQPQAILPSGEAGGELVDASDRASSTAP
                     GSLHRFASTPALDLSRSEHSLASVITSPRLDWNRGKRDSMGAPKEAPARMVSGSAAEG
                     PQGPQSVQQSTAGGKQAPSLMQTASELDLDSGQKSTASVVNWGKLDQETISKNVKLLE
                     ISDSGTGDYRIPSIGVIYEDGSTLSPFTYRRHRIRRGKIPMPNYMPAVFTEDVHEATT
                     LIVEMVDNVTGLVVELIYCVVHDYDVITRHCRIRNEGDANVIITRAMSATLDFETDDY
                     YLTQLSGSWARERQQVIRHLRSGQTSFGSTRGGSSHQHNPFAIISAGEPNEDTGEAFA
                     ALLVYSGNFLVECEVSETGRTRLNIGIHPQGFYWNLEPDEEFITPEVILTYSAQGIGE
                     MSRRYHRLIRDRLQPPQFRTYIPPVLLNTWEALYFQLSHESVLKIAEVAKRAGIEMIV
                     IDDGWFGRRNDTSDGLGDWYPNPTKLPFGLHGLVRELTATGLKVGLWVEPEMVSVESD
                     LFKAHPDWALHIPSRGKTMGRNQLVLDLTRSEVRDWLVDTMSTILSSCAISYIKWDNN
                     RFLTEVYSAVHPPERQGEIAHRYILGLYEVLGRIQEQFPDVFFETCAGGGGRFDAGLL
                     YYSSQIWTSDNTDASSRMRIQAGTSLWAPAKAIAAHVSTVPNHQTLRSAPMKTRSLVA
                     MCGTFGYELDPRVLSEDELREIRHYIELYRQVAPVVLFGDMYRLWCPFRTQNCAWMYV
                     SADRNRALVFAFNQIREVGRLEPRLRLRGLDAERVYEVEEWCPGVMQRNTLTGAIEAA
                     RSGVYQYAGNLLRMTGRTLMLAGLPIKFVFDADSVLLNIEAVDWKYSGAREAFRTIAS
                     PTGSTTPSLGRSSN"
     gene            <146508..>148391
                     /locus_tag="CYME_CMG051C"
                     /db_xref="GeneID:16993291"
     mRNA            <146508..>148391
                     /locus_tag="CYME_CMG051C"
                     /product="similar to sucrose-phosphate synthase"
                     /transcript_id="XM_005535806.1"
                     /db_xref="GeneID:16993291"
     CDS             146508..148391
                     /locus_tag="CYME_CMG051C"
                     /codon_start=1
                     /product="similar to sucrose-phosphate synthase"
                     /protein_id="XP_005535863.1"
                     /db_xref="GeneID:16993291"
                     /translation="MEATFTPLLSKVSGNPTSPSSSSTDDLPAGVLPYEDFDFAPYLQ
                     EVKTEEDLRKTWRVFTKMKDVLETGRRLENFSWRLWFAKRSQGETLDEEELVKDLTQL
                     EKYDLDLQRDLQRMRQSTEGVLTNIFTDQEKKRFEEQERREQLRLLLEHLERLKAIKE
                     EHSLPDDALDKILNLVDDAFGEMADAAAAAQQQQQQQISLDSKAPRVVRLPRSYADVL
                     ETLERIRAELALIPSCVAFGHSLERNGANNFLLYLLRELVDSFIFTLVVPKDGPMRED
                     FEALGCRVELLETTAESFADHVNKLVSSHSFLIANTIMRAEAVIAAAKHGTPSIWVIH
                     EAWPQDQFDYYAKQVFQMAHVDGDLIRQGFATASRIVFPAHVQKQCYAGLFEPHRSQV
                     IYNGIPLSAINSYRSTQNRDRVRAELGYQPTDRLVVHLGTICKRKGQIYTARAFSLLR
                     NDPEIQQSGYMCKLLMVGARFIRDHEIAYQQEIKAELEAAGAIRDCTILEIQKNVLPY
                     YLAADILVVPSLNEVLPLVVCEAMAFERPVVASAIDGIPEAISDGVEGFLVPPADEQS
                     LYERVKQLILDENLRTVMGKNGRKRVLGQFSFSAMANNYRQVIQDALKDKPSAAAAAL
                     EAA"
     misc_feature    148927..149388
                     /note="possible transcribed region"
     gene            <150937..>152088
                     /locus_tag="CYME_CMG052C"
                     /db_xref="GeneID:16993160"
     mRNA            <150937..>152088
                     /locus_tag="CYME_CMG052C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005535807.1"
                     /db_xref="GeneID:16993160"
     CDS             150937..152088
                     /locus_tag="CYME_CMG052C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005535864.1"
                     /db_xref="GeneID:16993160"
                     /translation="MTWLLRRPGLCWGVHGHGLELLRSRLLESTKTRPLLVSAAAWLQ
                     SKSRLCTTPGAASEPTAQTTVIPRNEWTPEEDKLLQTLVERHGPRWALIAKELNCLLK
                     KGLERSPSSCAMRYKRTLNPSILRNPWTPEEDATILKLYREIGPRWAEIARRMATLVQ
                     ETTDSTASSKIYQRTDKQILDRFREKLNPQRKSTRWTYAEDQQLKALVKEQGPGRWTA
                     IAAKLPGRTAKDCQLHWRRCLDPRISRSSWTIEEDEKLKMLVSRHGRRWALISKLMGN
                     RSDIQCMHRWSSKLDPSIRRGPWTPLEDQALIEAYAAWQKNTIREASIRQLRIRGHRN
                     VWIWAARAVPELHGRSSSQCRQRFMQLAASRKLPQELLKDNRHENRATS"
     gene            complement(<152784..>153572)
                     /locus_tag="CYME_CMG053C"
                     /db_xref="GeneID:16993289"
     mRNA            complement(<152784..>153572)
                     /locus_tag="CYME_CMG053C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535808.1"
                     /db_xref="GeneID:16993289"
     CDS             complement(152784..153572)
                     /locus_tag="CYME_CMG053C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535865.1"
                     /db_xref="GeneID:16993289"
                     /translation="MRSDPHLFLASSRKQGASMSRPWSQTGRRYLSRALNWSQMDWDY
                     AVYQMTCLASLAPSKLYRATRYHRRTKKQWSRDDPAFLVLFLSSFFMTCFLYGLVYSG
                     WSVKAGFRLAASQTILWFGIVALVFSSLYVVIANRFLADPTAGYSSESWMEPESPRVE
                     WMYALDVYCNALFGGVFLPLYVMQGVLLRFLVRSRFASCALYLFSNAYFWYISWLGYD
                     ILPFLRRTQLLLVPIPSMSAVMLAATFLGEVNFSQWTWRALHAI"
     gene            <154201..>156021
                     /locus_tag="CYME_CMG054C"
                     /db_xref="GeneID:16993288"
     mRNA            <154201..>156021
                     /locus_tag="CYME_CMG054C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535809.1"
                     /db_xref="GeneID:16993288"
     CDS             154201..156021
                     /locus_tag="CYME_CMG054C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535866.1"
                     /db_xref="GeneID:16993288"
                     /translation="MRHSALCVQKLRVSQRSRACLFANGHGRMVPATRVPTKVVTTNS
                     WPDSNWKQVQSLFRGLWSETVRPQQCADDLYLSERRRRLEVFARRSRSCLKACCNSMR
                     RFVRAAVSSPRQMIASSRWKHKLHEFDVILRYLGKLLSHVDARTRQFWIKLFVVQMEE
                     EILETTANIESIVSLAPCRAVCYEWLLRVGAWREFRTSLLRHQEGPIDAICSYKKAVS
                     LVPGDGRAYFAIGCALRLVRHALPSAPGAHAAASSSLTTGKLPGTEELVWLARGYWYI
                     RACLASTRQHSDARKRLVGLVRRSSTLASILLPQSRCSENRSGMGELNSYRDSADAST
                     CLGSATGAAARGALLARPAAHLLDAHCSLLTNAFDQICAWFEETANELTADNHDCPAV
                     HLITAVVFSHADAGAVGPIWRLLRTCCLSQLQAGAGILADYVTAHRDIVEQAPPGAVV
                     FLQACRDRYLAHGSANDAVAQNGALTLLSPAVVAAVDDFCDTLELCNDRFLPAPISPD
                     ISTSSKTRYLRAALPEERVFGGFTPISQVYANIVDFSHDRSFAEDATRVLGHLHLSTS
                     AMHAGYACAMRLRKLEHLVTKLRRQAPRQPLASTGALHTG"
     misc_feature    158287..160682
                     /note="repetitive element"
     gene            <160803..>163157
                     /locus_tag="CYME_CMG056C"
                     /db_xref="GeneID:16993287"
     mRNA            <160803..>163157
                     /locus_tag="CYME_CMG056C"
                     /product="DNA topoisomerase III alpha"
                     /transcript_id="XM_005535810.1"
                     /db_xref="GeneID:16993287"
     CDS             160803..163157
                     /locus_tag="CYME_CMG056C"
                     /codon_start=1
                     /product="DNA topoisomerase III alpha"
                     /protein_id="XP_005535867.1"
                     /db_xref="GeneID:16993287"
                     /translation="MKALHVAEKPSVARQAAAVLGHGRAERKCSCSPYHPNWFWSGVF
                     EFSAKDGTRFVVDEQVFTSVSGHVEELDFVTPYHKWSACEPVDIFRRDLVQTRRFVPE
                     RNAKVAQNLGQLARTCQYLVLWLDGDSEGEAISDEVQRICKLPPSMVFRARFSAVTPR
                     DLFRACATLDRVNAKVVEAVWIRQEIDLRAGAAFTRWLTRHIQRHYPQALICTSAIVA
                     SRRKGASGTSNLGRNERLQGSGVSSADAAVVSYGPCQFPTLGLVVDRYRERREFQTKP
                     FWTIRMRIQTTGDRASGNQVELCWDRARIFDRFIAYVLFQRLHDAVRLPGALRMIACE
                     KQPAHRSRPLPLSTVELQKEASRKLKLSSAQTMEIAEQLYQQGYISYPRTETDRFPTD
                     DRGISNLKALITLQSEDQRWSLLAKRLLETDDVSRGGFKAPRAGSHDDHAHPPIHPTS
                     AAPPGTLSGDAARLYEYIARRFLASCSADASGERTIWRFAVFSGASEARTEAPQETCM
                     FPANTVLETFTSKGLRITNLGYLEVFSPYEKWLESTLPGDLECGAAAPEHFWLTELRL
                     EESITEPPALLSEADLIAAMDRHGIGTDATIAEHIKKIQERHYVVKQIIAEERRRQSH
                     RAGTQVHDAAANSSDECDASQVTSRAHSATRTRERCGLVSRSSVQRFVPMKLGQALVE
                     AFESCHVHLARPNLRAEQERRQKLVAKGEASGSEALDELLTSFAEAFRRLVLERSKFD
                     ATFCKFFPKAEPPSLLRAPAALELTQSSVRRSCVVPTDESNANE"
     gene            complement(<163909..>164373)
                     /locus_tag="CYME_CMG057C"
                     /db_xref="GeneID:16993286"
     mRNA            complement(<163909..>164373)
                     /locus_tag="CYME_CMG057C"
                     /product="40S ribosomal protein S20"
                     /transcript_id="XM_005535811.1"
                     /db_xref="GeneID:16993286"
     CDS             complement(163909..164373)
                     /locus_tag="CYME_CMG057C"
                     /codon_start=1
                     /product="40S ribosomal protein S20"
                     /protein_id="XP_005535868.1"
                     /db_xref="GeneID:16993286"
                     /translation="MATPGVGFGPAKKPGYETSSEPFHKIRITLASRNVRALEKVCFD
                     LVQGAKSKGAVSRAERSQMRVDGALLGASSGASSEKGRLMRVKGPVPLPTRRLRITTR
                     KSPCGEGTNTWDRFEMRIHKRIIDLEAPTDVVKSITAVSIEPGVEVEVTIQE"
     gene            <165244..>166407
                     /locus_tag="CYME_CMG058C"
                     /db_xref="GeneID:16993285"
     mRNA            <165244..>166407
                     /locus_tag="CYME_CMG058C"
                     /product="unknown transmembrane protein"
                     /transcript_id="XM_005535812.1"
                     /db_xref="GeneID:16993285"
     CDS             165244..166407
                     /locus_tag="CYME_CMG058C"
                     /codon_start=1
                     /product="unknown transmembrane protein"
                     /protein_id="XP_005535869.1"
                     /db_xref="GeneID:16993285"
                     /translation="MFVYAVPRSKRRAADDINCLGSTSSRLWRLNAGVEGVPEWRVSR
                     FAQHTRPRTTLLWSHSCERQSQRLKPVTKLSLEGAKATCNLQINEAKTRQKKQHLGAF
                     AGRLSSSLAVIIRLWKVLRRTVGLERCCAALRLSGVSLSMACAAAPQGALIGSVVAAA
                     RTVPILGPAFEAFALVFFSEFGDKSMFSTALLSMRYGTRSMQMVVLLGSMAALTTMTF
                     ISCFLGRLMSFLPARITLILSVLLLAIFGVRFLQQAIVAWRRDRIRSATAKPGEDEGD
                     EEAAAARDLERYRISVDDTAPAVFAKSFTIIALSEWCDRSMFATMALAASTNAYAVII
                     GASLANFVCTGMAVAGGSLFHKLPERIVNLAAGVLFLATAAYTWLFELPEADS"
     gene            <169107..>169571
                     /locus_tag="CYME_CMG059C"
                     /db_xref="GeneID:16993284"
     mRNA            <169107..>169571
                     /locus_tag="CYME_CMG059C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535813.1"
                     /db_xref="GeneID:16993284"
     CDS             169107..169571
                     /locus_tag="CYME_CMG059C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535870.1"
                     /db_xref="GeneID:16993284"
                     /translation="MFVQTFGGADFLQSVKSGRSRLQTCTSRWHLRMLRRGRLTFAIQ
                     LQEQQPGRGTDAVESEAKVAWGEVGAGEDADNGASQATDVDMPMPSRPRRTGATVDAD
                     GKSNVWAIEPRVYTESSGESVTKKYLALAIAGFVGLAIIVLRFLPLTNADQM"
     gene            complement(<170168..>171478)
                     /locus_tag="CYME_CMG060C"
                     /db_xref="GeneID:16993283"
     mRNA            complement(<170168..>171478)
                     /locus_tag="CYME_CMG060C"
                     /product="unknown zinc finger protein"
                     /transcript_id="XM_005535814.1"
                     /db_xref="GeneID:16993283"
     CDS             complement(170168..171478)
                     /locus_tag="CYME_CMG060C"
                     /codon_start=1
                     /product="unknown zinc finger protein"
                     /protein_id="XP_005535871.1"
                     /db_xref="GeneID:16993283"
                     /translation="MDLGVLEDESTPSSQEPWSSYSVRVSVGSAIPEDALFSAARFAR
                     SSAVNGERQPSSRRVACIWCLKEFSSEQVLQQHERTARHREKLRELGIPESDEQHQQL
                     ISGASKETSLETADLDAWLAERMQEARPLDIHECLFCNHKVAVDENVSEQERSGALLA
                     NLRHMAKEHSFFVPYIEYCYDLAGLVRYLGVKVGLGYCCVFGGRVVPLSQDTTDSAEQ
                     LFERRAEVFSSLQACRNHMRDAGHCRLPDFDQEEVWDEYQEFYSFTPVRADALLSSAA
                     DASEALSPGTPHEAAGEAEFVALAPWEKWVSVAEAPRSTHPPDEEVVGLQLGASGRTI
                     AHRSLWRYYRQRVHDHHRTQLPVCIARQERQQMVLAYQELAHAAAMGFTGPAASQPYP
                     SIPPRRVLERWRRDQLALAERNAATRRGRAARSSIAVLNSGYRG"
     gene            <172293..>172586
                     /locus_tag="CYME_CMG061C"
                     /db_xref="GeneID:16993282"
     mRNA            <172293..>172586
                     /locus_tag="CYME_CMG061C"
                     /product="similar to U6 snRNA-associated Sm-like protein"
                     /transcript_id="XM_005535815.1"
                     /db_xref="GeneID:16993282"
     CDS             172293..172586
                     /locus_tag="CYME_CMG061C"
                     /codon_start=1
                     /product="similar to U6 snRNA-associated Sm-like protein"
                     /protein_id="XP_005535872.1"
                     /db_xref="GeneID:16993282"
                     /translation="MLPVGLVRGAVGQQVTVELKNGKHCTGVLTGVDPWMNLNLESAR
                     VTGASRAATTDSVEQAASYAALHIRGTMIKLVQLPSKSWEYAQDERKPRQLRE"
     gene            complement(<173563..>173931)
                     /locus_tag="CYME_CMG062C"
                     /db_xref="GeneID:16993281"
     mRNA            complement(<173563..>173931)
                     /locus_tag="CYME_CMG062C"
                     /product="mitochondrial ribosomal protein S16, precursor"
                     /transcript_id="XM_005535816.1"
                     /db_xref="GeneID:16993281"
     CDS             complement(173563..173931)
                     /locus_tag="CYME_CMG062C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein S16, precursor"
                     /protein_id="XP_005535873.1"
                     /db_xref="GeneID:16993281"
                     /translation="MSPVRIRLARHGRRHAAVFRIVVADSRAPRDGRFLEHVGTYNPR
                     VIRGAKLVQFDVKRTQYWLSVGAQPSERVAKLLGLAGVLPPAPVRGRTAAPSAAAPQN
                     LGAVRGLESLVPTFAVSREF"
     gene            complement(<175387..>177678)
                     /locus_tag="CYME_CMG063C"
                     /db_xref="GeneID:16993280"
     mRNA            complement(<175387..>177678)
                     /locus_tag="CYME_CMG063C"
                     /product="similar to RNA helicase II binding protein"
                     /transcript_id="XM_005535817.1"
                     /db_xref="GeneID:16993280"
     CDS             complement(175387..177678)
                     /locus_tag="CYME_CMG063C"
                     /codon_start=1
                     /product="similar to RNA helicase II binding protein"
                     /protein_id="XP_005535874.1"
                     /db_xref="GeneID:16993280"
                     /translation="MDVDIGELDLQADLSAEELLVLTANNNLLADAMAGQSGNGTPGG
                     DHYPMSALSSFGLERESFQDCSADHSQEAPDGIRGSFSSLSVPSGFACETQSPAGSER
                     LLGRPFSRATPSGGFLAERCFGAENLTRILQLWSRPPVFTSFWLLAKMVGYGGTNPSE
                     AVRAILTHQGWSPDVSLRGRMEVFGKFTKERVVDIGIMLNVQHRRGTNAATLLSLVLK
                     VADGADSSTVGRLCVTEDALLTANAERVQILHRGASEERRGFTEDAFIRPPFTAISWL
                     APHPHPSELPPRWTPRRLRSSRFCIRNGVLVPIDRYGTSGEVEEGRSETSQLNGAHLH
                     RIHETMAAVQHVQSTGITQEMPMNPLERTLANSQAPGVMRNPRGTANQADSFSRLWTD
                     DVMALALEAQNARSGCDESIQSFLSLVDNISFDTRQNDFTTDRTFCKKLTRGLPTSLE
                     FSVPVPLDKMLPKMPSLRTAIVLRCFEVSNRRISSWDCAFPASCRAWLSLQSSSSSQL
                     HSVDIKKAAQYVDLTLPIQKAYRKEVQLGTGGRTLLLRLDINQSLEEHVCPWPAEKFY
                     VFVVQSAHLFSVEFELERVLARKRPSAEKARAILCPAVQAGDDDLDIESVRISLLCPL
                     SRTRIKIPVRVRGSTQLQCFDAISYIEMSRLTKRFICPVTNKPAPLHMLQVCEFFRKA
                     LEFAHPEEEFIDVLPDGTFMHTMAAESEPSALRASMKCERAISFEPFSERKSQTLQNN
                     SSWHDRTENSGCLADTIVVDLCD"
     gene            <177975..>179036
                     /locus_tag="CYME_CMG064C"
                     /db_xref="GeneID:16993279"
     mRNA            <177975..>179036
                     /locus_tag="CYME_CMG064C"
                     /product="cytochrome c oxidase assembly protein"
                     /transcript_id="XM_005535818.1"
                     /db_xref="GeneID:16993279"
     CDS             177975..179036
                     /locus_tag="CYME_CMG064C"
                     /codon_start=1
                     /product="cytochrome c oxidase assembly protein"
                     /protein_id="XP_005535875.1"
                     /db_xref="GeneID:16993279"
                     /translation="MRVVSFPRSSGSALRKRTEAFAGLLSYPWCQHSALELYSRQKVL
                     NTRRLSFLDSGMCLFAGVRTFRSNFLASELRLARATHLNLDLWRRNSSLLRKTHVQYR
                     QASGRGRGPSTADSSDVRKRNLNFLAWSLSAAICTVGLSYASVPLYRMFCQVTGYGGT
                     VQTETEEYENRWSALQSSPSAEGDTRSESSAPEPSASSRTKSSHRRERMRIRQDARPI
                     TIRFNADVNAAMPITFVPRQSIVHVVPGEAALAFYTAQNQANEDVVGIATYNVVPAKA
                     GVYFNKIQCFCFEEQRFKAGEKIDMPVLFFIDREFSDDPRMVDVDTIILSYTFFRAQD
                     VSPEFLAEQQRQAIGLATS"
     gene            complement(<179564..>180094)
                     /locus_tag="CYME_CMG065C"
                     /db_xref="GeneID:16993278"
     mRNA            complement(<179564..>180094)
                     /locus_tag="CYME_CMG065C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535819.1"
                     /db_xref="GeneID:16993278"
     CDS             complement(179564..180094)
                     /locus_tag="CYME_CMG065C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535876.1"
                     /db_xref="GeneID:16993278"
                     /translation="MSSGQRGGAAAYEEECLDALFAALRLPSGALELDASAVLDDEGK
                     SLETADGDSFNFVRYLSELEDIVLHLSTEDDLPEDLLLPSRESSEGFSGRPDINDPES
                     GEVVSASVSAAAAATETLPTSPQARQIAPLQTTFGVGSFLPFIANATARPDMQRTSAV
                     APRRVVDQKKRRIRKM"
     gene            <180328..>181716
                     /locus_tag="CYME_CMG066C"
                     /db_xref="GeneID:16993277"
     mRNA            <180328..>181716
                     /locus_tag="CYME_CMG066C"
                     /product="aspartate aminotransferase, HisC in bacteria"
                     /transcript_id="XM_005535820.1"
                     /db_xref="GeneID:16993277"
     CDS             180328..181716
                     /locus_tag="CYME_CMG066C"
                     /codon_start=1
                     /product="aspartate aminotransferase, HisC in bacteria"
                     /protein_id="XP_005535877.1"
                     /db_xref="GeneID:16993277"
                     /translation="MFLAEAVFRIRQQSKTISYSARHENSCVQGLKLTSEKPEARSTV
                     AALSRRVWSLRDEGAYSILERANHLDRHATSTADKIIHLEIGQPSAAPPQHVVDALIN
                     AVQSGETKYTDPAGTLKLREAICAYIERTHQLKHGTLSPNMVVVGPGAKPGIALSCLA
                     LLEPGDEVLVPDPGFPAYRALIEVCGARAVTYTVSSEFGLLDPAEISAKITQKTKLLI
                     LNSPSNPTGGVLSPKTLKELEHVLKSCGSDIWILSDEIYARWFYEDRQIDDEAAGHVS
                     IFCDDELRSRTILIDGLSKSFSMTGFRIGYAVAPAFLAERLRLLAVHIYGCVANFTQS
                     AATTAFVEQEKSDAYIRSLIEMYRRNRDLTYETLSIMKGCYLAKPQGAFYAWLDVSAY
                     GIPTPDLARYLLEHGRVAVLPGTDFGSQGEGFLRISFVCDQAELREGLGRLDIALRKI
                     APSGIQQKLKQN"
     gene            complement(<181870..>182799)
                     /locus_tag="CYME_CMG067C"
                     /db_xref="GeneID:16993276"
     mRNA            complement(<181870..>182799)
                     /locus_tag="CYME_CMG067C"
                     /product="similar to mitochondrial carrier Yel006N"
                     /transcript_id="XM_005535821.1"
                     /db_xref="GeneID:16993276"
     CDS             complement(181870..182799)
                     /locus_tag="CYME_CMG067C"
                     /codon_start=1
                     /product="similar to mitochondrial carrier Yel006N"
                     /protein_id="XP_005535878.1"
                     /db_xref="GeneID:16993276"
                     /translation="MEADTVAERSEATPAPPLHTLAGALSGAIAASLTQPLEVIKTRM
                     QAERREAHRRTRYAGLYSSVRTILNDEGPRGLFVGLVPSTLALVPALGSFFTIYSSVK
                     AWMDPAETDDTTFFTLKCATSAGIAWSLTSVLTNPLWLMRTRAITRMLDETKCIHLLT
                     KEAHRPTMRNLLQEIVGEGGLGGLYRGTLVSMAGFPAASVQFALYENLRRLIDCEGAQ
                     RVYYMGIASLTSAILSQLVCFPLEVLRTRVQSGLEGPRIRLFHLVRNMIYREGISSFY
                     RGLGPSMLRTVPNTALALISYEFLLEFFQKLTL"
     gene            complement(183579..186256)
                     /locus_tag="CYME_CMG068T"
                     /db_xref="GeneID:16993275"
     misc_RNA        complement(183579..186256)
                     /locus_tag="CYME_CMG068T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461272.1"
                     /db_xref="GeneID:16993275"
     gene            <186954..>187229
                     /locus_tag="CYME_CMG071C"
                     /db_xref="GeneID:16993274"
     mRNA            <186954..>187229
                     /locus_tag="CYME_CMG071C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535822.1"
                     /db_xref="GeneID:16993274"
     CDS             186954..187229
                     /locus_tag="CYME_CMG071C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535879.1"
                     /db_xref="GeneID:16993274"
                     /translation="MTRWCRGAGYQSLLNNMVCIGIEHVHQKICALRAEISAPFWNFL
                     SAYHFITPFCCRGILVRQLGRLFPLCLDLKPFCKFLLFLINFVSSVL"
     gene            <188602..>189660
                     /locus_tag="CYME_CMG070C"
                     /db_xref="GeneID:16993271"
     mRNA            <188602..>189660
                     /locus_tag="CYME_CMG070C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535823.1"
                     /db_xref="GeneID:16993271"
     CDS             188602..189660
                     /locus_tag="CYME_CMG070C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535880.1"
                     /db_xref="GeneID:16993271"
                     /translation="MSLTLFPEGIHPRIPVEPQDLVCLQCPEANLGRSLLYSLAERAA
                     LFSSNGLTYHVFLIDGDCLSGVVGQGECAREVLWKTLLEARTEATVEEPLAIDRVSIA
                     VCHSFKESLACLRGILHTVEQLSREFPENTRTVPERKLSLRTTVSPFPHHVKASQNFS
                     LLSLPHERQISQNLESFNEPSSTSFKSFSESVALTDNCIVKTPSTLPVSNVPSHEYVL
                     ILVDGIGNSSGMLGSEYYNTCIIDLREELRDILRQLLASAYVSIVFRDSLMGTKTESI
                     AREIPIETSGADGTIEKMLRNLLTKSVLVEHSSMPNETYRLCFRQFHPSGSLQLEWES
                     FLGEPLHPAFKWLRSKAA"
     misc_feature    complement(189783..191253)
                     /note="possible transcribed region"
     gene            <194619..>195902
                     /locus_tag="CYME_CMG073C"
                     /db_xref="GeneID:16993273"
     mRNA            <194619..>195902
                     /locus_tag="CYME_CMG073C"
                     /product="probable clathrin coat assembly protein AP180"
                     /transcript_id="XM_005535824.1"
                     /db_xref="GeneID:16993273"
     CDS             194619..195902
                     /locus_tag="CYME_CMG073C"
                     /codon_start=1
                     /product="probable clathrin coat assembly protein AP180"
                     /protein_id="XP_005535881.1"
                     /db_xref="GeneID:16993273"
                     /translation="MDTKRVSDQKTMSFEFCTQLTMYVSNRSTAPRPFRLHTVSDHMP
                     LSLKATDLATRAWTHLSRNKLRRSVIKATSDQPSRPPWKHLQRILLSTQLASFGADSF
                     VCVPEVYEYLFQRLSISDSWMVVCKTLFVIHYILREGNQRLAELLLSDSATCFTSAER
                     LIGPDFVYAQFVRKYAIYLREKVIAYQAMRVVFEHPGTRKAVSSGAPVRVVTPRECAS
                     GPIILGSASGELRRAPPQQATNYSTQPAESAQMAAVASIPGASIESLALVDAIRVLPI
                     LLDQLDALVAVRLADGSRLNDLTCAVSELLLEELGGLIPEVNRGMNRVLESFHALGTH
                     HAIFCLHIYDRYCSCVRSTEDFLSMQFGTHVFLPRGRTPLLDHVPLDLSASLREHILR
                     KGLERTSGISSDKERAKEEELIRKAIEESIRATMR"
     misc_feature    complement(195993..197370)
                     /note="possible transcribed region"
     gene            <198601..>200955
                     /locus_tag="CYME_CMG075C"
                     /db_xref="GeneID:16993269"
     mRNA            <198601..>200955
                     /locus_tag="CYME_CMG075C"
                     /product="unknown kinase with aarF domain"
                     /transcript_id="XM_005535825.1"
                     /db_xref="GeneID:16993269"
     CDS             198601..200955
                     /locus_tag="CYME_CMG075C"
                     /codon_start=1
                     /product="unknown kinase with aarF domain"
                     /protein_id="XP_005535882.1"
                     /db_xref="GeneID:16993269"
                     /translation="MENGVFFVSPNFLGKYPGGFRKCCSSSAKRKECTSSIKLKRRVW
                     CLSLQFDESSPTVGPLQDRRFDARTASRTLKVTRKIAELVREQRRTVESASNPELVED
                     AADTEINLSLLFESDRERGSDPARVLEAFRMLSKQPSRLARLNGSQPASVDSTFPKFD
                     QRTEVPAAQHGPTVDARGYLLLQRSLPVEYESPMGFQKKRGLSTRPLEWTPQPFLRSL
                     DIWDFAAQFWLTTQLAKWRWTYGIVGSREELEAKRKERRRAIAAWVREELIRLGPTFI
                     KAGQLFSARSDLFPAEVVDELSKLQDSVPPFPAEVAKKIILTELGIKSGNIGEIFSYF
                     EDEPIAAASLGQVHLARLRSTGEYVVVKVQRRQLRELFDIDLRLLKSLADFAQRSSQL
                     GGPTRDWPGIFEECKNVLLREIDYIEEGRSADRFRENFRNIEWVRVPKVFWEYTTQRV
                     LVQQYLPGIKISNVAEFQAMGYNLPRIAKRVAEAYLFQILGSGFFHADPHPGNLAVAP
                     GEVLIYYDFGMMGTLPSNIKERIVMLLAAVVDKDADTVMKLLIELGALVPPRDPTPVR
                     RTIQFFLNSLGSRPVRSQTVQAIGEDLYSLAYDRPFRLPATFTFVLRAFTTLEGLCKA
                     LDPGFAFGQIAQPYGFALLRRRSQAQSLRRWLNDKTIRNIVSLPNRLEQLENSMQRIQ
                     NGDIVVRSRNTELERLLRRQSAAMETNRTTIIAAALAVGAATVDTNIALPYLGDINVS
                     LILGALAALFAVNATRSYISRVRQEERWDRFLSGDSGSDNNAPQ"
     gene            complement(<201021..>202430)
                     /locus_tag="CYME_CMG076C"
                     /db_xref="GeneID:16993268"
     mRNA            complement(<201021..>202430)
                     /locus_tag="CYME_CMG076C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535826.1"
                     /db_xref="GeneID:16993268"
     CDS             complement(201021..202430)
                     /locus_tag="CYME_CMG076C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535883.1"
                     /db_xref="GeneID:16993268"
                     /translation="MRDAFVVPGLPRFFGIRCSACTSSYGTGKSSFAAARSRAACSAA
                     QDTLPHQGSTWLGQRVFAQAHRHQRECLNGFEEEGGSNRCALPCPVGPKTERFRLAAN
                     LQPPQGSSGQGPKDNDDEREENRNRAEDKGDDEDDNDDNNFVFDGDEETLKWALRQIV
                     DNAKRLVRTEAAAGRKITSLLEYVRVYEDLENLNDVDGISKDVPEDTKEAFKRTALGI
                     LGTLPQEGFEIQITTNREAFSKLLLSSMMTGYMYHAAEVRMRMDEKFDIFSWTMGLKP
                     AENSSSERSEKKADNGSKDRIEKERKVVGGKVLIHGREMSAEEYIEMLESRLGLYLTD
                     RIMLLDYMRQIGVERLVALQSDLRGEVTETMHELVRSVVGKLGGDVVGGLFSGGENIV
                     RNRILTTLFGKSNETSDKESSGIPHYKGVSVTIVSSREYLAHLILWALAVGYRIRGIE
                     TLLQVQQSCAVRVGEEEAA"
     gene            202651..205533
                     /locus_tag="CYME_CMG077T"
                     /db_xref="GeneID:16993267"
     misc_RNA        202651..205533
                     /locus_tag="CYME_CMG077T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461273.1"
                     /db_xref="GeneID:16993267"
     gene            complement(<203719..>205791)
                     /locus_tag="CYME_CMG078C"
                     /db_xref="GeneID:16993266"
     mRNA            complement(<203719..>205791)
                     /locus_tag="CYME_CMG078C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535827.1"
                     /db_xref="GeneID:16993266"
     CDS             complement(203719..205791)
                     /locus_tag="CYME_CMG078C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535884.1"
                     /db_xref="GeneID:16993266"
                     /translation="MFAEQLRQLEAPGPMSATTLSATKWQPNPRRMSLGPGARLQTTA
                     FDCENTVPRTPASTMKSVKSVSYGVTGMRTDPRPLSDRQYMQACMKSLICYLTEHHYD
                     HPVSLKTLSSPSAKDFQSIFTFLIRRLDPHFQWTSKFEDEVPVLLKRLKYPFNVSKSA
                     LYAVGSPHTWPTLLGCLAWLVELLIFDVEHSAIKTRQMKRIMFSVGILDGAADPEAET
                     TADDEASIELKARADEEVFFEYVSATYSSFLAGSDDFEEFDNELEGVFSSRNSAATSR
                     SRDLELQMQNLENQLQRAQLAVSENESRISDLSQRREDYLSDIEKFRKLIAQLTAHKS
                     MLEKKLAEREEEVQEKAREVTSLIEQLKGLKDKMEAQQNLSIDVERISRRRRELRAAL
                     DRAQQKREEEEARRKELLCDKETLQGKIDELLRRIHALVERVGVQETRTLNGVLPSTI
                     DKNISSADAQKIHSTIQDALREHMQQVTENLERLNSEVLELQDAIRMVEEKILLQREN
                     NRVLTAKLQRLENTYNAERESLAKRLADASEKNARIQEEICDLRNNIQETVANSQKAI
                     EHARTEWRTLAASTQAEYDSANDSLLLVVERLTDHKVFIQNNLATLHRKYSSILAAVS
                     ENEIDGTVTRAGTDETSCDASPSLLEPAFQSLRLQKKAESSDIRIQQQREPEHQFDEN
                     VPPNQLMV"
     gene            <205988..>206599
                     /locus_tag="CYME_CMG224C"
                     /db_xref="GeneID:16993265"
     mRNA            <205988..>206599
                     /locus_tag="CYME_CMG224C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535828.1"
                     /db_xref="GeneID:16993265"
     CDS             205988..206599
                     /locus_tag="CYME_CMG224C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535885.1"
                     /db_xref="GeneID:16993265"
                     /translation="MFVSHVWGITIGDKQGNKVGFICPKPMINRRTRRTEKDRFFQRN
                     GFNGVPLGSAPCSKRKQRRNKFRSAPFYLQNVVMIVRFRPESFVESARRARDSEEIEF
                     VRKHGVSLVKRATGYLARGVRDKASHDMACVVFLFGTGSIVFLLQLINSIPCASTAFE
                     LFGVISASLIAWKSLMRLSSVNGKNSSKGTQPWAEFFRIRNRP"
     gene            complement(<206872..>207912)
                     /locus_tag="CYME_CMG079C"
                     /db_xref="GeneID:16993122"
     mRNA            complement(<206872..>207912)
                     /locus_tag="CYME_CMG079C"
                     /product="similar to DNA excision repair protein ERCC-1"
                     /transcript_id="XM_005535829.1"
                     /db_xref="GeneID:16993122"
     CDS             complement(206872..207912)
                     /locus_tag="CYME_CMG079C"
                     /codon_start=1
                     /product="similar to DNA excision repair protein ERCC-1"
                     /protein_id="XP_005535886.1"
                     /db_xref="GeneID:16993122"
                     /translation="MKQTKCSRTETCADSSAAAGSSPARSGTQSSLHAVTSPGAKRAR
                     RSAKSVDLIETIRERSANHGYAPTRAKELPGALDLNASSSPKSVEFAAFSGSVDFLRQ
                     LEVLQAQSKSHILVSLTQRGNPLLKHFRDVPWKFGEFRFADFLLGSYTCAFFLSMKFH
                     LLRPDYIYDRVRKLGRRSFRLRILLLLMDSEGGVFFGSGASEDGIPEGSPLAKLEKMC
                     LIQELTLMVAWNLDEAARILESYKVQEGKASDSLQGPLLGPRGSETRIEGSGDSVQRG
                     DLLFHRAAAFLTNSRAVNRADAAILLRHFGSLRRVLTASAEELASVPGIGPLKSARLH
                     KTFHEPLVKDAI"
     gene            complement(<213499..>214215)
                     /locus_tag="CYME_CMG080C"
                     /db_xref="GeneID:16993264"
     mRNA            complement(<213499..>214215)
                     /locus_tag="CYME_CMG080C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535830.1"
                     /db_xref="GeneID:16993264"
     CDS             complement(213499..214215)
                     /locus_tag="CYME_CMG080C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535887.1"
                     /db_xref="GeneID:16993264"
                     /translation="MVEVESDSVAERDRSSFLAGHDAIRLAKSCVDSPPERWYAALYQ
                     VYADLTKLRCWSNVEVVYSDSATFPTGLLGPLFEEDSMVQELHSAQCILGSERACFHV
                     RCCIVGSPPSGRAINALSPQSETRTEERIITSRREPEVVIAVPMHAMLKLSNLDQALR
                     MSSHIEGIVKNRHVADSSASTHSTDRQAGSRKSSVIFGFVDEDTTTAYYRIREGACES
                     NDRREFSTDDIASCLAQERT"
     misc_feature    complement(214395..215461)
                     /note="repetitive element"
     misc_feature    215472..216519
                     /note="repetitive element"
     gene            <216567..>220556
                     /locus_tag="CYME_CMG083C"
                     /db_xref="GeneID:16993263"
     mRNA            <216567..>220556
                     /locus_tag="CYME_CMG083C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535831.1"
                     /db_xref="GeneID:16993263"
     CDS             216567..220556
                     /locus_tag="CYME_CMG083C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535888.1"
                     /db_xref="GeneID:16993263"
                     /translation="MSLHKSDSNQLLVSLVVEHAKRATPPPEESGILFDEKGSQISEH
                     HAAPALEGSSATWPFVPARPREVSSGSDNACENGRALRRLHRTPSPEVTGSGSPTSHA
                     NVVGTCFVTGFVVEKDDSGTDVTGCGESRASEKTSGRPFRREVTAADSRLNLSGEHLA
                     CVSLEQLRSLPSLAALNEISLASNSLRSVDLRPLASCRSLQVLLLNDNLLERIDLTPL
                     ASCSQLERLWLHRNKLKHIDLSPLAISGSALRSLYLSRNELQEISLAPLEKCSKLRAL
                     QLEGNPNLKEIDVTPLFACRELSSFEAPPQARLIVRELAALEVQRRSYQQDCNSLANV
                     ESSESARTAAIMPSKLVLPKVFRRRGIVLHWIREALPDANLRDLTGQRSLKENSVNAE
                     LQDAERGEGIQTNASMNIIAPASEEALSSVAELQTGPTASRNLESVQEDKTPLCALIV
                     GMTTHRRISTCRLLEQSGTLRVLQSPSAAAALDAYISAPDGIDLILMEPAEYEVFSEQ
                     AQAASIEISVPVVAVGPPEFERSGVFRRCIAIGARGFISFPLDNRDAQALTEVARSFR
                     ASRQTSASQVLKESSVSELLLPTQEVRADSTSVSRDLSPMSMTNGSDASKYGAGIEPD
                     SKWVPSWWQNSDSIRKEGNSSPAAVSDRMDTFLSKSEGVEDIAEESSTYRFIQRAGIG
                     HLRSGSPICRSGSESSQFACERAEWARVEAIFAHRDKRPSREPCFQLQFMQHCSNPAT
                     LLIPTDGYHSAGLERFADIAAVCRLPKTSATVLFLRVLSHQDKLANSGTSSISNALTR
                     SASESVSSNCWLRNIHVDAFYHFYRCKLAPIRSPLERFYNVIASSWPGSDIHDSSSSL
                     YAEGKIRRLKESRARYVSRYTITLLIQELVYRKLCVGRNASGVAVPYHAAKANQGQMR
                     SARYSYQGKSFLSSSINQSGSASAMESAHFSSKNGEAARNAFLAFRDEVCEVLLTASV
                     ASACVWFHLGGGNRNYVPLSILRKVRFAEAIFAAERGIIVDSLMEMLTGNGIALVAQK
                     ELETVWNYNARTGTATSEQLASRDAPSFECSIPSVSGLSSSFPEQQSDGAVTQAPSGA
                     TESREQIAGAIRSSFLPDTFEFSKWCRKFCISREAAVSYFLDRGSLVPKAVEQVLNRF
                     RGLSLVQKPASSEHSAATPQLQDEKTVPEDQNLAPFSKLGNASVGDSLSPSAFVHLFL
                     ALCDPGNEKALHIFFDIMDLDMDGFISAADVAYFYREKCEIAFREGLVLASANNLWAQ
                     LVDMCRTSANDPKLESKGITLKMLRDIGERRRSSFIRNVLFKDDGMALVDIQQTLRLE
                     NSLALLSQP"
     gene            <223343..>224404
                     /locus_tag="CYME_CMG084C"
                     /db_xref="GeneID:16993262"
     mRNA            <223343..>224404
                     /locus_tag="CYME_CMG084C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535832.1"
                     /db_xref="GeneID:16993262"
     CDS             223343..224404
                     /locus_tag="CYME_CMG084C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535889.1"
                     /db_xref="GeneID:16993262"
                     /translation="MSRLGPLYYALVFFMVLAYLSLPLGKVSCSGLGTDPQANDPEQQ
                     PWHVHPTSLADVGQLQYSRSLHKRRSISEPEANGDSRNMSDFVRTATEPPRNRSLPLF
                     VFVAGVEGSGHHALGIALERCFDVSFSFAPEVWVAQYYSFTPYVWTRASDFYERLAAN
                     SYGASVIGARAVLDYQHSFPFGWFRSTLFHPDLNILRELDGEYLDLRVIFLHRDPTDT
                     VISALKRGFVDDPFLQARIVEAALMYMDRFIDKMAPEKVAVIHYNRYRERPLEYLETL
                     SRVAGYCNKEDLRDFIVEAELIIDRFRKQRLEGNEPKQCPRSNRRRPEDCDDFEKRIR
                     AWFAARSKYWPRLAEERLW"
     gene            complement(<224936..>225601)
                     /locus_tag="CYME_CMG085C"
                     /db_xref="GeneID:16993261"
     mRNA            complement(<224936..>225601)
                     /locus_tag="CYME_CMG085C"
                     /product="similar to BET3 involved in targeting and fusion
                     of ER to Golgi transport vesicles"
                     /transcript_id="XM_005535833.1"
                     /db_xref="GeneID:16993261"
     CDS             complement(224936..225601)
                     /locus_tag="CYME_CMG085C"
                     /codon_start=1
                     /product="similar to BET3 involved in targeting and fusion
                     of ER to Golgi transport vesicles"
                     /protein_id="XP_005535890.1"
                     /db_xref="GeneID:16993261"
                     /translation="MFEPSGERASTSQSGRSSSATSVKTQDTLPSAGFNVAALAKIGE
                     QAFQRGELVSAELVALTYGALVRQLFLDYQAPEDVNEELERIGYNIGLRLVDDFLARS
                     AAPPCRSFQATAEIVARVAFRMYLGVSARPANFAADNTAYSILFDTNPLAEFVEVPDA
                     VANTLWYSNIFCGVIRGALEMVQFSVRASFTRDMLRGDECNEIRVCLLRELEETVPLD
                     KET"
     gene            complement(<227285..>228709)
                     /locus_tag="CYME_CMG086C"
                     /db_xref="GeneID:16993260"
     mRNA            complement(<227285..>228709)
                     /locus_tag="CYME_CMG086C"
                     /product="aminomethyltransferase"
                     /transcript_id="XM_005535834.1"
                     /db_xref="GeneID:16993260"
     CDS             complement(227285..228709)
                     /locus_tag="CYME_CMG086C"
                     /codon_start=1
                     /product="aminomethyltransferase"
                     /protein_id="XP_005535891.1"
                     /db_xref="GeneID:16993260"
                     /translation="MAARILNRWLELSAVCASEVRFVAGKHPGHRLSAPVALLRGETH
                     KRLSPLNWIANGHLRYRQASTTSATQPSPEEKLKHTALYETHLKYGGKMVPFAGYALP
                     VMYSGEKGGIKNEHLQVRQSAGVFDVSHMGQVRVYGTDRVRFLERLIVADLQALPAGT
                     AVLSLLTNEHGGIIDDTIITNLGKDNTGAEALNMVINGACVDKDMAHLRAHERRAREV
                     DGMDVRLEFLADRSLLALQGPKAMQVLQHIVDRSTLNLEQMAFMNARMVKAPAFSDYL
                     LVSRCGYTGEDGFEISVHNQDAPKLFEMLVSNEAVLPCGLGARDSLRMEAGLCLYGND
                     IDENTTPVSAGLTWTIAKSRRNPDSGDGRPSFLGADVILKEIANPSIVQKKRVGFVLH
                     GGPPARGHETIHENSPKAADNAVIGTVTSGGFSPTRNCAIGMGYISKPMDAVGTRISV
                     KIRGKLVPGEVVKMPFVKTNYYKP"
     gene            <229248..>231305
                     /locus_tag="CYME_CMG087C"
                     /db_xref="GeneID:16993259"
     mRNA            <229248..>231305
                     /locus_tag="CYME_CMG087C"
                     /product="similar to lysosomal sphingomyelin
                     phosphodiesterase"
                     /transcript_id="XM_005535835.1"
                     /db_xref="GeneID:16993259"
     CDS             229248..231305
                     /locus_tag="CYME_CMG087C"
                     /codon_start=1
                     /product="similar to lysosomal sphingomyelin
                     phosphodiesterase"
                     /protein_id="XP_005535892.1"
                     /db_xref="GeneID:16993259"
                     /translation="MASGSGSDERVPLLGERGRPTGAVAATAAETAHSRDPVGRAQSD
                     RERVCLASRGRRAHRLDELCFWLIYAVLLVASIVWALISAKMRGHQRLQGEPVVPEPA
                     VANTESASFCQVGSTGWNKHRTRLGWSCTSELRSRVTLGRAVSQSAPLSILEKVKSTC
                     PNWRRLLQYPALCRRQERSVSGCGSFLWISDLHVDYWFDPRVPPTLCGERKVCRPAEL
                     VYNVSSQVRDASIPNNPAVPVRDVATTYTYGRPGCDPPLPLLESLTEAMKKVDSDPDF
                     ILITGDLAPHDLPSRAYVLRSLNASAQHLSATVCGALGNSGESQRRSPRCIVVVGNVD
                     LFPTLHIPIEAKPVSSAERYDAENNNQPVRFRDLYELYVTAGILDPENEALRRSFTVG
                     GYYRAYDDGKLRVLVYNSLHYIAGRLFSSASALNRTNASPALPFYALPCEQWKQVLPD
                     ADDPAGQFAWLEEELQDAEQNGRSVFLASHIGPGSKTGSRAWCAPYVTRFADLLTKYA
                     DTVTMQFYGDLSREELRLIEPYGSPNGTSEMRGLALLINPGLTPRRMPGGAPTFRHCF
                     FDRGIHRAKQVAQRRRGDHVFAPVTLLDYHAYAFPLQHTVIERMTRGASAPHPEWRWR
                     YSFAEQFCVPHLSASTLRQVIQNIASEPEFMEAYTLRTEDGLESDLDLSAAVGSLRVQ
                     PAA"
     gene            <232438..>233436
                     /locus_tag="CYME_CMG088C"
                     /db_xref="GeneID:16993258"
     mRNA            <232438..>233436
                     /locus_tag="CYME_CMG088C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535836.1"
                     /db_xref="GeneID:16993258"
     CDS             232438..233436
                     /locus_tag="CYME_CMG088C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535893.1"
                     /db_xref="GeneID:16993258"
                     /translation="MDSGAHRSFWRERVCKTAPIPRWLAHGIDALLIALVVIAFGAML
                     SETARSVADPASRAVLAHTVRPAMEHTLSSESISGRLESFRSLFAGVSNRCCRAALAP
                     GLANGVLGRVLPRQNEGAVAFPGKQTDGSRLSSAASVVTWPQTSFVRALLESVARPNE
                     GAGSAGDDRLIIAFVLFTVFVLLALYILGVCGSLRKCGYAAWFGLMPFTGQVALCEAG
                     GNVWLWVLPRLFTNPPFSTTANAIICYGFAVSFLGKREQDEAGGLGARPATTSIWDDF
                     TWKAFWLTVGLVFFPFVSFPLVALSDSLQYDACYRARLAERVRAAAPSAGEYIALP"
     gene            complement(<233856..>236450)
                     /locus_tag="CYME_CMG089C"
                     /db_xref="GeneID:16993257"
     mRNA            complement(<233856..>236450)
                     /locus_tag="CYME_CMG089C"
                     /product="similar to respiratory burst oxidase protein"
                     /transcript_id="XM_005535837.1"
                     /db_xref="GeneID:16993257"
     CDS             complement(233856..236450)
                     /locus_tag="CYME_CMG089C"
                     /codon_start=1
                     /product="similar to respiratory burst oxidase protein"
                     /protein_id="XP_005535894.1"
                     /db_xref="GeneID:16993257"
                     /translation="MNKAKQNESNLDPSLTERTQIWNIHLVENGLWYSIVLLFFCAMS
                     WFFAYGVRYVIVDLRPSGILRYAGSIARGMGFACTFCSLVLPLTINRTLATVLYRTPL
                     YDLLCVERWIPDMHTIVGTSLAATGWIHGIAQIVNYAASVFVFRGGLFTGPAALPATM
                     LFVTGVVLMVLLVPLLGFGVETVRRKWFRLFWWTHRPIAVLVYICLVFHGLRGGRPWT
                     VYFFAGPVFLYIIDRLYQLSRATVTPRRILVLSLAQANSNIVKLSVERRNAVYLPGQY
                     FKIMIIDTRKGCGMPADAWHPFTAASAPSCDSDRITFYIAAVGKWTRRLHSLAEAAVA
                     EAATTTADGLDLAPERICMTTIEAYRVLLAGPYGAPAQSHLHFPYQLLIGSGVGATPM
                     VSILREICSARAPAKLAGIADASDDDIRGIRAGTQHGTLDTLSKQETSAQLLDRIRKS
                     GILSMYMKERVGIFQTETRIDRLRAFVLSSLWLFSLLWMLYISLTIYVIANAFDANVA
                     LVADFTSSAVLLFLFSFTIASDMLVTLDPPRWRYVGTPRGFVSLSVCGLLVADLVVGA
                     TLFGIEQHSSHYMDGAGNAMRIIALVLFCIKSIMFALTLRIFYLPRPWRIQLRRVRHL
                     GRKASALLSRRGNGLGTAVAQQRCVQSDDKVSHVEQQEQQEQQEQQEQQEQQEQQEQQ
                     EQQEQQEQQEQQEQQEQQEQQEQRLYANVFSLTFVWVVREYADLWGIQGLFDLAQTWT
                     PDLIPRVRVHIFLTRGEIPASILEAGQSTKSILQFHQGRPRFETFIEDLLDLRDPYEF
                     ERLFGNIIQVKQFNRVSGFSNDVQRGIFFCGNPALGASVRRAMHKVQRQPERLGTKKP
                     ILFIQERF"
     gene            complement(<237516..>238685)
                     /locus_tag="CYME_CMG090C"
                     /db_xref="GeneID:16993256"
     mRNA            complement(<237516..>238685)
                     /locus_tag="CYME_CMG090C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535838.1"
                     /db_xref="GeneID:16993256"
     CDS             complement(237516..238685)
                     /locus_tag="CYME_CMG090C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535895.1"
                     /db_xref="GeneID:16993256"
                     /translation="MRETRGPRTAFCCTTLGYRAAHSVNASSEAPVVATHTCRRKRVS
                     PWKVYSRSWTRLQLNMASYQVRGLRSEELEAWLEFVYGVFKDAKGTAAPPRSYFLRHV
                     ENDPGAVERLSEDILVAVGEQDKFIGSLRIFRRRVYLKGSAVSAAGIGEVSVASAYRR
                     QGIASRLLEEASTRMRAAGFALSFLHTSSSESLYRSLGWISVPQKFVRVVREVAHSHR
                     DHIETLALGSEVEIQRCSEAYAEFASRFDGCIVRDDPAYWQRWVRAESGDTEWNDANL
                     TPFRLQTRTKEAYAILQKREDAIHVREFVVRLCGLKRAGLYLDAFLARAVSPDVRQVC
                     AVLAAPLLPLIGGSSAVLETTEDHGYMYRALLEQDAGQQALPEMDRHVFWATDAF"
     gene            complement(238820..240308)
                     /locus_tag="CYME_CMG091T"
                     /db_xref="GeneID:16993255"
     misc_RNA        complement(238820..240308)
                     /locus_tag="CYME_CMG091T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461274.1"
                     /db_xref="GeneID:16993255"
     gene            <240647..>241258
                     /locus_tag="CYME_CMG092C"
                     /db_xref="GeneID:16993254"
     mRNA            <240647..>241258
                     /locus_tag="CYME_CMG092C"
                     /product="similar to periplasmic protein p19"
                     /transcript_id="XM_005535839.1"
                     /db_xref="GeneID:16993254"
     CDS             240647..241258
                     /locus_tag="CYME_CMG092C"
                     /codon_start=1
                     /product="similar to periplasmic protein p19"
                     /protein_id="XP_005535896.1"
                     /db_xref="GeneID:16993254"
                     /translation="MYAGMRLRVVALLLMLVTYLCVPSAALGVAAEDTIQGSRTVLRA
                     APGTEFRIGGPVTIQNMTIAANYLVGIEVAPMPPGMPDPAAQNVVHLEADVHATSTNP
                     WGFPNGSWIPYLSIVYTISKEGSSWSARGVLSPMTADDGPHYADSLTLAGPGRYALIY
                     KLIPPQVNGFLRHVDHATGVPDWWTPFEVPFNFTYPVETASAS"
     gene            <243232..>244578
                     /locus_tag="CYME_CMG093C"
                     /db_xref="GeneID:16993253"
     mRNA            <243232..>244578
                     /locus_tag="CYME_CMG093C"
                     /product="26S proteasome regulatory subunit RPN5"
                     /transcript_id="XM_005535840.1"
                     /db_xref="GeneID:16993253"
     CDS             243232..244578
                     /locus_tag="CYME_CMG093C"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN5"
                     /protein_id="XP_005535897.1"
                     /db_xref="GeneID:16993253"
                     /translation="MVNTATTESARPESRAITAAELPAKLEQLRAEAETGGDTKPVIE
                     ALYALEKKFRLADDANATALVATEIVRLAWQQGRVPALVEHLRLLSRRRAQLKQVVAT
                     IVREGMQYLDRIKDVAEKRELLEVLRDISMGKLFLELERARLTRMLAELMEQAGDISG
                     AGRVLNELQIETFGSMERQEKWTFMLEQIRLCLDLEDTVRAQIIANKFTARTLVDEEF
                     RKSPIKTRYYMLMIRLYTMQQRLKLADDTRFIDIARAYLALGEEFLGNAALYTILAPR
                     NHEQHDLLHRLSQRQPLLENKSPLRIYGELLSLFRIEELIRWPIFVQSYRSALEEKHP
                     DLNWLYLQRRVHEHNLRVIAKYYRRIHLSRLAALMEVDEDTVEDLLCDEITSGRIWGR
                     IDRIDGIVSFQRERKPEEIVSEWAQNVDEVLASVDRLDELVNKERQQRAVPTSGTS"
     gene            <247389..>247946
                     /locus_tag="CYME_CMG094C"
                     /db_xref="GeneID:16993252"
     mRNA            <247389..>247946
                     /locus_tag="CYME_CMG094C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535841.1"
                     /db_xref="GeneID:16993252"
     CDS             247389..247946
                     /locus_tag="CYME_CMG094C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535898.1"
                     /db_xref="GeneID:16993252"
                     /translation="MLRVLRRSSSFNLVGPFPAAIRPRLGVREQSGAASYVESLTQLG
                     RKVTLPKSPSEAVLEKVANMHENYPYVTRFTCPEFTSLCPLTGQPDFCHMVIDYVPDK
                     WLVESKSLKLYLHSFRNHGDFHEACTIGIARRLTTELEPKWLRIAGYWYPRGGIPIDV
                     FYQTGEPPKGLWIPDTGVQPYRGRG"
     gene            complement(<248901..>249443)
                     /locus_tag="CYME_CMG095C"
                     /db_xref="GeneID:16993251"
     mRNA            complement(<248901..>249443)
                     /locus_tag="CYME_CMG095C"
                     /product="similar to 6-pyruvoyl tetrahydrobiopterin
                     synthase"
                     /transcript_id="XM_005535842.1"
                     /db_xref="GeneID:16993251"
     CDS             complement(248901..249443)
                     /locus_tag="CYME_CMG095C"
                     /codon_start=1
                     /product="similar to 6-pyruvoyl tetrahydrobiopterin
                     synthase"
                     /protein_id="XP_005535899.1"
                     /db_xref="GeneID:16993251"
                     /translation="MACAASLSTGNALQPLVRESVLRPAGSAVNATSAMFILEKRFPF
                     EASHCLQHHDSKCSRLHGHSYVLVVEVSTEALVTSGPKKGMVMDFDEIAAVVRPLVEK
                     FLDHQHLNETLETDAPTAEYIAYWAYRKLKPSIPCLSAVTVEETATARAIYRPKPLDS
                     LHRIEHDHETSFDHAYGPVS"
     gene            <249442..>250290
                     /locus_tag="CYME_CMG096C"
                     /db_xref="GeneID:16993250"
     mRNA            <249442..>250290
                     /locus_tag="CYME_CMG096C"
                     /product="ribonuclease P protein subunit POP4"
                     /transcript_id="XM_005535843.1"
                     /db_xref="GeneID:16993250"
     CDS             249442..250290
                     /locus_tag="CYME_CMG096C"
                     /codon_start=1
                     /product="ribonuclease P protein subunit POP4"
                     /protein_id="XP_005535900.1"
                     /db_xref="GeneID:16993250"
                     /translation="MSRGWRRRPDAGPLRSSGGVKRRPVVVGIFMDEASDPEARLYTW
                     VYEKAPKLLLPTNVTVNRLEETSAVASSTALNAFVAGALGSDEPVSSRLADRVLLLGN
                     PSKHTRRRESVLGGQKRRRLKPSRQRRQVQPLTARERRRLGLYKLDKRIPYAEVQPLA
                     QLWLEYAQSMIPVQQLDRLRQQEREAVLDRLLRLDWHGASITVHQSAAPERVGVHGIV
                     IQETEQTFKIVSPDSRLRVLPKLSTVFTVDLSDDWVLVLCGDALRVRSAERSVRKPKR
                     KALLLV"
     gene            complement(<250350..>251411)
                     /locus_tag="CYME_CMG097C"
                     /db_xref="GeneID:16993249"
     mRNA            complement(<250350..>251411)
                     /locus_tag="CYME_CMG097C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535844.1"
                     /db_xref="GeneID:16993249"
     CDS             complement(250350..251411)
                     /locus_tag="CYME_CMG097C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535901.1"
                     /db_xref="GeneID:16993249"
                     /translation="MLALNDDVDINSSETERYASTYELERLKRLERNRIFLQQIWSKT
                     FESGTDPLKQQNAEARQALGPVELSASVDQKKNSTLSRVRKRVPERDPKCTSTPQKPL
                     RRSERKRFREEDCPVSNGPVELIRSTEDGTNSGNSDSTSRNEILSGVFDELYEIQRYF
                     TEVAPLPADAPEPLRVDGHYRGWVNPEVAARWSIASNAAEAWNSNGGGRFSVRNPLGT
                     TKGTSSTRVTLSAKEIARRSLQKNPNAYFYRHNEPGEEQWFGDWSPEELDRFMAVARQ
                     YGCGDKWGLFASHIPHRVGYQCSSAYRELILPKGLIFDPNYMMTSSGKAVYVGSQRRA
                     TGAGRLESPPMSTEDRSQT"
     gene            <251713..>252402
                     /locus_tag="CYME_CMG098C"
                     /db_xref="GeneID:16993248"
     mRNA            <251713..>252402
                     /locus_tag="CYME_CMG098C"
                     /product="similar to COP-coated vesicle membrane protein
                     p24"
                     /transcript_id="XM_005535845.1"
                     /db_xref="GeneID:16993248"
     CDS             251713..252402
                     /locus_tag="CYME_CMG098C"
                     /codon_start=1
                     /product="similar to COP-coated vesicle membrane protein
                     p24"
                     /protein_id="XP_005535902.1"
                     /db_xref="GeneID:16993248"
                     /translation="MRSAYAANLLLLIFSFWFMLGVCGVHAWNFRMDPEVDPERVCFL
                     ASVKGGREVQGFFEVLLSPDSDAPAAVGFTITGPVVDSKQPEKARGPELVRLVEVSAP
                     FVFAAPSDGEYELCFHYGEEKKARDIAFFYDLGDAEDEVSELLRDAVKQDKHLEPLQH
                     RAVSIMHELRNVRIAQMRMRERIRQNLRMLQERKRSVMWMTLLELLTVVAACTLEVVF
                     VKQKLDTRRIF"
     gene            complement(<254112..>255554)
                     /locus_tag="CYME_CMG099C"
                     /db_xref="GeneID:16993247"
     mRNA            complement(<254112..>255554)
                     /locus_tag="CYME_CMG099C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535846.1"
                     /db_xref="GeneID:16993247"
     CDS             complement(254112..255554)
                     /locus_tag="CYME_CMG099C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535903.1"
                     /db_xref="GeneID:16993247"
                     /translation="MSVLDDTAVVYRPQRGPPSYFTLHPECNGRMEIMSSGGTLEERK
                     SPNTNCASARRRERAGAAPVLRETMTSTRPVTSEETMKHAEDTFVTDFGTAAPKALQD
                     VEKQEQTTPSVAAEARLDAEAHSRCLAGASARLLQRNETDTQTHDSGLEGIDCPKSPE
                     KTYALPSEKPDPDDALLPQGTRVRIIGNNRTKPKWIGLEGSIESGAPIGGWHVICLDD
                     GRRIRVQRNAIQAIDIPTGAVFVETAPGLKLKRERSRPRTGRDPLDTNPSSPTFSAVT
                     PNHGLHCSPMTKPLLGSPVLNRAKLSWTSPEDLTSCAPPMPSAQHGEHWRYGTEPSQQ
                     VQRPEVLGPGAAVSRQDWPPAEAATLMRCPESPGADSLEFHPNAGGSLGVTISRLNAK
                     ALRRYSKRFGLPLRSDVSRAQLVHEVQSHFTHLEVDEAAAIRDFLLTLHKGGNYRDQQ
                     KLGPTLTPTKRTRPDAKRCVNHGGGDAPAR"
     gene            <255699..>257318
                     /locus_tag="CYME_CMG100C"
                     /db_xref="GeneID:16993246"
     mRNA            <255699..>257318
                     /locus_tag="CYME_CMG100C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535847.1"
                     /db_xref="GeneID:16993246"
     CDS             255699..257318
                     /locus_tag="CYME_CMG100C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535904.1"
                     /db_xref="GeneID:16993246"
                     /translation="MYLANAFRRSASKNSEAFTGSALVGTGKLKQGWEGSYPGTPLGP
                     KTPHTPMLLDHTGCLTLSQTHEYSEKREASERLGSEQGFGADTSALNSGKETLPQEAA
                     ATPAGDHGRNPFDDDDVERVTLDIDESEIEAHKKVWDSRRAALANSGGRDPLDASARS
                     ALAASAGTPQRSLRHTLAPDVQDSILFMEPSPESVPGNHGNGSEVDFSRAEGSTDFRK
                     SAAKPAVVTNLSSTFEEEAHHPRELSVTPSLRSEDVHQKLNQSSVHHFEGSALRPALS
                     WDHIPSSIIRETIVSLETQMAQYQRELAAAQDVIGSLRKALCIEQTNRQSQAAKIAEM
                     ELQIRALEEETDRKSLRIACLEKDREEQEGVLERLREELVQTQRRNNAAHETEAYADI
                     LSKLRAVQEQLDLVQLERDLLEKRLNGHSFESTARKQNDSDVSTGKENIGNTSSRAVP
                     AEAPSATPDVPSAQRTKPTPLRLTQKSPHEDAAAASASLERSVAKQHIQKFERIQTSS
                     LLSAEQRNEKRVMRFTDWIGSVQEPSNYMNT"
     gene            complement(256708..259128)
                     /locus_tag="CYME_CMG101T"
                     /db_xref="GeneID:16993245"
     misc_RNA        complement(256708..259128)
                     /locus_tag="CYME_CMG101T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461275.1"
                     /db_xref="GeneID:16993245"
     gene            <261025..>262314
                     /locus_tag="CYME_CMG102C"
                     /db_xref="GeneID:16993244"
     mRNA            <261025..>262314
                     /locus_tag="CYME_CMG102C"
                     /product="similar to zinc transporter"
                     /transcript_id="XM_005535848.1"
                     /db_xref="GeneID:16993244"
     CDS             261025..262314
                     /locus_tag="CYME_CMG102C"
                     /codon_start=1
                     /product="similar to zinc transporter"
                     /protein_id="XP_005535905.1"
                     /db_xref="GeneID:16993244"
                     /translation="MRRLEQSEVQASTGSDHVSLVSFLALQALLYATALSGVLVPCLG
                     NDSDTEVGQVSSAACEEFGPQADPRLRLAVARRTQRPQAARRSWKHVFEDWGRGVAAG
                     VLLSAALVHILPSSAVQLEDNLATAYGMERSTAVSLLGTCFLVGVLGVYCIDLRARRA
                     ADAPRLPSPLCVDARAPHPWGDCSQRPAPSERVDSGHPLSQLEAHPASTSAALQRSQP
                     ATAEHHLRPIWKILLCSLSFHALSEGMALGLSVYRTFVAMYLAIILHKFFAGLALGVS
                     LASAREPMARCLRAGALFAAATPCAATLARLSAHWSQLDSARSGGAVRIVGGLLNGIA
                     AGSFLAISLLEIIPCPRNSAEASQVAPWIGKSHENAMDWYRGTPGYETLTTADSCATL
                     NAGVDTAADPMAAMSSRQTLVPLLFSAATFSLLALWI"
     gene            complement(<262566..>264476)
                     /locus_tag="CYME_CMG103C"
                     /db_xref="GeneID:16993243"
     mRNA            complement(<262566..>264476)
                     /locus_tag="CYME_CMG103C"
                     /product="similar to amino acid transporter protein"
                     /transcript_id="XM_005535849.1"
                     /db_xref="GeneID:16993243"
     CDS             complement(262566..264476)
                     /locus_tag="CYME_CMG103C"
                     /codon_start=1
                     /product="similar to amino acid transporter protein"
                     /protein_id="XP_005535906.1"
                     /db_xref="GeneID:16993243"
                     /translation="MVGRFTPDAASSPGGASSQAAADSVPDLVVATEHSAENADATGT
                     KPESDTLRTSGSSLKSVLGEFANLLKGFLGLNFLYVSYAFSYAGVTRGILGLVLVSLL
                     TFYGCVLLVRVKRHIPAEWWQRQRGGTEPGSERAPFAEVSSDSPGAASCVPARQVLYG
                     DVGAYAFGRAGELVVNLALLLTQFGYCTGYLIFLAQTIHDLTRCDCAPAWFLLIPLPI
                     VLTLALLRSVRKLTPFSYLANIGIFVGFSAVLVFLMANFQYRPYSPLFWKWPVFFGQM
                     SAALEGIGVVLPVEGSMKNPRRFNVILSATMVLMGAILLLIGLLGFMTFGKQTRSIIL
                     LNMGHSAAVRIVKSVACIGILFTYPLQLVPIVQALEAWLATTTWLRTRQLGTGSAHSG
                     EPLPSRHPEPFDETVSIDAIQVVETRITPERKASRAIDGEQTPEPLDERLDSIDIVDV
                     RVASEQRDSGPGSALLFEESGGSKAAISTSPVPVPDHIDAFGAPGGASPPSPQASAPA
                     EAPPEPAPPIAADRAPLARRVATLYCTYFTDEPAAVLVRVSLVIGTVVAAVIAGKDFG
                     LFQSLVGALGAATLAYTLPALFHLRVFWQRLSTWERALDIFMLAFGAVATLSATTTTI
                     AEMVRGTASGIA"
     gene            263909..266443
                     /locus_tag="CYME_CMG104T"
                     /db_xref="GeneID:16993242"
     misc_RNA        263909..266443
                     /locus_tag="CYME_CMG104T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461276.1"
                     /db_xref="GeneID:16993242"
     gene            complement(<267735..>270647)
                     /locus_tag="CYME_CMG105C"
                     /db_xref="GeneID:16993241"
     mRNA            complement(<267735..>270647)
                     /locus_tag="CYME_CMG105C"
                     /product="probable WD-repeat membrane protein"
                     /transcript_id="XM_005535850.1"
                     /db_xref="GeneID:16993241"
     CDS             complement(267735..270647)
                     /locus_tag="CYME_CMG105C"
                     /codon_start=1
                     /product="probable WD-repeat membrane protein"
                     /protein_id="XP_005535907.1"
                     /db_xref="GeneID:16993241"
                     /translation="MVQAEGKLLEGGLEEGELVALGQRTSLYAPFRVLGLVTCEGSGR
                     MLGGTSSPKPCFYELGIAPFVVVPLGRCLQLYDGRTLRLLSLSNALPSRITAVAHLGR
                     ERLVVATQHSLHITEQLRSRVSIETAPGGCIVGLYAFGNGVFVAVDAGERCARTYNRD
                     NELVSEVFFGEDITPNGLIVHPPTMLDVVCIGSDQGRIALVDICHSRILQTLDFSKHG
                     AVTALSESPALDIIGMGFHDGSVIIYDIGRGSILDQYNLRMHLPLGTSLTVNALCFRN
                     DDANAFPHLFSFHSDGSLCIYDLEARRVLDTIPRLHRGPCRMAFFYPREPILLTIGDE
                     DNRMNMFICDSPSGAPRLLKYRAGHRAPPTRIRFIGEDYRQLISAGCSDQQLRVTSTV
                     VSHHHRELSQVTTRLRRARKRARQMQHERAIEASDEFALDEDDPDTASLLPPVTEFAV
                     SEARQNDPDLANLVTCHLGRSEAYTWRYAENHRYRHVLRFRGDASTDLDQGTATCVSI
                     STCGHFAAVGLSVGHVDLFNLQSGLHRWRIRDAHHPGGVAGVAFDGSGGLLASLGSHD
                     GRLGIYRHQSREKVADIVVHSPGLQLIWSPVSDLLAVSCADDFSIKVFEAASGRCVRW
                     LRGHTARITDICFSCQADGRQILSTSLDGTLRTWDLVAGRCVDVLRMAAAPTSCAMSP
                     RGDFIVTTHVGHIGICMWHCKAYYRGPSEQGNMVALSSRAGNGLDVEALWRRHAVQLP
                     DLAMSWDPVVSAVADATASPENNPRCVSLTVEPIDDAHCGVVFSSQPESYWLLLPYLD
                     EIKEQNKATRESDSVTGTQKPPPPLVAELHDGYREAADASVSPGIEDRRPLPDSIASS
                     FVDALQRADFATAAKRLDALTPAAADVEIRLLPPEALADALSFFTWRLQSERDFELAQ
                     AQLRVFLNEHAELIMKEPALQHGASKCLRALDSSWLRCEDTLSKVLFLCQYLRDSV"
     gene            <271629..>272771
                     /locus_tag="CYME_CMG106C"
                     /db_xref="GeneID:16993240"
     mRNA            <271629..>272771
                     /locus_tag="CYME_CMG106C"
                     /product="probable flap structure-specific endonuclease 1"
                     /transcript_id="XM_005535851.1"
                     /db_xref="GeneID:16993240"
     CDS             271629..272771
                     /locus_tag="CYME_CMG106C"
                     /codon_start=1
                     /product="probable flap structure-specific endonuclease 1"
                     /protein_id="XP_005535908.1"
                     /db_xref="GeneID:16993240"
                     /translation="MGIRQLAKLIVDHAPRAYKEQDIRALFGRVIAIDASMCIYQFLV
                     AVRTADAANLTNESGEITSHLSGVFYRTIKLLELGIKPIYVFDGKAPDLKANELAKRR
                     SRREEDEQAAAKAREEGDLELYAKYARRVNKVSAETIDNVKRLLRLMGIPVVEAPSEA
                     EAQCAVLTRAGLAYATASEDMDALTFGTPLLIRNLFAALASGAERKDRKPSEFSLAIT
                     LEDLGISMDQFIDICILCGCDYTCTIPKIGPYRALMLVKQHGCIEEVLASLRESNHPI
                     PDDFDYLGARGLFKEPHVKDAADIEPLLEWHAPNEEGLVQFLVQENSFNEQLVRKAVE
                     RMTKALRSGVANQSRLDNFFKPKTLPKKHEPERPSSKRSTKRARKT"
     gene            complement(273119..274587)
                     /locus_tag="CYME_CMG107T"
                     /db_xref="GeneID:16993239"
     misc_RNA        complement(273119..274587)
                     /locus_tag="CYME_CMG107T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461277.1"
                     /db_xref="GeneID:16993239"
     gene            <274540..>275874
                     /locus_tag="CYME_CMG108C"
                     /db_xref="GeneID:16993238"
     mRNA            <274540..>275874
                     /locus_tag="CYME_CMG108C"
                     /product="similar to Raf/ATN-like protein kinase"
                     /transcript_id="XM_005535852.1"
                     /db_xref="GeneID:16993238"
     CDS             274540..275874
                     /locus_tag="CYME_CMG108C"
                     /codon_start=1
                     /product="similar to Raf/ATN-like protein kinase"
                     /protein_id="XP_005535909.1"
                     /db_xref="GeneID:16993238"
                     /translation="MRKSYDTQVATNAPNNDASARAVTLPSLLLFGTRGAAIIASAVL
                     NCVERLRQAREDVSSQRCCFQYAGSEHSFCRTELRRAFQSRLAGTTAQPELAPVGSSP
                     PLPNGGLFRAERLVLGGVEPDTSPGGPAVQHHLMQQSQQHADDSCTTAAQPSLDWSEL
                     EVFEKIASGTDTDIFRASLHGDAVAVKVLSKYASTDAEDAFNREWRTFVEHDLRHQNI
                     IRFYGWGYRPNGERFLVVEHAKGGSLRQALTRRLWKDIGRVVRLARDITAALEYLHSR
                     NIIYRDLKSSNVLLDASWNRALLCDFGIARAMIGDGAGQMTRECGTYQYMSPEVILGK
                     ADYGEKADIYSFGILLNEMCTGEIPFSRQRLLPVQAAAAVVNKGLRPGMRGSVERKYP
                     ELHALIRKCWAQRDDARPTAAEARAELDAILVKYFSADQTPTADAQLSTATT"
     gene            complement(<276758..>277204)
                     /locus_tag="CYME_CMG109C"
                     /db_xref="GeneID:16993237"
     mRNA            complement(<276758..>277204)
                     /locus_tag="CYME_CMG109C"
                     /product="40S ribosomal protein S15"
                     /transcript_id="XM_005535853.1"
                     /db_xref="GeneID:16993237"
     CDS             complement(276758..277204)
                     /locus_tag="CYME_CMG109C"
                     /codon_start=1
                     /product="40S ribosomal protein S15"
                     /protein_id="XP_005535910.1"
                     /db_xref="GeneID:16993237"
                     /translation="MDEESSSAPKKRTFRKFSYRGVDLEALLALPHNEMVELLPARAR
                     RKLARGLDRRQTSLIKKIRKAKAEVPDEFSKPEIVKTHCRNMIIVPEMIGARLGVHNG
                     RTFNEVEIRGDMVGHYLGEFSLTYKPVKHGRPGIGASSSSRFIPLK"
     gene            <279549..>280526
                     /locus_tag="CYME_CMG110C"
                     /db_xref="GeneID:16993236"
     mRNA            <279549..>280526
                     /locus_tag="CYME_CMG110C"
                     /product="probable phycocyanobilin:ferredoxin
                     oxidoreductase"
                     /transcript_id="XM_005535854.1"
                     /db_xref="GeneID:16993236"
     CDS             279549..280526
                     /locus_tag="CYME_CMG110C"
                     /codon_start=1
                     /product="probable phycocyanobilin:ferredoxin
                     oxidoreductase"
                     /protein_id="XP_005535911.1"
                     /db_xref="GeneID:16993236"
                     /translation="MRLRGRLLLAKADHPAASLELCVRMAFLASSCVTTAHPLTRRSA
                     KQRCAAGVHVRRALLASGAAGERRLRRVQHPLIQRLAEGIERTWQTELHDLAPFHLPE
                     DLGYIEGKLEGERVVIENVCHQSPAFRKMHLELARVGTSQTASLDILHCVMFPCAGRV
                     GTNVPMFGCDIVAGRGAVSAAIVDLSPVSASRELPPSYRDALQSPEMAALRRFRQVRE
                     LPAWGREIFSEFCVFIRPVQTPECNEEDRFVDLVLRMLRIHCHLAQKSTSTPHLDQVR
                     EALEGQIHYCRKQQENDKTRRVLESAFGKPWTERYISTVLFDSPVLAAN"
     gene            complement(<283867..>286962)
                     /locus_tag="CYME_CMG111C"
                     /db_xref="GeneID:16993235"
     mRNA            complement(<283867..>286962)
                     /locus_tag="CYME_CMG111C"
                     /product="alanine--tRNA ligase"
                     /transcript_id="XM_005535855.1"
                     /db_xref="GeneID:16993235"
     CDS             complement(283867..286962)
                     /locus_tag="CYME_CMG111C"
                     /codon_start=1
                     /product="alanine--tRNA ligase"
                     /protein_id="XP_005535912.1"
                     /db_xref="GeneID:16993235"
                     /translation="MDLKEHTFGFANSPQGMQWATTSLRQLVPRNLVSWSTPWSLRDY
                     ATGTLPRWKWCPRINRYAKRERALSRPQRSARPALIATLSPEATARKKAAERVAVGKR
                     LSSNEIRAAFLEFYQQRGHRVVPSASLVPDDPTILLTIAGMVPFKPIFLGQRQPPDPP
                     RAVSAQRCLRTNDIENVGRTKRHHTFFEMLGNFSFGDYFKEQSIRWAWELITEVYGIP
                     RERLCVSVLHADQEAYEIWRDVVGLPEHRIVRMSETDNFWSSGPTGPCGPCSEVYYDF
                     KPELGTNVASGGHETSVPPATAGTGILDLNDDERFIELYNLVFMEFNRDTEGRLMPLQ
                     ARNIDTGMGLERIAQVLQGVPNNYETDLMRPLLDKTAELAGRAYASLSERERVSAKIV
                     ADHARAVVHLLADGVQPSNLGRGYVLRRLIRRMVRHGRQLGIEQAFTEVVAGTAVALA
                     ADAGYLHVAEHRARITRELQMEEVRFRQTLERGEALLAELLRENRGHISGEDAFELYD
                     TYGFPVEMTQEIAAEQGLQIDMDAFQRCMEAQRARARERGRPGSIDLPAESELVAQLG
                     GNGTAIDRTEFVGYEQEQVATARIVALIVDGKAVQSLASVPEGSLNKVQVILDRTPFY
                     AEGGGQVADTGELQLVQREPRIALRVADVQQLGNAWIHTASLDGTSADLHVGDVVTAR
                     IDAARRRRIRAHHTGTHLLQAALRQVLGADQVAQAGSLVDSERLRFDFTAPRALTDRE
                     LELVSELVNQWIDEAHPLIVEHLPYPEAVQRGAIAMFGEKYGDVVRVVNVPGVSMELC
                     GGTHVRNTAEVGLFHVLSESSISSGVRRIEAICGQAARDFLNQRDLLVRTLQQTLRVT
                     QSAELVARAEALLNENKLLERQAASARTELAKALAMRCLPTQQLRQETGKPVALLIKR
                     LDQVDAVGTALGSWDNDILGAAADAILSQLGDRGIVVLAAAAAPSAQQVIMVGRCTPL
                     VASETPVHMGRLLQAAAKRCRGGGGGKPTQAQAGGRDATSLDAALAALQEEVSRLLQG
                     S"
     gene            287214..289071
                     /locus_tag="CYME_CMG112T"
                     /db_xref="GeneID:16993234"
     misc_RNA        287214..289071
                     /locus_tag="CYME_CMG112T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461278.1"
                     /db_xref="GeneID:16993234"
     gene            complement(<288334..>290691)
                     /locus_tag="CYME_CMG113C"
                     /db_xref="GeneID:16993233"
     mRNA            complement(<288334..>290691)
                     /locus_tag="CYME_CMG113C"
                     /product="protein phosphatase 2C, with protein kinase
                     domain"
                     /transcript_id="XM_005535856.1"
                     /db_xref="GeneID:16993233"
     CDS             complement(288334..290691)
                     /locus_tag="CYME_CMG113C"
                     /codon_start=1
                     /product="protein phosphatase 2C, with protein kinase
                     domain"
                     /protein_id="XP_005535913.1"
                     /db_xref="GeneID:16993233"
                     /translation="MSIVSELRQVSRAELGPLADPAAIGSGAAVYRGTLDGLAVAVRQ
                     PRITSSAALERFHSQVHLQHYVTVRARQRTCVQRGDEKVSMPAGLLPLLAVCEAPPFY
                     CTVTPWCSGGCVFDVLHKRTTPGTHSILQRLEWALQLAIGLQNLHELGVIHRDVKTAN
                     LLLEDDRVLLADFELAIMSNSHSLPNTESIRESSAHAIRQANEGKHRLHSEGTPLPVG
                     PSAGRLAHMVGTTVYMAPELLSAERSGWGSTYASDVYAFGITLNEIVTASVPYVDRQL
                     SEPELHTVLETRFNELQLRTAIVTEHLRPRLDVDALGGREGQRLCELIERCWDADPAR
                     RPAMSAVVKELAALVDQLKRSSFKAVRILRSTLAENPEGALAGAAWATHIGDDEVDAS
                     QTPRGPAERTRQASAATGADLVSETDPSALAASYFGKDAHEITTIAHELVQSVAHRPF
                     PLSDTGSAAPAGFRQRLDRSSSPASVDRSDRVQAEAYAVSGRRGPDRMEDRHLVASPL
                     QLSIELVQSGPALACWGSSHILGVFDGHGGVEAADFTAALIPDALQRLLGRNPQMRPE
                     QVLRELLCFVDMCWSLWCAQHDASQALGKRGLVGSTALVAMVHSGTLYVANIGDSRAV
                     LFEVQPDTALVPILVTLDQTCTASSQERARLQEQGARVLADSAGTLRVEGLTLVTRAI
                     GDIALKRYLTAEPELYIQHLQPDREYILILATDGLWDVMDVGEVAKIIRGTVQVPGLL
                     ARRLVTEALQRETQDNVTVVAALLSTSAAKAPLLPPPGDAAREHA"
     gene            complement(<292243..>292677)
                     /locus_tag="CYME_CMG114C"
                     /db_xref="GeneID:16993232"
     mRNA            complement(<292243..>292677)
                     /locus_tag="CYME_CMG114C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535857.1"
                     /db_xref="GeneID:16993232"
     CDS             complement(292243..292677)
                     /locus_tag="CYME_CMG114C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535914.1"
                     /db_xref="GeneID:16993232"
                     /translation="MAAAEPRTSAVPADSQTSHRTDVALAGERSSSKVPESCVPDLDA
                     LWFCYSPVYQFRYYYMNGTVDSCVGKVRRLVRCFRSRLLSPEDAERLYANGAEDDENA
                     HASVGRRAGPYEPVWELRARGAAPETPGASNAFAATREDRQS"
     gene            <294256..>294615
                     /locus_tag="CYME_CMG115C"
                     /db_xref="GeneID:16993231"
     mRNA            <294256..>294615
                     /locus_tag="CYME_CMG115C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535858.1"
                     /db_xref="GeneID:16993231"
     CDS             294256..294615
                     /locus_tag="CYME_CMG115C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535915.1"
                     /db_xref="GeneID:16993231"
                     /translation="MARLFEVPPDSIAAKKREHNWWNRTVDQLEDWKDSVTETKWYQR
                     VERVASSGYTFVRRAFGLGGRVAWISATSALVLVVPLVYEIDRELDANAASSSAAAAG
                     GSGVGSSSTAGRPAATR"
     gene            <296957..>297874
                     /locus_tag="CYME_CMG116C"
                     /db_xref="GeneID:16993230"
     mRNA            <296957..>297874
                     /locus_tag="CYME_CMG116C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535859.1"
                     /db_xref="GeneID:16993230"
     CDS             296957..297874
                     /locus_tag="CYME_CMG116C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535916.1"
                     /db_xref="GeneID:16993230"
                     /translation="MHCDHLDALSIVTGRDGGCAVRLVQSVHEHPQSSYRKILAIVDE
                     TVLSSPTLSVVRRQQACIHQYLQRAGKTEAHNSRPWVAVYGARHAAVRKGRTRASSAR
                     AYNEFRNRFYTIFIDDIVILSTHHEQACTMKQVERQRLQQSRMDNVVVYRTLTECQIA
                     RRSKKSGLLVCDSTRKHTRTHFLYRDLTTTINLRKRLALPQHLAAFFRQSFQANRLVL
                     CVGIGLKCASPSMKTSVLRSEGIESSLGPLNWGFTLQLPSKAATGLTDTWNTCPWPSM
                     NDIGVPLFDIAACARLKPTLHCFDIDRIT"
     gene            complement(<298484..>300757)
                     /locus_tag="CYME_CMG117C"
                     /db_xref="GeneID:16993229"
     mRNA            complement(<298484..>300757)
                     /locus_tag="CYME_CMG117C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535860.1"
                     /db_xref="GeneID:16993229"
     CDS             complement(298484..300757)
                     /locus_tag="CYME_CMG117C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535917.1"
                     /db_xref="GeneID:16993229"
                     /translation="MTPTKSRGAQAAPRGSWSSWLQPRENVAQRAERVAQLVSDAGQM
                     DVVARFDALGELVELVLSTEPRERELSRTAFLENECWAAILELAVQPAGDAKQQALRV
                     KALQTAAMLLWNIHDPLLLAYLLAHDALRQVVLAAPLFQETEATHSATGKEADVDSDL
                     LPSYLSLLRTVCLRLDIASLPLVFREEDNTFPLLNAATQFLDNDDRLVRAAAYGMILG
                     LVRLSADAPTLDRFLSREMEQKNSFSRRYIANLGQAAIAAVSVNGDQARAAAELQDVY
                     EFLGELANQAGPFVQLTLLNLLRSDFLTPVLVAAANGDRSDLTLSDAVQLFIFFLERG
                     HSALVCSECCATLVRSERYTALLSRFVKASASNADRIADHVRLRCLTAYAASVPVCIA
                     AREALINRLEAVPQGELWIQLDPGRSFWGSVFDEKTNGAGGIATTLEMVLLRLVLAVD
                     DPEQHTQIDASIVQLYRERIGDIQLSLEQNPAYANDLGRLLAHAEDRQRLCNDLLQHI
                     RDRYRSRFGSVTPSEANTLNENALDSVQRREHVIADASLWMLAHAVAAQAPRRQTGTP
                     SRPADSSETSAAYKRVTCFLGYLEATLDSDTYSDVDAVLLPLYKCDLARSDPSRWSTQ
                     SAETMTLALAQTDVFNCSLEGRRVLCAADENESKMLIVGEVLEGGGFQPLLGLPLEYI
                     LELTEPEPTTSATNEGWCVLIQRSDVTQVLDLVFESESTARDFVAHVSKLFPQVAAWR
                     AACLRDALLLPHSRTSL"
     gene            <302510..>302863
                     /locus_tag="CYME_CMG118C"
                     /db_xref="GeneID:16993228"
     mRNA            <302510..>302863
                     /locus_tag="CYME_CMG118C"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_005535861.1"
                     /db_xref="GeneID:16993228"
     CDS             302510..302863
                     /locus_tag="CYME_CMG118C"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_005535918.1"
                     /db_xref="GeneID:16993228"
                     /translation="MKYLAAYMLLKLGGAEEVTADDIRKVVSAAGAEVDDDRVAALLQ
                     AVNGRSIDELVTEGRSKMESVAGVAVAAASAAPAAAAAGGGDSGAAAASADKGAAKEE
                     PKEESDEDLGFGLFD"
     gene            complement(<303344..>303985)
                     /locus_tag="CYME_CMG119C"
                     /db_xref="GeneID:16993227"
     mRNA            complement(<303344..>303985)
                     /locus_tag="CYME_CMG119C"
                     /product="similar to histidine triad protein"
                     /transcript_id="XM_005535862.1"
                     /db_xref="GeneID:16993227"
     CDS             complement(303344..303985)
                     /locus_tag="CYME_CMG119C"
                     /codon_start=1
                     /product="similar to histidine triad protein"
                     /protein_id="XP_005535919.1"
                     /db_xref="GeneID:16993227"
                     /translation="MRDRTKPRPLLDENLVHRIRVALQHQADGGDIDLSTEDSYSSSK
                     VDCVFCCLTLENCVALHASARTLTILDRTPVTLGHCLVISRRHVSSMDALTESELAEL
                     FTQARHVAQVVLREVYLTRRVSDASRLTFSERMSAREPTEEPVTRVEASVSSQERFGY
                     NIGVNNGRCAGQSVPHVHVHVIPRAPGDGFWCTHRPWGMELAKRRLKMHRHRL"
     gene            304121..307230
                     /locus_tag="CYME_CMG120T"
                     /db_xref="GeneID:16993226"
     misc_RNA        304121..307230
                     /locus_tag="CYME_CMG120T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461279.1"
                     /db_xref="GeneID:16993226"
     gene            complement(<306813..>308786)
                     /locus_tag="CYME_CMG121C"
                     /db_xref="GeneID:16993225"
     mRNA            complement(<306813..>308786)
                     /locus_tag="CYME_CMG121C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535863.1"
                     /db_xref="GeneID:16993225"
     CDS             complement(306813..308786)
                     /locus_tag="CYME_CMG121C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535920.1"
                     /db_xref="GeneID:16993225"
                     /translation="MLGKALQLHRSSARLRLHTLDFTFINWKPYYQRIPGTCSALSPQ
                     RASCWLSNCGLQVHPELLSKSGAVELHAATLDGFHTHAPGRRRRLVSSHSQQPLSANE
                     LASAALRKAALIAADTPDSCATDLHRALQAIRDSDTIQSLHAALRHSQAESVPFGEKN
                     RSPDANRRAPLIAAAVRTKLASWPSVPHDRQTGALLSDIVEWCTSAFGDVSALQPTDK
                     LAFAKALASWTPWIRWLRPETVTRLYRTLEQVYAAAPALSLGVYSALWKCRVQALGYL
                     RWPQDLDECFDVCRRYQCSPDIVLLNTVLDGLCNGPRGGPFYPTWRRRQLPHPITEDE
                     PLGFLERFLERIRREWQIEPDRGTLNIMLEFLGTRGCTEEMLGFYDRWVPSPYALGKE
                     TRHDAGFARLVPDAFTFRVLFRGLDPRWRPSSLPDASRHSWREFFSLADRFLPRIQSR
                     WSALPDSERGPAPAREALPIAEVEAFAYNGKGAQVLQILRGTLPDAQRLVVPAIRGLA
                     YNARAVRLADYAFTIYETYVRRNETIQEKLTPQMLRSILDALLVASDRTHRARTALDL
                     FHVFANGEIAATTVLPSHIGVRALIRAHCKAPAVLWPALAECLAIVSAEGIHLDPDAM
                     HRLERHYAEQGATASTARQQVQRIMRLLFDLER"
     gene            complement(309251..311373)
                     /locus_tag="CYME_CMG122T"
                     /db_xref="GeneID:16993224"
     misc_RNA        complement(309251..311373)
                     /locus_tag="CYME_CMG122T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461280.1"
                     /db_xref="GeneID:16993224"
     gene            <311518..>312855
                     /locus_tag="CYME_CMG123C"
                     /db_xref="GeneID:16993222"
     mRNA            <311518..>312855
                     /locus_tag="CYME_CMG123C"
                     /product="aspartate-semialdehyde dehydrogenase"
                     /transcript_id="XM_005535864.1"
                     /db_xref="GeneID:16993222"
     CDS             311518..312855
                     /locus_tag="CYME_CMG123C"
                     /codon_start=1
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="XP_005535921.1"
                     /db_xref="GeneID:16993222"
                     /translation="MFVTIGIGTTTFREQKLDVHRALKASQPAWNVANVRFRVACAPF
                     RKTSSTTRSRRAGTAALHARLNLTERIPVAVLGATGSVGQRFVQLLEGHPWFEVVALG
                     ASSRSAGHKYGEQVSWKQATPIPADMADIEISECDPNEAAYRDVRIVFSGLDNQIAGE
                     IETRFAQAGKAVFSNAKNHRMDPDVPILIPPVNASHIEAVRTQAVYRQSGGFIVTNAN
                     CSTTAMTIGLAPIWKSPELGIETIVVSTMQAISGAGYPGLSGMDILDNVVPYIGAEEG
                     KMETESLKIYGEYQPTRGFVPAEINVSAMCNRVHVLDGHTEAVSIKVRNRGNRSKEEL
                     AQMVIRAIQEYPSTSRDVFGLPSGPERDVVYNQAPDRPQPRLDRNLGRGFTVTVGRVR
                     PCNVLDVKLALCGHNTIVGAAGGSILNAELAVVKKLIASVGVGATEHGAAVRR"
     gene            complement(<313798..>315030)
                     /locus_tag="CYME_CMG124C"
                     /db_xref="GeneID:16993223"
     mRNA            complement(<313798..>315030)
                     /locus_tag="CYME_CMG124C"
                     /product="GTP-binding protein of Obg-family"
                     /transcript_id="XM_005535865.1"
                     /db_xref="GeneID:16993223"
     CDS             complement(313798..315030)
                     /locus_tag="CYME_CMG124C"
                     /codon_start=1
                     /product="GTP-binding protein of Obg-family"
                     /protein_id="XP_005535922.1"
                     /db_xref="GeneID:16993223"
                     /translation="MVQCVDAAANIAYRRGETRCLYSAFVAAGPGGVVCRGTMATLQK
                     IKDIEDELARTQVNKATMGHICRLKSRLAKLKRELLLESTKASGGGGGGEGFDVARTG
                     DARVAMIGFPSVGKSTLFSKLTETESEVAAYEFTTLTAIPSNIFYRGAKIQLIDLPGI
                     IEGAKEGRGRGRQVIAVARSCDLIMIVLDATKPVVHKRIIERELEGFGIRLGKQRPRI
                     AVRRKDRGGVTLTTLFQGPASHLDLELCRTICQEYRCPNAEIVLKEDATPDDLIDVLE
                     GNRVYVPVLYVLNKIDATSMEELELYDRLEDYVPISGHLGWNLDGLLEEMWKKLDLIR
                     IYTKPKGEIPDYDAPIVLRNAPEHCTVRALCRRIHKSLLDQMRYAWVWGSSVKFSPQK
                     VGADHVLQDEDVVQIVKS"
     gene            <316702..>317694
                     /locus_tag="CYME_CMG125C"
                     /db_xref="GeneID:16993221"
     mRNA            <316702..>317694
                     /locus_tag="CYME_CMG125C"
                     /product="similar to peroxisomal membrane protein PMP22"
                     /transcript_id="XM_005535866.1"
                     /db_xref="GeneID:16993221"
     CDS             316702..317694
                     /locus_tag="CYME_CMG125C"
                     /codon_start=1
                     /product="similar to peroxisomal membrane protein PMP22"
                     /protein_id="XP_005535923.1"
                     /db_xref="GeneID:16993221"
                     /translation="MSFVTTGPGGLHELVLRRVRDLGNEATIRRVIEATTSGKANDYA
                     PYAPEGSKTSGTLRLLLAAIWKSYLRKLQTDPVVTKSISAAIISLVSDLLASSLSGSK
                     LSSRSLLNQFSIGLAIRGPIVHYFHQFLDRVVFARVTNQTQIAVVIAKVIIDQFIFSP
                     PYNALYFLIIGLLEDRSLAEIGRKIRRELWGVMKTNWIVWTPANIISYYAIPLELRVL
                     WGNLVGIIWTAILISKVRRGGGSSSTSNQNSGGSGSGDMSANSSGHARIGSSEQPNDQ
                     SGTRTYANAAATRSSVGLRAGDASAASGKHRQPIAENTNDVEESEHLNDHNKFE"
     gene            <320096..>321493
                     /locus_tag="CYME_CMG126C"
                     /db_xref="GeneID:16993220"
     mRNA            <320096..>321493
                     /locus_tag="CYME_CMG126C"
                     /product="similar to zinc finger protein"
                     /transcript_id="XM_005535867.1"
                     /db_xref="GeneID:16993220"
     CDS             320096..321493
                     /locus_tag="CYME_CMG126C"
                     /codon_start=1
                     /product="similar to zinc finger protein"
                     /protein_id="XP_005535924.1"
                     /db_xref="GeneID:16993220"
                     /translation="MPKNGLSLGKVEAVAASLDVPEGYHWPHEAFRSLDVLTRCPICG
                     EHFRAPVLLECGHSFCSECIRRALVYRSECPQCRAPASAGQLRRNRLVQDVTTAWQQA
                     RECVLTRFSPQEHAGNTECRSSKLEASTESGLTVRERTEAACPVRAAALTAQVATRGR
                     ARSAPVPPDEHTAAVSAVWTDRQHQNWDEAGVCCGNCEESASSAVSMSKRTEPSHRFE
                     RSAERAGAQPPNGGLSGIAAVPQPLPVFQKTDDIYAEDWSEAAPTRTPAALPGEAARA
                     MEPRPRNDAESTATSGHASFTRRASCERIQQRDHTKYVECPICNRAYPPAFIQVHVNE
                     CLDQLDAVEASGFPEAGSRALAKATNTLEDEYPMRKIPEVWYDGLTERRLREMIRALG
                     MKAPPAWLRNRRGLIYLHREYVIRHNAECDVEPVTARKQRRNICREVEELAWFQIESA
                     RRPTRPEAARSSNAT"
     gene            complement(<322714..>323943)
                     /locus_tag="CYME_CMG127C"
                     /db_xref="GeneID:16993219"
     mRNA            complement(<322714..>323943)
                     /locus_tag="CYME_CMG127C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535868.1"
                     /db_xref="GeneID:16993219"
     CDS             complement(322714..323943)
                     /locus_tag="CYME_CMG127C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535925.1"
                     /db_xref="GeneID:16993219"
                     /translation="MKRHLRRRVGRTVAFVVACCLIGSWIGCQLGISRSSYSLTRKRT
                     PRALWPGAGHETQLPRVALLSTTTAAYARRFAYAVQNKVLYAKKWSATVDFLLDSYPY
                     HWLKVAATPERHAEPGQPLPPHYNRLFALERLLKQDAPYDWFMYVDVDAVITNFSIPV
                     QTFLQGISPEHYVVVHDGPEINSGAFLLRNTPESLQFVRNWIALGTQWPQASLDQTAL
                     WHLLYLHAAFPSAPPELLLRYAHTYPCRASVLFPVHFVGSPALQRAPAAMLRHIEGCW
                     RYHMARLGYGYGQRNRQQQQQQQAVYYRHEAPGFNFYASVGRPENCALRHASQLWRPG
                     DWLIQDSGYGLEDSYETVNETVLVRCIRPPCSTEIWKDEAKPGMIASWDRQALLLYPQ
                     NRWHRRGPDDSEPFAAP"
     misc_feature    322847..324825
                     /note="possible transcribed region"
     gene            complement(<325585..>327294)
                     /locus_tag="CYME_CMG129C"
                     /db_xref="GeneID:16993217"
     mRNA            complement(<325585..>327294)
                     /locus_tag="CYME_CMG129C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005535869.1"
                     /db_xref="GeneID:16993217"
     CDS             complement(325585..327294)
                     /locus_tag="CYME_CMG129C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005535926.1"
                     /db_xref="GeneID:16993217"
                     /translation="MHSISRRTRCALDAPANSGTRRLRYVPHDGGQLTMQTGSRSHTT
                     VARGDKLCWCFVYKVESTTIFSCFFSLVRCVPSGIPKYLHRLLEVLCSMATCAETGEQ
                     STSELSCIPVDWLPLLGPEPHEHSSFSYASDSLTEGWKTWLHRFTAEALSGTIESLSQ
                     DTMSESDHGTHSVCSSILVDDLKGVGYPNWKRAPLNTSLDGGDLVGAANAAAHSAALS
                     PVTPQPVHLDTQTRLDAMSPFCVGSDPSASSTTTTTTPWCRARSTPLSETSSIARAGP
                     ACFDDLSTDTQQPNVCIFCAHLLEASHASAVQQVLHSIGWEALRASRGGSDHGRRTSS
                     ADVSASSSMPTRSLSLKRDVAGAGGEPDSFGEDHPRTAKKLKTKPSPGTEQTIDTSLQ
                     EYLADSIPLNNGIEKDNRKRRDWTPEEDNRLRQLVEAHLSTLRTGAHMTRDREPRGLW
                     PHEDDDHDQPDSEYDPTRNAYGNVQVSVSGLRIPWTQIASRLPGRTAARCRERYRNYL
                     DPSIRHEPFSAREDLIILREYERRGPAWAFIASKLKGRSENAVKNRLHALIRKARRSS
                     AVI"
     gene            complement(<328007..>329560)
                     /locus_tag="CYME_CMG130C"
                     /db_xref="GeneID:16993216"
     mRNA            complement(<328007..>329560)
                     /locus_tag="CYME_CMG130C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535870.1"
                     /db_xref="GeneID:16993216"
     CDS             complement(328007..329560)
                     /locus_tag="CYME_CMG130C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535927.1"
                     /db_xref="GeneID:16993216"
                     /translation="MGYESDHKHDALYREITAKGGNLQRREYHRVVKQLVQQEVRNWI
                     ADDWHRSSEKSKSRDAVTASVLLTKPRKRFLRLEIARITGLPSGDESEAQRRWLELHE
                     QRIYQYTRNLLYYSRNQERLKSKSRAAKDAARERLRRGALSSTLDTRSSNEQVQARAT
                     GTSRRAVAGSPSQSVCPRVAVSPSDQAHTVVSEAPSQATSENDSGTRTVVTAPAQRAC
                     PMKRSTCPLPSLSFDLERVTQEHHVDGDWSLARELNQADTCIEPKFEPRPARVACGAS
                     SAMAGWASPWSTKFSGNQTGADTETLCGWLSGSRPGVAASAAFADEQTSPCWRQASPE
                     HLTQNPATQAPTLEVLKETEVSLEYDLHVESVEEASGWSSAGWTQFVHEWTGSVQPSD
                     EPPNWQRIQTAFRKRDPSAESLPTQREDSETSALSADMSDLNLVSATGLRRSDSLESA
                     VDGYFSSTESDPISTEAALLSDGSRRRAHISCRTQARQRMEELVRQGRLSGSGRPLVP
                     TTPLREGVI"
     gene            complement(<330666..>331634)
                     /locus_tag="CYME_CMG131C"
                     /db_xref="GeneID:16993215"
     mRNA            complement(<330666..>331634)
                     /locus_tag="CYME_CMG131C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535871.1"
                     /db_xref="GeneID:16993215"
     CDS             complement(330666..331634)
                     /locus_tag="CYME_CMG131C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535928.1"
                     /db_xref="GeneID:16993215"
                     /translation="MIHIMFRLPGISLSSGRRPRHGERPFREGACAAAFSREIERHGS
                     SRAMKTFRQPHASPTNGNAGWIQGYGFSECPAQPATPDATHQRSPLGHGIAFLCLEAH
                     RLDAHFIRSSCMTSRRLGFDGSAQTCVHRAPDCTLKGAEYQRELAHAGRFRVGTSMGR
                     FRQAAYTCVYERVKANGSTCHARMYVLRFCCVPMVINSGSCRLLLQLLPFPISSFWFT
                     ARNSLRALHLRCHGSKRMDSVYKVQIFPLSAVVAELDAQPKDAIYILGTAAKVAPKVY
                     AEIIEAVTLNCGQASPGVSTMHPLPGVALFLVYARSIARDMPLAGT"
     gene            <331752..>333065
                     /locus_tag="CYME_CMG132C"
                     /db_xref="GeneID:16993214"
     mRNA            <331752..>333065
                     /locus_tag="CYME_CMG132C"
                     /product="similar to acetylpolyamine aminohydolase"
                     /transcript_id="XM_005535872.1"
                     /db_xref="GeneID:16993214"
     CDS             331752..333065
                     /locus_tag="CYME_CMG132C"
                     /codon_start=1
                     /product="similar to acetylpolyamine aminohydolase"
                     /protein_id="XP_005535929.1"
                     /db_xref="GeneID:16993214"
                     /translation="MSVYNQFVPSVGIENRTSLRYLTAHHVRNLATQPAVRLRPRFLS
                     VRRVGWARPLLRLRSEVPATVHGADIYHSPLFRKHWPYGEDLDDEPQHPECPHRVIVI
                     ERALHESQLPLHWHEVPRFREPFAANCAKLLKIVEASGLEALEKETEDPALARAVRAA
                     AAVHFLDHIAEIHRLVHVRGATRIDMDTYLSDDTLEVALMATRAALEATDAALKDPSR
                     LAFVVSRPPGHHATRATAMGFCFLSNVAIAAHEVLKRSDKGEFSRPITRIGILDFDVH
                     HGNGTEDCVRQQERIRFVSLHEHPQYPMTGGNPNEHGPKHNIWNFPLPAGTDWHNGYA
                     EAYAEALNRLCSGTDRSDVVSDLDLVLVSAGYDALASDPLAGLHLKPSDYSEMAFQLI
                     HRLKPSTPVVFCLEGGYDLNAIGEAVSQTIQGALRARAEQPQAVV"
     gene            complement(<333923..>336640)
                     /locus_tag="CYME_CMG133C"
                     /db_xref="GeneID:16993213"
     mRNA            complement(<333923..>336640)
                     /locus_tag="CYME_CMG133C"
                     /product="excinuclease ABC subunit B"
                     /transcript_id="XM_005535873.1"
                     /db_xref="GeneID:16993213"
     CDS             complement(333923..336640)
                     /locus_tag="CYME_CMG133C"
                     /codon_start=1
                     /product="excinuclease ABC subunit B"
                     /protein_id="XP_005535930.1"
                     /db_xref="GeneID:16993213"
                     /translation="MFLIGNLGLCRSGLARNAGCLCRLRIGGGVFHGPVVMRLLANGA
                     GRWPSLTLVCNATNDASRAVLAATAHGRPLDPRVATEQRPPFERLVRFVQEVCNGSAE
                     HAITKNARFSRSMKLYLDDSMAVIVIERKLPLKRPDAERLVARHAVMWRLCTQLALLL
                     RRGRLDADAQQHLEQHGWHIFRYSDDADQIVPLTKILPIPADVSISPRRSAEQETLAE
                     HFARLPDQRFQLVAPYTPAADQPAAIQCLVDRLPSKRFQVLKGATGTGKTFVIANVIA
                     QYGRPTLVLAPNKTLAAQLYRELRGFFPSNAVEFFVSYYDFYLPEAYNSATDTYIEKS
                     ASINKDIDRYRHAATRALFERPDVIIVSSVSCIYGLGMPSTYLRAATSLKLGDVCSLD
                     EIVLQLEAMLYERRADPRDPGTFRIRDTAVEVSLPSWDERELLLRIDVQDHQIVELRY
                     VDRETGADVEYSSHVTLYPARHFVTPKEERERALQAIAAELQSRCKRLRERGQHHAAE
                     RLERRTTQDLELLREHGYCSGIENYAMHLSGRAPDVPPECLLDYFPPEWLLIIDESHV
                     MVPQIRGMYHGDRARKENLVRYGFRLPSALENRPLRESEFWTKVHRCVFVSATPGPFE
                     LCLADGALAELLIRPTHVLDPRIQVHPTRGQIEHLAASLRQRVQRGEKALITTLTKRM
                     AEELCRYLREQRFRVSYLHSELNALERVEVLSALGTESCDVIVGVNLLREGLDLPQVS
                     LVAILDADKEGFLRSETALIQTMGRAARHVAGTVTLYADTLTDSMQRAISETERRRAI
                     QAAYNAKYGMEPRSILAKHEPYLKREKTSSKMGLGGRLPAGLGALDDEQLRTHMHEAA
                     AQLDFELAAVIRDLLEKRELSRLEARLQAQHLTEDSTANASRHRRGESV"
     misc_feature    336799..339808
                     /note="repetitive element"
     gene            complement(341757..344057)
                     /locus_tag="CYME_CMG135T"
                     /db_xref="GeneID:16993212"
     misc_RNA        complement(341757..344057)
                     /locus_tag="CYME_CMG135T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461281.1"
                     /db_xref="GeneID:16993212"
     gene            <344413..>344853
                     /locus_tag="CYME_CMG136C"
                     /db_xref="GeneID:16993211"
     mRNA            <344413..>344853
                     /locus_tag="CYME_CMG136C"
                     /product="probable ubiquitin-conjugating enzyme E2"
                     /transcript_id="XM_005535874.1"
                     /db_xref="GeneID:16993211"
     CDS             344413..344853
                     /locus_tag="CYME_CMG136C"
                     /codon_start=1
                     /product="probable ubiquitin-conjugating enzyme E2"
                     /protein_id="XP_005535931.1"
                     /db_xref="GeneID:16993211"
                     /translation="MSASSVLAHEDARLGFEHETNHLVERSDLYTWGATIIGPEDSEW
                     ENAVLTLKLTFPEQYPEKPPRVRFTCEMFHPNVYHDGNVCLSLLSENWSAAYSVSSIL
                     IAIRSLLTDPNPNSPANPEAAHLFSMDYNDYKRRVRRIAQKSLE"
     gene            complement(<346351..>347391)
                     /locus_tag="CYME_CMG137C"
                     /db_xref="GeneID:16993210"
     mRNA            complement(<346351..>347391)
                     /locus_tag="CYME_CMG137C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535875.1"
                     /db_xref="GeneID:16993210"
     CDS             complement(346351..347391)
                     /locus_tag="CYME_CMG137C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535932.1"
                     /db_xref="GeneID:16993210"
                     /translation="MSTPRAIARRLRSQAKPALRLYCQVCERQFRDQRALDTHQAGRA
                     HQERVIALAGNESACRALFSERFFSQFLLALAQLSRTSQFPDRRVQATKVYDYVTQDP
                     RHVRLHATRWQSLRRFLQWLLAHCPDRVVFVSEGETSPHTSAVVRLQPERVWLVSIQD
                     TVHGNVSKAPGIPLSNKSILELHERRLGTNLPQVARSSVTAAEAHVAQSAVCESERDI
                     VDVQRLVMEFDSWNPPPTRATRLAAQHMPAQVLHSMDKSWIPRYQAGDLVVIRNKALA
                     QGALHERLGVVLQQAPVMHGCVVDVVVSLLPAEPLLYVLRMDQDELELADEARRSGIN
                     PWIDTSRLRVFA"
     misc_feature    346992..349167
                     /note="possible transcribed region"
     gene            <349289..>350851
                     /locus_tag="CYME_CMG139C"
                     /db_xref="GeneID:16993208"
     mRNA            <349289..>350851
                     /locus_tag="CYME_CMG139C"
                     /product="similar to flavin-containing monooxygenase
                     FMO-1"
                     /transcript_id="XM_005535876.1"
                     /db_xref="GeneID:16993208"
     CDS             349289..350851
                     /locus_tag="CYME_CMG139C"
                     /codon_start=1
                     /product="similar to flavin-containing monooxygenase
                     FMO-1"
                     /protein_id="XP_005535933.1"
                     /db_xref="GeneID:16993208"
                     /translation="MPLNPGASVAVIGAGAAGLVAVRIFRDAGFRVTAFECSETVGGT
                     WNYQDVANEPDLARAASRRLESTTTTETPSSEVFRQVPEQTTRLAALPPVQSSIYAGL
                     RTNLPRQVMQFSDAPFPEHLPSFIGHRDVQRYMVDYARRHNLERHIRFGVWVQRVQPV
                     SNDVWSRYLVTFSSSKSPEACTQAFDAVCVCNGHYSVPQIPAEPYSEPADGTEYIPGL
                     TDGTFCPGVVRHSHYYRDAEKYRDLRVICLGAGPSGVDISLEIAEYARKPVYLSCRAV
                     KQMPSDSATEQYGVLQVPRLVAVIGPRTVQLADGSILHDIDVIMLCTGYRYSFPFLTE
                     ACGISVTLQGRVVTPLYRHLIPVSRWTLPLIGIPYAVVPFPLFEFQARYVAAVFQGRV
                     QLPEMNAMQAAILEEKQVQQSFGLQAKHFHRLGDRQWAYNRELADAVGVKGPTLAVQS
                     VYNDAGTHRKLDPKHYREREYRIFGDGPEDWEVQSPAMVQLDAKSSKKGKHPTRSKEA
                     AIETSAEFSAGL"
     misc_feature    351670..353804
                     /note="possible transcribed region"
     gene            <355634..>358324
                     /locus_tag="CYME_CMG141C"
                     /db_xref="GeneID:16993206"
     mRNA            <355634..>358324
                     /locus_tag="CYME_CMG141C"
                     /product="gamma-glutamylcysteine synthetase"
                     /transcript_id="XM_005535877.1"
                     /db_xref="GeneID:16993206"
     CDS             355634..358324
                     /locus_tag="CYME_CMG141C"
                     /codon_start=1
                     /product="gamma-glutamylcysteine synthetase"
                     /protein_id="XP_005535934.1"
                     /db_xref="GeneID:16993206"
                     /translation="MGLLTTGRPLGWWDAQPHLDYVREHGIEQFVNVFCATRDRQGDV
                     LKWGDEIEYTLLVLNESERCTYLSLRAPQVIQELQSEERLVSRNSLADVQEHVTGESE
                     LSEFDSAPVPETLWRPEYANWMVEGTPGVPYSCYMRDLVLVEQNMALRRAQIRRVLRP
                     NERLLSLTAYPLLGCGRFCEPAGDGVCGPLARSLYLPDAVINPHPRFGTLTRNIRLRR
                     GEPVAIHVPLYRDKSTPSEIPLWEGGSRHGGVVDIDLHQIVDEKLATTSLSQDNTDQN
                     VGSVRSDEAVRRQRLAWSLSQASSDTELVLVPIEAPSVDGPERPEALDAQHDGLGYLC
                     EKAGLASWNERNRDGRHTSPDIYMDAMGFGMGLCCLQITLQAANMDEGRYLYDQLAVL
                     APVMLALTAATPALRGFLTDTDVRWSIISASVDDRTALERALGCPPKSRYSSIDCFIS
                     NRPEMKAALYNDIPVLVDARAYRRLREAGVDEHLARHVAHLFIRDPLVIFDDFATVDD
                     RVSLTHFENIQSTNWNTVRFKPPSQTGPNTSAGWRTEFRSMELQITDFENAAFTVFMV
                     LLSRCILAFGMNLYIPISKHDENLVTAHQRDAVRQGKFWFRKHIFSREAELSCSVRCH
                     YRCACGSEHCVSFQSLNAGSPAGSQSSPSQSCPFRFCTDPDPEAMELMTIDEIMNGKP
                     CCEKHAFRKAYPGLLTLVRVYLDAIPGLDRATRMRLGAYLDFVAARSSGRLLTCAAWM
                     REFILKHPSYRHDSKVTPEACYDLIQRCIELSEGRCGEPALLGDFWPEHHIDGELTSH
                     DFSKLRNQIHEEDSPQLRGESFREELLPAAASRILETVSISARTHAGVAEHHHDQHAR
                     HRGCDYHQAHGVDERQRRHHRGAGALGRFQEARHQADQHL"
     gene            <361267..>362502
                     /locus_tag="CYME_CMG142C"
                     /db_xref="GeneID:16993205"
     mRNA            <361267..>362502
                     /locus_tag="CYME_CMG142C"
                     /product="similar to DNA-(apurinic or apyrimidinic site)
                     lyase ARP"
                     /transcript_id="XM_005535878.1"
                     /db_xref="GeneID:16993205"
     CDS             361267..362502
                     /locus_tag="CYME_CMG142C"
                     /codon_start=1
                     /product="similar to DNA-(apurinic or apyrimidinic site)
                     lyase ARP"
                     /protein_id="XP_005535935.1"
                     /db_xref="GeneID:16993205"
                     /translation="MPDQLSGDGGSAPDAPEALLPPPEKRARTLPATGTSTQSTQVTP
                     ALTSERSVTSSRQLRLVTWNVASYRSASTALLKYVHEANPDIICLQETKLQANATPGP
                     FLLPQYRYKTWFCSTARKGYSGTAVLSKLKPQSVHRGIPGHPEHDAEGRCIVYEYPDL
                     VLVNVYVPNSGLRSCERLAYRVQEWDSALRDYLRQLAATRRSIILCGDMNVALDDRDV
                     YSVEACRGCAGFTSDERESFRRTLSEAGLVDAFMALHGNEATPRFTFWDYRDSMGGVR
                     RNGWRIDLFCVSAAMVGQGRTPRQVLRHNDASAEACTADTSPQSMATESVWKVVQVRP
                     RPDIYGSDHCPVEMVLAFVPDAEASAAFSQPLVNVPERRESAECSSPVRTDDDASGCC
                     PERGDSDKADPACPGVKQS"
     gene            complement(<362721..>363320)
                     /locus_tag="CYME_CMG143C"
                     /db_xref="GeneID:16993204"
     mRNA            complement(<362721..>363320)
                     /locus_tag="CYME_CMG143C"
                     /product="similar to anti-silencing factor"
                     /transcript_id="XM_005535879.1"
                     /db_xref="GeneID:16993204"
     CDS             complement(362721..363320)
                     /locus_tag="CYME_CMG143C"
                     /codon_start=1
                     /product="similar to anti-silencing factor"
                     /protein_id="XP_005535936.1"
                     /db_xref="GeneID:16993204"
                     /translation="MAAVDIISVAVENNPAPFLSNLRFAIAYEVREALSDDIEWRVVY
                     VGSASSESYDQELDAVLVPADTPGRFAFVLEVPPPRPERIPEEDATGVTIVLVTCSYR
                     GQEFIRVGYYLCNEYPPEVLKEAASSVKQRLVQAGMSEAEAEAQAAATVEISPPQWDK
                     LLRNILAEQPRVTRFPCSFDRSVPAKTPSTSVAATDQIY"
     misc_feature    363501..365332
                     /note="possible transcribed region"
     gene            complement(<364086..>365291)
                     /locus_tag="CYME_CMG145C"
                     /db_xref="GeneID:16993202"
     mRNA            complement(<364086..>365291)
                     /locus_tag="CYME_CMG145C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535880.1"
                     /db_xref="GeneID:16993202"
     CDS             complement(364086..365291)
                     /locus_tag="CYME_CMG145C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535937.1"
                     /db_xref="GeneID:16993202"
                     /translation="MVVCRYYLQGNCKFGDRCRYEHPPGLGGRASRQQVGPGMPAASG
                     QAGFPASGLPTAGTPAAGGGTWPAVTPNAFNMSGGAPYGVNDSARAPDRGAGSETNQG
                     AGRGNNQRKTLWDWWREGHESGVWPLSCYGNTYAKSSVKGVDVSFEELRADAYAAVHF
                     QGASLAQIEAQEASRVHQALETAQQMLQRQAHRQASRTMQGMSTAPPAAFATAPQPMP
                     SMSSAVNGAFSATGEKAPSTMTRFGTESMMMPSGSGKPPAMATASSFAHPENVSGMYT
                     GTSFQGAGAVPLNAPQNSLDMAQAYQSIVSPYGQPVEAPWSMAVSAGAGFGEPTHRTN
                     ESISSMEMGAYPSNGNVEWQSSSGGTVPQQQQQQQQQQLSDQSAQAFAAEHFSRGAVP
                     ETPPPSHFC"
     gene            <365957..>367660
                     /locus_tag="CYME_CMG146C"
                     /db_xref="GeneID:16993201"
     mRNA            <365957..>367660
                     /locus_tag="CYME_CMG146C"
                     /product="GTP-binding protein of Obg family"
                     /transcript_id="XM_005535881.1"
                     /db_xref="GeneID:16993201"
     CDS             365957..367660
                     /locus_tag="CYME_CMG146C"
                     /codon_start=1
                     /product="GTP-binding protein of Obg family"
                     /protein_id="XP_005535938.1"
                     /db_xref="GeneID:16993201"
                     /translation="MTFIVPSRGVRAPQKHAVLQARRPRGPGPLTRCWRLAPLRASLE
                     RPRSVTPADDDNQVLGSTKVPTRKREPTSAYSYIDRARIRVKGGDGGDGCVAWRRERG
                     NARGGPAGGNGGRGGDVYLVADAGLNTLVKFGSVVHFTAENGEKGQPKNCTGADGKAL
                     ELRVPLGTVVYDAETGALLGDLDQVGARLLVARGGRGGRGNAAFKTDRNRAPVIREKG
                     EPGTGCWLRLELRVLADIGIIGCPNAGKSTWLAAVSNARPKIADYPFTTLVPNLGVYA
                     ENVVLADIPGLCEGAHLGRGLGIGFLRHIERCRMILHLVAGDAPDPLYDLQAIRLELA
                     LFNPRLVQDKLHVVLFTKMDLPLAQQRWNDASFREAFQKAVGHRRIAAVSAVTGQGVE
                     ETMQRVCKLLEKIPQPDRLSSLPDASPGVLEQSRSPAAADTFRGDHDAIGASVDGTFR
                     IQKERMADGQRRWRILGLPKLERLAVMTDWAYPEAVDRFQRVLRALGVTEALSQSGIR
                     AGDVVVIANIEFDYTPDDNVFYQNALEDGVDLFKDTSDVEIAVDEDHDYREWSENVSQ
                     S"
     gene            complement(<370063..>371988)
                     /locus_tag="CYME_CMG147C"
                     /db_xref="GeneID:16993200"
     mRNA            complement(<370063..>371988)
                     /locus_tag="CYME_CMG147C"
                     /product="probable long-chain acyl-CoA synthetase"
                     /transcript_id="XM_005535882.1"
                     /db_xref="GeneID:16993200"
     CDS             complement(370063..371988)
                     /locus_tag="CYME_CMG147C"
                     /codon_start=1
                     /product="probable long-chain acyl-CoA synthetase"
                     /protein_id="XP_005535939.1"
                     /db_xref="GeneID:16993200"
                     /translation="MSTANNLSSTLPEAFQHTAERHGSRTALVQYRPNACHYTYAEYY
                     EACVDVARALVALGVEPGATVAIFGSNSPKYLIAYWGALLAGVLPYGIYPTSSEASCR
                     QLLELGRCVVAFGEDGDCGMRLVAAAAAAAAAAFPDLKLKHLVLWPSTATSPDDDTVS
                     QTKTFASMDTRVMSWHTFLNAGCSLDDGNIVLMHRHRAQNADQAALIVFTSGTSGTPK
                     AVALSHRNVLFVIESARRLVQFDETWRGVSYLPLSHVAATMLDIIGPAIVGFSLHFAD
                     PDVLQPGSRSLVRTLRAVRPDFFVGVPRVWERIAEQLQEVAASQPAPIRHVSTWAKRV
                     MFSDIQRWEYPQADWCPSWSAWLADRLVLWPIRRALGLDRARILISSAAPLGPETLDY
                     FSSLGMRICDLYGMTECTGPIAINLPRAYRRGSSGRPLPGTCVRVDAETSELQVQGSH
                     VFKAYFNDPASTAVAFTSDGFFRTGDLATIDRDGFIWITGRLKELIVTAGGENIAPAP
                     LERALESAMPAVARAMVIGDRRKFLSCLLSLQTAPDGETLIGEAAAVDDATRTAADAS
                     AEAAVLGTPWNRYVEQGLAKANRQAVSRAAQVRKAWIVPRAFSVEDQTLTPTLKLRRA
                     FIEARYAAQIQRLYAGG"
     gene            <374226..>375713
                     /locus_tag="CYME_CMG148C"
                     /db_xref="GeneID:16993199"
     mRNA            <374226..>375713
                     /locus_tag="CYME_CMG148C"
                     /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
                     /transcript_id="XM_005535883.1"
                     /db_xref="GeneID:16993199"
     CDS             374226..375713
                     /locus_tag="CYME_CMG148C"
                     /codon_start=1
                     /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
                     /protein_id="XP_005535940.1"
                     /db_xref="GeneID:16993199"
                     /translation="MNAKPEQLQARGGALLTPRSSTAPGAFLAASAGVRLLVGGWTTR
                     GGTCRQRSTRRTPARWVCMDQGAAPVGTRKSIQALENALQPTAFHRRVTILGSTGSIG
                     TQTLDIVRSCPDKFSVVALAANGSNVELLAEQTHEFSPELVAIRDTARLETYREALRQ
                     RGVPEPPHIVAGEDGVVECARYGDADVVVTGLVGCAGLLPTVAAIKARKDIALANKET
                     LIAGGPVVVPLVHEYGIHLTPADSEHSALFQCLQGAPDGALRRIILTASGGAFRDWDV
                     SRLAHVTAADALKHPNWNMGPKITCDSATLMNKGLEVIEAHFLFGIDYDAIEIVIHPQ
                     SIIHSAVEFQDTSVLAQLGWPDMRLPLLYALSWPHRLRIETFRPLDLVQVGSLTFRAP
                     DHDKYPCMLLAYAAGRRGGTMPAVLNAANEVAVELFLRNELEFMGIPAVIERTMQRHD
                     TSDWKQTPTLDDLIAADAWARRTAREEAAKRPIYPAGANLETQKT"
     gene            complement(374634..377027)
                     /locus_tag="CYME_CMG149T"
                     /db_xref="GeneID:16993198"
     misc_RNA        complement(374634..377027)
                     /locus_tag="CYME_CMG149T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461282.1"
                     /db_xref="GeneID:16993198"
     gene            376939..378980
                     /locus_tag="CYME_CMG150T"
                     /db_xref="GeneID:16993197"
     misc_RNA        376939..378980
                     /locus_tag="CYME_CMG150T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461283.1"
                     /db_xref="GeneID:16993197"
     gene            complement(<380756..>382279)
                     /locus_tag="CYME_CMG151C"
                     /db_xref="GeneID:16993194"
     mRNA            complement(<380756..>382279)
                     /locus_tag="CYME_CMG151C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535884.1"
                     /db_xref="GeneID:16993194"
     CDS             complement(380756..382279)
                     /locus_tag="CYME_CMG151C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535941.1"
                     /db_xref="GeneID:16993194"
                     /translation="MDSEEKRWRVRVVQDAAQRKVLLRFLGCTEARCPLGPLRWQRDQ
                     RNRVQLETSTVSFEGPLVELDGPWEAGAWRTARLEASAGRKATSGQHVLIFVDAAAQE
                     LQIVPIASTATLRAGSSNTVSSLVPSLALQQNSGETAAADGAQLPDELAVQSQASREA
                     HEARNALIAAFGSKRQKRARALSLARHVTNENVQAAEAAVQGDATDDDAGDSLNQHVT
                     DVVERGPSDHVRKRDAISREAPPPSLREATTESVRLVPPYNSEATTPETAYPLLGGCL
                     PSRFFSAYKSNATELESLGSDMKYAKSLREQFTSSRKTADTETATSLEQPPASAAAEA
                     LPSTTASVGSNPLLQRCTHLYLWILLECYHRWPRQLRVPASREHGLSGDTADVPEPLR
                     WLPSWLGKLLLEIFTQADSTETKRIVEKERMLHHILVLYLHCSGFQDQPVDALAEALR
                     LPPARCATYFKYMGLSVRRVRSAAPNSPSGANRSGLFVSLDRLPLQFPRAVRRQRLP"
     gene            complement(<386553..>387767)
                     /locus_tag="CYME_CMG152C"
                     /db_xref="GeneID:16993193"
     mRNA            complement(<386553..>387767)
                     /locus_tag="CYME_CMG152C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535885.1"
                     /db_xref="GeneID:16993193"
     CDS             complement(386553..387767)
                     /locus_tag="CYME_CMG152C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535942.1"
                     /db_xref="GeneID:16993193"
                     /translation="MPELGDVSASSSFDALLASDDSTASEVESELFAESEGLLDEDTL
                     RQLQEELSLEDLDIESEEIERILEEHEEEEDAISRSASPSGKREHQPVRAGASRYRPA
                     QQTERVIARSTEPADLELSTVDLSFASSLFDSDSFVLTDTTSFPSTASTPTVIETRRL
                     ARKARSGERTHPAEPRQTPSRATPDTMLSDGSISTISPRQPADTPIDHDWPTPGPAAV
                     TTKAGSRRRYSPTCRESSAYGFRAARKQLSANVALQAAAMQSQRLKAELDRLAHELQS
                     SVVNGYGKWHREPTALDTERSHRDWRPREVHETPRLLPRLSAQSSSSILSPDSSDSSP
                     QIDMAETEPSHAPDTWLENRVVDALVRKYLRADMIHHLIKRIDNDPLLQPSYRMNIDV
                     ARVPASLRLVPC"
     gene            <388981..>389877
                     /locus_tag="CYME_CMG153C"
                     /db_xref="GeneID:16993192"
     mRNA            <388981..>389877
                     /locus_tag="CYME_CMG153C"
                     /product="small GTP-binding protein of Rab family"
                     /transcript_id="XM_005535886.1"
                     /db_xref="GeneID:16993192"
     CDS             388981..389877
                     /locus_tag="CYME_CMG153C"
                     /codon_start=1
                     /product="small GTP-binding protein of Rab family"
                     /protein_id="XP_005535943.1"
                     /db_xref="GeneID:16993192"
                     /translation="MSEWNEVVSPRRLVSVSPHGEPMTRAESPLRGSPEARTQQHEEV
                     ALELARGDVPAEPTDAVDEAASTLAAQTLDENEVEQTPSSPPSSSSVSMGFGGEAPYL
                     ARRPRRSSLTLKVGMVGDAGCGKTSLMVRYCEGHFDEDYIMTLGVNFLERSVSLRHTD
                     IVFSVWDLGGQSEFRTMLPLVTSDAAAMLFIFDLTRKTTLISIRDWYQQVRLLNVTAV
                     PILVGNKYDLFISLAADQQASIVRRARKYARAMHAPLVFCSASHCVQVQRVFKLVLVR
                     LFDLQPAFERQTDAARGPLCEW"
     gene            complement(<390866..>391381)
                     /locus_tag="CYME_CMG154C"
                     /db_xref="GeneID:16993191"
     mRNA            complement(<390866..>391381)
                     /locus_tag="CYME_CMG154C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535887.1"
                     /db_xref="GeneID:16993191"
     CDS             complement(390866..391381)
                     /locus_tag="CYME_CMG154C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535944.1"
                     /db_xref="GeneID:16993191"
                     /translation="MDKTGRCEVCSGTRLGASVDCSSKYRCPVCGVRYGSAQCFQEHV
                     PRCSSQYRTLGAQRAPTWKRTKGVAVPERDPAARAESFAKRLALLVNNSSSGQTADSV
                     EDQATLEYLRAQVQQQRETIEFIVEPRVSRTKRMERLSGVLASAGEFACFVKSLLEFV
                     QFRSSFDEHGS"
     gene            <391781..>392803
                     /locus_tag="CYME_CMG155C"
                     /db_xref="GeneID:16993190"
     mRNA            <391781..>392803
                     /locus_tag="CYME_CMG155C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535888.1"
                     /db_xref="GeneID:16993190"
     CDS             391781..392803
                     /locus_tag="CYME_CMG155C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535945.1"
                     /db_xref="GeneID:16993190"
                     /translation="MPPPGPIAALRDRVSSILFDFKDATEVLAEEEAHLGRRSGQALY
                     RALVALEQAQGAFLRTSERTLAYCTAWSGLARALRALAEPLSAGDLVPLAFRVEHEER
                     VVAQLQTGGACGATAESIERTANRLRNRLRSLRGELDTVVVQESLSSRKAQYRRARDN
                     YRKQQDEAALEVWREASLELQTAAVRAVQRFSDAVDEVVSMVARSTYHIGRMLSEEWR
                     EAAAAVVGLDEVFAEEASEAADAAFAPVSAVRHVEDTTNADAPVEAPKAPGQSSATAA
                     DERLSASAPVSASVLPRSSTGPTGDEPDTGAAFTLYDELDATFDAYSKEEPQEPASSS
                     SSSPQQ"
     gene            complement(<393873..>395534)
                     /locus_tag="CYME_CMG156C"
                     /db_xref="GeneID:16993189"
     mRNA            complement(<393873..>395534)
                     /locus_tag="CYME_CMG156C"
                     /product="probable nicotinate phosphoribosyltransferase"
                     /transcript_id="XM_005535889.1"
                     /db_xref="GeneID:16993189"
     CDS             complement(393873..395534)
                     /locus_tag="CYME_CMG156C"
                     /codon_start=1
                     /product="probable nicotinate phosphoribosyltransferase"
                     /protein_id="XP_005535946.1"
                     /db_xref="GeneID:16993189"
                     /translation="MEPFPRNNFVTPLLTDLYEITMAYAYFREGRHLLPATFDLFFRK
                     NPFQGEYTVFAGLTEVLHFVQEQFRFTAEHCAFIRQHEVFAEAEQLEAFLAFLQSDEC
                     SGQVVQLRALPEGSVCFPLEPLVRVDGPLAVCQLLETTLLTLVNFPSLVATNAARHRV
                     AVGDRVQLVEFGLRRAQGPDGGMTASRYAYLGGFDATSNVMAAFTYGIPCRGTHAHAF
                     VQSFVRPAQAPPVDAGASTERSALALLAYRYRDEIVDPALRQSFQLSAKAANESELEA
                     FIAYAAAFPRAFLALVDTYDSLGSGVPNFLAVALALEHQGYKPLGIRIDSGDLAYISS
                     QARRIFDVVKPGNKYIIFASSDIHEDTLYALKEQGHAIDAFGVGTHLVTCQKQPALGC
                     VFKLVQVDQTPCIKVSEDPNKTTIPGRKRVYRLYGRDPSVSMIDLMMLDSEPEPQPGE
                     RILCCHPYEEHKRCYMTPSRVEEILHLRLINGTVMPEDALASTASDRDRLQLARRRCR
                     EQVQALRYDYKRPLNPTPYKVSVSAALFKLVHQLWLSELTIRELS"
     gene            complement(<397946..>398377)
                     /locus_tag="CYME_CMG157C"
                     /db_xref="GeneID:16993188"
     mRNA            complement(<397946..>398377)
                     /locus_tag="CYME_CMG157C"
                     /product="60S ribosomal protein L26"
                     /transcript_id="XM_005535890.1"
                     /db_xref="GeneID:16993188"
     CDS             complement(397946..398377)
                     /locus_tag="CYME_CMG157C"
                     /codon_start=1
                     /product="60S ribosomal protein L26"
                     /protein_id="XP_005535947.1"
                     /db_xref="GeneID:16993188"
                     /translation="MKFSKEVSSSRRKQRKAHFTAPSHERRIRMSAPLSSELVEKYGV
                     HAVPIRVGDEVRIMRGLYKMQEGKVKRCHRKKYRIAVEGVAREDSRGLPVDIGIHPSK
                     VQIIALRLDKDRIALLKRKERASLMNARVTPSRSAVMADVD"
     gene            398718..402412
                     /locus_tag="CYME_CMG158T"
                     /db_xref="GeneID:16993187"
     misc_RNA        398718..402412
                     /locus_tag="CYME_CMG158T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461284.1"
                     /db_xref="GeneID:16993187"
     gene            complement(<399786..>401882)
                     /locus_tag="CYME_CMG159C"
                     /db_xref="GeneID:16993186"
     mRNA            complement(<399786..>401882)
                     /locus_tag="CYME_CMG159C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535891.1"
                     /db_xref="GeneID:16993186"
     CDS             complement(399786..401882)
                     /locus_tag="CYME_CMG159C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535948.1"
                     /db_xref="GeneID:16993186"
                     /translation="MSGSNSGDLRQAPAFVFPIDEDKRPLAGATQPAENPGHQLARLV
                     PAGVASTSTAVRSARETDALLPSASVAVHSPAESCVTDTPMATGTLSESVTDPQSAAV
                     SWTTARVPESRSQQLETAQYHSSKQDEAEVPKLVRPGGRSAGAFSPPSALSGTPTSPP
                     SVERRSSSRELSWQLASSTGCTLMHAEGTSSGTSGTTAMETTSTHLDMRQQRDETVLS
                     ALRQRKFHFTFRPVGGSYGESVLERLENFRVLFGLLKPNEKLPLTLEGAALARRLLAS
                     SPAPRGGPACLGELTAIVTSPDGASVFFGHNWNQSKPPSLSPVFRQEVADADAAATMT
                     TVASASQQKAAKLPDSGLTSPGAAAPVTDEPGECLHRRWRSDSDDAAACITAAAAAVA
                     QREISRATIERKVREHYRYPPSHSVRNVIRRHRTIFEAACFCSAFLQAVQSNVIELLD
                     DVVCNRANIPEEFHDRIVRRPLSHQIAEQQSVLVAKRPDLWDRVEPHLRWAPTRESLR
                     RRAPSTSQHAQAHYLEEAPRDMPARPAFHWHRQAPSQLDVPASVSEQRGGEMFSGTCV
                     AGAAESSDHCALPEASRWSHQRRAAHRSAEQAELDALFGPLQDVRPFEMPAAPIEIGD
                     SPHLIIQKTRTFRTASWRGETSRVGNPLGIASAETNTEADPSTSPGTRTLATVAVTVS
                     STSVSTASSVSSAPER"
     gene            402421..404033
                     /locus_tag="CYME_CMG160T"
                     /db_xref="GeneID:16993185"
     misc_RNA        402421..404033
                     /locus_tag="CYME_CMG160T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461285.1"
                     /db_xref="GeneID:16993185"
     gene            complement(<403442..>405748)
                     /locus_tag="CYME_CMG161C"
                     /db_xref="GeneID:16993184"
     mRNA            complement(<403442..>405748)
                     /locus_tag="CYME_CMG161C"
                     /product="unknown kinase with aarF domain"
                     /transcript_id="XM_005535892.1"
                     /db_xref="GeneID:16993184"
     CDS             complement(403442..405748)
                     /locus_tag="CYME_CMG161C"
                     /codon_start=1
                     /product="unknown kinase with aarF domain"
                     /protein_id="XP_005535949.1"
                     /db_xref="GeneID:16993184"
                     /translation="MRNQNRSNERGPMFIRALPSMLFVGAQQAFTLTAGKRTLRPTRH
                     ELPAPAATWCTRPVAVQGKAARRTRVSRAMNTLASRAVLSPPPDNTEALAAVQTRQVL
                     DADRGLPLTYDEDAIAAYWSRRPTEVARRLSEISSLLIPFLVSTATSRMSTASGAAKA
                     DLEVARAARLREILTELGPTFIKIGQWLAVRPDLVGPVTMRELQKLHDAVPPFPTAVA
                     RRMIEEELGCSVDDVFATLTPEPVAAASLGQVYRGTLARDPQKKVAVKVQRPDMLQRV
                     SLDLFCIRRLAGSAQSIQNLFTANRTDFIALFTQWARGMYLELDYVNEGRNAERFERL
                     LLGCLQQRGSDPEARITADQVKIPKVYFEYTSRRVLTTEWIDGTKLADAPPERIRALV
                     NVGVECFLTQLLETGFFHADPHPGNLLATADGRLVILDFGLMAEIERPQMDRMVASII
                     HLANRDFEAVVDDFIALDFLPDTEKVRENRSRIVGVMGNILNQALEGGGARAIDFRSL
                     SSDLAAVTFEFPFSIPPYFALIIRALGVLEGIALKADPNFKMIMEALPFVSRRVMTAA
                     SANNQTLRKALREILYANGSRLRIARLRTLISSSQGLLIDGKAFVDFDAPPKQMDAAA
                     MRAALRFVLASDGGKVLRELLVDEIVDGVELLLDPRRRGRRAPHDIAKLETLRELVQF
                     LGELTPTLLTAGIQKQSDSYWSRGSTQRALPMVSLVPRLLPLVPWLPAPDALEWLLEL
                     APPASDLFRQVLGRLTERAVQQGFRRVR"
     gene            <407498..>408043
                     /locus_tag="CYME_CMG162C"
                     /db_xref="GeneID:16993183"
     mRNA            <407498..>408043
                     /locus_tag="CYME_CMG162C"
                     /product="Rieske iron-sulfur cluster containing protein"
                     /transcript_id="XM_005535893.1"
                     /db_xref="GeneID:16993183"
     CDS             407498..408043
                     /locus_tag="CYME_CMG162C"
                     /codon_start=1
                     /product="Rieske iron-sulfur cluster containing protein"
                     /protein_id="XP_005535950.1"
                     /db_xref="GeneID:16993183"
                     /translation="MFVTTPLSLKNSKVSTRSSCCVQRARRSTGVAKLAMKEAWVRLV
                     PTSDLQPGELRTVTVASQLVLVAVDQDGSVFATQGYCSHLAVPLDTGSIGDGVLTCSQ
                     HRSSFDLKTGEVISWCTFPPILGPLLGKLQPPTPISVYPVRENAGYIEAYLQVDAKDE
                     FEKQYWKGILDAQGKATGGYY"
     gene            complement(<408515..>410074)
                     /locus_tag="CYME_CMG164C"
                     /db_xref="GeneID:16993180"
     mRNA            complement(<408515..>410074)
                     /locus_tag="CYME_CMG164C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535894.1"
                     /db_xref="GeneID:16993180"
     CDS             complement(408515..410074)
                     /locus_tag="CYME_CMG164C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535951.1"
                     /db_xref="GeneID:16993180"
                     /translation="MRLAKTCCRFYMSTAAASLYRSWQRQLRRICSRVQLKAQELERE
                     YDSEFQRSATTATTKSASAPKQASVGARQRGLRMSSPLAVGAGTCESDLEATAPTAPD
                     ATRKAAAPSGAREHHVRDANGRLCGFRNPWTSEADPPPLKDIWRVRSVWNKETSRVTQ
                     EQRQALQAAARTPDWSLVGNVEPQQAAIAATWIGHASFILQFPGRSDTDEATQPTNCA
                     GRRYDLPNGITTVYLDPIFSERASPVSFLGPKRLVRAAPLQECPLPDVVCISHNHYDH
                     CDIGTIRALVASARAQRRTISWLVPLGVESLLRDKNPLWGGQVPASHQIYELDWYEQR
                     RLGRLEVTFVPAQHATGRTLWDRNQTLWGGWVLRDIETDFRCYFAGDTAYRVIREDDP
                     SYPYPTEKEREQLAVQHPQRAPCPVFREIGDKWGPFDFAMIPIGAYSPRWFMSRFHVD
                     PVDSVAIHRDVRARSSVAMHHSTFVLTDEGLGDPERRLAQALTAAGLSSDDFLVWRHG
                     ETRLVYRKTTV"
     misc_feature    408664..408757
                     /note="possible transcribed region"
     gene            <416038..>419259
                     /locus_tag="CYME_CMG165C"
                     /db_xref="GeneID:16993178"
     mRNA            <416038..>419259
                     /locus_tag="CYME_CMG165C"
                     /product="probable tRNA
                     (cytosine(34)-C(5))-methyltransferase"
                     /transcript_id="XM_005535895.1"
                     /db_xref="GeneID:16993178"
     CDS             416038..419259
                     /locus_tag="CYME_CMG165C"
                     /codon_start=1
                     /product="probable tRNA
                     (cytosine(34)-C(5))-methyltransferase"
                     /protein_id="XP_005535952.1"
                     /db_xref="GeneID:16993178"
                     /translation="MALGFVNSPSLMQSTVRLHRRARRRVGSFANRQNVAAATSPSGN
                     GDAMQPQTASAPSEQPSRDRHPQRRPTAGKADLRGQPLTSPAMLSFYGRQESLFRDDS
                     DREALFQCLTQPLPTCFRIVAGNPFSKLIQQRLDQKLSLITSDAGLAAAREPGLVPGS
                     TESTSTMTTTTERTRCEAPFPLPWYPDRLAWQVNLPRALLRRDPALQWLHEFLVKEHE
                     FGSIHRQEAVSMIPPLVLGIEPGQRILDLCAAPGSKTAQILDMLASERSVPFEVANNT
                     LLVANDVDRKRCWMLVHQLQRYALAGVIVTNFDASSYPTRGLPFRFDRVLCDVPCTGD
                     GTLRKAPDLWLRWNPHQARSLHRLQTRIAIRGIEALVTDGRGRMVYSTCSLNPIENEA
                     VVAAVLRHFGSDHVELLDAAGMIPAIYRRPGLSSWDPGFDVVDETSSSAAFSPPSAAE
                     RSWMHLSRCIRIMPHDQNTGGFFVAVFHRKKLPEQHLNEQTQAHAAAEGSALHTLDSK
                     AGSAGEGSPQPQSASRLETSAGYGGALRQPCRPAASQGVLARARPPAEAQGCPFLTDG
                     SRDAHDEDHLGAKARKSPHPRSRSGAAEPQSPGTGDALVSALCPGRCPEASAPVPGAG
                     QQCGNESFLNSSWRSTQHAGEPEPVHTSNASPAHVPLPMLDRDRMPSTAISAAAGVVQ
                     ADLMGFSNAAGFNEVGAEQQRKQERCSPEKNRSDDNSNKCTTTGFADLWSVSETSAPI
                     KRGGRRVAHSEPSNVPGSAKVHAADDAAAVTFEMPTAEKRAADDGTQSGSDEDHATAV
                     VTASPAASSETTPVGTPSESSLCSHPGPYAHRMRGPRDPPLIPVRHVPFGAIVVQRIA
                     SSYGIPVEILEAHLYCRVYLDQCSASPSKRLRVYWLPEAVRSVLASHEHRPERILFAG
                     IRAFEAMELRQAPQGAADGNADLWFRIAHEAIPTLLPYLPEAKVATLTQSDLRNMIKE
                     ILQGRLGLRIAMLAESPTRRTLEEYPLGPMILRGALVAAVTGSSPVDIPLLLSSWKTS
                     PQFISLFLSREELEAIRRAMPFLVEDGTTDSSAKDPAQALACE"
     gene            complement(<420427..>421584)
                     /locus_tag="CYME_CMG166C"
                     /db_xref="GeneID:16993176"
     mRNA            complement(<420427..>421584)
                     /locus_tag="CYME_CMG166C"
                     /product="fructokinase"
                     /transcript_id="XM_005535896.1"
                     /db_xref="GeneID:16993176"
     CDS             complement(420427..421584)
                     /locus_tag="CYME_CMG166C"
                     /codon_start=1
                     /product="fructokinase"
                     /protein_id="XP_005535953.1"
                     /db_xref="GeneID:16993176"
                     /translation="MTSRQTTTPTWLVWAAAPALFSTVTALGWGLARWRQRRALSLGE
                     EDERSTTVPAVQSLRNQHLVFAAIELGGTSARAAIAVGRPDQFIERFQVPTSTPRETL
                     TLLTAWLAERHETHPITALGVATFGPILLPSVASSAASHQVRFGKTPKKAWQGLALLE
                     ELQQLWERDEQRPASQELAKAIGTRIPVLVDTDVNAPALAELAARRSPTDPGGPLVLA
                     YVTVGTGVGVGVAIQDEPLHGRLHPEAGHIRVVRYPADSYSGSCIWHQDCLEGLCCAG
                     ALAERAKVDASQLADLADDHPVWKLAAHYLAQLCWNLSCVLAPHWIVLGGGVMQRKSL
                     LKKIQSKFVELDRDYLGIETPVEKYIVSSAYGPHAGLVGACTLAERAWQMR"
     gene            <422073..>424022
                     /locus_tag="CYME_CMG167C"
                     /db_xref="GeneID:16993175"
     mRNA            <422073..>424022
                     /locus_tag="CYME_CMG167C"
                     /product="cell cycle controlling protein kinase RIO"
                     /transcript_id="XM_005535897.1"
                     /db_xref="GeneID:16993175"
     CDS             422073..424022
                     /locus_tag="CYME_CMG167C"
                     /codon_start=1
                     /product="cell cycle controlling protein kinase RIO"
                     /protein_id="XP_005535954.1"
                     /db_xref="GeneID:16993175"
                     /translation="MSASDTVAQRLDAMSEQIDAETSRKLELQRRTKDRQERATVEQV
                     LDRRTRAYLAKLFRQGALLAVHGCIATGKEANVYFGRSHPPNEPESVVVSAAIKVYKT
                     SILIFRDREKYIAGERRFRYGYGKPRNPRKMVKLWAEKEFRNLSRLCRANIPCPSPFY
                     IRGHVLVMQFIGDEEGTPAPRLQEVRARRRAPSLSAEGASRGEEGVSSAPETMTEAAT
                     TPAESLYEQTVINMRRMYQKARLVHGDLSSFNILLWQGRIYFVDVSQSMEQDHPLALD
                     FLRRDCQNITAFFQAEMGNAEANEGMILLSVRNLFEYIVDVWDDVDDIALLQKYQTRQ
                     EEQRRRRVSRSAQHADDELLSDDSTDALVFQSVRIPRRLDEVDEEQLDRIYYDRLLRL
                     ASSSSSSSYSSSASDSYTGASSALSAEVARSDDKSDHEVSSTASLRHAITVLDGDGDV
                     STNDGSIEGDAAPAVFDRQCRRSTSRQSGNSSASTEAASIRQVSAQAMASDTRSPLRY
                     PEHLDAVSSARSASGHEPGTPSTPQHPCKVPYSAAPAGSEQRVVPVAAPHNHSATEDS
                     DTIVRSTSKSAETPEAASVERVHLRCARKAWKKQVKEQNRIRRQNKIPKHVKRQAVHR
                     PGRLRRYLAARETAARTQQASSGEC"
     gene            complement(<426656..>428389)
                     /locus_tag="CYME_CMG168C"
                     /db_xref="GeneID:16993174"
     mRNA            complement(<426656..>428389)
                     /locus_tag="CYME_CMG168C"
                     /product="probable purple acid phosphatase protein"
                     /transcript_id="XM_005535898.1"
                     /db_xref="GeneID:16993174"
     CDS             complement(426656..428389)
                     /locus_tag="CYME_CMG168C"
                     /codon_start=1
                     /product="probable purple acid phosphatase protein"
                     /protein_id="XP_005535955.1"
                     /db_xref="GeneID:16993174"
                     /translation="MQHIHGSGHLLRILPALFLRYTLGFIEVQHDQGSAQRNKSHVND
                     AMLMRHIIAVCVLVSTLVLLCSGALSMPVKLQTLSRTSAYIRPKFSSEALPFHDIRVQ
                     SRHGKVEQVHLSVLRYDRVVIGFLRDINDLPNTELPMQATLRYGTNASHLDHEMVLNA
                     RVYSGMQEYNSYLWNPPMGAPALNRSEVAAFMNTASWAEPWWYVYRNTTVADIPENRS
                     VFAVYNNPTALYQSPLVFQAKLDNLLPQTTYYYDIDGEFSGNFTTLPEPGIQDRPMTI
                     GLWADVGQTNISVMNMEYMLNKVNPDFVMLHGDLSYADAYWPLWDTWQRLMEPLFSTK
                     MHLWCNGNHEFNSGNENNVAYMFRFATPFEESESPTFEYHAFEAGLVHVITLASFARF
                     DKQSVQYRWLMRALERVNRTRTPWLVVQFHVPWYCSVLGTGSRLLMREAMEDLIYKYG
                     VDLILVGHVHVYERTYPVYNNQTNPCGAVQLVLGDAGNREGPSLPFIDPQPSWSAFRE
                     GSFGVGKLVVYNHTHAYFEWNRVACEYSNSSTCATPGDNSAQSHIASDSTWLVRNTTQ
                     CPNRLMPTERL"
     gene            <428789..>429163
                     /locus_tag="CYME_CMG169C"
                     /db_xref="GeneID:16993173"
     mRNA            <428789..>429163
                     /locus_tag="CYME_CMG169C"
                     /product="probable RNA polymerase II subunit I"
                     /transcript_id="XM_005535899.1"
                     /db_xref="GeneID:16993173"
     CDS             428789..429163
                     /locus_tag="CYME_CMG169C"
                     /codon_start=1
                     /product="probable RNA polymerase II subunit I"
                     /protein_id="XP_005535956.1"
                     /db_xref="GeneID:16993173"
                     /translation="MPARFCRNCSNLLYPQEDKEYFLRERRRRLLYVCRTCAYREVVQ
                     NLAEPVHRHVVHHSASEKTTVRLDAPLDPTLPRTHHVTCAKCGHHEAVYFQSPVGRND
                     EALVLVFICVHCKNTWLSSDEQ"
     gene            complement(<430127..>431806)
                     /locus_tag="CYME_CMG170C"
                     /db_xref="GeneID:16993172"
     mRNA            complement(<430127..>431806)
                     /locus_tag="CYME_CMG170C"
                     /product="26S proteasome regulatory subunit RPN7"
                     /transcript_id="XM_005535900.1"
                     /db_xref="GeneID:16993172"
     CDS             complement(430127..431806)
                     /locus_tag="CYME_CMG170C"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN7"
                     /protein_id="XP_005535957.1"
                     /db_xref="GeneID:16993172"
                     /translation="MNEQRSQKAGIDGGQWSNLQLWCEVIDATPDADGHCIIGDDASL
                     DSGILCPKHLRADGHVSLGRSACLGARAASAALREHCSAHLPSFWSLGCIRVVCNRAV
                     HETVGAWRKRRSSGASRPVIAPYRRVVGASRADRRPTRRHASTRSGFSGVELGVRLRL
                     NLLLQTLAHTHTRTVWAALMVTEGETQRDPILDLADLAFAVINGWKHVSELEQAIDTQ
                     LALPFYEKRVRPLLPSARVSEDALRERIASTIKQLQVRVQDAREHEGETEVREALEAR
                     SAFWARIGDIENATRSYEAAFQETVAVGPKLDICFALFRLGLAMEDRRLMRRELARAR
                     DLLAKGSDWERRNRLRVYDALHRMYCEGEWLEASEAFLDGLATFTATELLSFPQFVFY
                     AVVCCLATRERPVLQERVASSPEVLQVIDNYPAVRDCLNAFVSCDYLRIMQTLPSILE
                     QVRKERLLHRYEAFLGREIRLAAYAQYLRAYKSVSLTNMAAAFGVREAFLDAELARFI
                     NADRLSVKIDRITGIIVASRPDSRSGLYQEVLKHGDALLNRLQKLSRIIDV"
     gene            <432052..>434073
                     /locus_tag="CYME_CMG171C"
                     /db_xref="GeneID:16993171"
     mRNA            <432052..>434073
                     /locus_tag="CYME_CMG171C"
                     /product="thiamin biosynthesis protein"
                     /transcript_id="XM_005535901.1"
                     /db_xref="GeneID:16993171"
     CDS             432052..434073
                     /locus_tag="CYME_CMG171C"
                     /codon_start=1
                     /product="thiamin biosynthesis protein"
                     /protein_id="XP_005535958.1"
                     /db_xref="GeneID:16993171"
                     /translation="MRATLAPSLASALQIGFCAGVSATRDVREYHTTMFSATAFLSAS
                     VHTRGSWLGSEKKSTVWWKRANSVAERRRRCSALRLIISPDQRTADRSDQPSSDGSRG
                     VTGSPTVRRRRTKDPFNPDFKAAPRFQEIYPSSEKVYREVVHEPTGERLRVPFRRIYL
                     TNGEHLDVYDTSGPQGYDPHDGLPKLRQRWIERREKRGDPCFTQLYYARKGIITEEML
                     FAAVRENVDPEFVRQEVAAGRAIIPSNKKALELEPMVVGPNFSVKVNANFGNSAVASN
                     IEDEVEKLQWSVLWGADTVMDLSTGEHIPLVRNWILRNSPVPVGTVPIYEALDKVGGV
                     VEDLNWEVFRDTVIEQAEAGVSYFTIHAGVRLAYIPLTARRLTGIVSRGGSIHAKWCI
                     AHRKENFAYEHWDELCEIMRQYDVAFSIGDGLRPGCIHDANDEAQFAELKTQGELTRR
                     AWAFDVQVMNEGPGHVPLHKIPENMEKQKKWCSSEDGSMGPAPFYTLGPLVIDHAAGR
                     DHISSCIGAANIAMHGTALLCYVTPKEHLGLPNADDVKEGLLAYRIAAHAANLAKGLP
                     GAQARDDAISKARFEFRWSDQFNLSLAPLDAKRHHDEALPAEAAKSAPFCSMCSYDFC
                     SMRITQDIRKFAAENGYGTGITTGMDALPIHPHECESFVQAENEHTKSL"
     gene            complement(<436263..>438296)
                     /locus_tag="CYME_CMG172C"
                     /db_xref="GeneID:16993170"
     mRNA            complement(<436263..>438296)
                     /locus_tag="CYME_CMG172C"
                     /product="similar to Glu-tRNAGln amidotransferase subunit
                     A"
                     /transcript_id="XM_005535902.1"
                     /db_xref="GeneID:16993170"
     CDS             complement(436263..438296)
                     /locus_tag="CYME_CMG172C"
                     /codon_start=1
                     /product="similar to Glu-tRNAGln amidotransferase subunit
                     A"
                     /protein_id="XP_005535959.1"
                     /db_xref="GeneID:16993170"
                     /translation="MSLQPRKPKRFTSLHGTTLRVLVLVLELLGNLGSWLAATFTKRL
                     FSFDRLCTTLRSIVELGAAEGSATAVDAAALATSALDERPLPGRHIDGSSATRQPREA
                     LSYARVWALCEAYSASVGKTRVASVQEAAPPTAFEERGIRTGSCLTYHQLYRQRVCTP
                     LQILESTLSAIRKMEQGGMTAWGPSPFSQVFEERARRAANASAQRYAREPQPQPLSVL
                     DGVLVVVKDSVNVAGRVTSSGTRIHTIPPYRDAPRVADADALLIERLEAAGAVVLGKT
                     KMTEFGLDPLGFSEVYAMPPCAFSERHAAGGSSTGSAAAVARVALLHVPVAYGTDGGG
                     SVRIPAAWNGLFGLKPTHAFLLPRRGDPGIACSSVGHGGVLGVSVLDLVAFLVAAVQD
                     TSPNTKSMDHLLVHADESGDGYAPRGSAKHAVAMLLDRLEQWSASLNDAGQIAVGSTR
                     KLRIGIPLSEWQRCSSAAIRRTGLDALHRLADRGWAELVTIPQEHISLQPFASALGAI
                     YLPLDALECLLSTDWSFKPRSELLEYGSRLVLHTVKGITGADMAVARRARAALRVQLA
                     TLFRRNIVDVLALPTTDTLPVAFRPDRKPCKDLRATWQAVTYTFVANIAGLPAGTAPV
                     GLVPSADAQGSEPPVYLPVGIQFIGDAYDDATVVQALALIERSGMVPALPSAP"
     misc_feature    complement(441317..442096)
                     /note="possible transcribed region"
     gene            <441479..>443689
                     /locus_tag="CYME_CMG174C"
                     /db_xref="GeneID:16993168"
     mRNA            <441479..>443689
                     /locus_tag="CYME_CMG174C"
                     /product="similar to glycogenin glucosyltransferase"
                     /transcript_id="XM_005535903.1"
                     /db_xref="GeneID:16993168"
     CDS             441479..443689
                     /locus_tag="CYME_CMG174C"
                     /codon_start=1
                     /product="similar to glycogenin glucosyltransferase"
                     /protein_id="XP_005535960.1"
                     /db_xref="GeneID:16993168"
                     /translation="MTDEHQSGTACQSSARKPPKGGLRRSTRSRIREAPPEDSPALPT
                     PRTPQWQAKAPAETLWSPWRDQIETGLGFETPKNSGKGDRRRGHRREQRTRPAADKRR
                     VRWAASVRGKRPPLLSIAVSVAGWITLVIVAVLLLVRGQKWQQQQVLSLRATTRRYAY
                     ATLLCDDERMLRAVAALVHSLRVRANTSYPILVLTTPNLSTAASQHLEALGATVIRRE
                     PLPYPFALNAARLRDNKPCRYAKLHLWSLTTYEKIVFLDGDTLVLAPIDDLFEKYDAL
                     AAAPDLYPETFNSGVMVLEPRHDVYASMLARYRETPSYNLGDQGFLNSFFGEQWRANP
                     KRFHLPLEYNTLLKLRETILWASLQRRVRVVHFTGETKPWSWHLTNFRDWDRHIDPVF
                     YYEWIQIDRSARNLSLDEPHWARCALEAQTLAMHNGSLGQRFPLRDRYSVVLSTYSRD
                     DLLHKLLRIHYRPGLFPGKPKSRQKEQTSDASALIDKVFIVWHDPQRTPPPDLLRNLP
                     PDRFLLVQQQQDSLNNRFNPLGPALRTRAVLIVDDDIRIHHEDAAFAFRVWQDNPNAL
                     VGFFPRFHRRHPQTGTYEYHIAEPVDHDANASHRQFRRYSIVLTKHMFMRADFLFYYR
                     CLLPDERIHAYVDEHRNCEDIACQCMVTSMGGSAPIAVRAVHPVEDYGTPGVGVAGGI
                     SASRSHLGSRSHCIATFLETFWKGSNALLYNDVIMERFVKIPFEKKRLRDLAKT"
     gene            complement(443600..446543)
                     /locus_tag="CYME_CMG175T"
                     /db_xref="GeneID:16993167"
     misc_RNA        complement(443600..446543)
                     /locus_tag="CYME_CMG175T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461286.1"
                     /db_xref="GeneID:16993167"
     gene            complement(448555..450518)
                     /locus_tag="CYME_CMG176T"
                     /db_xref="GeneID:16993164"
     misc_RNA        complement(448555..450518)
                     /locus_tag="CYME_CMG176T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461287.1"
                     /db_xref="GeneID:16993164"
     gene            <450875..>453286
                     /locus_tag="CYME_CMG177C"
                     /db_xref="GeneID:16993165"
     mRNA            <450875..>453286
                     /locus_tag="CYME_CMG177C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535904.1"
                     /db_xref="GeneID:16993165"
     CDS             450875..453286
                     /locus_tag="CYME_CMG177C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535961.1"
                     /db_xref="GeneID:16993165"
                     /translation="MKEASRSRGCQVRLRIASHLTCTRVYPELQWVQPHVLFSGRQAV
                     SRKAKVVNIAKAWSRAPHRIYAACRRRSVANLVYCCATKGHQEHSEAPPSDDALREYE
                     AVTSTPEHDTNDAVRRELAENRFKAVRERVATLEQKLQHGEAIRRVLLAEQLLKALRN
                     PELYAKLEAVGRRHAAEQETPSSASSDSKATASAAMSSAVAGAAATELEQPTDVDAGR
                     TPSVAASDERIMALARIIQQTQGLLEALSQWKHLPDSVLAKAKEFRKELGQVLLETDL
                     ETVLTTGGSVSSAGTPSSETSSPAARDFFNRAVRALRGRSSGKPAVTDEELESILSAA
                     AQMRRTSALKAEMDRIVTAEAAAAMVEAQRARDEKSAKNTGATYTQASARHAQHLLER
                     CRLKGHELRSWLKHFVSDTWQRLNGVPSPSQGSSEMSETAIAPAPVMPFRQRQALIFK
                     HTLEDLKPLERKLQELSKEREMRLRREGPLGKLIHIRDLRALDDQVNALRRQISVRVL
                     ESEMERIYLYLDAELDASTLFFSRPINDEQEEMLLIAEYGLLARRLAEIQVLVDVGEA
                     VLIEDDELADLASDIQFLKSRLGIGEDDAYMNLGSVVLDWSRIRQYLAEMSQKAKEGG
                     EFYWRGVRLLGGDIMYSLRLIQRAAAGYTLTPREVRTIRRTGRDILTLVPFGILLALP
                     LTPVGHVMVFSFIQRYFPSFFPSTFTDKRQELMRRYESLMQQISSLEKDSATEEAEKV
                     SLLARAAPEETHLASDDDDNDIDAGTSYVDNEIDIDKRSSALGNSAGERLASRRSRGV
                     EFPRK"
     misc_feature    455093..455750
                     /note="possible transcribed region"
     gene            complement(<455840..>457330)
                     /locus_tag="CYME_CMG178C"
                     /db_xref="GeneID:16993166"
     mRNA            complement(<455840..>457330)
                     /locus_tag="CYME_CMG178C"
                     /product="squalene synthase"
                     /transcript_id="XM_005535905.1"
                     /db_xref="GeneID:16993166"
     CDS             complement(455840..457330)
                     /locus_tag="CYME_CMG178C"
                     /codon_start=1
                     /product="squalene synthase"
                     /protein_id="XP_005535962.1"
                     /db_xref="GeneID:16993166"
                     /translation="MGALRTVLCHPDELWALVKYREKSRKAVNVQEEGLRQRVGDAER
                     IADWRFCYEYLRRVSRSFALVIMELDSELRDPVCIFYLILRALDTIEDDTSVDATLRM
                     RLCQELYTHLQGNSYAVHDIGSADERKLLEEFPRVLGCFHELKPAYREIITDITRCMG
                     DGMAQHIHHKACATIADYDLYCHYVAGLVGIGLSAMFAASGYESREVFVESKLADALA
                     NSMGLFLQKTNIIRDYLEDQRDGRTFWPQEIWGRFGKDMELADLARPEHRRVAVECLN
                     AMVTDALRHVPDCLQYMSQVRSESVFYFVAIPQVMAIATLALCYNNADVFVRRVKLRR
                     GQTAKLVLRARDMPAVLTIFTEYCEAIASSVDPCDPSYAETVAAVEHALTVAARIRDE
                     LIYRPMATVYRVPAYRPPLGLKYANRIAVLLFIILSLYVLYRRKQQDGGGLGWRAAFG
                     GIPSLGDLAAIALLFAVLSYLLGVFGLQYVSLAPPNEIKATCTDVN"
     gene            <459289..>465081
                     /locus_tag="CYME_CMG179C"
                     /db_xref="GeneID:16993162"
     mRNA            <459289..>465081
                     /locus_tag="CYME_CMG179C"
                     /product="RNA polymerase III largest subunit"
                     /transcript_id="XM_005535906.1"
                     /db_xref="GeneID:16993162"
     CDS             459289..465081
                     /locus_tag="CYME_CMG179C"
                     /codon_start=1
                     /product="RNA polymerase III largest subunit"
                     /protein_id="XP_005535963.1"
                     /db_xref="GeneID:16993162"
                     /translation="MSVKGAQVDTAHGALDREIFDNGFPSDNGGCRDSDQGIPPHTGA
                     VNAMLRNLSTSVPFDASVYGSYTFVHESWEPCPTAVNAWQRLCEVWRARQELQQIERQ
                     LEQVRRRASSLLPMQKTSSETNQDAMTTNVYRTTYAQIHRLLLEREQARRALSARPVT
                     LRDDTQVLSRSLEAIQFRIPSVDDIRRASVIEMNRKQLYTPEHDIVPHGALDKHLGVS
                     DKNERCATCGLSLADCAGHFGHIELVLPVFHVGYLSFLLQVLQCICKRCSGLLADAQF
                     VEHLRHQQREHRARNTPGYLQSLLKRHLEWAKRSSICRHCGAPNGLVRKVSSPREWLA
                     TASAAATSSSTTCTQRDGSGGIATRAASGLRSNSSMSHTGAPRLVHELMPRAGWSHRQ
                     YLQLELYLAHWYERASFAAGRNLRRCPADQVIAQKAPTAQASSIAGVLMHTADGDKDD
                     LDSDHNEFNALPSALGKPAASGASLSAAVAARRMMHRSRKAHFAFELTPLHVLELLRN
                     IAPADLEALGMDPDTTRPEDMLLRCVAVPPVCIRPSVCNDPSQGSTEDDLTIMLADIA
                     GANALVMEQLVKGSDLGKLLDAWDHLQLAVARYIHADYPGLPASLYYKAQIGLCQRLK
                     GKQGRFRGNLSGKRVDFSARTVISPDPNLSIDQVGVPLRIAKILTYPERVTPWNIDQL
                     RKSVLRGPDRHPGANYVLFPDGSKRFLRFGDREDIARSLCVGCVVERHLRDGDLVLFN
                     RQPSLHRLSIMAHSVKVIAGRTFRFNECVCAPYNADFDGDEMNLHVPQTEEARAEARA
                     LLAVPQNLLSPRNGEPLIACTQDFITALYLLTHKDVFYGRWAAVQCLSFGLEPEASAA
                     ILGRLPEPAILHPLPLWTGKQLFSALVQADPALSDEAVRVLICFDATEKAYTHEGIWC
                     RADAYVCVRSAELISGQVAKRTLGSQSKQSLLYVLQREAGPLLAVRCMNRLARFASRW
                     LSEYGFSFGIDDVRPSPALEHAKAVRIRNAYTQVQDAIERYRAGVMRPRPGYTDEETL
                     EWHIHRLLSDLREHAGQVCLQEMAPHNTAMIMAMSGAKGSTINISQMVACVGQQTVNG
                     TRVRAGFHQRTLPHFMRGDKSPEAGGFVANSFYSGMNAIEFFFHSMAGREGLVDTAVK
                     TAETGYMQRRFMKALEDLRVAYDDTVRTSDASLVQLRFGGDGLDPLEMEASDGQAIDW
                     ERLWTTVQWLDAHSDPLVERALGGRFLADSVPSAVAVAMPDTGSAQALPGASHRYQQQ
                     QQQQQRLQQQRRSWTLASPRMQPEPERMVDDLQRPLLEALEAADPSTAAFEQQQQQVP
                     LSWPGRVRQGVLALATRHSPLTPRQWQLLMTLTERKLRRALIEPGTAVGAIAAQSIGE
                     PSTQMTLKTFHFAGVASMNITQGVPRIKELVNATRRIATPLVTAYLETTAPGQQEPRA
                     LAYNLQRRLECRRLKQVIRYGEVRWNASGVYLDYVLDERFVAEYGLHAIDAKASATLE
                     ASGAKALPNMTGISQVESLCRRLRAQLPWPALSEEEDTCNDPRRDESTGNVRVVYANG
                     SSDGSDDDVVHLQFWPPSALARSRPTRRRMGSASAAAAVAATAAATTETNVADWEPAL
                     AQLQRLVPELVVSGLASIARVVWSQALSPASDSAGKSGEAAAAAAAASAATESIQLLA
                     ETEDMRSVMNTQGIDASSVYCNHVLVVEQVLGIEAARSTIVKEVLETMAAHGVTLDAR
                     HVDLLSDMMTQSGQVLGITRFGISKMRQSTLMLASFEKTVDHLFEAAVRSRSDRIRGV
                     SERVIMGKPVPLGTGMVSVGYVECPERVALAPQRDATCSGSEEAVSSSLEGTSRSRSR
                     PEAIQSADDEAPRDVDRPATERGVDRITNGTTTAVAAAAAGGDADETFAAMPFPNQKR
                     LAWHLLRPPEAATWSRNCNRREKATIVHEQ"
     gene            complement(<466651..>471207)
                     /locus_tag="CYME_CMG180C"
                     /db_xref="GeneID:16993159"
     mRNA            complement(<466651..>471207)
                     /locus_tag="CYME_CMG180C"
                     /product="similar to key negative regulator of the Notch
                     pathway SEL1L"
                     /transcript_id="XM_005535907.1"
                     /db_xref="GeneID:16993159"
     CDS             complement(466651..471207)
                     /locus_tag="CYME_CMG180C"
                     /codon_start=1
                     /product="similar to key negative regulator of the Notch
                     pathway SEL1L"
                     /protein_id="XP_005535964.1"
                     /db_xref="GeneID:16993159"
                     /translation="METLFSSCKLWKRWRLFIHRKFWLGVILWVVLCNLGAAQAHQRE
                     MREESVTKSPSIPQTSASPTIQGRGSLIRPSVVQSAAWQTHWRSSDSSAATDTSNVNA
                     SRGSDSNLFMQRRTFGVSAASWTTWKPTLSSLASTEAITTGSVEHAKHLESSSWPKRT
                     RDEAPQANAVVHGARNAPAADSEKQQAQPSVSLVAIQLPADSTAADTIDSTVSGTVHP
                     TAGDETESSSVVVAATQVSAMDPFPKDVAQERSRSEQLLGSAPGASWSYDPESKPKAS
                     LEAAGLESPRAIDNSDSPESTVDAGSPMEIRSSLSESFRITDTQQAVNTTYGVSERNR
                     TPNTATDSKQGPDATLWTQQERLGEGYKQQQQQEQQQQQQQQQHMEQHQHQQMPLPLD
                     QRLPDPKPSILPPEDALLHMLGWPLDASILEEPTPEPVESAAPAPETDAHPAGVAWQA
                     IQVIHQVLRLEEELRQLIPAPQTASALEGWWPELRERATSEVLRLTTRLQLHRVQVES
                     LRITDRIAALTDEQPLREVQDLRERLQLFGKELNASFAAMMTLLDKGEQHPLALSLPQ
                     GRKPTAFQQLRQQLTRWHLDLYAEQMLLVSKLSATDTIAGERPRAPSRSRANVKDERA
                     APELLSGVQGSASAASEASQDVHGAEEPQEASSLKRFSMPTVQPEAQQRPVPSWISEV
                     EALWRTQANVTAIVALLETTAATAESPDCFLASSVLARLYWSGDSVYGLKPNRTRATY
                     HLERAVASGQADAHDLVATLLLWSSTTTAEHGSIPLGYAAAWRSAQSSVPHAGSKTPS
                     SSSSSSSSTSTGERDRVAALLHWHRAANDGHPRAQLALAFRYLYGIGGLPENCEQAVR
                     FYRLAAAYLGQVDDDHHENDDGILRPTSSSRERASKNPMHPLADGQLDFTGTFSERGW
                     FASQRLPLESFRLSLQDAQRIRRFAKRAPALWQRTAAATLAHEPAAAGLGSASWQPLD
                     RPRRWLPDWLASLQQIAAARRNTPPELLETKPRFALETSMTLLPQVHADERELIQYYR
                     HAADRGDVRAQVALGHVLLTGMAGHAPDYGRALQYLTRAAQTGDPHAHVLLASMYLHG
                     LGVAPSNESALWHYRVAAARGEPSALNALGQLHRWGIAVERDEHEAARLFRAAAAHGY
                     SEAKYNLGLLYLSGAGVDRRDERQALVCMVEAARAGHRRAIWKAAALMQAGIAPSACV
                     DIALSFRRVAEEAPLVRRSLERAQYLLELSGLVTTARLSRTRPRMLSRAVKAALVDEA
                     LWNVVQAAWAGVEVAQYNAAILLDAWMQDEQRALSFWLLASLNGQRQAMVAAGDLLYR
                     WQEQQAASGDKSQVWFNEEVAAPSDPISAWMFYRQAAELGTAEALFNLGYLHLRGRGG
                     APRDLHLAERYLETARVVDAKEAWLASTLVLAWLQLERWQESVRWWRWRWLLSPWQRL
                     LRYLQYVAVPSRRPAWARLSVVSGHRGELRGSLLVLLFIAIAAKWYLRRRRRRRRLAR
                     DPYPAQARNPLIRPMHTMQHMHQE"
     gene            472541..474368
                     /locus_tag="CYME_CMG181T"
                     /db_xref="GeneID:16993158"
     misc_RNA        472541..474368
                     /locus_tag="CYME_CMG181T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461288.1"
                     /db_xref="GeneID:16993158"
     gene            <475043..>476347
                     /locus_tag="CYME_CMG182C"
                     /db_xref="GeneID:16993157"
     mRNA            <475043..>476347
                     /locus_tag="CYME_CMG182C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535908.1"
                     /db_xref="GeneID:16993157"
     CDS             475043..476347
                     /locus_tag="CYME_CMG182C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535965.1"
                     /db_xref="GeneID:16993157"
                     /translation="MTADVWLQTLVGDELLLRNWCERDRNTTGELIARVLSEYGLVWE
                     PNGADADVLRVEQEYFGAGGEFFVLEHKPTAQIVGSVGWYPLPPETNAPLRAELRKMY
                     LERSFRGRGLGRLLLAFAEARIRQTSCAPWQVILESASVLERACALYRRSGYTDLAAA
                     TNQTKRCDVVLTKWIAPLAPLCGGPASHSHAPRHEADNQNCLACGEHVDTWTHSCSAV
                     HFAIASCATATFGSIVAWLPLSLRAPVPTLWRVTLWLVQKQNADVSSAQYMWMRASNS
                     ASSRASPNLSWHFLYCTPWYTMMDGNGAHGACACDWACACCACGGRCCSPLPPSLRCG
                     ANPQLAFRQVLVPGPASAQVLLLPGPQHQSLVADLCLLRLRDVKQQRFSDDEAMAAAE
                     YLWCRWDELAQRIAECDPPMRAFLQQVWRILDTVRCSFEPVR"
     gene            478983..480538
                     /locus_tag="CYME_CMG183T"
                     /db_xref="GeneID:16993156"
     misc_RNA        478983..480538
                     /locus_tag="CYME_CMG183T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461289.1"
                     /db_xref="GeneID:16993156"
     gene            <481595..>482548
                     /locus_tag="CYME_CMG184C"
                     /db_xref="GeneID:16993154"
     mRNA            <481595..>482548
                     /locus_tag="CYME_CMG184C"
                     /product="similar to U3 snoRNP component Utp6p"
                     /transcript_id="XM_005535909.1"
                     /db_xref="GeneID:16993154"
     CDS             481595..482548
                     /locus_tag="CYME_CMG184C"
                     /codon_start=1
                     /product="similar to U3 snoRNP component Utp6p"
                     /protein_id="XP_005535966.1"
                     /db_xref="GeneID:16993154"
                     /translation="MAALSVERNLEQVLHQTREQVDAGVWTLEEAAQLLQRRRAWECS
                     LARLKTGKTAVEQLRDTFKSYITYEIAVLELIRHRFGRLKRSREPQRPAAGATGLRRP
                     RAQQFKVLGKMRQRVFQLYERAISCRSLRTDESLWLAYMRFAARTGEVRKLRPILVRA
                     MHQVGPYSARIFAVAAALEADVCGSISTARAVYLRGLRHHDQNAELWAQYVIFEVTMA
                     LKRIGREAVLHDVKRQMPDAAVWQVPRTVRCYALTTLTLAELRQQFHDCLESMLKQVG
                     GIWQEDPAFLAHAIGVDRARPAPATLEAGLGVSDPAMLSAS"
     gene            complement(<483908..>484639)
                     /locus_tag="CYME_CMG185C"
                     /db_xref="GeneID:16993155"
     mRNA            complement(<483908..>484639)
                     /locus_tag="CYME_CMG185C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535910.1"
                     /db_xref="GeneID:16993155"
     CDS             complement(483908..484639)
                     /locus_tag="CYME_CMG185C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535967.1"
                     /db_xref="GeneID:16993155"
                     /translation="MSQRNIETAGSSPNMNGPVNDPNSWIEIFHSMPSLENVYIIFSK
                     DGGKWTPNRTYRFEDASHIREGFRVFRVSGCKRLEFAITDGKRYWDNNGGQNYVITEP
                     GRYVVSIRGLQRRGDVDMDEIRRQQTKATDQYIEILYRAPADWSQVYIMYAKQLNAKA
                     DWTSAPGELMLRNPEEQNLYFIRLLAKELEFVLNNGGEEYDNCKGKNFKCHTPGRYLV
                     QHEDCKYLGRSERDLLRQEMAARKA"
     gene            <485782..>486567
                     /locus_tag="CYME_CMG186C"
                     /db_xref="GeneID:16993153"
     mRNA            <485782..>486567
                     /locus_tag="CYME_CMG186C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535911.1"
                     /db_xref="GeneID:16993153"
     CDS             485782..486567
                     /locus_tag="CYME_CMG186C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535968.1"
                     /db_xref="GeneID:16993153"
                     /translation="MNAATPRGGGVRFEPFVAAYNNSTPEAVLALAPTPVRAQLQNRS
                     ETPSGARLRSSSGGAGADSVPDALSNAVETVDLLRDLVAVFRSEEDVQIMEALASLEQ
                     QIDDTVLERQQRAKESLVQLARQVDAARQRATPPEPEHLHQQRVEERERVKRLIIERM
                     LTAEERSKALQANLRELDAESSEVQQALDRYRQRIQTDIPSLKHALSLYVTISRIRWN
                     YRCDQTYIEGYVAQERENDVRPFRFQHGDAVATADRLWALIEP"
     gene            complement(<487000..>487680)
                     /locus_tag="CYME_CMG187C"
                     /db_xref="GeneID:16993152"
     mRNA            complement(<487000..>487680)
                     /locus_tag="CYME_CMG187C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535912.1"
                     /db_xref="GeneID:16993152"
     CDS             complement(487000..487680)
                     /locus_tag="CYME_CMG187C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535969.1"
                     /db_xref="GeneID:16993152"
                     /translation="MFVLGVLALRAQGSPPSSSSDSTPDRPKDDADEPGRRDGHASAG
                     GGEKRRGSARRPRGNPLAAAVAALEARFAASFPDMRDRSAVRPAPFAERTLRRGMSQQ
                     NLEALLRERYLPLTGPSLRQFLRDLYGFEYDIQPVRRNVIGKYALYMQVMWEHTLQAS
                     FRLTQEQYVQHLQAIADILNAYDGAAMYFLRELYRSRRTPVVGMSVSVRLPMIDPAHF
                     DDIFKPGA"
     gene            <488256..>488879
                     /locus_tag="CYME_CMG188C"
                     /db_xref="GeneID:16993151"
     mRNA            <488256..>488879
                     /locus_tag="CYME_CMG188C"
                     /product="20S core proteasome subunit beta 3"
                     /transcript_id="XM_005535913.1"
                     /db_xref="GeneID:16993151"
     CDS             488256..488879
                     /locus_tag="CYME_CMG188C"
                     /codon_start=1
                     /product="20S core proteasome subunit beta 3"
                     /protein_id="XP_005535970.1"
                     /db_xref="GeneID:16993151"
                     /translation="MSQVNPLHYNGGAVFAATGNQCVAIAADRRFGQAQLTLACDANR
                     LFRVHDRLVLGLTGLATDCLTLAERVRMRTNLYRLGEKREPKPATISALVSALLYERR
                     FAPYFVEPVIVGLSGDNKPYCCSMDLLGTPMETDEFVAAGTCAESLYGTGETFWRPGL
                     DPEDLFEVTAQCMLAALDRDCLSGWGAVVYVLHSEGVTVRELKARMD"
     gene            complement(<488876..>492403)
                     /locus_tag="CYME_CMG189C"
                     /db_xref="GeneID:16993150"
     mRNA            complement(<488876..>492403)
                     /locus_tag="CYME_CMG189C"
                     /product="chromosome assembly complex Condensin, core
                     subunit E"
                     /transcript_id="XM_005535914.1"
                     /db_xref="GeneID:16993150"
     CDS             complement(488876..492403)
                     /locus_tag="CYME_CMG189C"
                     /codon_start=1
                     /product="chromosome assembly complex Condensin, core
                     subunit E"
                     /protein_id="XP_005535971.1"
                     /db_xref="GeneID:16993150"
                     /translation="MYLKEIILDGFKSYAHRMVLSGLDPHFNSISGPNGSGKSAILDA
                     ICFVLGMTHLQSLRVNGLHELIYKNGQAGVQRASVTLVFDNTDASSSPVGYEDSPEIT
                     VTRQVALGGRSKYLVNGHVAQPAKVQNLFHSVQLNVNNPHFLIMQGRITKVIQMKPLE
                     LLSMLEEAAGTSMYEAKKTAALRTIEKKQRKVEEINTLLAEEITPSLVKLRDERERFL
                     HWSANNAEIERLRRIVALQAYAQAREHVKQLEQDRAQLVAQIEKHEAEQAQNHEAINA
                     LRAESHGAKRSQHDREARQLQQQEKELAALDRELVKERARRDHLRASLTREQAQQTEM
                     IEAQEHLTKTLEQLTARIETFEPQVEKRRLEARAANDKWQTLSEASAFRSRTELITST
                     RQQLALARTEEETTKIALAGAKSELEKHAKRATAVRALESELAKAEKAVSSVKLQLHE
                     LDYDQHGAEKLRKLRQSEEQAVHSLRDQLDRLSARLAAIDFTYQNPEPAFESSRVKGV
                     VARLVQLVHPEYAVAIEITAGSKLFYVIVDNEQTGKLLLERGQLTRRVTMIPLNRIDD
                     KVLEPERVAAARQAGGNLALSLVRFDEALEPAMRYVFGRTLVCDRLDQAKQMAFSEQI
                     RCRTVTKDGDLVDPQGTMTGGSQSAVASLLIQLAELERLRAELQIRERALARTEEDLQ
                     NLEQKADQHARLSTELAMKQQAVEAIRERMLAEPLIRYKNEVASLEAQLREQGARRVA
                     AERRLAELDSGADVGAQDLAEAKASAEQLQRLWQDEQAQLARLHQQLESSREELDDVQ
                     KRLAQCNETIAQLERDLTEQSNRLEKELEPAYYSQQEALRQRREALSAQAQEHAVRQE
                     RLSALASQDEALSLEIKRLRLQLADLDETLANARQQAVALEAEHPNLSCTAGDVSVVD
                     AEEIRRARQQLARLTAENQSLGKRINRRALSLFEKSEQEYQDLMNKKRIIENDKQKIY
                     AAIRSLDEKKRLALEATWQRVNRDLSAIFSTLLPGADARLDRVPESQSMLDGLVLKVA
                     MGNTWKDSLTELSGGQRSLVALSLVLAMLKFKPAPMYILDEIDAALDLSHTQNVGQVI
                     RQSFRDSQFIIVSLKPALFEHANVVFRTKLVQGSSTVTRTVSASRVSTTTTTSSSSSS
                     GQSELHAGPAAAAMDEAVAATTTTTTASA"
     gene            <494860..>496554
                     /locus_tag="CYME_CMG190C"
                     /db_xref="GeneID:16993149"
     mRNA            <494860..>496554
                     /locus_tag="CYME_CMG190C"
                     /product="unknown zinc finger protein"
                     /transcript_id="XM_005535915.1"
                     /db_xref="GeneID:16993149"
     CDS             494860..496554
                     /locus_tag="CYME_CMG190C"
                     /codon_start=1
                     /product="unknown zinc finger protein"
                     /protein_id="XP_005535972.1"
                     /db_xref="GeneID:16993149"
                     /translation="MRSTAKYAAISYCAIGLILGHAWLTQPNFYRATAYLYNSKTARF
                     SAVNAGLVSLYLVGQLVQRLLLGELRLVEAERLHLRARESLVEMFLAMTVFSRTDFHA
                     RFLCMFAWTFFLKVFHWLSQERLGYVEQQVIMLSRPRLTHARLVVLFCWLFVTDACML
                     WHCLHFTSTNGPSIMAMFAFEYAILLIGLLSQIVRYVVFIIDVFVLTEGTWDDKGLWL
                     FYNELLSLFLQLAAYLAFFTYVHLFYSLPLHILRDLAVTARTFRQRLIEFIRYRQVVR
                     SMHTQFPNATEQELAAGDRTCIICREEMFGGAGAKKLVCGHIFHLRCLRSWMERSMSC
                     PTCRRDIRPLRAPTTSARPTASSGAATHHDDGARRNAPGSLSTRPQRGATAPIEAPAT
                     AARRVDTSAVPASTQQRMRPSTASADREASDPEHLSRNEWNAHSGRPPWTTARLTEMP
                     PPSSSTSTPAPPPPSSPPPPPPPPPQLLAVLEYIAQTAPHADVQCSPLPPTSTPAQPT
                     RTHTTPASYARPRSATIEDARRLQRQLDDLSSVMRNLIERLEHELEDRDAEQIERR"
     gene            complement(<496907..>497362)
                     /locus_tag="CYME_CMG191C"
                     /db_xref="GeneID:16993148"
     mRNA            complement(<496907..>497362)
                     /locus_tag="CYME_CMG191C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535916.1"
                     /db_xref="GeneID:16993148"
     CDS             complement(496907..497362)
                     /locus_tag="CYME_CMG191C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535973.1"
                     /db_xref="GeneID:16993148"
                     /translation="MGWKRLETPSEPLGELVDPPAGFPRTHRVLRAVTMLATVCSAAF
                     AVLFIHPPPQVLADGSQRSRPHVFESFQLWCFRKMESAGFRNPVDLDRARSEPREAAP
                     MSERLEPTGVESSEPQVDTRLAALLLDGRAECTGNTSGGVSGTELRSRT"
     gene            499352..501725
                     /locus_tag="CYME_CMG192T"
                     /db_xref="GeneID:16993147"
     misc_RNA        499352..501725
                     /locus_tag="CYME_CMG192T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461290.1"
                     /db_xref="GeneID:16993147"
     gene            complement(<499723..>502923)
                     /locus_tag="CYME_CMG193C"
                     /db_xref="GeneID:16993146"
     mRNA            complement(<499723..>502923)
                     /locus_tag="CYME_CMG193C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535917.1"
                     /db_xref="GeneID:16993146"
     CDS             complement(499723..502923)
                     /locus_tag="CYME_CMG193C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535974.1"
                     /db_xref="GeneID:16993146"
                     /translation="MTSRKRRSVDASAKAASAPKSAKLARTGSKVGALQPSRRGSRSS
                     SKERFVESSAPGQGQTQPEAAAGEEQAQSRLRRNLRQTSSTRERAKGHSSQGKAASVH
                     MPAAEQHQSADEDSSSSEQLAQRSGKDAMAVLVGLRRSRRSGQASQSAAKRAARASTR
                     ALTERTAEKQTASGSASVSETSIGTDHDAGDDGDDDDDDDDEAFSSESTLNASRAETT
                     GRTSRAAPSANAPGAARSTAPASGPCEGSVAEDENAASIAALSVEERAKQQLELERAL
                     ARVREEAELLVRIAQTLPSFAVEDTGGQPVVSAPVAVNEDAAADAAADTATVPKTQSN
                     EGSISTDEMVRANSCDGTNGLEMAQQQVMELVKQTIGALAAETPKEYADSFALAHMFI
                     ADLVDLERRRYALENRIQRNFELQQAYLHKYAQARFREVEHQYLVAEESLRERLLEAA
                     FQRQRRYRIACQLDRDPMVLFGQPPVMIPPGFAGVPYQLLPARPRGASPAAMGTAANL
                     TPEESLLLLERRPVSLGLEPGEASDDLREVQRAITALRRRAKAGNAHAGRAPGASGNE
                     TATDGQLLTSAGRAPSGPTGRQTGARARASNRQSTGARHSHERSSIAETGTQSSAHRA
                     PAAGTAAIGNGSLSAAGDLGIDWNDQKQRSRLAVGLVQRDQPAHRLGARPGNATRELP
                     PEQPRTGAVGRSATTTVATAASTTPTSGHVAAPKAARGSAGAHDAGTSSDARSTGKRG
                     RPRKRPPLEPTGAGDRGSNAGVPPRPSTNKVRKPPTSARDKRPVHPPPEPENDVSSSS
                     SSTAAPRSNVGTVSSTVHPGFEHNAEQAGRSLASSPAMTRPLKSESAPNESAADKAPD
                     SSVAKSDTSSGRVAGAAAPLQTQHASTREANQFAVEAVAPAPVPDNAPERSASPRTPQ
                     VSEPRVNTGDAGHPGTALSPGTPDIAAAQPSAVTAVPADEKPIPMPEFPVGGDPDAFV
                     SRGTLFYRGMQLHRGDQVAVRVLPKGSTSGAVYVGLASGSPEAQADNQAAQVFHGPLV
                     SLNVKELHVRDAEHRVYVTWLQSGRAELVHLAGHQA"
     gene            <503736..>504587
                     /locus_tag="CYME_CMG194C"
                     /db_xref="GeneID:16993145"
     mRNA            <503736..>504587
                     /locus_tag="CYME_CMG194C"
                     /product="probable phosphoribosylanthranilate isomerase"
                     /transcript_id="XM_005535918.1"
                     /db_xref="GeneID:16993145"
     CDS             503736..504587
                     /locus_tag="CYME_CMG194C"
                     /codon_start=1
                     /product="probable phosphoribosylanthranilate isomerase"
                     /protein_id="XP_005535975.1"
                     /db_xref="GeneID:16993145"
                     /translation="MLGRNQHPLAFAASAVVPGSRAQALKSLKVCGVTSAEDATWILE
                     TIQRRLSVQVWIGCVLWPHSRRCVSVREARDIAAAVRETAAKLGTPARTVAVFVDEDL
                     SRIRQVCTDASINVAQLHGSLDWQEHVLRAVDSWPSWLDYARVLRPDEAAQEPSKRAI
                     TTADGRPPCYTLIDPGRGDGKPFDWRKFSNERVLGPDPGLWMIAGGLHAGNVVEAVRV
                     TNAPGVDVASGVEVSTDGRRKHESGEGSADAYPQHSGRVYRPRKDPARLEAFLDALCS
                     VYGGRMI"
     gene            complement(<506140..>506898)
                     /locus_tag="CYME_CMG195C"
                     /db_xref="GeneID:16993144"
     mRNA            complement(<506140..>506898)
                     /locus_tag="CYME_CMG195C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535919.1"
                     /db_xref="GeneID:16993144"
     CDS             complement(506140..506898)
                     /locus_tag="CYME_CMG195C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535976.1"
                     /db_xref="GeneID:16993144"
                     /translation="MPRFRTQEEYDNAGAVYGLTGCIGTGKSEVVKVIRADWGYPVLD
                     ADVIAREVVAPGTVASLLLRLVFGRNLYRRNEQGNLELDRKRLSEIAFGNPRALNLLN
                     WITHPLVCARILWRVFLLRYVAGVRTPIVLDVPLLYESGLSRLCNVTMVVYASRSQQF
                     ERLRRRHPDWTDADIQQRIQAQMALEQKMLRADERIDNRGTPEELREEVARALERLRL
                     QVSLKARSRQKRLALALGVVFAIILVVAILNPIR"
     gene            <507699..>510212
                     /locus_tag="CYME_CMG196C"
                     /db_xref="GeneID:16993143"
     mRNA            <507699..>510212
                     /locus_tag="CYME_CMG196C"
                     /product="mitochondrial translation elongation factor G1"
                     /transcript_id="XM_005535920.1"
                     /db_xref="GeneID:16993143"
     CDS             507699..510212
                     /locus_tag="CYME_CMG196C"
                     /codon_start=1
                     /product="mitochondrial translation elongation factor G1"
                     /protein_id="XP_005535977.1"
                     /db_xref="GeneID:16993143"
                     /translation="MRTFRAFTLQSRLASAAHWPPRPVPAPADDLLRRCDASLMQRLP
                     SAASTRHLLRFQHSEAVSPATDPEQNDRAVQVALEEAQIAARERGLTGAPVGRRNFGI
                     AAHIDSGKTTLSERILFYSGRIRRIHEVRGKDGVGATMDSMELERERGITIASAATYL
                     NWQRGFHLNLIDTPGHVDFTIEVERAMRVLDGAILVLCGVSGVQSQSLTVDRQMRRYR
                     VPRLAFVNKLDRQGANPERVLEQIVNKLHQPAAFLTIPIGVERDLVGVVDVIRQQAVY
                     FEGEYGEQLRIEDTIPSSLKSKADQARRHLIECLANVDERFGDLFLEHDYGVPEDAIH
                     RAIRRATIARSFTPVYCGSALRNVGVQPLLDAVVNYLPSPVEVRSYAMQGDTEQRIQL
                     EPDANASLVSLAFKLEDGRFGQLTYLRVYQGTLRRGDLIYNARTGKRLRVPRLVRLHA
                     DQMEDIQEATAGDICAMFGLDCASGDTFTDEAGLGRRLSLESIRVPEPVISLAITPQG
                     KTDAQANFSKALARFTKEDPTFRTYLDPESKQTIICGMGELHLEIYIERMRREYGVEC
                     QVGQPKVNYRESVSRRAPFQYLHRKQSGGAGQYAGVQGYIEPTLEAGYWTARPEDSET
                     AESDRQAMSAVNTTSEEGGQAVAAQREATKRAAENEFVNALVGNNIPPQFIPAIERGF
                     QDAVQEGALSGHIVQGVRMVLQDGKSHPVDSNEIAFRTAALMAFRKAFPQAGGVILEP
                     WMRVAVQVPQEYSGDILGSLTKRRGTVVNSQTDGEYALIEADVPLSQMFGYSTDLRSM
                     TQGKGEFTMEYLRHEPCTREDQERLIADYAALRKTKAND"
     gene            complement(<511688..>512320)
                     /locus_tag="CYME_CMG197C"
                     /db_xref="GeneID:16993142"
     mRNA            complement(<511688..>512320)
                     /locus_tag="CYME_CMG197C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535921.1"
                     /db_xref="GeneID:16993142"
     CDS             complement(511688..512320)
                     /locus_tag="CYME_CMG197C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535978.1"
                     /db_xref="GeneID:16993142"
                     /translation="MSCLGSAQSRYRCRLDARHLEHKRGWRCRLRKLWRKRPRRSRSS
                     MTTTCRESRLQPRSDWLRLRRRRARAAELRSKSRRADRAQFSGTGVSARYTERLCTTS
                     ERQRGTTQPQKHAPAQSVGNCAPELVPLPKALSEDHVRSHAEQRSQPGAWARPPPVPW
                     QPWASTGVAWNPVGAAPRHRHTRHRTRTLSLSSPDDLLERTTYIAAPIES"
     gene            <512796..>514079
                     /locus_tag="CYME_CMG198C"
                     /db_xref="GeneID:16993141"
     mRNA            <512796..>514079
                     /locus_tag="CYME_CMG198C"
                     /product="methionyl-tRNA formyltransferase"
                     /transcript_id="XM_005535922.1"
                     /db_xref="GeneID:16993141"
     CDS             512796..514079
                     /locus_tag="CYME_CMG198C"
                     /codon_start=1
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="XP_005535979.1"
                     /db_xref="GeneID:16993141"
                     /translation="MWVSYALVKRSWFAPNRPARFIETVARSRLHKASFKSRARCLCN
                     ASNDVPPRRIVFLGTPPVAELVLARIAEATGQVPRATAEPVNLTSAASPGTQHVPFRV
                     VGVVTQPPAPQRRSGAPQPSPTHRYAVDVMQVPVWTPTRLARDESFLRLWETELRPDL
                     AITAAYGQLLPERFLRVPPLGVLNIHPSLLPLYRGAAPVQRTLLDGLEYSGVSIVRTV
                     LELDAGPILCQERVPIDENIQGPDLLEQLFALGAELLIQRILCRRDVARASTAAEMDE
                     LLGEIRMQDSSQATYAPKLSKCEGELSFTETAYRVHNRVRAVVDWPGAWMELIVRPGS
                     EEAPHAGQRLRIKVLRTRIARRQGGAALGIHRVSFVEDALRVTCDDGSQLDILEVQLP
                     GKRVQTARAFWNGLRGRFLERPRDPYPPLYETPAR"
     gene            <516813..>518660
                     /locus_tag="CYME_CMG199C"
                     /db_xref="GeneID:16993140"
     mRNA            <516813..>518660
                     /locus_tag="CYME_CMG199C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535923.1"
                     /db_xref="GeneID:16993140"
     CDS             516813..518660
                     /locus_tag="CYME_CMG199C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535980.1"
                     /db_xref="GeneID:16993140"
                     /translation="MRTGFLPTVTLGRWQPLPPSRAFAWRRCVNHRLAKFAKHSLLFG
                     GATAEASSSISSSWTQRADTWAMSDVWRRQFPNATASQWHMRFGESVTTSSVEQLLDE
                     LVRKYETQVEAAPGTPADTSPTPAQLIQKVIEFLRGLGLSVEDAGRVIHKRPQILRLS
                     LKSQAAPIIHFLVRDLGLTDAQVRRAVRHAPQIFEQPLDLLRSNARYLSRPTSRRALA
                     LRIADDTVASHATSDPADSVERSVASAAVSSDHGTFTTSANEDDEDGDARKPHQNNDL
                     VAGESTASNDSSSSAMEALSFGRRQLARAVAKCPGILWRSPATMARMVYFFRSEMGCN
                     ARETAHVLSLVPQLLLRSPDELLPQVSWLRRHLRRKAADGNGAIAPNQRDLARLVVQY
                     PTSLLLDPMETMQPRLDYLRDHFGVSDFRRCLLNSPTVLEASIERDLAGFKRVLVDSI
                     GFASDDPALATIATKVPKFFHTRPQLIFEFLTREAGLDPAEARTCLALAPTLVLLSGR
                     RGQSVPSFGTHLFPYLHFCTQVLGRSLVDVLRIAPDFLTMDVERRLIPRYAFAKSRLT
                     SHEWQALKLHDLLCSSTSRFCEHVMHVPVSEYQRYVQSGKWLLFYLQIL"
     gene            complement(<522824..>524722)
                     /locus_tag="CYME_CMG200C"
                     /db_xref="GeneID:16993139"
     mRNA            complement(<522824..>524722)
                     /locus_tag="CYME_CMG200C"
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /transcript_id="XM_005535924.1"
                     /db_xref="GeneID:16993139"
     CDS             complement(522824..524722)
                     /locus_tag="CYME_CMG200C"
                     /codon_start=1
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="XP_005535981.1"
                     /db_xref="GeneID:16993139"
                     /translation="MEFGKVMPAIYQVRNLGARLQLPGALLSATSGKAWKQRRAAPEQ
                     LSKRALQHRTVRTSVADAPTPSAAAVGSVGALNAFGHILGNAQLPPIENETYKHYAPG
                     SRERAALKAELEALKSQFPVRVPCVVNGKEYFDDAEPVEQVMPHDHRRVIALYRPLDG
                     QLVQKAIQGALEARERWSRTPADERAAIFLKAAELASQKYRYRLNAATMFGQSKNVWQ
                     AEIDAAVETIDFWRFGVKYMREIYNMQPPEHFPRGVWNRLEWRPLEGFVAAISPFNFT
                     AIGANLPSSPAIMGNVALWKPSPNTELSSWFVYQVLREAGLPEGVIQFLPGDGPSFSR
                     ACLQHPALAGVHFTGSTRTFRTIWQQVASNLPHYRNYPRIVGETGGKNFHFVHPSADL
                     DWVVPHTIRGAFEYQGQKCSATSRLYVPSSLWPTLRDRLVREMQQIKQGPVEDFSIFM
                     SAVINRQAFERIRNYIEQARTASQQMNPVAKIIHGGSCDDRVGYFIQPTLIETRDPDF
                     VTMREEIFGPVLTVYVYRDTEMESALDHALYGTDYALTGAIFARERSAVMALTDRLRD
                     AAGNFYINDKCTGSIVGQQPFGGARQSGTNDKSGSVLNLLRWTSARAIKESFLPPDDW
                     RYPHMMEP"
     gene            complement(<526457..>528268)
                     /locus_tag="CYME_CMG201C"
                     /db_xref="GeneID:16993138"
     mRNA            complement(<526457..>528268)
                     /locus_tag="CYME_CMG201C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535925.1"
                     /db_xref="GeneID:16993138"
     CDS             complement(526457..528268)
                     /locus_tag="CYME_CMG201C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535982.1"
                     /db_xref="GeneID:16993138"
                     /translation="MAPRLASRFRGIRNKWGTLLQDTAPGTKRILGVLCGLLLFGLLF
                     HLTLSRSQQRFKSYANSPEHPTGVGSAPLEPHGAQPEGDSEDASKVVPSGLSGWELAP
                     EPWTTEELTELAKVWIGIENALCSAHEVYVKHAEGQGDDDEQRIRGHAHAWRAFMAAI
                     PSPPPQPARAQRRGLGKDTATRAVVIPAGGPGLMQLGLVALQALRDRAGCRLPVEIFY
                     QDAGEAPTPGLEAWVRKTFAPVVFRNIQQVAQRAYELRANGSATTRNWYASCPQQLHI
                     EGYGLKVFAMVLSMYDEILVLDSDNIPLLDPTGLFGVGKFGLGDIGGFFWTDYFGLFE
                     PSDYRRLVPYRTMLKALGPPPCSQYEGTVEYTEPGSEQQACGIRIEDRRGSESGQILL
                     RRRDIDRKRSFWRPLMLAVYMYHHRDFFYRHLYGDKDSYRLAALALHEPSEITPIALG
                     SVGFYDDHGLFQGHGMLQFWPFPEELVRTPALATNGSARKHVLARLEKMGRSVMFLHR
                     NQRKIPQEGTRLLMKQHFNLKVSCWSNTTGEEAKTPPRYIMTPEEGLTRLTEPKIVCV
                     NTTDLVGFDVDAAILNYIENLWDRREWRHYLYSRNIY"
     gene            <529191..>531431
                     /locus_tag="CYME_CMG202C"
                     /db_xref="GeneID:16993137"
     mRNA            <529191..>531431
                     /locus_tag="CYME_CMG202C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535926.1"
                     /db_xref="GeneID:16993137"
     CDS             529191..531431
                     /locus_tag="CYME_CMG202C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535983.1"
                     /db_xref="GeneID:16993137"
                     /translation="MRRSRGKSARRSRKLEPWELSSDDDEDGALASGSGDSDESFASV
                     SDTERARAVNQVSTETSGRAMLRGKRVSGAAAAGSSTDDAGTLQDPESRVKRQRAARP
                     KDDRRTGSDADTDNLVNADTAAEKAKEASTQDLSELEDIETEPEFDDGYDAEGYGDEQ
                     DRAHLLSLTAVERETILAERFERRQREYEAYLFRKALRERRRAAIDARKQQRDASSAD
                     KATLAERERAKKRTRKQALDALAQAKRRDKSSSRRRASDSEALSQASDLDESDWSATH
                     PPGLSETDSVSDMPHGTDEEEDGAQRRRRGTLPVSASASVQRRTPVERSHGLLSKTMT
                     FADLVDPQTGAPSPLVLTRGLVERFHQKPWFTRFALGSFVRVPLPPTASANATSSTPQ
                     QLQQYVLARVSAILKAPRLYPVPSTQVVEGGRPAPPFKVGFRIQAELCGRQRRFSVDQ
                     LSRHAPSELEWLHYEKRHQEQRLPLPSRDEVEALRAEKLAFMRGEIPATPEEIADFQA
                     EFERLHPEAVNYARRITQVRAQLAHAQEAGDMEKQNALAAELERLAELETRYGQRPRE
                     GSSNEQVRDMLLSRRHHMPSTESKFTPQRPAPEAELPLAASLMLLKRTVEEQNAVELD
                     PFARRVARGTSYFFTPSKATSSEAATDASASLESETRRSIGATGQPPPPPPPPREANI
                     PANAHRAEALRELIPQIERWLWYGPLLEPLRNVELSSADEDVFLASRARFEHLRRAQG
                     DASVAL"
     gene            complement(<531841..>533871)
                     /locus_tag="CYME_CMG203C"
                     /db_xref="GeneID:16993136"
     mRNA            complement(<531841..>533871)
                     /locus_tag="CYME_CMG203C"
                     /product="similar to protein phosphatase 2C"
                     /transcript_id="XM_005535927.1"
                     /db_xref="GeneID:16993136"
     CDS             complement(531841..533871)
                     /locus_tag="CYME_CMG203C"
                     /codon_start=1
                     /product="similar to protein phosphatase 2C"
                     /protein_id="XP_005535984.1"
                     /db_xref="GeneID:16993136"
                     /translation="MGLCKSKLDLDTKLDDDCVDTVHNGGSQQPTSSTTAQKKNRGAS
                     SVPGERSTAAGVQPNAGGGRTEHKSQQQSSAAAGEQEGAAVGAASESSGGRLSLDRRS
                     DRFFFSFLGARRRLSVANEGTLPLDGEAAAADEESNRNRAHHHFQEYKVQFDDKGAVV
                     RPLPITKQDSAAEVLHSELSYELPLEPPAARPALRLSAGVVSRTGWEPVRKGKENQDS
                     ACVLMPLVPAWTCSTLAPRGENEVAKPCDMQCIPRQPSKLERRISTRDGLDNLMEDSS
                     GTRTFDDPEASLATVTVMTPRHLSLRHLPENPNVKGASVQYHEMILRATGSNIPPHVL
                     SDALWAVFDGHGVAGRLCSHYIRNIVPKLLARFLYDHALHDKPAEALRRTCLNAEQLL
                     TARGELLELEPETDAFAYLWNNMKSMLHQAVATVRENSRPSTSMESIPDVDDEDDGLG
                     GIDSRFSGTTGIIVLLHGRELFCANVGDSRAVLGRRLTGRGASDDAAATRSKQARYYA
                     VALSVDHKPDRPDERKRIQNLGGHVESWHGNIGPARVWLPTTRVPGLAMSRSFGDQVV
                     ENIGVIADPEIYHLEVCPADAFIVLGSDGIWEFLSSDDVVQFVGRRKDQGESPQAVAE
                     QLVQEAVRRWMAEESVIDDTTCIVVYLEPVGDAFTDPGVCQHTPRKVDFPDS"
     misc_feature    534235..536003
                     /note="possible transcribed region"
     gene            <537755..>539713
                     /locus_tag="CYME_CMG205C"
                     /db_xref="GeneID:16993134"
     mRNA            <537755..>539713
                     /locus_tag="CYME_CMG205C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535928.1"
                     /db_xref="GeneID:16993134"
     CDS             537755..539713
                     /locus_tag="CYME_CMG205C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535985.1"
                     /db_xref="GeneID:16993134"
                     /translation="MENLLFQAEGIGTGNDTDSEPGDERNSTTELWEHSAAALARNPC
                     GCPAEESQARCCRDLDARQNSHSHPEQRAIVCTHEAVFSLDERGSVAAPSLDTRHLLA
                     EPPALATSLGTHYRQIGLAVPPNGELQCFTPRGEALSAYWRTSQLGGPVTSTCVGELD
                     PLEHVANQTVLDATSSRGLTTPAEHHEKGIAEPVTTQPVFRIVLTGGPCAGKTTAMAL
                     LAERFRSRGFRVFLVPEAATLLFTGGAGQANITGDSECRILFQSILARLQITLEDGFF
                     ALAQQCRAPSIVLCDRGFLDGRAYMSGDEYTEMLGQNAWNLIEMRDQRYDAVLHLVTA
                     ADGAESFYTCEGHAARSESLREARQVDARTREAWSGHPRLYVIENRNRWLAEHSSTCS
                     LDEAPAAAPPNDQEFLPLGHCTPSPGFAEKMERLFSIVCRLVGLPTPAHMLDRKFLLT
                     PDANMVNHLRADPHVRGLQTFRVEQTFLIRAQASSSNDKSDPKNQSQAPVFWASQQEH
                     VRRRGRDGFHSYTHCIRRRYAEWSHQQSNPISERKAQPWVELRRNISLQEYHLLLGYA
                     DPRHRTLLVWRSCFFYHNAYFVLDQIENANVGPVALLRTSASSTSRSGSTDAPTPAGL
                     PLSNCVRCEVTADARYAFYALSRRCPCS"
     misc_feature    complement(538893..539764)
                     /note="possible transcribed region"
     gene            complement(<540851..>541789)
                     /locus_tag="CYME_CMG206C"
                     /db_xref="GeneID:16993182"
     mRNA            complement(<540851..>541789)
                     /locus_tag="CYME_CMG206C"
                     /product="similar to peroxisomal membrane protein PMP22"
                     /transcript_id="XM_005535929.1"
                     /db_xref="GeneID:16993182"
     CDS             complement(540851..541789)
                     /locus_tag="CYME_CMG206C"
                     /codon_start=1
                     /product="similar to peroxisomal membrane protein PMP22"
                     /protein_id="XP_005535986.1"
                     /db_xref="GeneID:16993182"
                     /translation="MIDVCFVSGLLQVPGRSARTCGVVHTTPLRCSVGRRVPAQGHRR
                     PLGASAQGAPMQRRMRACFAVPPEGTAAPAYGGTGGSGGSRSGSGGGGGGGGGGGGGG
                     GGASGRPNPLAALWALYLQNLAKRPLLTKMFTSLVGFGLGDVLAQHFLDKQKLDKKRL
                     FRMMSFGFLIHGSTGHYWYQFLDQMIKGTGVREVVSKVALDQLLWAPIFTAIFLGYTS
                     LLSGASTEETVKKIKADTFTGVRASWSVWPVAHAINFRFVPPSQRLLYINSIQIAYNM
                     FLSILATSRPASVQVGPSKSGSSSGKTKVNDISGKK"
     gene            542106..543964
                     /locus_tag="CYME_CMG207T"
                     /db_xref="GeneID:16993132"
     misc_RNA        542106..543964
                     /locus_tag="CYME_CMG207T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461291.1"
                     /db_xref="GeneID:16993132"
     gene            <548569..>549486
                     /locus_tag="CYME_CMG208C"
                     /db_xref="GeneID:16993131"
     mRNA            <548569..>549486
                     /locus_tag="CYME_CMG208C"
                     /product="retroelement"
                     /transcript_id="XM_005535930.1"
                     /db_xref="GeneID:16993131"
     CDS             548569..549486
                     /locus_tag="CYME_CMG208C"
                     /codon_start=1
                     /product="retroelement"
                     /protein_id="XP_005535987.1"
                     /db_xref="GeneID:16993131"
                     /translation="MRPGQTTGQSCMKTQLGTAKTQSIGTNMPQKYRASNRYLEWNDP
                     IFWPEIAETLLSSCNRKTPGIDGIAAEWVKLATPEGETTGTPWIPDEPDTSLGKRFLE
                     LIQRMFEEAYIPDVWGTAEVVPVLKKDSHTDMNSYRPIRLIPSIMKLLCAILTNRIHS
                     GLQERKFFAPEQAGFRSREECMSHALTFIEVVQRRFTSDQQPTYVCFIDFQKASDTVP
                     HEALFLKMERAGVSEKCLAFFRALYVDSWMRIRLGDGSRTPSIRMRRGLRQGDPAFPL
                     LFNIFINDLLNNCRQYVLEVPWIDWGDAR"
     gene            complement(553979..556008)
                     /locus_tag="CYME_CMG209T"
                     /db_xref="GeneID:16993130"
     misc_RNA        complement(553979..556008)
                     /locus_tag="CYME_CMG209T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461292.1"
                     /db_xref="GeneID:16993130"
     gene            <556137..>556781
                     /locus_tag="CYME_CMG210C"
                     /db_xref="GeneID:16993129"
     mRNA            <556137..>556781
                     /locus_tag="CYME_CMG210C"
                     /product="unknown zinc finger protein"
                     /transcript_id="XM_005535931.1"
                     /db_xref="GeneID:16993129"
     CDS             556137..556781
                     /locus_tag="CYME_CMG210C"
                     /codon_start=1
                     /product="unknown zinc finger protein"
                     /protein_id="XP_005535988.1"
                     /db_xref="GeneID:16993129"
                     /translation="MSLTAAENSGARVVDTEPNEVEARRCQVCGHQVPLSNWTLHEVR
                     CARGACTCEHCGSRMHESELDAHWKTECPCTLVDCVYCELPVKRSDMEGHVRRCGART
                     ERCKACGDYIRLIDRLEHELYICSASRAHNGESDASHPAKESVHACAASLPESAPDTV
                     TSTTPARRPQTARGRSGVPSRKLSASKPWLLTMGAILAVVVLQGLRSRERRPAP"
     gene            <557758..>559338
                     /locus_tag="CYME_CMG211C"
                     /db_xref="GeneID:16993128"
     mRNA            <557758..>559338
                     /locus_tag="CYME_CMG211C"
                     /product="lipid-A-disaccharide synthase"
                     /transcript_id="XM_005535932.1"
                     /db_xref="GeneID:16993128"
     CDS             557758..559338
                     /locus_tag="CYME_CMG211C"
                     /codon_start=1
                     /product="lipid-A-disaccharide synthase"
                     /protein_id="XP_005535989.1"
                     /db_xref="GeneID:16993128"
                     /translation="MARRHLFAGRFAGFAPVTGALWLRPGQRASSPVTGASDSVSRLG
                     QRHPVSRRWRQQRTGLFNVRLSTRRLRVFISTGEVSGDMHGAALARSLKQQAMHRGGS
                     RQQQQLLLLRGVGGPAMRQEGVELYADTLRISSIGLYEALRFVVPAYLAYEKAKKELL
                     EDPPDVAVLIDYTGPNMALATWFRQNLPGVPVISYIGPQQWIWEANGKPAHRLLDYFP
                     ILATCCRCLVAIFPLEAAFYCRKLEELGALPNPPPQIVYVGHPILDLVEPVTRDAARA
                     MLPWTSSEHVCVALMVASRLQEIGALLPATTRAALAMEKSLEAKDPPKRIRFIIPTAR
                     PEFSDQIRRVLLDQGVPSSRIASWDPNLREMHPETLFFLVPRDYARLVLAAADLAICK
                     SGTVNLEAAVLGVPQIVLYRLSWTSAFVIRHLFQMQLPYVSAVNVVCLDQAIVPELLQ
                     EHVTPERIHEEAMALLENRNGCADRMRHSYQSQVLPRLRLAEDCPEPVVERTAAGRAA
                     AVVWRYLDQAQESRTLVT"
     gene            complement(<560475..>562325)
                     /locus_tag="CYME_CMG212C"
                     /db_xref="GeneID:16993127"
     mRNA            complement(<560475..>562325)
                     /locus_tag="CYME_CMG212C"
                     /product="similar to iron transporter ferroportin 1"
                     /transcript_id="XM_005535933.1"
                     /db_xref="GeneID:16993127"
     CDS             complement(560475..562325)
                     /locus_tag="CYME_CMG212C"
                     /codon_start=1
                     /product="similar to iron transporter ferroportin 1"
                     /protein_id="XP_005535990.1"
                     /db_xref="GeneID:16993127"
                     /translation="MCAEATAETCVVLAQPEKVATSGFQQAVTQKAQHVAESRSATVS
                     ADTEFLPPSESRRPPESDSGGTHASSEVESTPANDANRTGEPATQHSRQAKPSILAFL
                     PLYTAYALICGVQRAFTFVVPIFLMIVSQRALNRTDGSFVPAAIYMLSSRGACFLLGP
                     TVGKMLDWGWRFRTAAVASVLYGVSTSLCAIWMPLLARYRPNDQATAIPEGTLWFCVF
                     GTIAALSEFALEISLWKRWLPLTVHAQQYQSGAIDGSKTEEQLAIANARMRRITMTID
                     IGMPLLVGWLLSSRGEVQGSVLVARFGAFLLAIQLVALFRASQICARGENVNASNEQQ
                     DAARRTGRKVQGTASTREEPIPSTTTRVAVAARTVYQHLRELFSSWRLYYEQETFVPS
                     LAHVSLYFTVLSPGGLLFGFLTYCGVNGSTIGIFRAASAIIGILATFSFEILVTRLHW
                     SVLQVGRVGVLCQLACLLPAQLLLWLVRVPEVPLPSAAQNSVAQITYQQPPLLIGVLV
                     FVTLSRWGLWCWDTAETEIMQTMVDASAVGEVSAVEAALCSLAELLMYGVSFTLSSPR
                     RFPTLATMSTMSISTGALAFHRWTKRQDRRRQHLDAETEREDRTPFESGV"
     gene            <565976..>568069
                     /locus_tag="CYME_CMG213C"
                     /db_xref="GeneID:16993126"
     mRNA            <565976..>568069
                     /locus_tag="CYME_CMG213C"
                     /product="probable proline dehydrogenase"
                     /transcript_id="XM_005535934.1"
                     /db_xref="GeneID:16993126"
     CDS             565976..568069
                     /locus_tag="CYME_CMG213C"
                     /codon_start=1
                     /product="probable proline dehydrogenase"
                     /protein_id="XP_005535991.1"
                     /db_xref="GeneID:16993126"
                     /translation="MSLVRSLTERRSICLQSVSSLLRTEVTPSEYTQRRSRECAAHQS
                     STLNAQRACSRHAPAWQLVAGFQQSCRSLERSAEYDAKSLRYPATGTTGQIMSMRQRS
                     FGVQSRSLGVTVGPASSLPLESEESGSGTSKRSSGPATEERAAVAAALASSASEANEV
                     ASSAKISGLLPPPPSAETRLESAPPLNLFDVEATYGTTPTRDLIRSLFVLRTAQMGWL
                     VRYAPTLYRWTQRVPLLRESTNLFIKYTFFRHFCGGETLSECREYVEKLRARGVGSIL
                     DYSAEGEAAPMNAAAVGRRRGDGLLLEESDISPDEVRYDGAANVLMTTVQWAGNEARH
                     CDTISCLKVSALARFELLERISEALAIRFGNLTTTHDGTPFLLLGHFDANGLVRAIAD
                     SYEFDESEIGMAGAVGMAASGSGAAVDHEPKQPSDSILDHVSLHLFNEYLSPAERLEF
                     ARVLCRLDAVCSEARRYRVPMLIDAEQYSIQTAIDFCAGLMMLRHNRSFESDQETPAI
                     MYSTVQSYLKDSPERLKAYRELASRFRFRYGVKQVRGAYMASERRRAAAAGRPDLSPI
                     HDTIEDTHASYNAGLSALIDEVRAGHAAALFATHNVESLQRAVELVGSDSLLRRNAAL
                     RFAQLYGMGDSLTFGLARAGFRACKYVPFGRVDEVMPYLLRRLEENHSALGTAPRDIS
                     HFLAELRRRDLRVPL"
     gene            complement(<568644..>570371)
                     /locus_tag="CYME_CMG214C"
                     /db_xref="GeneID:16993125"
     mRNA            complement(<568644..>570371)
                     /locus_tag="CYME_CMG214C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535935.1"
                     /db_xref="GeneID:16993125"
     CDS             complement(568644..570371)
                     /locus_tag="CYME_CMG214C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535992.1"
                     /db_xref="GeneID:16993125"
                     /translation="MYGYQQGSRFRRLKGVLVVWGLGCAAGAWWVRRNALAEPTLPSA
                     FYSAAVDQTDLRVVDGRFQSIRTAAVHVSRRLRRHALHGCSAALRGLDWLGLAVPPLE
                     SSLKTVKKVLGYLAIQIGLTAPYRLKSSYPMPELRQRIEEKWSGYGTRPVETHRLRDS
                     LSVDLYIVGDTPDCAFQLATAAARAYPAAVAWAQTGTLPPPTSSRAETPATSARCPVA
                     SSHLPVPVLRLHLPFRDFFPPGASRDMVQILIRAGRVINREHDWLGLERPYGDSGTHS
                     VSDVPEERDPHRIPRGVCFDAASEPAKTLPLTAAIESTSSARRLETGDLSKLPTSISG
                     TSIRQDASAGCTDIQIDQRSRAATRTCACTLLGRIDLTTSGLDLITAVGSTPVTSPLD
                     DALRLHQDDFVTFDRLLDTFCNFIETIQDSVAISSVRATSGRLESSRHEERSLPAPVV
                     LVFHACPPDFAIASGSLRTTDTDEQPFISGREIGSLEDLDPEEWAEFSQRLTTAPLWR
                     ETGPELAKYWRLATLELLERLAHVYPQQPMEACDGRVPESIPPSTVFVGRAPGALGLA
                     LVNHLAKSS"
     gene            complement(<571437..>571640)
                     /locus_tag="CYME_CMG215C"
                     /db_xref="GeneID:16993124"
     mRNA            complement(<571437..>571640)
                     /locus_tag="CYME_CMG215C"
                     /product="cytochrome c reductase hinge protein"
                     /transcript_id="XM_005535936.1"
                     /db_xref="GeneID:16993124"
     CDS             complement(571437..571640)
                     /locus_tag="CYME_CMG215C"
                     /codon_start=1
                     /product="cytochrome c reductase hinge protein"
                     /protein_id="XP_005535993.1"
                     /db_xref="GeneID:16993124"
                     /translation="MSETVDPKVEIEESCRPQCIRQLIEYEDCTKRIENDPAGEAHCT
                     GQYLDFWRCIDLCVASKLFVRLK"
     misc_feature    complement(571688..573468)
                     /note="repetitive element"
     gene            <575272..>576483
                     /locus_tag="CYME_CMG217C"
                     /db_xref="GeneID:16993123"
     mRNA            <575272..>576483
                     /locus_tag="CYME_CMG217C"
                     /product="NADPH:protochlorophyllide oxidoreductase"
                     /transcript_id="XM_005535937.1"
                     /db_xref="GeneID:16993123"
     CDS             575272..576483
                     /locus_tag="CYME_CMG217C"
                     /codon_start=1
                     /product="NADPH:protochlorophyllide oxidoreductase"
                     /protein_id="XP_005535994.1"
                     /db_xref="GeneID:16993123"
                     /translation="MQALFVSVPLYQERHIVCARAATRAPFPLRTPRNGCFAAGHRHH
                     CQHPLPLVVQRLPVARRHHALHLRMGPKQSQIAVITGASSGVGLYAARALINKGNWHI
                     VMACRDVDRAERAANSVNLPKDAYTVLHCDLADFASVLKFVRELSSVARVDHLDALIC
                     NAAIWHPRDKKPRFTVDGIEETMQVCHLSHLLLCRELLPKLKISRGRIVFLTTQTHSP
                     NSLPGKIPPQARLGDLSGLAAGLGPQTTGMVDSGPFEPTKAYKDAKAANVLTMKALSD
                     RYGRDGVTSVAIFPGCVADSNLFREKRGWFRYVFFPILQKYITRQYVPNDEAGRRVAE
                     VATQGQFSDSGSYYQWRGKYTEGREKTKPQVIEPTYEIDKADQLYELSLDLIDQALRR
                     RGLKSTILAPV"
     misc_feature    complement(576691..577947)
                     /note="possible transcribed region"
     misc_feature    577062..578257
                     /note="pseudo-gene of trefoil factor"
     gene            <578942..>581128
                     /locus_tag="CYME_CMG220C"
                     /db_xref="GeneID:16993195"
     mRNA            <578942..>581128
                     /locus_tag="CYME_CMG220C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005535938.1"
                     /db_xref="GeneID:16993195"
     CDS             578942..581128
                     /locus_tag="CYME_CMG220C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005535995.1"
                     /db_xref="GeneID:16993195"
                     /translation="MRKRYFSIVRLLVIVLVVSSTHSVRGVLSSEDTFLWTWIGGSNS
                     TDSSGSYGVQGVPNTSTVPPARYGAAFWTGVDGVLWLFGGSDSSGVFGDLWNYNLSTF
                     SWTWVGGSASLNSEGVYGSLGVPNKSNYPPSRTESASWSDSYGNLWLYGGQNFNSGYS
                     DMWMYNVSSGEWTWVQGSTETNVSPIYGTLGNSSSSNTPGARFQPATWVGLDGQFYLF
                     GGFKPFGPLYGDLWQYNTVTNEWSWIGGTQQQTPSGSYGTFRQASPNNYPAGRAGATS
                     WRDLDGNFWLFGGFGQIVGSSNLLNDLWLYNVSSKEWTWMSGNDSVGSNGSVYGEKGV
                     PSSSNTPGYRSGSSGFVDSSNTLYLFGGSSPGVCNDLWTFNITSLEWTWVDGDDTTNG
                     AYSYGEVNKTSNTTLPPPRYGAVLWNTDQNDPVLFGGQGSSGSYNDLFTLYIATSTPM
                     PTATPTPTASPTPSVTASPSATTNVTQTAVGEGSAVCFPADASVLIDGLGNSLLISEL
                     RSGMAVIGVNGRGQLVEDSVLGWLHNEPGATAEILAIKTLSGKQLRLTRQHLVYRVIE
                     HSRDFDSMTTAFSCISQKQQQQHQKHVGQSLELGTSAVVAVFAEDIRVGDALLDVAAQ
                     LPDPVVAIETLVTHNGLYAPLTRSGRLAVDGVLVSCYGTYASHAVAHAVLWPARVDAL
                     RKVWGSGLGTEGIVGIMPYAERLYHIWTSAARVLTEARVSVVVAAC"
CONTIG      join(AP006489.2:1..584452)
//
DBGET integrated database retrieval system