GenomeNet

Database: RefSeq
Entry: NC_010134
LinkDB: NC_010134
Original site: NC_010134 
LOCUS       NC_010134             739753 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 8, complete
            genome.
ACCESSION   NC_010134
VERSION     NC_010134.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 739753)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 739753)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006490.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..739753
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="8"
     gene            complement(<1346..>4909)
                     /locus_tag="CYME_CMH001C"
                     /db_xref="GeneID:16993603"
     mRNA            complement(<1346..>4909)
                     /locus_tag="CYME_CMH001C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005535939.1"
                     /db_xref="GeneID:16993603"
     CDS             complement(1346..4909)
                     /locus_tag="CYME_CMH001C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005535996.1"
                     /db_xref="GeneID:16993603"
                     /translation="MRKRYFSILKLLVIVLVVSGTHAVRGVLSSEDTFLWTWIGGSNS
                     TGSSGSYGVQGVPNTSNVPPARYGAAFWTGADGVLWLFGGGNSDGVFGDLWNYNLSTF
                     SWTWVGGSASLNSAGVYGYLGVPNKSNNPPSRTQSAAWSDSNGNLWLFGGRNLSSGYS
                     DMWMYNVSSGEWTWVQGSNETNVSPTYGPLGKSSSSNTPGGRYQPATWVGLDDQFYLF
                     GGSGPNGTVYGDLWQYNTVTNEWSWIGGTQELDPSGSYGAFRQASPSNYPAGRYGATS
                     WRDLDGNFWLFGGFGQIETFGGLNDLWLYNISSREWTWMSGNDSVGSNGSVYGEKGVP
                     SSSNTPGYRSFSSGFVDSSNTLYLFGGYSSGFCNDLWTFNITSLEWTWVDGDNTTDGA
                     YSYGELNKTSNTTLPPPRADAVLWNTGQNDPVLFGGEGGTGPLNDLFTLYIATPTPTP
                     TATPTPAATPTPTPRPTATPTPTPTATPSPTPTPTATPTPTPTPTATPTPTPTPTATP
                     TPTPTATRTPMPTPTATPTPTPTGTPTPTPTPTATPTPTPTPTRTPTQTATPTPTPTA
                     TPTPTPTPTPTATPTPTPTATATPTPTSTPTPTATATPTPTVTPTPTPTPTPTATPTA
                     TPTATPTATPTPTPTATPTPTPTPTPTPTPTATPTPTPTPTATPTPTPTPTPTATPTP
                     TPTPTATPTPTPTATPTPTPTPTPTATPTPTPTATATPTPTPTPTATPTPTPTTTATP
                     TPTPTPTPTATPTPTPTATPTPTPTPTATPSPTPTPAIAGVAFSAVVSVVNKTVCVDV
                     AVVLQDNLETKLNGTGANVTVSDNCDSIFVSIASRFADWYERSSLDVQRVFSATSAVN
                     ASYNISILAPTALVSNVTKISTNFTSSVPSILPSGASLVAISTPKVVPTPTPTPTPTP
                     TPTPTTSATPTPTVSVTPSPTANVTQVSVGGGAAVCFPAGASVLIDGLGKTRRISELR
                     PGMTVIGVDSRGRLVEDTVLGWLHKETRATAEILLIKTRSGKELRLTRQHLVYRMNEN
                     PRVPGRKMTAVSSLSHEKEQHIQKILELETSVGEAVFAEDIRIGDALFDIAAHLPDPV
                     VAIDTLVTSDGLYAPLTRSGRLVVDGILVSCYGTYASHTVAHAVLWPARVELLRKIWG
                     SALGSDSTEGIMPYAEGLYRVWTSAARILKDSRVNAIAVAC"
     misc_feature    complement(5708..7054)
                     /note="pseudo-gene of trefoil factor"
     misc_feature    complement(7383..8595)
                     /note="pseudo-gene of NADPH:protochlorophyllide
                     oxidoreductase"
     misc_feature    9225..12560
                     /note="repetitive element"
     gene            <12629..>14008
                     /locus_tag="CYME_CMH005C"
                     /db_xref="GeneID:16993342"
     mRNA            <12629..>14008
                     /locus_tag="CYME_CMH005C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535940.1"
                     /db_xref="GeneID:16993342"
     CDS             12629..14008
                     /locus_tag="CYME_CMH005C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535997.1"
                     /db_xref="GeneID:16993342"
                     /translation="MAGSRASNLKQTREKRQRAVASASAAAAVRWESIDAALCEQRAT
                     AVTRSLIWAYLILAVVLVVFPALYTHAEDSGLLSSAPRLFAMAATAITLVNMLLVSTS
                     VVFIGARVSAARDRLRRWALEQSRTRAGADDSESVAAALAALEREVIGRGDALRFPLV
                     ASLGLIALFMAIRYLPQNVVQLLIGMYVALASLVSMTSILSPLLDLLEHRLRQSPRTK
                     PLGMLMARRFGLFRDTLSVHGRDVLGMVLALPLLYWYRQSSGLGAAILNNIFAASLGV
                     AGIDLLAIGDFQTAVVLLVGLFLYDIFWVFGSEAVFGDNVMVSVARGIDGPFKFVFYR
                     LRARPDAARDMSMLGLGDLVIPGLFVALMLRFDHRHLAKPSLAPKHPYFSATYMAYAL
                     GMVTTFVAMAVSKAAQPALLYLVPFCLVAPLMRAWRLGELRSLWYYREHDAELDSHRE
                     PHQSSCNDT"
     gene            complement(<15634..>17439)
                     /locus_tag="CYME_CMH006C"
                     /db_xref="GeneID:16993343"
     mRNA            complement(<15634..>17439)
                     /locus_tag="CYME_CMH006C"
                     /product="unknown protein involving with Iron-Sulfur
                     proteins SufD"
                     /transcript_id="XM_005535941.1"
                     /db_xref="GeneID:16993343"
     CDS             complement(15634..17439)
                     /locus_tag="CYME_CMH006C"
                     /codon_start=1
                     /product="unknown protein involving with Iron-Sulfur
                     proteins SufD"
                     /protein_id="XP_005535998.1"
                     /db_xref="GeneID:16993343"
                     /translation="MLTIEARENKLSAFVVPGGRVGAFRGGWNATVVGSCAHQRRAGS
                     RCRSAQVRRSARLDMNGSDVGGMQPRSQSVEEELSAVVQAMRLWRSSSFMERLLAQAP
                     PSDITSGCCASLRDIALARLGSAAAEKRLPHRKMETWRFTDIRELLETDFRLRTPREP
                     YTSAQLERLRDALHRAEQVCGTPTQGSETEPLRFVLLNGRLVQELSSLAQIRDTSSLQ
                     QGYVGNLKECTDGALQERIVSVIRTAPPEAGLGVVPFREEPRTHDYSSGIAKVNDFFT
                     LLNVYLGMSGDGDGVFVVYLPPGCTIDRPMEIIQVVDAGVAVNPRTVIFLDRGAMASV
                     SFRLVALGATSPEAPQQPNDATFLNECVNVHLETDACLKLSIIGSQSVSESVRQDQHR
                     FYHMTGLSVRCEQGTSFTATNLNVDSLALRRLVMGVDLVGRRASCNVNGLTLLQDRAL
                     GDVQVRVSHHVAQCESNQLHKNVVVDRSTAVYRGTVYVEREADGTNAHQLIRSLLLSD
                     GSRVHVMPFLEVLNDDVSCTHGAASAHLDEVELFYLQSRGASRDEARTLLLYGFVGDI
                     AKLVPYPRMEGWIRDHLVRNIAGRAVALWQGDTPE"
     gene            <21790..>23715
                     /locus_tag="CYME_CMH007C"
                     /db_xref="GeneID:16993344"
     mRNA            <21790..>23715
                     /locus_tag="CYME_CMH007C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535942.1"
                     /db_xref="GeneID:16993344"
     CDS             21790..23715
                     /locus_tag="CYME_CMH007C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535999.1"
                     /db_xref="GeneID:16993344"
                     /translation="MEDQPRTGTLTSNDAAAIPLRGRPFAYEYAAVNALQLVPEFKQL
                     LEGSNLLAFIAYLRRQTIESGGRPGRVSWPVWLQAAEDLGLGATRAAILWRGAQFADT
                     DRGASAVQSLDVFSEYDSVPLARLGALLFLSSVIPRPLAREVDAAWLDFPSPTTITES
                     VPQLLKEAARWETQTKVIDLQSGEVTEHLSFEQKSISDVMAVTTSSMEKILGMVEKGK
                     FYPAGSYISTLRRLPAILQYNCTFQTKILVVSLGLTFTNGDVCADVITPWNPKGRPDA
                     NTGTKSADDIDWNDIWIPLRCIEHFRFLFELPDVPLTLGWDATQIVEGISEPAVKFAD
                     SVSYLFDLFNILLGTCFIRNKNLPWAHIRSIAGLRAVASLRPYRWEVSALVRSTLIKR
                     IDHEDTADIDIRGCKDCRLEFVPGDATTIAHVTIGQCVDCTIFVAACKTLMLTTSERV
                     TILAAVHAELRIINCLECQIYILCNERPVAYGDNRLVYIGPAAYNFDGLDSILSRHGI
                     RTDSNRWSEPYDFERDGTPTSNTVALIPPSSYWPPVLAWKNAKDLRSCPWQIEKEYLE
                     VFEHRSASVDRLRRSVCDRFGDRKDAMSQLQDLVHARFREWLGNGNRMRSVHDLLRME
                     RTEAKEAPKDSSEQSAS"
     gene            complement(<24679..>26112)
                     /locus_tag="CYME_CMH008C"
                     /db_xref="GeneID:16993345"
     mRNA            complement(<24679..>26112)
                     /locus_tag="CYME_CMH008C"
                     /product="branched-chain alpha-keto acid dehydrogenase
                     E1-alpha subunit"
                     /transcript_id="XM_005535943.1"
                     /db_xref="GeneID:16993345"
     CDS             complement(24679..26112)
                     /locus_tag="CYME_CMH008C"
                     /codon_start=1
                     /product="branched-chain alpha-keto acid dehydrogenase
                     E1-alpha subunit"
                     /protein_id="XP_005536000.1"
                     /db_xref="GeneID:16993345"
                     /translation="MYHSKSYLKNVRVLLTRAVQDSVRIAYRAAFRAQVEKHHGRRIG
                     NAYQQGCSGSYAAVGQQARCCSSGTERPVSWFSPGGEVHFPGAVAAPYTHKLVVEEAA
                     KLLPIPAFRLLNNNGELVDGVDSKSVEEKVSGAVLRKIYDCMVALNVMDSILFSAQRQ
                     GRISFYLTSFCEEAAVVASAAALDNHDEVFAQYREQGVLLWRGYTYDDFCQQCCSTRK
                     EPARGHQMPVHYGRKDMHFHTISSTLATQIPHAVGAAYALKLDGKGIAACYFGEGAAS
                     EGDFHAAMNFASTLDCPVLFICRNNGYAISTPATEQFRGDGIARRACGYGMDAIRCDG
                     NDALAVYVATNYARDRIVATSRPMLLELLTYRGGHHSTSDDSSQYRSLEEIDYFMRYA
                     DPIARLGRFLNVSPAEEQAMRKRERTLVLDALSSAEQEEKEPPLDMFLDVYSSMPPHL
                     IRQRESLRLSLERIEQAKANRASTSPK"
     gene            <27096..>28235
                     /locus_tag="CYME_CMH009C"
                     /db_xref="GeneID:16993346"
     mRNA            <27096..>28235
                     /locus_tag="CYME_CMH009C"
                     /product="probable adenosine deaminase"
                     /transcript_id="XM_005535944.1"
                     /db_xref="GeneID:16993346"
     CDS             27096..28235
                     /locus_tag="CYME_CMH009C"
                     /codon_start=1
                     /product="probable adenosine deaminase"
                     /protein_id="XP_005536001.1"
                     /db_xref="GeneID:16993346"
                     /translation="MAGELNRRVLQLIPSDLENDPKFLTFLAANVPKAELHIHIEGAL
                     EPELALKLAARNNVTEVLSKYDSSVAKLRESYNFSDLQSFLNVYYDTMQVLRTADDFF
                     CLTRAYLEQARIQHVRHVELFFDGPFHVRRGVRLSSVIDGIRSALENAEAEWGLSWRL
                     LMCLQRELPPEEALHCVRQIGPYRPWIHGIGLDGAEKPNPPERFADAFNLARSMGLHC
                     VAHAGEEGPPPYIYTALNVLHVERIDHGVRAVEDPSLLEMLRVRLVPLTVCPLSNWRL
                     RVVESLAQHPIKELMDAGLCVTLNSDDPAYFGGYINENFSAMIHEKHLNCTQVLGLLE
                     NSFVASFLEPNQRNLFLGEQCSAVESCVRTWQTDPNRHESVVSTA"
     gene            complement(<28549..>29505)
                     /locus_tag="CYME_CMH010C"
                     /db_xref="GeneID:16993347"
     mRNA            complement(<28549..>29505)
                     /locus_tag="CYME_CMH010C"
                     /product="similar to syntaxin protein"
                     /transcript_id="XM_005535945.1"
                     /db_xref="GeneID:16993347"
     CDS             complement(28549..29505)
                     /locus_tag="CYME_CMH010C"
                     /codon_start=1
                     /product="similar to syntaxin protein"
                     /protein_id="XP_005536002.1"
                     /db_xref="GeneID:16993347"
                     /translation="MTSRDRTSVFKRYRAEARLALGERSALEELKSEKQQAPAAARAG
                     VTQVAKGVALLPPRWVDLHESIQEDLATIRSGMDELENMRRKLLLPEFADKSEEEYVV
                     DKKTAEVARLFQSCEAKVRQLSELVHEISLSRTERIIRENVQKKHAMQVQELSIRFRR
                     EQRRFLDRLRKADADNALALRVNGALFRTKAGANDSMDDNHPDNFSTYDPGFNESQLA
                     LWRHAEMHAGARYEEARRIARSIQELSGIMRDLSLLVTEQGSIIDRIDYNIEQADMEA
                     EQALKQLQRARRTQKRGWIHYCTLILALGCVVLFLILVLKWI"
     gene            <29774..>30553
                     /locus_tag="CYME_CMH011C"
                     /db_xref="GeneID:16993348"
     mRNA            <29774..>30553
                     /locus_tag="CYME_CMH011C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535946.1"
                     /db_xref="GeneID:16993348"
     CDS             29774..30553
                     /locus_tag="CYME_CMH011C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536003.1"
                     /db_xref="GeneID:16993348"
                     /translation="MPETGDTDGAALNQEERVPTELSENEQEGGSASAGEKLRDPRYP
                     LKVKYAPCGLPPEYCEFHSQDELRQCLPWLATHFPHWFESRDQERSIDPQKQTRTSAP
                     LPPEQRSEGLEEIRVDFSAFADAFAELRVTAKTNAVNKPDRKESTKHSGGKQKGSKID
                     NVIIHVSKVKGNKQMTAVHGLEAFLERGTIKDMAKLCKKRFSCGATITRTEAHGEALE
                     IQGDRSTDIAEWLRDEFLVPADRIFFATTGDLRNKQAAFPA"
     gene            complement(<33573..>34118)
                     /locus_tag="CYME_CMH012C"
                     /db_xref="GeneID:16993349"
     mRNA            complement(<33573..>34118)
                     /locus_tag="CYME_CMH012C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535947.1"
                     /db_xref="GeneID:16993349"
     CDS             complement(33573..34118)
                     /locus_tag="CYME_CMH012C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536004.1"
                     /db_xref="GeneID:16993349"
                     /translation="MIEAMSLWSYMYEAGCTVKKFALGQGLIFCSPLETRTGAATTLE
                     RGATPLDAEPSSYPSNEPESTRIGVFDITRAYPEVWLSYGVTVLLLAGTWLYFRQRLR
                     AAERLLPQKRVEFSRNAEHVHQLQEKPTEALGTAAGDTEALHEPVLKEVRVKPVPSLE
                     AEEGTNDRTRRRRRRASKQNT"
     gene            <35740..>37677
                     /locus_tag="CYME_CMH013C"
                     /db_xref="GeneID:16993350"
     mRNA            <35740..>37677
                     /locus_tag="CYME_CMH013C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535948.1"
                     /db_xref="GeneID:16993350"
     CDS             35740..37677
                     /locus_tag="CYME_CMH013C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536005.1"
                     /db_xref="GeneID:16993350"
                     /translation="MGVWSDFRKFLEDGAFFNQNGFKPAWFVYVVQLWSLLQAFILPA
                     AQTLAGLFALRVAAGVLSRLRPFCRLAAHHLPSLNSLWNDRHNGLPLGTDAVALRKRG
                     AVTDRAAALEPLGAKLAHSRAENAGRCDTVACEAGGAPRNETCIARCRSFLVELRRKP
                     QLGWPRLLYRVLQLLIVLRGLMLFKHLALTNEPRTYFYSTSIVPPPLCPLNDLEPLIE
                     KESRFLQVELPRYVAQVQEALWQDARRYGEPGIRKHRIVLYRASCDGLGNRLTGLVSA
                     FYYAYMSQRAFLVDWNGCAAVVSGTLEDLVDPPFAWSARDLLRVLGADDRQHAARRSD
                     QDTDPVLVEFQRIFGDAGVRRLSTAYCRPCPERRPLRDLEHMLCERFVDDSTPVVDFY
                     GTHWTGATIQHNPYFRTASCKLFGNDAFGILSRALLRPNAVVQRIAAPVLEEMSRAVL
                     TIALQIRRRDSYGISAAMEEVMWRCAQQIRVLHFQRRTLGDRSNKASTPGHSTGRNES
                     GIGNQTFYRTLLFIAADNDRSRKRIEDGSSKEHTGLHAIYLSSPLTKTELVGIQYAFA
                     EMYLLSKADEIIISPYSSFGSFTHGWSSKVPWIALRSGKCMQTTSSMPCDVYWFGVQR
                     LSCFNASMLSSEMVNMDSCYG"
     gene            complement(<41188..>42708)
                     /locus_tag="CYME_CMH014C"
                     /db_xref="GeneID:16993351"
     mRNA            complement(<41188..>42708)
                     /locus_tag="CYME_CMH014C"
                     /product="cysteine desulfurase for iron-sulfur cluster
                     formation sufS"
                     /transcript_id="XM_005535949.1"
                     /db_xref="GeneID:16993351"
     CDS             complement(41188..42708)
                     /locus_tag="CYME_CMH014C"
                     /codon_start=1
                     /product="cysteine desulfurase for iron-sulfur cluster
                     formation sufS"
                     /protein_id="XP_005536006.1"
                     /db_xref="GeneID:16993351"
                     /translation="MFTVQHTVGTARFGRSGKLSGAKTRDQAPLESCLSAAGRTCAHH
                     RGAARWVGAYRLKAEASSVGQAGTSVEAPGHRRNRPAIAALDKDSFPILERTTTEGKQ
                     LVYLDSAATSQKPLQVIEALSHFYRYENANVHRGAHRLSQQATEAFESARAKVARFLN
                     AKKDTEIVFTRNATEAINTVAYAWGLLGGNLTPGDEIIVSVAEHHANLVPWQLVAQRT
                     GARLRHIPLLPQVQALDMDTFEKMLSERTKLVAIAYVGNVLGYVQDVRRITELAHQAG
                     ASVLVDACQAVPHMPVDVQDIGCEWLVASGHKMCGPTGIGILYGKEHVLRREMAPFLG
                     GGEMIAEVFLDHSTFADLPHKFEAGTPSIGDAVALGAAIDYLEDGLGGMKRIHQFELQ
                     LARYLYESLEQFQEISIYGPPLDNDLGLERAALCAFNVRGVHPSDLATIIDLDGIAIR
                     AGHHCAQPLHRDALGVGGSARASVYVYNSSADIDRFIDALVDAVSVLGEKLTLRPA"
     gene            42913..46539
                     /locus_tag="CYME_CMH015T"
                     /db_xref="GeneID:16993352"
     misc_RNA        42913..46539
                     /locus_tag="CYME_CMH015T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461293.1"
                     /db_xref="GeneID:16993352"
     gene            <46562..>47317
                     /locus_tag="CYME_CMH016C"
                     /db_xref="GeneID:16993353"
     mRNA            <46562..>47317
                     /locus_tag="CYME_CMH016C"
                     /product="similar to thiamin pyrophosphokinase"
                     /transcript_id="XM_005535950.1"
                     /db_xref="GeneID:16993353"
     CDS             46562..47317
                     /locus_tag="CYME_CMH016C"
                     /codon_start=1
                     /product="similar to thiamin pyrophosphokinase"
                     /protein_id="XP_005536007.1"
                     /db_xref="GeneID:16993353"
                     /translation="MPFSHNYGGLLRPKTRVVALADFWRCTALVVLNSPDRSLSNEQV
                     HGLASACGFVVAADGGANWLRGTNVRPNVLVGDLDSVEDETRSFYEKSSVLCQSDPDE
                     SRNDFQKALTCLPDAFQRAVVIGGDGGRFDHLLANIHAMYADAMHHQHRDVVLLSSKS
                     MAFVLRPGGHTIHIDECVEGPSCGMFPMGGPCNVRTRNLQWDVNSEGWNGRPLEFGSF
                     ISSSNRILGNSVLIWTDAFLLWTHEVRWPSPGG"
     gene            complement(<48464..>48964)
                     /locus_tag="CYME_CMH017C"
                     /db_xref="GeneID:16993354"
     mRNA            complement(<48464..>48964)
                     /locus_tag="CYME_CMH017C"
                     /product="RNA polymerase I, II, III common subunit"
                     /transcript_id="XM_005535951.1"
                     /db_xref="GeneID:16993354"
     CDS             complement(48464..48964)
                     /locus_tag="CYME_CMH017C"
                     /codon_start=1
                     /product="RNA polymerase I, II, III common subunit"
                     /protein_id="XP_005536008.1"
                     /db_xref="GeneID:16993354"
                     /translation="MAADEEDVDDYIEDEEAEPELPYDYGDDYEGEELQEESEELKES
                     VPETEIDAEVLPDGEQEQKPTIYAGDNEKVARESSHWSKDQSDLKNRVTTPFLTKYER
                     ARVLGARALQISLGAPVLVDLEGESDPLLIAEKELRAKKIPLKIRRHLPNGAYEDWSV
                     NELTSD"
     gene            <51379..>54198
                     /locus_tag="CYME_CMH018C"
                     /db_xref="GeneID:16993355"
     mRNA            <51379..>54198
                     /locus_tag="CYME_CMH018C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535952.1"
                     /db_xref="GeneID:16993355"
     CDS             51379..54198
                     /locus_tag="CYME_CMH018C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536009.1"
                     /db_xref="GeneID:16993355"
                     /translation="MDVREAVDLLTPFRVLHLVAAALCAQVPCNPQIDGATGTNAAVQ
                     ERRALTCLHLLHVARAGPAENFDWRLSSPDTYFPARSVLDRLPSAEREELQHFADRWV
                     ELTRHVLSESVDVLYDAFEVLLGDLFVSVPLSLGDVVLGSLQVDESFQSHEQSDTFER
                     GICTDRVLQRSAFAGGSALGTFVRRCRVAFESLPFEAVAQLHREVTLDHTKAPSTHYA
                     NVVHTSFDFSAVRRAAHRAVRAIVIAGGPPHPRDRALLKASTDPAAELFRWVDAVWRR
                     NLNEANFALRRYNDLAIARCNRGMFDSGPQEAAVAVAGMLVLMGHPVQARIALEESIR
                     VAQQTGDHVTLSRALTWISRLTENERKRLRYLKDCWTRSPKLSQESVLARLAAAHTLL
                     NMNFPLGNHTATKFRKWRRILRHMECAYAASVNSPEDTHLVLASMHTLAVLSGQPLVL
                     RESLTEMRLRSLLPNIREFTEDGDHRTHDETTSSLSSVDHDSCESNAKKAGAGANFGE
                     HERSRHPLGELPVQLHQSASIDDGPEDAAHVDANFLLTSKELGLAPTEHLARALCAAS
                     AETLMRHGILRASWTAALPLRNACALVRAADDEPESSPVLRILHQCLARIAFEYAVAR
                     EEWQIAAACLERLTSFAPPIVQEKYPDLAGNSASTATLNAILDVLDCHARFWLCRAQV
                     SEALYFAEEFAQTANKYAALGCRSRLVDALLLQVECYLSAEMNARALAASLASISLAE
                     SIGDEPRRFRGILSLAQVRLAMQAVDSASRLLESADSMLLDQKDSASLGSAALWKSLV
                     SEESCLSHSDRARVWMMLGGIALVKMQSQQSVNTGEATSCFEMAFRTADLVALQREAL
                     FALLHTRGAKTDIAAMTNFEFKMQCVRRQQSSWAEALQVSGSTEWEQNVCCYLQHTRT
                     EFHESRNSESDLYMEVAAANRKSEC"
     gene            complement(<55187..>56560)
                     /locus_tag="CYME_CMH019C"
                     /db_xref="GeneID:16993356"
     mRNA            complement(<55187..>56560)
                     /locus_tag="CYME_CMH019C"
                     /product="similar to UVB-resistance protein UVR8"
                     /transcript_id="XM_005535953.1"
                     /db_xref="GeneID:16993356"
     CDS             complement(55187..56560)
                     /locus_tag="CYME_CMH019C"
                     /codon_start=1
                     /product="similar to UVB-resistance protein UVR8"
                     /protein_id="XP_005536010.1"
                     /db_xref="GeneID:16993356"
                     /translation="MRREGLERGTEEGSELQPALVVWGRAKNHRLGIPYAEGDIFQPS
                     ELPKIVLDRLVSDRRTPNHVLQVACGGSHTAILLRNGALYTVGHGLYGQLGLGQRIRR
                     VSLPTRVRGVLGPEAITNVGRSSAVALPPIEAVACGRYHTFAVSSDGRLFSWGGGKNG
                     RLGTGTELRSFLPWPVSTVQEKVPGQPGNVRRSLAIPSECQIVAVECGYHHSVALSAI
                     GVVYTCGWGAYGQLGHGSCNDEPSLLAVTFRDEHGNALPNLRIIKVASGDRHTLVLTD
                     DGRIYGFGSNEYGQLGITMSCDQETAENPTSKQCVFSEPRLLTGGALAGRRIAQIACG
                     ERHSVALSDQGEVICWGHGMSGQLGLGESITMTPTPQILNTRNSPLASRRVTGIACGH
                     ENTLFLVSDNEIYVTGSGEYGLLGIGAGAPRMAFEPVRVQLPPGFRVDRATMGHFHAA
                     AWGYRSH"
     gene            complement(<57784..>60033)
                     /locus_tag="CYME_CMH020C"
                     /db_xref="GeneID:16993357"
     mRNA            complement(<57784..>60033)
                     /locus_tag="CYME_CMH020C"
                     /product="cleavage and polyadenylation specifity factor
                     protein"
                     /transcript_id="XM_005535954.1"
                     /db_xref="GeneID:16993357"
     CDS             complement(57784..60033)
                     /locus_tag="CYME_CMH020C"
                     /codon_start=1
                     /product="cleavage and polyadenylation specifity factor
                     protein"
                     /protein_id="XP_005536011.1"
                     /db_xref="GeneID:16993357"
                     /translation="MPPATDDDTLSIIPLGAGSEVGRSCIVLKFKKKTILFDCGVHPA
                     YSGLAALPFFDEIDPSEIDVILITHFHLDHCAGLPYLVTQTNLNPRARILMTHPTKAV
                     YRSLIGDFVRVGSSDYAGIIYTESDLNQTMARIECIDYHQHIDVSGVRISAYNAGHVL
                     GAAMFLVEVAGVSVLYTGDFSRQEDRHLMEAEIPRGIHIDVLICESTYGVQVHEPRRV
                     REARFTQRVAEVVKRGGRCLLPVFALGRAQELLLILEEYWDAHPELQEIPIYYSSSIA
                     KRCMAIYSTYIHQMNQNIQQRYRRFGNPFAFKYVMNIRSLDEFEDSGPCVFMASPGML
                     QSGMSRRLFEKWCSDRRNGVILPGYSVQGTLAKYILTDPATVPRLDGQHVPLRCSVDY
                     ITFSAHSDFMQTSEFIEQCRPSNLVLVHGEKSEMQRLAQALDSRFNRKATFEAAIAEA
                     SAVQVGSNEKDVYEPDVDVLPSNLAPLSGVTTGSVRDTMRVKDANQDDSKRLRIFTPR
                     NTKAVLLRFQGEVIGKAIGKFAKSRPEAGHRASGVLLKRDYKYSLLEPSDLEQYTAMK
                     TSRILQRLVAPFCLGGGIESFEEELRGMFSKVVTEDTECGSEERVFLVQGAVHVRISG
                     TEPKTGYRFLTFEWDSSFQADAIVDALIAFLADRSVHEPPKGYPDQDALRELRLTRRL
                     LAERFGSVEVTGRSETRLVIENTPVIVNHETGEVTCKDTKLRDHIYIVLRRIYSSIYP
                     IPDWFCGCS"
     gene            complement(<63679..>64026)
                     /locus_tag="CYME_CMH021C"
                     /db_xref="GeneID:16993358"
     mRNA            complement(<63679..>64026)
                     /locus_tag="CYME_CMH021C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535955.1"
                     /db_xref="GeneID:16993358"
     CDS             complement(63679..64026)
                     /locus_tag="CYME_CMH021C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536012.1"
                     /db_xref="GeneID:16993358"
                     /translation="MTEKQCLILTTNDCPGMRVLRVIGPVYGTSVRTRSIGGNWVSCF
                     RAVRGGKQPGYTKMISATRDDALQELAKHALSLGANAVFAMRFDSSEFGSGAGYLMNE
                     VTAYGTAVVLEAV"
     gene            <68431..>69909
                     /locus_tag="CYME_CMH022C"
                     /db_xref="GeneID:16993359"
     mRNA            <68431..>69909
                     /locus_tag="CYME_CMH022C"
                     /product="RuvB-like DNA/RNA helicase pontin"
                     /transcript_id="XM_005535956.1"
                     /db_xref="GeneID:16993359"
     CDS             68431..69909
                     /locus_tag="CYME_CMH022C"
                     /codon_start=1
                     /product="RuvB-like DNA/RNA helicase pontin"
                     /protein_id="XP_005536013.1"
                     /db_xref="GeneID:16993359"
                     /translation="MAPLQELLKSSGESAKRISAHSHVKGLGVDCETGVVRDVEQGSE
                     QFCGLVGQTPAREAAALVVDLIKLKKMAGRAVLLAGPPCTGKTAIALAISRELGRRVP
                     FCVLNGAEVYSSEVKKTEILTSHFRRAIGVRVKEIKEVYEGEVTELAAEESPVPDPAS
                     GYSRSISRVVIGLKTTKGTKTLRLDPSVHEAILRERVEVGDVIYIEASSGTVKRVGRC
                     EAYASEFDIEADEYVPLPKGDVHRRREVVQDLTLHDFDVANSRPTQTFSEDNDVIAVL
                     NNLSRPKKTEITDKLRNEINQLVSQLVDQGKAEVIPGVLFIDEVHMLDIECFTFLNRA
                     LESNLAPIVIFSTNRGICTVRGTDMQSPHGIPYDLLDRCMIIRTEPYSKNQIQRILSI
                     RAKIESISVRTLEPLACENENGEEGESSAIPDDALHILATVAERTSLRYACNILTPSY
                     ILAKVAGRDQVTAQDIHEANALFLDAKSSAKFVMDRSENYLS"
     gene            complement(<69897..>71837)
                     /locus_tag="CYME_CMH023C"
                     /db_xref="GeneID:16993360"
     mRNA            complement(<69897..>71837)
                     /locus_tag="CYME_CMH023C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535957.1"
                     /db_xref="GeneID:16993360"
     CDS             complement(69897..71837)
                     /locus_tag="CYME_CMH023C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536014.1"
                     /db_xref="GeneID:16993360"
                     /translation="MTGNGVQGEFRRNKVPPVERTNLRRETVRTKTTPAAVLFVGTSG
                     GPDLSRRHARKLGTTGLSNRKQPAWKSWCALERDDGHSWKKQGEPFRPTRANDSKQIG
                     SAREKSFGQSASFRALSAIYNHTKERAVNDSACVARWLRVALSSATLVARSLTFSFKL
                     ARSDSKRLGPSLRHFYHLLSWRKSGTTYGAQSAVEVSGENLDSPRLSQMNGLVRYAAW
                     ASRFFFKRLDPSNLNIKISWKHLVHVAGHRELLGSIRGHLPSENSNLIVHDEALEPAS
                     GLISAASRFSMWFRQLQSTTGAFTGLSRKRLSLHVHSSGRKTYADARLFNTYRVLPST
                     TRGQITAVPVAIALSTLFFLFLGMDAVNAGVVGLSTAALSITISKNTDTTKFLLPSGR
                     RTRETRNSHLVTKSNDTRVLLRYHSHIMDWFHRRRLPLDPTWALSRTRIRRELINQPL
                     QANQRASSIARDTDGGFQLDAADDSRQMDSVVNIPASSARTSTPHVYRIRRFGYLKNH
                     VRNHVRLWRHSVAFPSGRAMKPTGHMYSDGKYEIYAYASGGKVESAHRLSLNHLDVGV
                     PRSNPTVIDTISRNLPPEQTLLQKFLLCMDRILYNLESRVQRAIRRLRDLGIWSLSTA
                     RGKRELLVTIKDRGIEDSFYDK"
     gene            <72832..>74112
                     /locus_tag="CYME_CMH024C"
                     /db_xref="GeneID:16993361"
     mRNA            <72832..>74112
                     /locus_tag="CYME_CMH024C"
                     /product="chloroplast peptide chain release factor RF-1"
                     /transcript_id="XM_005535958.1"
                     /db_xref="GeneID:16993361"
     CDS             72832..74112
                     /locus_tag="CYME_CMH024C"
                     /codon_start=1
                     /product="chloroplast peptide chain release factor RF-1"
                     /protein_id="XP_005536015.1"
                     /db_xref="GeneID:16993361"
                     /translation="MKRPVSRSCAFATPLRVVCVRHGLSLTHREGSYGCRGPARFSVR
                     VATSMSLDPGIVHKLQSTQAAYDDLTKSLSDTAVCADAGELARLMKARAKLEPICEAY
                     GEWKRLQETIASLSELLEDEELRELARSEMQEATSKLEETEERIRFLLLPQDPNDEKN
                     IMLEIRAGTGGDEASLWCGDLVNLYTRYAQSKKWSVKLVSASAADVGGYKECILEISG
                     DNVYSRLKFEAGVHRVQRVPATETMGRVHTSTATVAVMPQVDEIEVKIDPKDLEIQTA
                     RSGGAGGQNVNKVETAVDLYHKPSGIRVFCTEERSQQKNRERALQILRAKLYEIQLNE
                     QREKIEGLRRSQVGTGSRSEKIRTYNYKDARVTDHRLSQNFSLENFLQGKLDEIIDAL
                     IFEDQQRRIESMMIDPGPAAADTDMMRSSNAVRR"
     gene            <75548..>76471
                     /locus_tag="CYME_CMH025C"
                     /db_xref="GeneID:16993362"
     mRNA            <75548..>76471
                     /locus_tag="CYME_CMH025C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535959.1"
                     /db_xref="GeneID:16993362"
     CDS             75548..76471
                     /locus_tag="CYME_CMH025C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536016.1"
                     /db_xref="GeneID:16993362"
                     /translation="MPTQRRDLEVQRSYVFFTELISHAELYSPPLEVTKAQTLISAVQ
                     DILHNVRAGDSTLAAILWKTIPVHSRLSGAAHLNALSGLAAILSTIHLSSIAHSSHLV
                     RSCFRRTIRELESFGPKSLNRGSKLYSAIILFGMLIHERVISAEALLVLWQHLRECFV
                     RILGAGLSSPQEAMDLDAADWTLHAALDIAYITGDILAKEEPGSKIYTGLCLFKERLR
                     RAIWEGVLEHHAQPCRMCHISSERSLAERAVIFVEALDRNGAGVLQRNAHRASTDLLK
                     EICMPPELKQGVHRYPCISLPAFQNRRERVL"
     gene            <78607..>80487
                     /locus_tag="CYME_CMH026C"
                     /db_xref="GeneID:16993363"
     mRNA            <78607..>80487
                     /locus_tag="CYME_CMH026C"
                     /product="similar to (N6-adenosine)-methyltransferase"
                     /transcript_id="XM_005535960.1"
                     /db_xref="GeneID:16993363"
     CDS             78607..80487
                     /locus_tag="CYME_CMH026C"
                     /codon_start=1
                     /product="similar to (N6-adenosine)-methyltransferase"
                     /protein_id="XP_005536017.1"
                     /db_xref="GeneID:16993363"
                     /translation="MKGERKRPQRHDRDADRELALRLHNEEKQELRGLRRQTRTSADK
                     AVVEDATVMGRPCETVTGLDSFLSSCLNETGRHSRPRASRKRTVENAFEHFSVAKYTE
                     KHAKLEPRKQGTSALPIDEIQTVPIKDLDQFPSCVGVAENQKTSSSLRRQIREQIRRL
                     NDGYYINCDLRYFNLAYLRECVGNFDVVLIDPPWRIAGGQRASTPNGPMFTNNHWAVN
                     YNTLSNEEILDLDIGCLSNSGLCFLWVVSSQLPTGMACLSRWGYEYIDKITWIKKRQG
                     KLHVSHGYHFMHSSELCLIGVKRPCEFIGKVSNDLIFAEVREKSRKPDELYHVVETML
                     PGTAKIELFARNHNIRRGWLSLGNELGEQFCDWFNDFECDMCGARIHFGERRYKAKNR
                     PNSDFCRDCYLEAISAGVTTETEWFELANDAADPVYHEYYECNHCNIYPLWGVRFHRD
                     PDMDLCEQCYDELVANDAETEDASNNARTSSPDDWTAIESPICGGSLPVHRNIRCSSC
                     LQCPIIGYRFSCTCCENLSLCQKCFFQQKCPKGHNADHDIVIIVDSEAALNALVRCDG
                     CGIRPILGTRYRCNTCYAFDLCETCYKKVEQGEYDLQQVSQKKLAEHNRSHAFSAIPV
                     SA"
     gene            complement(<81193..>82011)
                     /locus_tag="CYME_CMH027C"
                     /db_xref="GeneID:16993364"
     mRNA            complement(<81193..>82011)
                     /locus_tag="CYME_CMH027C"
                     /product="similar to transcriptional activator FHA1"
                     /transcript_id="XM_005535961.1"
                     /db_xref="GeneID:16993364"
     CDS             complement(81193..82011)
                     /locus_tag="CYME_CMH027C"
                     /codon_start=1
                     /product="similar to transcriptional activator FHA1"
                     /protein_id="XP_005536018.1"
                     /db_xref="GeneID:16993364"
                     /translation="MPYLAETKVPAILYAKIITESQSHYMTKPTLTIGRSSNKTAGLA
                     SEYTLWLPSRDRAVSRIHATIALNVDMQSFELFVQGKNGMEVNGSFVCPNSAPVQLRS
                     QDVLQAGSCTLWFLLPCAKGLGPRKRKKLGGADLRYKTPLTMAQSEQGGHRAPLTESK
                     ISQRLINDLPQYLGELIASAEGHRMLYDDIVDRVFELHPNVHDHMWIKSAIRHTLALN
                     DYFETVVVGNQAVWTLKPQHLSRFLHKRNPGSLEKDEKVESSQKNETAVKSAVS"
     gene            <82071..>83501
                     /locus_tag="CYME_CMH028C"
                     /db_xref="GeneID:16993365"
     mRNA            <82071..>83501
                     /locus_tag="CYME_CMH028C"
                     /product="probable alpha-1,3-glucosyltransferase ALG6"
                     /transcript_id="XM_005535962.1"
                     /db_xref="GeneID:16993365"
     CDS             82071..83501
                     /locus_tag="CYME_CMH028C"
                     /codon_start=1
                     /product="probable alpha-1,3-glucosyltransferase ALG6"
                     /protein_id="XP_005536019.1"
                     /db_xref="GeneID:16993365"
                     /translation="MKVLQSCRFGQLRKLLLIIVLAIYIRASIGLFPYSGEHRPPRFG
                     DYEAHRYWSAVTLHMRPVANWYTHPGDYWVIDYPPLSAYLAFAIGICARLLDFEGAVQ
                     ADAYGYESESSRAFFRGTVLLVDLLFFFPAAYFASGGDLNRFASLTLFQPCWILIDHA
                     HFHYTCIQLGFILWMIARYRTIKLTMIATAVLFKQTSIYFLPVPAMDALRQAWRRAFP
                     DNDVLFSVLVALFILYPFKLDALLRRVFPFHRGVFEDKVATFWCTISPLLRRTGLLRS
                     RFLPPACGLMTLVAVIPFLMGSPGRCITESDRLRLCIRLTGCSLAFYLFSYHVHEKHI
                     LLPLLPLSLCAHEYPDIIIWATSTAVFSLLPLFLHEGSAMALVALIIWTCLGRGRRPS
                     VAWMLLALPLGILLAVDGNPFRERYPYLLPYFVAIFCFLNFLMLLLWCYKEHAKLSGC
                     SFTVEGARNLLFRSLNFSRAPPQKLS"
     gene            complement(82333..83923)
                     /locus_tag="CYME_CMH029T"
                     /db_xref="GeneID:16993366"
     misc_RNA        complement(82333..83923)
                     /locus_tag="CYME_CMH029T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461294.1"
                     /db_xref="GeneID:16993366"
     gene            complement(<87573..>88337)
                     /locus_tag="CYME_CMH030C"
                     /db_xref="GeneID:16993367"
     mRNA            complement(<87573..>88337)
                     /locus_tag="CYME_CMH030C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535963.1"
                     /db_xref="GeneID:16993367"
     CDS             complement(87573..88337)
                     /locus_tag="CYME_CMH030C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536020.1"
                     /db_xref="GeneID:16993367"
                     /translation="MTSRLLRTCFPCLAVERDFGTENRGGLPANLEALSNDTPQAPQQ
                     EPANELPGETKAHCTGLSVSQVSAESRDAIADAPKTSSEASSEGKHDISSIFASWIDE
                     TFRNRNVRRALLLRKSDSKVLASYCAATDSGENNVSDMIGPLFLASAAYAADTIFDVL
                     SAPRHRFARYTSRDDDCMNLNHFGHRMWSITGSRGFQLSVYHLRETSDYCIIIGERSQ
                     SSEPLSALWGHRRWVLESHLVLLERAIKASMSRCAL"
     misc_feature    complement(88353..90631)
                     /note="repetitive element"
     gene            <91997..>94300
                     /locus_tag="CYME_CMH032C"
                     /db_xref="GeneID:16993368"
     mRNA            <91997..>94300
                     /locus_tag="CYME_CMH032C"
                     /product="similar to protein phosphatase 2C"
                     /transcript_id="XM_005535964.1"
                     /db_xref="GeneID:16993368"
     CDS             91997..94300
                     /locus_tag="CYME_CMH032C"
                     /codon_start=1
                     /product="similar to protein phosphatase 2C"
                     /protein_id="XP_005536021.1"
                     /db_xref="GeneID:16993368"
                     /translation="MIPRKLPTSETRSKPPSFGHRAGQRHRTQLVERQGGQEWKHDHL
                     GESTEGRSVCSCEACRTLSLAGFPNSSNSSNSSNSSSSSLSELEDRPQCIGGYSSSSG
                     GAAEGVDQYVWELHEGFNMGTPTQTIQRPAECPSFGYGAFRSRRADSGSEPLANEPLE
                     TMRDLSIHDAASHDTQKLPSMKHRAGDVSSVTVPSTNAKFAVAGHSDAPKIFSSPEAE
                     ARLLPCSSYADSATTGSSSLHEGLVQLDVVDYRMRIVSKQISSSMPVYETRQLSTSRA
                     SSRNTAVLGRLWSVASLGVNRPNEDRWHVERQRLICDFQSYAPFKLSQASLRSEAGTS
                     SVAALKSVKCSGSAVGFTRPATPPGSHDVAECEVADCDSGFESDDSFTVGLFDGHEGA
                     TCCELVGELLLETIRDRCTKNGKYTTMLQELGIEGFARCLIETFEFVDKKILELLWEH
                     LERSGDGHFAITGACCITATLMNGGRDLFVASLGDCEAYLGRRCCAAAELPHPQEGAN
                     KRMARKNFEAIRLCRSHNLRISENSKALMERFPNDPSVVQKIGNNFFVKGKLQVSHAF
                     GNGYLKEQRFNERLYPIFRAKSPYCGGYVSATPHVEHVSLMDRDEFLILGTDGFWENA
                     EPEVVVELLGHFFHDREILEGNLDQISIDPRRASELLMQYVWLRLHDSIEPASLRTAG
                     QTGGKSSGSCAAEPRPQLRDDCSVLVLFLRPTEIGDAEEAISYTGNMDCTDFCEQLDG
                     DTKERIQRLRASISEWMRTYGEHSDEI"
     misc_feature    96651..98163
                     /note="repetitive element"
     gene            <98387..>101425
                     /locus_tag="CYME_CMH034C"
                     /db_xref="GeneID:16993369"
     mRNA            <98387..>101425
                     /locus_tag="CYME_CMH034C"
                     /product="probable DNA repair endonuclease XPF"
                     /transcript_id="XM_005535965.1"
                     /db_xref="GeneID:16993369"
     CDS             98387..101425
                     /locus_tag="CYME_CMH034C"
                     /codon_start=1
                     /product="probable DNA repair endonuclease XPF"
                     /protein_id="XP_005536022.1"
                     /db_xref="GeneID:16993369"
                     /translation="MLHYEKTAAAEILRGGNSLAVFSRGLDLGSLVAIVAAEKLLLSE
                     GRPILALNFPKTVFQRLGRLLATHPAKFPIHLLPRHVSSSVSAVERFEVYGCGGIIAA
                     TPRTLAVDLLTAVSQLGDHGAKKVPTLSFLGILIYNAHEISEHRSETFVTRLFREYVG
                     RCELEDTFIHAFSDAAPALCRGFHSAEKLMRLLGLERLLLYPRFHVDVVTSLEHKTEN
                     PQSYVDGGYGTHSSSSAGIELLELHQPMTALMKAIQDEILVLMRSCFFELRRSSPAAE
                     LDESDLRVAATSRSILQAAQRIGQEWRRLNSRSRQLLQDIQNLNSILSSLLDDDCVTF
                     LAYLESLRDTQGATSLWMAMESAQNLYRLARERVFRGTDTGGDSKLMGMQDAALDLRA
                     SETGELPFEFSQKLVCPEPNSKWELLKELLDEVVSMLMGHQRHGNVSDASTRRVLVLG
                     REPCTIQFLAEYLHYREGAFDALHRRLLLYLGTKSGGKARESVRPTTATMSKAVPSLR
                     VKSDAIDASQSSSNAESEHSSACTDMRQHAPNQRITAEHDSPGQKFGHLQGDAAGHAS
                     PRESASDNYNSAPAHASSAVSQCADAARVEILLKSYGRRQSSTGVENLIGPSTILPFL
                     LDSQPCSIIMLDPTLQHVREIEVYQAAYSRFAKIRVYAVFYEESPEYELYCNAIADEK
                     HAFQTLIRHKASMAVRLDQSSAVAVPDTGPERIYWPLWAGSLAKADRPSPSSGRPQIL
                     VDVREFRSTLPGCLYQAGFELLPRTLKVGDYVLTPDICVERKSIPDLTSSLASGRLYT
                     QCQAMCRLYRYPLLMIELQEDDIGSTGAKAHVTNLFAPSLSFQENSSHGPATGIGKLC
                     LLTIHFPRLRLLWCRGPQAGAEVFGTLKIGEAEPSGEPTGQISGESEATEDSSAEASL
                     YSVMNARDAFAMRPFDMLRCLPGVENATVFALMRQFRTLTDLANAEADNMAKHFGPTL
                     AKQLISFINTEFRDPNEVSASAAGAEPVSKKIRSTSPADL"
     misc_feature    complement(98981..101941)
                     /note="possible transcribed region"
     gene            <104011..>105183
                     /locus_tag="CYME_CMH036C"
                     /db_xref="GeneID:16993371"
     mRNA            <104011..>105183
                     /locus_tag="CYME_CMH036C"
                     /product="O-acetylserine (thiol)-lyase 2"
                     /transcript_id="XM_005535966.1"
                     /db_xref="GeneID:16993371"
     CDS             104011..105183
                     /locus_tag="CYME_CMH036C"
                     /codon_start=1
                     /product="O-acetylserine (thiol)-lyase 2"
                     /protein_id="XP_005536023.1"
                     /db_xref="GeneID:16993371"
                     /translation="MVQHAANGHAQCSFRPLRYKAETRGRVARSTRERVLLRCLFDMR
                     LVHNVYDSFEDAIGNTPLIKLRRASERTGCNIYGKAEFMEPGGSVKDRAALYLLTDAE
                     KRGTLKLGSIVVEGTAGNTGIGLTLLGNSRGYRTVIVIPETQSEEKKEFLRSCGAELV
                     QVPAAPYRNPNNYVRLSERLAKELGAFWANQFDNPANRRAHEETTGPEIWDQLDGHID
                     AFNCAVGTGGTLAGVSAFLRAKNPGIKIALTDPQGAALVRYYQCGELVSVGDSITEGI
                     GQSRITGNLEGFVPDMSFEISDAEALQAAYDVVRHEGLHIGLSSGINIAGAIRVAESL
                     GPGHTIVTILCDGGSRYQKKMFQPSFLEQKKLPIPTWLSDSMKPDLAAALSKVYVP"
     gene            complement(104254..106018)
                     /locus_tag="CYME_CMH037T"
                     /db_xref="GeneID:16993372"
     misc_RNA        complement(104254..106018)
                     /locus_tag="CYME_CMH037T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461295.1"
                     /db_xref="GeneID:16993372"
     gene            <108201..>108608
                     /locus_tag="CYME_CMH038C"
                     /db_xref="GeneID:16993373"
     mRNA            <108201..>108608
                     /locus_tag="CYME_CMH038C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535967.1"
                     /db_xref="GeneID:16993373"
     CDS             108201..108608
                     /locus_tag="CYME_CMH038C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536024.1"
                     /db_xref="GeneID:16993373"
                     /translation="MASTGWSNFRRTWLKTEVLPVLSAVGLGVVVAFYHFSHKVLNSS
                     SITFNRRDRSVGGIERYNRLDEEQVWRDQHGLMSFAIDKSESIFHNDRRIYEAKRLPN
                     PEYVPPQSAELTQSAGTGEVLADDLAANAQASP"
     gene            <109515..>110717
                     /locus_tag="CYME_CMH039C"
                     /db_xref="GeneID:16993374"
     mRNA            <109515..>110717
                     /locus_tag="CYME_CMH039C"
                     /product="similar to PREG1-like negative regulator"
                     /transcript_id="XM_005535968.1"
                     /db_xref="GeneID:16993374"
     CDS             109515..110717
                     /locus_tag="CYME_CMH039C"
                     /codon_start=1
                     /product="similar to PREG1-like negative regulator"
                     /protein_id="XP_005536025.1"
                     /db_xref="GeneID:16993374"
                     /translation="MGRNESAGMNWSAYAGITLRLPWTESGVVEAAHTPTDARVCDRS
                     TPVGLTEVPVLRHSDQSSVFVNRSGASSGDDCSPASVHLETGQDAVFLRHFPEWARDG
                     RHERHTLDSASTMRLYFSKSADIFEDFSNQRKLCPSPSASLISWSAEINNDREKGDLV
                     GRILSAALLSWVADNEQTRARGMQMQEASPFHASRIPSISVEAYFERIYTFAFCSKAC
                     YVIALLYLDRLSARNANLALTSFTAHRLLITAVMLAAKFFDDIFYNNAYYAKVGGLPL
                     SEMNALEVRMLRELSYQLNVSVEEFYNFESMLINRAVRSAPELGRQLSESGFPLHHTL
                     WHPLSPSLPIPPAWGNLCQNAPGNDPQTPKVVAGWPCVWIKQPLQIDCPKIEGAMHAE
                     SRRVSYWH"
     gene            complement(<110727..>111521)
                     /locus_tag="CYME_CMH040C"
                     /db_xref="GeneID:16993375"
     mRNA            complement(<110727..>111521)
                     /locus_tag="CYME_CMH040C"
                     /product="similar to glutamine amidotransferase class I"
                     /transcript_id="XM_005535969.1"
                     /db_xref="GeneID:16993375"
     CDS             complement(110727..111521)
                     /locus_tag="CYME_CMH040C"
                     /codon_start=1
                     /product="similar to glutamine amidotransferase class I"
                     /protein_id="XP_005536026.1"
                     /db_xref="GeneID:16993375"
                     /translation="MIDQIAVVDCQTLPEAVKQRTGCSGFFDAFVQLFEQTGQKNLVY
                     TRYEAARGEFPDLDDSSLRAVFISGSFSSAYDEDLWIQTLKHNIQRARGRIPLVGICF
                     GHQVIAEALGGKCGSVAAGPEVGCVSTQLTARGRELFRRLSGGTLDADTVCLIYFHFD
                     EVQVLPPGAVLLASSPSCPVEGYLLPEDRILCLQGHPEFGATTELMPALLSSSLERGR
                     LKLDAYWSAAASLKVPQDGHAIGACLLEFAVSDPKSWSALRPWSPK"
     misc_feature    complement(111705..113658)
                     /note="repetitive element"
     gene            <116965..>118071
                     /locus_tag="CYME_CMH042C"
                     /db_xref="GeneID:16993376"
     mRNA            <116965..>118071
                     /locus_tag="CYME_CMH042C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535970.1"
                     /db_xref="GeneID:16993376"
     CDS             116965..118071
                     /locus_tag="CYME_CMH042C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536027.1"
                     /db_xref="GeneID:16993376"
                     /translation="MSQKLEETARSTGKVLCAFTVLLSMKQSHRAPLRAWSRIQPCFG
                     SSCHPLYKKGTGATRLSRNNRTGRAALWPQLNVEHRKPRVQRERNALKVRADVTAERD
                     TSETSKLRQFVPKAIIFDCDGVLVESEELHRVTYNETFDAEGLSHIQWSQDYYEILQN
                     KIGGGKEKYLYHFQNEGWPTPEQCGFDTTTPSGREALIQHLHQSKSARYAERIRNDDS
                     IRLRPGVGEIIDTAHKRGIRLAICSASNRESVEAVLKRILSERPPGASRSKSRFEMFE
                     FIIAGDSVPKKKPDPLIYEVALERLGVAPSDCLVIEDSAIGLAAARGAGIRCVITYTW
                     YTKSQSFDGATAIFGELDGVSLDDILDAVTVSSN"
     gene            complement(<120222..>121811)
                     /locus_tag="CYME_CMH043C"
                     /db_xref="GeneID:16993377"
     mRNA            complement(<120222..>121811)
                     /locus_tag="CYME_CMH043C"
                     /product="unknown RNA-binding protein"
                     /transcript_id="XM_005535971.1"
                     /db_xref="GeneID:16993377"
     CDS             complement(120222..121811)
                     /locus_tag="CYME_CMH043C"
                     /codon_start=1
                     /product="unknown RNA-binding protein"
                     /protein_id="XP_005536028.1"
                     /db_xref="GeneID:16993377"
                     /translation="MGKGASNSHKQLIETFLQTYYSALSRQLEGFHRFYVDKEGQLTC
                     DYVLRGVTLPWIPLRSGSLPEEALPGTRTPAAESPGDAAPAGWSRADVPHASVDGGSG
                     SPAEFRISEFSFDPKQMPLETAVGLLQAAIQSALPAVYYDIRISSYDVDEITSPGHPG
                     SVTSDVYVVAVGSIHVSEVPRPAWNAEPVPVSLLKYVALFPFIQTFRLRLKQVKAESD
                     EKNAAFFNNNQDAIHVWICHDVLRYLDGNILNWLPPATHTSDGQSDSVPQFSRAGLDA
                     EQERVIMPAAHQGPMYPFAPSPQPLSYAGNFQRTGMMPFFPYPFGTLPNAHVLASADV
                     TRMMQGRYQMPGFIPPQPVYGMNPGAVPANIPMSSGVKAADDLPFACTIWVGGVPPGS
                     TEDLIRAEFSRFGPIHKVDYRPMRGFAFIVFVSEKARDRAIEQYRSGNFVPTTRHFEN
                     AHLKIDYKREFGNRSMHPIYRVPYRMQPRIPQPGVAHQFEVVARGDYPAPQQVASVET
                     SQEIYPAPGESPVRAPTLPSR"
     gene            <123056..>124408
                     /locus_tag="CYME_CMH044C"
                     /db_xref="GeneID:16993378"
     mRNA            <123056..>124408
                     /locus_tag="CYME_CMH044C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535972.1"
                     /db_xref="GeneID:16993378"
     CDS             123056..124408
                     /locus_tag="CYME_CMH044C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536029.1"
                     /db_xref="GeneID:16993378"
                     /translation="MRFFLSFCVFSQRTVKYPSNPYLQFTLPILLLGYTGRFVRPIVC
                     LVPAESDSNSAYSAGAVAARRQNGVAVPQSASARGLIRGARGSASSVDATLLGSRARQ
                     VHPWRASSAMGSELETGHADRSTSRSDDGPTPTQGSFEPGEEPSELHRSRTEATTPPN
                     RSRLRQILCEEPSTELVHSWIGPSDEVEQKGTPRSVPKTETKLLTRTAYSELRRNLKS
                     ERLNRRLFMKELDEAVTDFERTEIILRSQERELHQGLALLNHQASGSAEASAAPSPNR
                     PSPEIVQGSSVLRRRRLTPARERSSGLDPGLAALRLDAADVEIEKLGAETKAIFLQTQ
                     QVSASLAQMAQVLGTLLNSMNDLNRREPLDETRSSQGHAPADVHETSTERRTESGAQT
                     YPASFWKEPACSQQHVCQSKRTSMSALLKVGGALTVLSVPVYLLVLWLLFEEMTYWLV
                     "
     gene            complement(<125132..>125770)
                     /locus_tag="CYME_CMH045C"
                     /db_xref="GeneID:16993379"
     mRNA            complement(<125132..>125770)
                     /locus_tag="CYME_CMH045C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535973.1"
                     /db_xref="GeneID:16993379"
     CDS             complement(125132..125770)
                     /locus_tag="CYME_CMH045C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536030.1"
                     /db_xref="GeneID:16993379"
                     /translation="MPGFGRLFSSRNSSKDRSTNSRTENVSSSNDFYDDTHLGYGVES
                     RARPIIEEPPDENEAQSSAGVDAWDYPGHHHRDLLNRDALSIWGGDSFSDPFSMMRSM
                     MTEMDSVFRNLDSHFGAFSTFDSVLADTSEHSFAQSTRTIRRTRPDGSVYEETVTTRR
                     APDGTVEETRTVRDSSTGENRTIANRGFEARALESKTGQGPRIEECPDGEEL"
     gene            <126975..>127427
                     /locus_tag="CYME_CMH046C"
                     /db_xref="GeneID:16993380"
     mRNA            <126975..>127427
                     /locus_tag="CYME_CMH046C"
                     /product="40S ribosomal protein S14"
                     /transcript_id="XM_005535974.1"
                     /db_xref="GeneID:16993380"
     CDS             126975..127427
                     /locus_tag="CYME_CMH046C"
                     /codon_start=1
                     /product="40S ribosomal protein S14"
                     /protein_id="XP_005536031.1"
                     /db_xref="GeneID:16993380"
                     /translation="MASKKRQAVVSEEVSQGPQLREGEECFAVCHIYASFNDTFIHVT
                     DLSGRETFVRRSGGMEVKADRDESSPYAAMIATQKVAERCKELGITALHIKVRGTGGS
                     KAKTFGPGAQAAIRALARSGMKIGRLEDVTPIPHDGTRRKGGRRGRRL"
     gene            <130178..>131422
                     /locus_tag="CYME_CMH047C"
                     /db_xref="GeneID:16993381"
     mRNA            <130178..>131422
                     /locus_tag="CYME_CMH047C"
                     /product="similar to mRNA binding protein CSP41 precursor"
                     /transcript_id="XM_005535975.1"
                     /db_xref="GeneID:16993381"
     CDS             130178..131422
                     /locus_tag="CYME_CMH047C"
                     /codon_start=1
                     /product="similar to mRNA binding protein CSP41 precursor"
                     /protein_id="XP_005536032.1"
                     /db_xref="GeneID:16993381"
                     /translation="MFCISEPFTLCASHTEHHRRALCGKQSVWGCFTNTTSWFGRNRG
                     VRNSAFLAGAADAFNSRSKARNLSRRASLSMKLPMSCRADTIGSKRCLVIGGTRFSGV
                     YLAKVLGDLGHEVVLYNRGSKPLQRVPNEPEGEFAARAAMSSTIIGDRTKPDEVKEKL
                     ASENFDAIFDMNGRELEDTRPFAELFAGKIDHYVYMSSAGVYLQSPVLPHIEGDACDP
                     KSRHLGKLQTEEFLDSHGLPWTAIRPTYIYGPSNYNPIEEWFFARIAEDRPIPIPGDG
                     TYMTGLGHVADLANAFAAVLGNPRAVGKVYNIQDRKSVTYNGIAKMCALAMGRDPESI
                     RIVHYDPNRVDIGKAKAFPFRLQHFFTSVNRALRELDWDVDFDLLDGLRDSYHNDFLP
                     KKQAGKLQVDFKTDDLILSQVS"
     gene            complement(<133647..>134384)
                     /locus_tag="CYME_CMH048C"
                     /db_xref="GeneID:16993382"
     mRNA            complement(<133647..>134384)
                     /locus_tag="CYME_CMH048C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535976.1"
                     /db_xref="GeneID:16993382"
     CDS             complement(133647..134384)
                     /locus_tag="CYME_CMH048C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536033.1"
                     /db_xref="GeneID:16993382"
                     /translation="MFLILNTATQFTAPLHAKRFSSVKQARNDFIVHGHRTVDSECAR
                     RKLPRGFHRTPPFALRLSCTGQTDQYMKWLESTRRPPMEDGSSSSTSTRPLSYLEQLE
                     QRRLEQSNNAVRPRDSAPEQAMNTARKRQGFWKRLQGAFTNLFPEKETALQRLRSYGL
                     AAILAYGFFDAITYSASFVIALITFKRATDNAPLTWQNFLKVVAGMWLLNNFSRPFRI
                     AGALLLAPLVDQFVVKPVARRFKPMSG"
     gene            complement(<134820..>135806)
                     /locus_tag="CYME_CMH049C"
                     /db_xref="GeneID:16993383"
     mRNA            complement(<134820..>135806)
                     /locus_tag="CYME_CMH049C"
                     /product="unknown homeobox protein"
                     /transcript_id="XM_005535977.1"
                     /db_xref="GeneID:16993383"
     CDS             complement(134820..135806)
                     /locus_tag="CYME_CMH049C"
                     /codon_start=1
                     /product="unknown homeobox protein"
                     /protein_id="XP_005536034.1"
                     /db_xref="GeneID:16993383"
                     /translation="MYPPCTFKQTQTERNRINSGPETLAAAIQAEVSSMDSQGGAAEK
                     PLLSPGSGNSCWGTRKSAGAMHTCLQSQFQRPVNVCAVGLLVPFHQLLALVRSHSFFG
                     KLASGVQDVVVAPPADSSAEELQILTILDTLAAAVCYVRNLQAWVALQRFNTPADTLD
                     LLLPDAEATGAGRRRPASPISAAHLDSSSQDSGNISINTKRDLRETSDTLQSRSCTYC
                     PDRSILEDWFFKHFDHPYPSEREKCELAFRSGLTLRQVNDYFANKRVRCRRRAETLRR
                     RAVPPSSPPGVMQKSWSVPLGRDVAVDFSRRGAVWRARVLPYAKHLLSRETF"
     gene            <137597..>138124
                     /locus_tag="CYME_CMH050C"
                     /db_xref="GeneID:16993384"
     mRNA            <137597..>138124
                     /locus_tag="CYME_CMH050C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535978.1"
                     /db_xref="GeneID:16993384"
     CDS             137597..138124
                     /locus_tag="CYME_CMH050C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536035.1"
                     /db_xref="GeneID:16993384"
                     /translation="MFLTAAPWSLRRSKRSCSQCPRTLFCCTGTTRMGAEGSLWRLAN
                     AGHALLLVDHGSRRKEANEALFDMIELLRRRAPPGIIIHGAHMEMAEPTLDDGFRACV
                     EAGARHIVVVPYFLAPGRHSTTDIPNMAAEAASKHAHVTYTVTAPLGVHESIGNVVIE
                     RAMEAMGLDALRERD"
     misc_feature    139558..140775
                     /note="possible transcribed region"
     gene            complement(<142914..>144710)
                     /locus_tag="CYME_CMH052C"
                     /db_xref="GeneID:16993386"
     mRNA            complement(<142914..>144710)
                     /locus_tag="CYME_CMH052C"
                     /product="pyrophosphate--fructose-6-phosphate
                     1-phosphotransferase, beta subunit"
                     /transcript_id="XM_005535979.1"
                     /db_xref="GeneID:16993386"
     CDS             complement(142914..144710)
                     /locus_tag="CYME_CMH052C"
                     /codon_start=1
                     /product="pyrophosphate--fructose-6-phosphate
                     1-phosphotransferase, beta subunit"
                     /protein_id="XP_005536036.1"
                     /db_xref="GeneID:16993386"
                     /translation="MPLTLAKLPYEQDPEAIELSRKRLGIRVEKHTPLALQRHLYRPR
                     CPPVLRGAFTVRRASSPQSAMDHDERIKALFPHVHHKPIVEIAFHDGEKPMSIGRPLR
                     LGVLFSGGPAPGGHNVLAGLHDFLASRNISSSLVGFLGGPSGLIEGKYKEITEETLFR
                     YRNQGGFHLLGSGRTKIETPEQLDAAFTTCERLQLDGLVIVGGDDSNTNACVLAEYIA
                     ARGGTTCVVGVPKTIDGDLRNAYIEASFGFDSACKLYAEIVSNLALDAVSAQKVYHIC
                     RLMGRSASHITLEVALQTHPNLAIISEEVAAHKQTLGMIVDTIADLVCERAALAKNYG
                     VIILPEGLVEFMPDIKSLIQELNEVLAQAPARNGVAAGDAPQNPSEEADEANALGDPD
                     ASLVVIRRIAQRLSKESAELLSSLPSAFAVQLCMDRDPHGNVQVSKIESERLVAEMVE
                     RELEKRKQEGTYRGKFSAVTHFLGYEGRCGLPSNFDCNYCYVLGLVAGGLVENGCNGY
                     IARATGLTQAPELWHVGGVPLTAMMTIERRKGRDIPVISKSVVDMAGPIFQNFKRERH
                     SWALSDDYRIVGPMQFYGDGADCLTISMQIGD"
     misc_feature    145478..148118
                     /note="repetitive element"
     gene            complement(149541..150872)
                     /locus_tag="CYME_CMH054T"
                     /db_xref="GeneID:16993387"
     misc_RNA        complement(149541..150872)
                     /locus_tag="CYME_CMH054T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461296.1"
                     /db_xref="GeneID:16993387"
     gene            <151061..>157651
                     /locus_tag="CYME_CMH055C"
                     /db_xref="GeneID:16993388"
     mRNA            <151061..>157651
                     /locus_tag="CYME_CMH055C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535980.1"
                     /db_xref="GeneID:16993388"
     CDS             151061..157651
                     /locus_tag="CYME_CMH055C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536037.1"
                     /db_xref="GeneID:16993388"
                     /translation="MESSELADSEPSAQQDGVAASDSPASTDGTHEPRSGKSSEHEAH
                     NFPRTGSIMEVELEFDYIEHLLEEKLHRILEKLWEQRRVERSLVTAATARLFAAQTLR
                     RVKLEIRDAHGSLLGSTSYVDYDKQSNKVQFRRQKVKFFVHIADKPTARDLIRVNVIG
                     RTTPLKRYSSYVLPIPPALAKQAAASEHATLEHQSLAVREQYFASLPVDESAALSPVP
                     FPSKLLLEHSKRKPTSSAVHQDATRGASTVDTEDEPEALPNTQNSTEASPPTDAAVAS
                     SHHSLHSTRIHLGHCSLELHRLWAHQGNAVYHALHAAGRHARLLLRRQVHLLPFCSLS
                     LAARLPTFPHGSYSIRIHVHDVSIFQSGPKAFTSMNPVVHVYALGDTQHTQVCRWSFT
                     AIFDRMLFFSKTLGQEQIRDEVITLAVWNWNFWRPSQLIGSYSFDFLALWNQKDHCFR
                     ERWLPLTNTTGNEDDLVGYIRISAVVYGPGIMPVAEHSTHAARTTAAAPRLLKNLVIQ
                     RPSLLIERWRLYIAILGIELAPSTPEAALNASEASHTPAGTNEKSSKLTRHRASQARL
                     LSRRSEAGESNGKQVYCEIVFAGREKKAVIASEVVRVGFGKETSLSMGFCLPISLTNH
                     EEANFEDILLRLRESPSSRLIADVHLPLSGLLQRGCTASIQYRDQTQLSLTADTEMHH
                     HRTSAASSHLGHRTHGESTTKLERLFRIVHWLEQLVHSHLLHQHKQHGHIRERRVFEM
                     RPHYIHLNASPTKYVGRILLAARMWPHSPHCKAIPLWYQRLNWAELFTASQRAPHRLQ
                     YTLYVRLQRITELPLPDSSLVRVYLKIGDRLIAQTDLAPVHHHSAVTGALLPVPPVQS
                     VTNQKTQAMKLEVEQDLRNIPDLFLQVFYRMGHDAPERYFSLLRLPASLLHALPDDGL
                     CRSWLMDMPVTETEGTDVSVAGTAYLYICLRHQGDAHAPTKVTREPSRSRHSGTREVS
                     STGPVDGHNISADTYWVECNILRCRNLPAADPTGFSDPFLVVRFGAARAFGTRLCHQT
                     CDPSFQERLLVGPVQLSRFEALPPVSVKVFDWDDDPAAFDPRKLDKAEYLCRAEVDLT
                     ALDASEPTWFDMFITNPLIVHGGMLASFRLLNSSLASPSALETRVLRDPHIHLRAHVD
                     TPTQALTSGNNPQSPDQRDGDMAVQRPPLTITPKPADLQSQPSRGPAASYWMLVGLVS
                     IHHLGLGCFGLDPSRDSLSLRMFLNFRDGMQRSEPIHLSAGSSGSLGADQNHIGDVVI
                     LRLPPDIGDLSSLHIILESRDGERFYASANITPEEFAKKHLLVGGLQQYGLEYLEQRV
                     LMRRAKRQHGPLAGMQEALETASNGAPQRSGFDLSSFRRQLKQVWQHDVRASGLALWA
                     ALVNYLVEIAPEIALRFGLEEMEFPSSRLTPWLLRFFRLLHHRGLVTALEHYERSVIG
                     GRSKGPERPDHAVSDKSDAHGVHSVSDELERSLEPHAQFSEALLRHGLVRRKRRRVNL
                     TATGERGMLTGIKKMRLPQIRPSFRAEPSRKPRHAPSTIHPEAAALEQTAPAPCSVLA
                     AETPNSPATEDAEVVAEERSLSGAQAGPTAGTVTRRSSSTAVCAAVSPVRRRLRSGSG
                     HERRGARPLRRGRVSGRATASMLYRRDETERRLSLLHHESRRYNDPVPVGKLALDWRI
                     VRTGYAAVAADTNVVTALQRVEDVSDLEAYAAAFREQMRRRYVERNDVVVRLHVYHAR
                     GLRVPSGDPNIYLKVELNGGEKTLSTKRSPVRHSLNPDIFQSFEFTNVRLPGSRLTIR
                     VKHFAGPDFEVPNAAALVPRYATWTFGPFVHRAMSRDVRVDLVRAGIGRALLLGETEI
                     DLDQRWYTDLPPLSRLESPMETRRLFVPDRVIPRGELTLRLELLSAEEAANRPFRPLE
                     PLDPHQYELRLVIWRVIGCKLERVSEPVHGGDVDGAADGGRTRGTTASAAVGTTPSGN
                     ANASVPLQDLQVRAQLGNDTSSEIHTSVVHNCDDGSANFNYRLVWRPLHWPDPELVPR
                     LRLHVWDVHSPSGFPLVGQLAPSDPQLLATVTLDLSSIFEEAHRNNGRAQRFRQWIMM
                     HRVGSGPVAASPRIQVSLDLLSKEQAMQHRAGSQVGQSGLPEPLQPVPFSAFAPQRYI
                     RYRIARQWQDGFWYFVQAVLLVPGGIAVLKILAALPLLLYIAGAIVGIFLVLRMRRVE
                     QELEAM"
     gene            <158714..>160786
                     /locus_tag="CYME_CMH056C"
                     /db_xref="GeneID:16993389"
     mRNA            <158714..>160786
                     /locus_tag="CYME_CMH056C"
                     /product="protein kinase YAK1"
                     /transcript_id="XM_005535981.1"
                     /db_xref="GeneID:16993389"
     CDS             158714..160786
                     /locus_tag="CYME_CMH056C"
                     /codon_start=1
                     /product="protein kinase YAK1"
                     /protein_id="XP_005536038.1"
                     /db_xref="GeneID:16993389"
                     /translation="MSYGGHESSLQKRAWSARTRSTPTADGASTSASAGARQRKPLLE
                     LLTTDILRTYRRVSSVFEYDPKLNPRRTLTRPDQPRFNNGYDNENHDFILRVHDAIRS
                     PNGDVYEVLDLLGVGTFGQVVKCLELGSSRTVALKVVKNQEAYLRQALMEVYVLQMLH
                     RTFPAERVRHVVKLLQHFQFHHHLCLVLEKLGMSLFDLLKQNRFRGLGLLIVRSVLQQ
                     LLPTLDLLAQAGIIHCDLKPENLLLCRNDGVEVKLIDFGSACQENHVIYSYVQSRFYR
                     SPEVILGLPYGTKIDIWSLGCIVGELFLGLPLFPGHDDENMIQRMVDMLGMPPAWMIQ
                     SGKQSHRFFHNGHLRGLTSDALTGQGPVPWKQYFKHRKLEDIIVKSPMKPNTDEREEL
                     AQRRALLSLLRGMLEWDPGRRWTSTECMLHPFLSGRGMMDQETWLPPRLRSPNMGLRF
                     HTRDLATYGDEAAEDARALASASSAAHGSSKAQLPPAYVLSTSAPAFALHERAGDEAA
                     SLPAAASDATAREQRTRRLARPRQDSSMMQSLSATLEQALQTVQDCQRMERTPQQSNA
                     QCSIASGASRTFVEGNPMLASSPGMLADIAACTSSALYDAAWNPFAIEEAVEPTNAYM
                     LGDASSNMPHDPEIPEDDADIVPPAVPKAPTTALDSGAVAAASAPEPGGLASNVRIWP
                     FAGQGRGH"
     gene            complement(<160783..>162966)
                     /locus_tag="CYME_CMH057C"
                     /db_xref="GeneID:16993390"
     mRNA            complement(<160783..>162966)
                     /locus_tag="CYME_CMH057C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535982.1"
                     /db_xref="GeneID:16993390"
     CDS             complement(160783..162966)
                     /locus_tag="CYME_CMH057C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536039.1"
                     /db_xref="GeneID:16993390"
                     /translation="MRAEAGKRRASVVVGDQRGADEADSLTFETATKAGGVTSKANTV
                     GSSVSDRQTCQRPAPESASEHLSVQMLREHLSLSPTAADATEDALTWQRCEANCMDTE
                     PVTGAHARSWDAPDIFASAVKGHVTRKRYEEAQRRLCSIPDLVAATPMLQRRLAALVD
                     PSAGDVAASAPFRYGERDLLLQRGLCFARALVTKADVLLACIDSVDEEQLHLEIVAAY
                     TCAHILQAQARQEQHNVQLAQRPGASVVDDDWDQYRDRGLSRARVLVFAPTRQVAYAF
                     LSAVLRYLNPRQIGHAQRFEGAFGPDADDGTVSEEPNTLLVPPTEPVPDPGADTSRAR
                     HWRAKPRDHRAAFKGNIDDDFRLGVRVERRSLHFFADFADSDFVVVSPLGLQRVLDDP
                     DKGGMRGGAADPLSSIEIAVILRSHMMLMQNWDHLLRVVREAVNRMPAQVPQKTDFSR
                     VEQRFLEDHAAAYRQDILLSAFDFPECHAWFRLARRDHQGNVSGVLKLLRTRHAGVIA
                     DIPAPRRVRHVFRRLATPHGTGSGREGAATNTLSAVEAAELRFAAFSHDWLPKLVQST
                     HTHILIYIPSYFDFVRVRNLFRKWTEQAVYPASKLSFAACSEYSKPQDISRYRLLFFE
                     GRVRFLLVTERFHFYRRYHLRGSQYIFFYGVPQFPQFYTELVASLEASGSSFRQACTL
                     FIMPDDALALHRIVGSQRMAYITANQLRREFEFPAPVSFGARVCD"
     gene            <163843..>165717
                     /locus_tag="CYME_CMH058C"
                     /db_xref="GeneID:16993391"
     mRNA            <163843..>165717
                     /locus_tag="CYME_CMH058C"
                     /product="eukaryotic translation initiation factor eIF-5"
                     /transcript_id="XM_005535983.1"
                     /db_xref="GeneID:16993391"
     CDS             163843..165717
                     /locus_tag="CYME_CMH058C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-5"
                     /protein_id="XP_005536040.1"
                     /db_xref="GeneID:16993391"
                     /translation="MELGGSSGLVNIGGGSEDAHYRYKMPRIMGKIEGRGNGIKTRIV
                     NCSQIAKALHRPPGYICKFFGCELGAQTKISDDEDVYIVNGAHDQKLLADTLDKFVRM
                     FVLCPSCNMPETDLVIDKRGNIYHVCNACGAQHLVDMSHRVTTYMLNNPPDGARSKKS
                     GKSKKERKESKKKKGHEKGSNVHEEAPDADDAPDSGTDGKTKKKKSSKRRDGETEEAY
                     RERRAAEKAARRQERAAQKAGASAPWHANGTEALVAPTDLDALAQEAEAMNAALNQRR
                     RQTNATGQEDSELDESGSGDTSPSSPAAAQPHGFPSDAAQRHAGDRGMRTASHKSGGH
                     LESDRNALRPNGDHHYNDDDDHEDDDDDDDDDGEDPQADGDWTAHDDQTTSQMKLAAA
                     RAAALLTNAGVNGNGESPQRAVSKTTSKLDELHLVSSKGTVQRATTDVSVDDEKLDRF
                     EAWLRQGHHSPASIASEARKYFPNDSASAAQAIFCAVVAHAAHPECRPGESPARHAVH
                     AVDALRALSLNHAAQARLLDAFEALAGVGSDEARNLAPSDVQRGAKLSLQSRLNSIPH
                     ILKLFYDEDILDEQVIIDWFTRRSPGSSTAAGERARDAAKPLVEWLQQPSEAEDSTEE
                     "
     gene            complement(<166000..>168264)
                     /locus_tag="CYME_CMH059C"
                     /db_xref="GeneID:16993392"
     mRNA            complement(<166000..>168264)
                     /locus_tag="CYME_CMH059C"
                     /product="eukaryotic translation initiation factor 3
                     subunit E interacting protein"
                     /transcript_id="XM_005535984.1"
                     /db_xref="GeneID:16993392"
     CDS             complement(166000..168264)
                     /locus_tag="CYME_CMH059C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3
                     subunit E interacting protein"
                     /protein_id="XP_005536041.1"
                     /db_xref="GeneID:16993392"
                     /translation="MVETIVDPRKSTLPEEVSQYLVNFYNKFVDGDSVAVHGLYESGF
                     TRIAERFYKSCLLPQSSVVRELLRDLEAKVQRGTEADDDDESANAAAGHAPSYIELFM
                     LLYQELGYRHMHMRLHPTLKQRSQSWSNYLALFAHFAQGHLQECALPASWLWDLIDEF
                     LYQFEDYHQYRARSQDGHTLEELETENMNSMWNVRTTLEILSTLVEKSGIVGWLREAV
                     GAPKPDDNYPFASVNNAAAATATAEGARAATAATGSIAPAARGDSAEETAKDTGGGAG
                     EASPDNIGVHEDDAEDFRGAPGAAEEDEEDMANDSEDQSLTDADEDLGTLAPERCLAA
                     DSLLYRYLGYFAMVGLLRLHCATGDFFAALSVLDPPSLFETEWIRSVTISAVARASRE
                     KPIPSAANAEPAGTEGSLMQSTDLRLRLHTHVTACHVAVYYYIGFSALMLRRYEEAIR
                     ALQPTIVHITRTKHIHVRSFQYEQVNKRIDQMLALLSLAQCLGRNRLDDSMNSWLREK
                     LGDRTTRIRQGDLSAFEELYNHACPKFLQPSVANTCREVFLQQVAQSESGLPAQLSSY
                     LRIYRTIDVQKLSQYLGLGGSADHSTEQVLAALFCLKYRALLRHRAATASASGSPALG
                     TAMDSEYIGTNDTEFVIDDVGMVDVFETRTGKRPEDYFLRNIPRLGEQVSLYRRIQRD
                     RLAATAAAFAQKEQARQQRESEQRKAQEKQQQQQRLDSEQYARLSQAPDTMPVLPPRP
                     LSLAERLAGVERSH"
     gene            <168810..>172775
                     /locus_tag="CYME_CMH060C"
                     /db_xref="GeneID:16993393"
     mRNA            <168810..>172775
                     /locus_tag="CYME_CMH060C"
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit A"
                     /transcript_id="XM_005535985.1"
                     /db_xref="GeneID:16993393"
     CDS             168810..172775
                     /locus_tag="CYME_CMH060C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit A"
                     /protein_id="XP_005536042.1"
                     /db_xref="GeneID:16993393"
                     /translation="MSGAYPGRYGSMSRGGGTGGGGGGGGGYGGHRGRNQRFGSRYGR
                     PILKPENALNRAEQLLAVGQKSAAHEALYTLITEHTPINVGGREAQALVAQAQAQAQA
                     AAQVAANAAAVAQEQDEGGARSTAAAAAAAAAAAAAAASAIQSSTSGWSKVHEGIMMR
                     LVELSVELRRPLALKESLHRYRALCGVANTASLEAVVLHAVECSEAAVDAARTLAMES
                     FHASAAAQSPITEDAGDAEGDGNELISEGTDDIVADEVADSDDRGNATDDDAQPAWGV
                     EVPQTLLLEANGMLASRTRIERQLLAPTLMFAWEVFRMCLDILKNNIRVEKAYNEVAE
                     RALLFTAKFNRATEFRRLCDILRQHMAGLVRTIVRSPQSEIDQVHWPTVQRMIRIRFQ
                     QADQAMASGHWQEAYRTMDDLHELLRICTRGRSPEILAGYFERLATIFETTDNLLLHA
                     LALYKLYLVRQAAAEALQNQDPNQDADGQVPGPSSETPRDTAVRLLVATLSIPVKELS
                     AHSKVMEVFADAATLTSFEQARQAKMLDLLQWPSAASAGSNEAWDRLISNPTKSWLIG
                     EVISNGIEEACPEALRELLYEFIDPGLLRWKQAGKARLGTPQSLAAKAQRWFTSMHLD
                     VGSEVAGVTGSGGVDGTGGDCTGAGAPSSKPGQSARASMMPLSRAIIAELLLRIAQYY
                     DSFLLWELRSMVNFLPFVQVHAIVLEFLRAELVPFRLDFRKGVLYRFCRTIEQEELGD
                     ALCRIATRLQAAASTITQRASTADEHEIRILNAKEAAFPLERLEREQQRRVTQLEVLQ
                     SFLKQLDEVAQRMEREEQRQAQLEAARHAEEEKRRLAEEARRRELEAIRREMEEKEQA
                     ELRRLKAEMDARRRVGLSASGAAAGLALPSSVAGIESTAAGASLGTVGIGVDSVGGAG
                     GPARSVWSRSGSGTAAVLSGARATSALPGVAVDSVPGIGAGAADGFTAVGADALDHDG
                     DRLSRQELLQQQQQERLQQRKMLEQKIFQLSRRMDYLDRALHEKQATHLDQVHKEMVR
                     ELIARRQSAATCRLRQLQEQFESDLARRARLESIFRDPLYQKAVDHIKEEARARALRE
                     WKPRQGNGSPNQQTPIGNVSAEETPAEQTPGRTAAAAAAAEQQRQQQQPRSDTGSNGV
                     PASAYEAAAEHSPTATVPYPKQVPLAGTPTGNTVSATRSSGDNHSGPERPVPPAGETV
                     SEREQQARHAPAPALAPVAPRSGIVTIVHAADKGLLGDQPFVTPSTATSAGIPAPKAT
                     GNEESSQRRGYVPPHLRRQQQAPQRLAANQEPEQRAGLGARAGPRRGFGFTDSNPRPS
                     S"
     gene            complement(<172829..>173713)
                     /locus_tag="CYME_CMH061C"
                     /db_xref="GeneID:16993394"
     mRNA            complement(<172829..>173713)
                     /locus_tag="CYME_CMH061C"
                     /product="eukaryotic translation initiation factor eIF-2
                     beta subunit"
                     /transcript_id="XM_005535986.1"
                     /db_xref="GeneID:16993394"
     CDS             complement(172829..173713)
                     /locus_tag="CYME_CMH061C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-2
                     beta subunit"
                     /protein_id="XP_005536043.1"
                     /db_xref="GeneID:16993394"
                     /translation="MPPNENGAFQESSGNLAEVSASTGAGATADTAAALNTAEPLLFD
                     PSMKKKKKKKPVEQGTNAGDTTTALDSEQAPTERHVHFQVESDGDRAASPVDSGTAVN
                     AGTITTSSSSVSHENNMEAAEPWQGTDRDYTYDELLRRIFDMLHGRHPGLGGNPDGRR
                     RLSLRPPQIAREGSKRTVFLNFGDICQSLRRQPEHLAAYMAAELGTTGNLQESARLVL
                     KGRFQPAGFEGVLRRYIREYVMCASCKSPETVLMRDAHTRLYFMKCENCGSSRSVAPI
                     RQGFMAQTERRSLRRDAA"
     gene            <174970..>175629
                     /locus_tag="CYME_CMH062C"
                     /db_xref="GeneID:16993395"
     mRNA            <174970..>175629
                     /locus_tag="CYME_CMH062C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535987.1"
                     /db_xref="GeneID:16993395"
     CDS             174970..175629
                     /locus_tag="CYME_CMH062C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536044.1"
                     /db_xref="GeneID:16993395"
                     /translation="MDLESEWRENPHETARFEVLLERVLGNGTDSDTVTTPEPSLKVP
                     ASSLRLQLAPQAGERLDWESEADAAHHRGNEAFRARFLYYAWLEYTRALLSKPTNAAV
                     YANRAQVDLLLAQSVPEHSLSTAVDWYQQARRDARHAWGCLGGSVTAEGNPDWDERSA
                     TASIPEPKLARLRWKVCLRYAAAARGLGLVAEADAAAASAQRLKLAARASQQRQRNAS
                     F"
     gene            complement(<177430..>178272)
                     /locus_tag="CYME_CMH063C"
                     /db_xref="GeneID:16993396"
     mRNA            complement(<177430..>178272)
                     /locus_tag="CYME_CMH063C"
                     /product="similar to Surfeit 1, a protein involved in
                     cytochrome c oxidase assembly"
                     /transcript_id="XM_005535988.1"
                     /db_xref="GeneID:16993396"
     CDS             complement(177430..178272)
                     /locus_tag="CYME_CMH063C"
                     /codon_start=1
                     /product="similar to Surfeit 1, a protein involved in
                     cytochrome c oxidase assembly"
                     /protein_id="XP_005536045.1"
                     /db_xref="GeneID:16993396"
                     /translation="MIYPRAWSRLISYVPASITLGLGLWQLDRRREKIEQLNDCREQV
                     ALPPLDESIFSQDRGTLETQPYRLVRLQGEWVHHETRLVGPRPCPRGDQGAQASAADP
                     YGYFVVTPFRVAGTEQPNVPQLDGGLINWPVLVNRGWIPRLEVNEYWQRVRQVEENLT
                     GHVEHQNSLIAVLQKTERSTFFIPRNHPAEHKWFRLDPTDLGGELLLAELAEPASTIP
                     GETAQNDPLHDLSVSRPLTAELCQFYISPETHAGYSMTWFTLSAALGFLGWYRNRRLL
                     LDKR"
     gene            <180000..>181637
                     /locus_tag="CYME_CMH064C"
                     /db_xref="GeneID:16993397"
     mRNA            <180000..>181637
                     /locus_tag="CYME_CMH064C"
                     /product="similar to guanine nucleotide exchange factor"
                     /transcript_id="XM_005535989.1"
                     /db_xref="GeneID:16993397"
     CDS             180000..181637
                     /locus_tag="CYME_CMH064C"
                     /codon_start=1
                     /product="similar to guanine nucleotide exchange factor"
                     /protein_id="XP_005536046.1"
                     /db_xref="GeneID:16993397"
                     /translation="MRFADPKPQASIQTPCCASQSQPARFEAIPRPASQSCSAGGKAV
                     SMAPAKSDEQVVPDVASERGTPQRTSLESLFEEESLAQGERVRSQVSRLGLRRAPPLA
                     SQGDESIETAASLPETEVESSVQTESRQRSESVGVTVDLEQVYNRLRDSQTGLQLADR
                     RWRLITYSRCFVGSEAVQWMQINLGISREEAIDLGQRLMDAGLFHHVTYSEPFRDGNF
                     FYAFQEDEESNVLNTKLIWDPTRRPRDPVVVAKELITRLALLCEVFRHPSNANEVDFE
                     SLRSSDAFRKYTFAAAELQRVDLGPLSPEERLCFFCNVYNALCLHAHVVHGPPNTVLR
                     RWSFFKSLSYRIAGMDFTLDDIEHGVLRGNQTRPYGLIRQFRPGDPRMQYVLSRRDPR
                     IHFVISAGTQSDPPMRILDGENIDEELHFATESFLEESCKVSASALEVTLPRIFSWYR
                     DDFAKGNLELLRWILPYLGLEKRRALESMLDNAKSDSSISIRYEAFTWNAGARFSAAI
                     VRRKRRRLEQERASSQPPADEEPAAATAASPVSSKPA"
     gene            complement(181368..184075)
                     /locus_tag="CYME_CMH067T"
                     /db_xref="GeneID:16993398"
     misc_RNA        complement(181368..184075)
                     /locus_tag="CYME_CMH067T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461297.1"
                     /db_xref="GeneID:16993398"
     gene            complement(<181655..>182077)
                     /locus_tag="CYME_CMH065C"
                     /db_xref="GeneID:16993401"
     mRNA            complement(<181655..>182077)
                     /locus_tag="CYME_CMH065C"
                     /product="60S ribosomal protein L14"
                     /transcript_id="XM_005535990.1"
                     /db_xref="GeneID:16993401"
     CDS             complement(181655..182077)
                     /locus_tag="CYME_CMH065C"
                     /codon_start=1
                     /product="60S ribosomal protein L14"
                     /protein_id="XP_005536047.1"
                     /db_xref="GeneID:16993401"
                     /translation="MAFKRFVEVGRLCIISYGEHADKICVIVDIQDQGHVVIDATADS
                     GVPRTVINVKRLKLTDVVVKLPRACKTSVVRKALEAQQAVQRFRETAWGQKVEKQRVR
                     ARLTDFDRFRVMVARKRRSQLIKHELGRLRSETKTSAS"
     gene            <182345..>183022
                     /locus_tag="CYME_CMH066C"
                     /db_xref="GeneID:16993399"
     mRNA            <182345..>183022
                     /locus_tag="CYME_CMH066C"
                     /product="mitochondrial ribosomal protein S15 precursor"
                     /transcript_id="XM_005535991.1"
                     /db_xref="GeneID:16993399"
     CDS             182345..183022
                     /locus_tag="CYME_CMH066C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein S15 precursor"
                     /protein_id="XP_005536048.1"
                     /db_xref="GeneID:16993399"
                     /translation="MNSGAVGLWRRQTWALSALSRAATGLCPALRPLATEATDTNGSS
                     VGSGGNGQTAATGRPEDVSAERTSVTAPPQSFPVAAELVGIPRNVYDSLPEPVQTALL
                     AEFATGEQLQTWRERVAVRAFQRHELDTGSPEVQIAILTTRIANLTRHLRLHRKDVRT
                     KRSLEHIVAQRRRLLRYLFRTEPGRYEDTVERLGIRSGSLVDPQTERRARRPGDLSVP
                     TGNRNRP"
     misc_feature    185605..188949
                     /note="repetitive element"
     gene            <189147..>191003
                     /locus_tag="CYME_CMH069C"
                     /db_xref="GeneID:16993400"
     mRNA            <189147..>191003
                     /locus_tag="CYME_CMH069C"
                     /product="conserved GTP binding protein of unknown
                     function"
                     /transcript_id="XM_005535992.1"
                     /db_xref="GeneID:16993400"
     CDS             189147..191003
                     /locus_tag="CYME_CMH069C"
                     /codon_start=1
                     /product="conserved GTP binding protein of unknown
                     function"
                     /protein_id="XP_005536049.1"
                     /db_xref="GeneID:16993400"
                     /translation="MLVKAPLPTAEELPQAKGAAHTVGSSTPTDVQDTDRALDLENLN
                     LDSNTEVSLIAADLPPESDEGNTEYKRQLVQPSPQRFAELVTQLKYRMAAGHGEAMYQ
                     LGYDDDGRARGVPEDVLEASIETVERMAAELRADATVWRRARGRDGWVAQLLIRARPR
                     SCEEFTDTRICVSGNVDAGKSSLLGVLCGTGQLDNGRGLARAQVLTHKHELESGRTSA
                     ISMQLMGFDSAGHVVNYTNVTTNRQLSWAEIVTNSSKLITFCDLAGHEKYLKTTMFGL
                     TAHAPDYCMMVVALNQGVLRMTQEHFAIALALKIPVFVVFSKSDLAPANVAEHTISVM
                     TRMLKSSGARKIPVLVNSLDEVSICARNIPNDRMVPMFVVSNVTGAGLDLLRAFLNLL
                     PWRHDWNERKKSAFAEFTVDDHFSVPGVGTVVSGVCLRGVLQQGQSVFLGPDRHGHFA
                     RIAIKSIHYKRVPVQRLYAGQSGSLALKKIRRERVRKGMVVLSTAGFSNGAKSGSSPA
                     ASGNGNTPTTPVSVIEFEADVALMYHSTSVRAGYQPIVHCSTIRQAAQVTWMDRDVVR
                     MGERARAQFRFLYRPEWLRVGDRFCFREGRTKGIGHVTRLVECWTRDLITIN"
     misc_feature    complement(191547..192153)
                     /note="possible transcribed region"
     gene            <192710..>193606
                     /locus_tag="CYME_CMH071C"
                     /db_xref="GeneID:16993403"
     mRNA            <192710..>193606
                     /locus_tag="CYME_CMH071C"
                     /product="60S ribosomal protein L5"
                     /transcript_id="XM_005535993.1"
                     /db_xref="GeneID:16993403"
     CDS             192710..193606
                     /locus_tag="CYME_CMH071C"
                     /codon_start=1
                     /product="60S ribosomal protein L5"
                     /protein_id="XP_005536050.1"
                     /db_xref="GeneID:16993403"
                     /translation="MAFVKVVKNKAYFKRFQVKPRRRREGKTDYHARRALIIVDKTKY
                     NTPKYRLVVRITNSDVICQIVTARVEGDKVIAAAYAHELPRYGIKVGLTNFAAAYATG
                     LLVARRTLTILGLADAYQGKVEADGELYQVEPVGETRPFRAVLDVGLVRTTTGHRVFA
                     AMKGAVDGGIDIPHSEKRFPKYKKGSEFDPEELKARIYGNHVADYMRMLREEDPEKYQ
                     RQFSRYIQAGIDPDQLEDMYREAHRRIREDPRAVLTDKSRVTKRPRKTPKLSREEKQA
                     RLAARLAALARSGATESMVTVS"
     gene            complement(<194587..>195360)
                     /locus_tag="CYME_CMH072C"
                     /db_xref="GeneID:16993404"
     mRNA            complement(<194587..>195360)
                     /locus_tag="CYME_CMH072C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535994.1"
                     /db_xref="GeneID:16993404"
     CDS             complement(194587..195360)
                     /locus_tag="CYME_CMH072C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536051.1"
                     /db_xref="GeneID:16993404"
                     /translation="MQAGFVQLSGVGVSGPASLPARCGLLSGLSWRGFYRVQRSCGAR
                     GLRGHYTDIRHRGTSKPEWFDVLDQTDLHTIVGKKLRHEVHRDGDWHRAVHVWLYDPA
                     SDAVLLQLRSAAKDTHPLCWDVSAAGHLHSGEHDLSTAAKRELEEELGIGSVEPELLF
                     TVRSEYVDDHLRDREVQSVYVVCIPGAATATANADEADALGTSATSHTFLLQKEEVEQ
                     VRWMPLSEYLAAVEQHRAGYVPRPQAYIEKLRASLLPLN"
     gene            <195551..>196507
                     /locus_tag="CYME_CMH073C"
                     /db_xref="GeneID:16993405"
     mRNA            <195551..>196507
                     /locus_tag="CYME_CMH073C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005535995.1"
                     /db_xref="GeneID:16993405"
     CDS             195551..196507
                     /locus_tag="CYME_CMH073C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536052.1"
                     /db_xref="GeneID:16993405"
                     /translation="MLRQLSLVVTSRSTSSRLFVSLTKRRGLASAGNDGTEEPPKSPK
                     PQVPPADVLDEDLLTELFAADEDLRRLEKQRQLESVQEEGQRRQEQVSPAATFFGPAF
                     ATDLAPAEVAALLTELEKRITQDVDPDTKTPVSRLHVSLLPLLHYGTRLTTHRMYVAG
                     HELGEHPMEHKASLEVDTDALVQRGLISQSLRRAMEVIAGQRFQPPSCIRLTCGRFAS
                     RAENVRWLLYVFDSLVQHARYAVGEWDRQQLQRWRYPGGTADAPSSHEMDWLQSRWDA
                     SSERQLNGYLEGLPQILVNERQRWLRIDRDLGEPFPYPGSEP"
     gene            complement(<196608..>199052)
                     /locus_tag="CYME_CMH074C"
                     /db_xref="GeneID:16993406"
     mRNA            complement(<196608..>199052)
                     /locus_tag="CYME_CMH074C"
                     /product="ubiquitin-specific protease UBP15"
                     /transcript_id="XM_005535996.1"
                     /db_xref="GeneID:16993406"
     CDS             complement(196608..199052)
                     /locus_tag="CYME_CMH074C"
                     /codon_start=1
                     /product="ubiquitin-specific protease UBP15"
                     /protein_id="XP_005536053.1"
                     /db_xref="GeneID:16993406"
                     /translation="MTLYQEPESKRPNASAARQESATDLNGAVRASPVGDGGCTHEAP
                     TEAEPAGPKHNGAAPTRYYGAVPATWYREQVQQRVEHPEAMPISTLTDPQRPQLLRAG
                     LVEYEDFILIPDSEYRQLAEEYGTDAPLPDPLPLMSNGLVEVRPLRVLVDGEERFISQ
                     EADIQSLHAGPLFLADSAEPLPATGTVRDAMITDNTELYSSEESLRRARVRKLSTETN
                     AIAATRATGLVGLSNLGNTCFMNSAIQCLASTVPLAEFFLSGEYRKDLNRSNPLGTGG
                     VLAEEFAALVRQLWSTSQGTVAPRRFKYQVSRYAPQFSGYGQHDAQEWITFLLDGLHE
                     DLNRVRRKPYIPLDPDQDVPPDEAWRYHKARNDSVIVDLFHGQYRSRVQCPECDKISV
                     THDPFMYLSLPLPGRRERLVTIRLWTLDDMQNRKPPQCLDLRIPRRANIRMLKERLQQ
                     VAGIDADDIAVVDCGAASLALDTSCLVAARRRIEKASDVEELAAIQVEDPDALAQLEG
                     RGTRSQSGSKGLLSAIPEAVRATACGNGAIPGADAKLVEVHQYSPNRDPVGIPLLFTL
                     PQDALDERSVCKSINERLRGALPQLDADAYTLRPRTHTPHSALLFELEWHRAEDAAQV
                     DRFLALNPASESNGGNRRNSNGAIDLHQCLHLWSETEQLDDDNLWYCPRCKKHQRAWK
                     QLSLYRAPSILIIHLKRFQYTSWFRDKLDVLVEFPLRNLELDFAGNRVVYDLYAVSHH
                     MGGLGSGHYTASCYRASCSRWFYFDDAYVSALPEDPEEVAKRIVSPSAYILFYQRRLD
                     REQPNGHRDTAPASSL"
     gene            <199798..>200889
                     /locus_tag="CYME_CMH075C"
                     /db_xref="GeneID:16993407"
     mRNA            <199798..>200889
                     /locus_tag="CYME_CMH075C"
                     /product="similar to mitochondrial carrier protein"
                     /transcript_id="XM_005535997.1"
                     /db_xref="GeneID:16993407"
     CDS             199798..200889
                     /locus_tag="CYME_CMH075C"
                     /codon_start=1
                     /product="similar to mitochondrial carrier protein"
                     /protein_id="XP_005536054.1"
                     /db_xref="GeneID:16993407"
                     /translation="MSSADSREHKRLANFLAGALSGLTTTLALQPLDVVKTRMQQTML
                     FSKTVGLLDESRVRFDPNRAQLRKPPFRPGKAWRAARSVVEENGLLGLWRGTTPTILR
                     NMMGVGVYFVTLNQLATRLRGSDPELAPQYALLAGATARSVSATLLCPLTVIKARFEA
                     AGPREYRHVFDALYKIGRYEGIRGLFSGLLPTVLRDAPYSALYVFIYLRTRDRAQELA
                     PNVNSMVISFTSGFVGGGLSTLLTQPQDVVKTRMQLARHVELERDQYATVRMAIRRIW
                     REEGMFGFFRGASPRILKRCLGSAITWMIYEEVVVVIDRLLGAAIPAPGTSPAALGTS
                     ADTKTRHGGTRQTAAAAAAVVGSPGASQR"
     gene            complement(<201369..>201872)
                     /locus_tag="CYME_CMH076C"
                     /db_xref="GeneID:16993408"
     mRNA            complement(<201369..>201872)
                     /locus_tag="CYME_CMH076C"
                     /product="similar to FKBP-type peptidyl-prolyl cis-trans
                     isomerase"
                     /transcript_id="XM_005535998.1"
                     /db_xref="GeneID:16993408"
     CDS             complement(201369..201872)
                     /locus_tag="CYME_CMH076C"
                     /codon_start=1
                     /product="similar to FKBP-type peptidyl-prolyl cis-trans
                     isomerase"
                     /protein_id="XP_005536055.1"
                     /db_xref="GeneID:16993408"
                     /translation="MASVVRGTSSAARTANRFWTRANTVRVVLVVVCFIILLNRVTNF
                     VIVSRRVRKRVLRPGEPAAGSDPRSSQPAANSIVTVHYRGFIVNTGREFDSSYKRGKP
                     FTFELGIGQVIPCWDRAISSMHRGELARIYCDPSEAYGERGIPGVIPPSAALEFEVEL
                     LDFVPST"
     gene            202083..203918
                     /locus_tag="CYME_CMH077T"
                     /db_xref="GeneID:16993409"
     misc_RNA        202083..203918
                     /locus_tag="CYME_CMH077T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461298.1"
                     /db_xref="GeneID:16993409"
     gene            complement(<203404..>204357)
                     /locus_tag="CYME_CMH078C"
                     /db_xref="GeneID:16993410"
     mRNA            complement(<203404..>204357)
                     /locus_tag="CYME_CMH078C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005535999.1"
                     /db_xref="GeneID:16993410"
     CDS             complement(203404..204357)
                     /locus_tag="CYME_CMH078C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536056.1"
                     /db_xref="GeneID:16993410"
                     /translation="MLSWVRVAVPRFRSVFRLRSTRIRSRHCGPYMGGTASKGTSHRR
                     DAEVLVESVQRVALELRHARQRTPHVLSDAYEAEARQHVSALMAVVNSVDVAQFELSE
                     SDLVSAVDGAEHSQDVSLPEASWPEECRWPTRRIQYVFGAEQSDLFSVGVFYLPKGAY
                     LPLHDHFGMVVVSRVLWGSLVMRAFDFATDHYTNYEELEWMHCNGGWAESTIQRSERE
                     AGDAWALYPRSGGNIHELVAVREPCAMLDIIMPPYPSGSTIFDRRKNRELYECHYYRA
                     TRRRQLGDPSRTPEWFLERFPGEDLVYVQRARQRLFPDLWR"
     gene            204428..206098
                     /locus_tag="CYME_CMH079T"
                     /db_xref="GeneID:16993411"
     misc_RNA        204428..206098
                     /locus_tag="CYME_CMH079T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461299.1"
                     /db_xref="GeneID:16993411"
     gene            complement(<206328..>207908)
                     /locus_tag="CYME_CMH080C"
                     /db_xref="GeneID:16993412"
     mRNA            complement(<206328..>207908)
                     /locus_tag="CYME_CMH080C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536000.1"
                     /db_xref="GeneID:16993412"
     CDS             complement(206328..207908)
                     /locus_tag="CYME_CMH080C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536057.1"
                     /db_xref="GeneID:16993412"
                     /translation="MESDASTYATQVCIGLASAVSHAVERWSTWWRKWITQRGCWLAL
                     GVTVISELLLALFFSFQQVRKATLLGVSVRKLFPVLMLTLPAASLGLVYFGARANSDS
                     SEAFLDSGAAYFFLSNTGGGRGFLQTHRTKVNIVALAFGLALLLLGAATLVNSYRRRT
                     REYIAVARQHRARLFADPALDDVCSRGLPVRLLSYNICVRPPGVSGSSGDDLKDERLK
                     LLLPELASFDIICFQELFDAYSNRRSAMQAALKEYGLRHHVYLPKRILGIPPKFVDGG
                     VSIFSRFPIVAWDYIHYRNVVYHTIDALVGKGVLYARIELPVYWPADFPRKWNRSAFP
                     SSTVQAKRVESQTNARYLHIFSTHMQAGDRPGYEPEAYHAEIRFHQAEEMRDFIARKV
                     ADDAGPVLITGDFNINARISPENPHESRWYRELMQRFGSAPRQGAALQVVDLVSLAHS
                     GMHPITDDGKCIDYLLFDPRQGPVIAHGDENGAVRIYRYTVPEAARTRIFPEEDFSLS
                     DHSAVLARLRIPVAWPNS"
     misc_feature    207414..208987
                     /note="possible transcribed region"
     gene            <209975..>212152
                     /locus_tag="CYME_CMH082C"
                     /db_xref="GeneID:16993414"
     mRNA            <209975..>212152
                     /locus_tag="CYME_CMH082C"
                     /product="DNA polymerase epsilon, subunit B"
                     /transcript_id="XM_005536001.1"
                     /db_xref="GeneID:16993414"
     CDS             209975..212152
                     /locus_tag="CYME_CMH082C"
                     /codon_start=1
                     /product="DNA polymerase epsilon, subunit B"
                     /protein_id="XP_005536058.1"
                     /db_xref="GeneID:16993414"
                     /translation="MSVDPQTRVLVDELHRLGFVVEPAAVYLLQERFCSDLELSLLDE
                     EERVAALASLVQRLRETALEQGTRTISTEAVERTLKLGSGGSFGTDRSGTGAGITKHG
                     RVNVANGWKLHVTRELKETDLLQLPPIAKRREALAFRYQTLYKDLERCLQISALRREG
                     TTQESPWPRQVVPVGVLRSARASENRLQIVMGMLSAQGVDEWLLEDPTGSIALRLHGE
                     RSAVDDYRLCGTKSCSLVCAGCMLVVIGVYDPIGDAIVVRELRQPPLCPDWSMKLLPL
                     EETPESSAPLSHAGDLRFTGTTTLDASLDAHASDCSVRLPHPESPQVMDASRGNLLAA
                     KDFPEVHGDVSVAQELQGNVSLPRADPESEVESLDDPDGELHILFAADLALDDSTSYA
                     KWRKLLRELYLPNEASTMQGTSTLPPTDEAAEHPSRPEASLPHCIFVLCGPFLGSKCM
                     SWPPVTEPAHEDAPTAGAVQGESSLTPNEQALLLALRRFGKMLAAFRAPLRSSGSEFI
                     LIPAERDMDCFGEVLPRPPLSNLFVETLRVHSGLRTEQIRTLSDPARFDVLRGERCRY
                     SVLVHATERLCERLAAEALPWPAEREQRNYAADMQQFASNVFRTILHQRHVAPLPVYK
                     QPIFWTFDRQYLWTLTDPNRFVDFLVLADNTLPLCMETYAVGGFASLAGGLEPSMVLC
                     IAPGSFSRDGTAVWIRLTGQAQQRIQPRSLHLVAGQQAEPSDL"
     gene            <213336..>214004
                     /locus_tag="CYME_CMH083C"
                     /db_xref="GeneID:16993415"
     mRNA            <213336..>214004
                     /locus_tag="CYME_CMH083C"
                     /product="similar to mutator MutT protein"
                     /transcript_id="XM_005536002.1"
                     /db_xref="GeneID:16993415"
     CDS             213336..214004
                     /locus_tag="CYME_CMH083C"
                     /codon_start=1
                     /product="similar to mutator MutT protein"
                     /protein_id="XP_005536059.1"
                     /db_xref="GeneID:16993415"
                     /translation="MVYLRSLKVPRGYAAAFMVAGPYARSGCCSRGACVHRRTTVRGC
                     ETSSAPLAPRVAVSSVVWQLPEAAAQAFQERNWQDCASILVETPVQTAQCLLVQRTKE
                     PAANLWSFPGGSLHFGESVLDGIARELFEETGLARSDVMLGSEYEVYEYIAREWHYII
                     LTAVGLARHGVEPVAGDDARRACWVPLRDLMNPNFPSTTRCLETARKLWDRLRVHSTS
                     ARHS"
     gene            complement(214687..214821)
                     /locus_tag="CYME_CMH084R"
                     /db_xref="GeneID:16993338"
     tRNA            complement(join(214687..214722,214757..214821))
                     /locus_tag="CYME_CMH084R"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:16993338"
     misc_feature    complement(215531..216919)
                     /note="repetitive element"
     misc_feature    217068..218421
                     /note="repetitive element"
     gene            <218606..>218899
                     /locus_tag="CYME_CMH087C"
                     /db_xref="GeneID:16993416"
     mRNA            <218606..>218899
                     /locus_tag="CYME_CMH087C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536003.1"
                     /db_xref="GeneID:16993416"
     CDS             218606..218899
                     /locus_tag="CYME_CMH087C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536060.1"
                     /db_xref="GeneID:16993416"
                     /translation="MSSGSQDTSSGQSVLKDAEAKVGSAWESTKESVSEAFTSAKETI
                     SDKYRDLTGQKSAQEKAQDKASEAVDHLKETGQSAKESLQHAADAASEKLKDG"
     misc_feature    complement(218771..219257)
                     /note="possible transcribed region"
     misc_feature    219382..222120
                     /note="repetitive element"
     gene            <222133..>224073
                     /locus_tag="CYME_CMH090C"
                     /db_xref="GeneID:16993418"
     mRNA            <222133..>224073
                     /locus_tag="CYME_CMH090C"
                     /product="cysteine--tRNA ligase, cytoplasmic"
                     /transcript_id="XM_005536004.1"
                     /db_xref="GeneID:16993418"
     CDS             222133..224073
                     /locus_tag="CYME_CMH090C"
                     /codon_start=1
                     /product="cysteine--tRNA ligase, cytoplasmic"
                     /protein_id="XP_005536061.1"
                     /db_xref="GeneID:16993418"
                     /translation="MEPKPTVFNSLTREKEQITLSSDRSFLSWYICGPTVYDAAHVGH
                     ARNYVSFDIVRRLLVDYFGIPVLYQMNITDVDDKIIQKSFDSGESFTNIARRFEADFF
                     DDLEALHCLPPDVVTRVTEYIPEITAYVRKLMERGYAYEAASGSVYFDVEAFERSGRH
                     RFGKLRPAAAAAATSVETRPHAGANGVDPPSLEQLSVQEEKRNPRDAALWKASKSAME
                     PGWESNGLARGRPGWHIECAVMASLVSCAGTTHLDIHTGGIDLEFPHHDNEIAEAEAY
                     FETDLWSRYFLHSGHLNIEGLKMSKSLKNFITIREVLRRWNWRQLRVLFLMHHYQTTM
                     NYSEESMTHAAAVERTIQEFMRSTEAELRAHLPEERHRKPTKVDLELLYQVLPATEAT
                     VRAHLSDNFNTQDALQDLLTLIRTVNLHRHETPGGVGYATLHHIRSSVGRILSCFGLD
                     YDVKDDVASQGGAALASVEPWIQGAVRLRDQIREVVLSADANTDANALKESILAVCDE
                     FRDAVLPPLGVRLEDRTYPKPAIWKYDDPAAIQADIEQRRQAEAARAAEKEARRREAE
                     QRLLKELEQGRTHPSQMFLDPSLYSQWREDGIPTHDAEGRELEKSRVKRLLKEQQRQE
                     RLHRKFLEAQASGLLSKLGMEP"
     gene            complement(<224317..>225237)
                     /locus_tag="CYME_CMH091C"
                     /db_xref="GeneID:16993419"
     mRNA            complement(<224317..>225237)
                     /locus_tag="CYME_CMH091C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536005.1"
                     /db_xref="GeneID:16993419"
     CDS             complement(224317..225237)
                     /locus_tag="CYME_CMH091C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536062.1"
                     /db_xref="GeneID:16993419"
                     /translation="MSRNCARVCVRHVGTGRAEVLDEVDLTGEHGLEALRQRLEQVFA
                     VPVACQRLRAGVPPRLVETAADIQPLDTILLESTVPETPHHRRRPSTNTNTASRNRKR
                     PVGTRGAKQLATDAAIQPAEATAALGTQLVNALSGSAGSAREAQAFRRALREARTEHD
                     QEVRAADRYRAALARSYHVVREESDHADTGASGNASRFWIVQYPKMGARTAMHEDTHV
                     RSLPVDVLREIIREVYGMPPEHRENLRPAKMAQVSPLVFWNVVEYWWRLDHGHQPRLE
                     DALCTLLPTLDWQWLRTRRRTPSQKRFRSL"
     gene            <225483..>226100
                     /locus_tag="CYME_CMH092C"
                     /db_xref="GeneID:16993420"
     mRNA            <225483..>226100
                     /locus_tag="CYME_CMH092C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536006.1"
                     /db_xref="GeneID:16993420"
     CDS             225483..226100
                     /locus_tag="CYME_CMH092C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536063.1"
                     /db_xref="GeneID:16993420"
                     /translation="MACAQTMSLLVEDEETGHADKEGQISGARVRKVVPAPWCRNPLV
                     EILVIYNADSTLVGEVRYFLQKVLFHNYCAACVLTHGRRSEKPEWVALKSGQHDWGSR
                     VRLRNVHRDEIGPEARKVAGKHLPCVLGRLENGSYLLLLTREELELCNGHVGGFRERL
                     SETLVRHGLFVWLDGTTGDATLTNGACKMVAEHLENTNATVTHSR"
     misc_feature    complement(225620..227256)
                     /note="possible transcribed region"
     gene            227503..227571
                     /locus_tag="CYME_CMH094R"
                     /db_xref="GeneID:16993422"
     tRNA            227503..227571
                     /locus_tag="CYME_CMH094R"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:16993422"
     gene            <228606..>229532
                     /locus_tag="CYME_CMH095C"
                     /db_xref="GeneID:16993423"
     mRNA            <228606..>229532
                     /locus_tag="CYME_CMH095C"
                     /product="similar to inositol monophosphatase"
                     /transcript_id="XM_005536007.1"
                     /db_xref="GeneID:16993423"
     CDS             228606..229532
                     /locus_tag="CYME_CMH095C"
                     /codon_start=1
                     /product="similar to inositol monophosphatase"
                     /protein_id="XP_005536064.1"
                     /db_xref="GeneID:16993423"
                     /translation="MWVTSAYARGNRFARFFGRPRSAGTCVSGRMCSMEVPAPAHYSG
                     NVSDDLVALARRIASAGSQVVARHFRRKDSYVSYTKKDRSPVTEIDRQAEEAMRAVIR
                     RDAPAALQGVLGEELSDSDVNPRTGGFLWVLDPIDGTKAFMCGKPTFATLVALLRDGE
                     PVLGIIEQPFLGECWLGVHGRPTLWNTQVAHTNQTNTELSAAILSATTPAMFQHANRE
                     RFFEGLAAKVWQVVYGCDSYAYGLLAAGFIDIVAEADLKPWDYMALVPIVTGAGGIIT
                     DWNGQALTVESDGRVLAAANPELHRKALTALQ"
     gene            complement(<232333..>232881)
                     /locus_tag="CYME_CMH096C"
                     /db_xref="GeneID:16993424"
     mRNA            complement(<232333..>232881)
                     /locus_tag="CYME_CMH096C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536008.1"
                     /db_xref="GeneID:16993424"
     CDS             complement(232333..232881)
                     /locus_tag="CYME_CMH096C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536065.1"
                     /db_xref="GeneID:16993424"
                     /translation="MDVDSRLDDDAAARLAELWTEELFNRLVEELRASRGTLTNDQLV
                     ALYVLSGCNAATLDAALELAASESKRITLHCTKAQWFALVRPGRPLSGAPYLCESCPL
                     RCSCSCADISLCKHLLAAVLIEAAGQGASEARWIHYNRVSDWIAVRCCILGEVEGNAS
                     CFSAPRAEQWRSAHPATNTFGE"
     gene            complement(<234012..>235370)
                     /locus_tag="CYME_CMH097C"
                     /db_xref="GeneID:16993425"
     mRNA            complement(<234012..>235370)
                     /locus_tag="CYME_CMH097C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536009.1"
                     /db_xref="GeneID:16993425"
     CDS             complement(234012..235370)
                     /locus_tag="CYME_CMH097C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536066.1"
                     /db_xref="GeneID:16993425"
                     /translation="MSSASSWKPSQPADRWLKQSVLGVYASALLFFSVWNAVFFKRMT
                     NTMPNYPYFLSQVTSWIYLPVLGLVLLFKRVFDRPSPLEDEELPQLKLAFVGLLEAIA
                     GICTVLGGVYTRGTTQMILVQASIPMTMFWSACILGTRYVVHQFVAAGVIIGGALVVL
                     TPRLIGIHSSGSTSTGTVDLLFFNLVFLAAQLPQSLAHVYKEYALRGQEMSVFIVMFY
                     IAWYQSLIGLSLIPVNSLRLFGPARVPLHDLPSLLLNGIKCLLGQDVLRTDCIIERGD
                     DGTSLPPCDHCRGAWLPVLLYMIANILYNVFGILVIKHGGATLYTMLMTLRLPLVSFA
                     FCMSFFMGDEAQPVDWYDLVGLVVILIGLCIYRWEERAAHRTENEAATEASQALERDH
                     EASANVAVGPILSEPLLLDTPAGAISPVRQAAAGTRWRPLQRAPFWSSNRNANRDYDT
                     FG"
     misc_feature    complement(235722..238992)
                     /note="repetitive element"
     misc_feature    complement(239807..240111)
                     /note="pseudo-gene of 3-oxo-5-alpha-steroid
                     4-dehydrogenase"
     gene            <240278..>242332
                     /locus_tag="CYME_CMH100C"
                     /db_xref="GeneID:16993427"
     mRNA            <240278..>242332
                     /locus_tag="CYME_CMH100C"
                     /product="probable trehalase"
                     /transcript_id="XM_005536010.1"
                     /db_xref="GeneID:16993427"
     CDS             240278..242332
                     /locus_tag="CYME_CMH100C"
                     /codon_start=1
                     /product="probable trehalase"
                     /protein_id="XP_005536067.1"
                     /db_xref="GeneID:16993427"
                     /translation="MTLKVIEAYVHMAFRLGALAPAFPSSVVYCAANCAETSAGCEKS
                     LLAVVQRLRIFADSKHFVDLPLLPGRIPERIIEYWDAEFGRRVVEEPLAGPGEATSGL
                     REAEREPPVPTFRLARVEGPDTDFEEVRRFLLEHFDYAPGGDLLAWIPRDLPQLELDP
                     EPGTTATGSPPLLHQIWRWMKAQDVDAGNWLMDMVARWRKLGRETSPMVFREPERFSL
                     LPLKHPFIVAGGRFRECYYWDTYFIVRGLLVCGMWETARCCVENLLDLVEQFGFVPNG
                     ARIYYLNRTQPPLLSDMVRCIAEHAHAGWDVMTFLGRALPLLEREYNFMMEQRAVKMR
                     AGGTLNRYHAPAAEGPRPESFYEDSKLASDCSMELLGDPRRSELFIALTAAAESGWDF
                     SSRWLRDRRSMCSIRTQLIIPVCFNSFMLRMERNLAFLYQWYISGSRPETEKGSIFEQ
                     RLPGNEEVPNDPVTRDLLDRVQQRVSTMQKYLYVPSRDQWIDYDLEADTTTLQTVADW
                     RQTVSSSNFFPLWSGILEHIESEQAASIARGVLQSFEESGLLQNGGVVATLVTDSGQQ
                     WDYPNAWPPVQLLLHEAFASLATQFSANEQISNRARELSLQIAIRFLRSVYQGWLRSG
                     DLFEKYHAEKVGESGNGGEYVPQVGFGWTIGVSLALLSSVWQLDRSLLAQVWQRVSDE
                     AT"
     gene            complement(<242975..>245695)
                     /locus_tag="CYME_CMH101C"
                     /db_xref="GeneID:16993428"
     mRNA            complement(<242975..>245695)
                     /locus_tag="CYME_CMH101C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536011.1"
                     /db_xref="GeneID:16993428"
     CDS             complement(242975..245695)
                     /locus_tag="CYME_CMH101C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536068.1"
                     /db_xref="GeneID:16993428"
                     /translation="MAGRSDAEEQQVPSGGTPADFRWPNLRIPGFRLLLPRESSVTQD
                     FSRNTPWEDLVYALEEAAKALVTQVATRNTVPGAVRQSLTVALPPALDRTPWTPWTTC
                     REDASTSTRVSAELFLVCDETWQVAQPLGLVRLFGVPAYWLLRLTPALSSYRDWVQAA
                     VGALFFVATTCLQTDQDQPGESACVLWQSRGAGRQCMTPDCTSDVETGPRRKCTTLNK
                     RNGSTHSVESTEPQDRKHCTSVSMTMMPTTVFVETSATMTEAATEYRGLGIGDGFALR
                     HYEMRVLSTPPANIEDLESLLAFFRQHIVTPSLSPGATETNRSITQERLEIALTYEVV
                     LEPEAVESEGLVTSPLVDADALRLALMLRWPLRSLAAYESMDLLDAPEWILWLPSESL
                     DAEPMSSMPRKVMPVPHWTQMRLLRQLVRRLVQLIRILRSVSISDTEQSLDPEQPSRV
                     FTSRHLICPLLEALRACVDDALIANSWPKGLHSENDGTVAAELRVTLESLNRLASANL
                     QKSTPEATPLDAAAASVESQRVPVESTCPAARNRGAVASEKSAGAQAPSATPVYALNA
                     GIRGEAGAVALEQTAVAFASDAFGSQAYTVRVPGRALGSVSPGQGVASASLPSPEPAP
                     VPSRPGHLQTAGTRKQLHGAASEHAVKSDPEALGQAEVDSDAQMPVAADDTSTEGIFS
                     VENDPHRCASLYDANPGANGTPTGNATAKAEASFFPDDSEPSRQQWQRLLEFGAMQCV
                     RALWQAICCQSSIERQYVTGFRRCFESTAAACAALFQSSVPETGVLGAHLQHSMDEID
                     QLLTLWVHVQLLRRVFQDRMELLDELLQHGQLTLPGPYASPTAAPVQTALLEYLTRSI
                     FDLDEAAVLETPHMREYVLEARTEDNEERARLLYRLTGEHCVLATVHDSN"
     gene            <245728..>246231
                     /locus_tag="CYME_CMH102C"
                     /db_xref="GeneID:16993429"
     mRNA            <245728..>246231
                     /locus_tag="CYME_CMH102C"
                     /product="similar to splicing factor 3a, subunit 2"
                     /transcript_id="XM_005536012.1"
                     /db_xref="GeneID:16993429"
     CDS             245728..246231
                     /locus_tag="CYME_CMH102C"
                     /codon_start=1
                     /product="similar to splicing factor 3a, subunit 2"
                     /protein_id="XP_005536069.1"
                     /db_xref="GeneID:16993429"
                     /translation="MDAYALKNRLGAVECKLCRTVHPSEANYLVHTRGRRHRQAVKRR
                     EERDTLRRRFPETGVVSGSVVNTKLESRRSEGTEASPHTPKVECWRLPGNAGFRIATE
                     LSASADVEVLVTPQPRRLGQEIWLIPDVACMRLEQGSFVTRVRTRRFPVCSGAVRFEV
                     DLYVRRD"
     gene            complement(<247295..>248209)
                     /locus_tag="CYME_CMH103C"
                     /db_xref="GeneID:16993430"
     mRNA            complement(<247295..>248209)
                     /locus_tag="CYME_CMH103C"
                     /product="similar to short-chain dehydrogenase"
                     /transcript_id="XM_005536013.1"
                     /db_xref="GeneID:16993430"
     CDS             complement(247295..248209)
                     /locus_tag="CYME_CMH103C"
                     /codon_start=1
                     /product="similar to short-chain dehydrogenase"
                     /protein_id="XP_005536070.1"
                     /db_xref="GeneID:16993430"
                     /translation="MLQAKEASFGSSQPVAIITGASRGIGRAIALTLAERDRMVLVLA
                     AKSRVSRANLPGTVQSVADECLARGAAAVLPFPLDVRDDQGIERMVHETLQRFGRIDV
                     LVCNAGALWWKPVAETPLERFDLVHGVNARGSFACARAVLPAMVRQKNGLIITMSPPV
                     ELDALPGMTGYLISKFGMTMLVHGLGGELAGTGVTSVALWPATMVESFATKNFQLGDR
                     SQWRKASIIADCVHMLLHDPERNALSGRALIDEDYLRSRGVRDFSQYRCDPDVEPERA
                     WPPRKPWASTAKDPRALPPGVSLAPSKL"
     misc_feature    248512..249954
                     /note="possible transcribed region"
     gene            <250615..>252375
                     /locus_tag="CYME_CMH105C"
                     /db_xref="GeneID:16993432"
     mRNA            <250615..>252375
                     /locus_tag="CYME_CMH105C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536014.1"
                     /db_xref="GeneID:16993432"
     CDS             250615..252375
                     /locus_tag="CYME_CMH105C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536071.1"
                     /db_xref="GeneID:16993432"
                     /translation="MFVVSGHTTVKSFRKPLVGSRYAGAPLERRLWNKRKCARLWMQQ
                     TSSAGTAGTGTADASSTDSKPTAGVGTVAVFGASGRTGKQLLRQLCSQRACRQVRAIV
                     RDASRLRSELASWKQDPSLSGVHVDVRAVGDLTRLDSNALSELVRSADAIIWSAGASG
                     GRDGFQTSPAALDEATLQRLCSVLATESTANGVTFRSPDEMVRVLDFGRGPLVPAAFT
                     AVDDVIMGGQSKSSFHFDSNDSVGLFTGLVTTDGGGGFCHVRCDASAVMPAERFGDAP
                     LVNVDENGRSVPHWDLAAYDGIALVVRGDGRRYKVNLKTSSEPELVFQQEFVTSDDLP
                     PGTFETHFLPFADFVPVRRGEPVYSTGSAQLYAMKLDPNRIRSVGLVYSKVAIGGGPA
                     IDFRPGRFHLACRRICAYRQVPPRFLALSSAAVTRPYWPPLKRQAYPELAQVPIVKLN
                     PAGVLGHKLAGEDAVRTLVSHRSSLGAPYAIVRAVGLNDGDDPDFPGAAQGELRFGQG
                     DLMVGKISRTVLAELLVNLLNEPEGFCKTFEVKQEPKTMSRNGTGASAATLSLAEKLR
                     QLRTDVARALKPWNPPPSLS"
     gene            complement(<253158..>256955)
                     /locus_tag="CYME_CMH106C"
                     /db_xref="GeneID:16993433"
     mRNA            complement(<253158..>256955)
                     /locus_tag="CYME_CMH106C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536015.1"
                     /db_xref="GeneID:16993433"
     CDS             complement(253158..256955)
                     /locus_tag="CYME_CMH106C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536072.1"
                     /db_xref="GeneID:16993433"
                     /translation="MENPPQSLIVDRVDTCTPTSITQELGRSDADLRHEGIHSWNVEP
                     NHCDFKSQVSDNEGSTADVAFGRKPTRFLETSAIFDTPLGDKERYGAGCAALSLVHAP
                     NASPGRARIDDKATGTCPANEKLLRVFTRSTEATGVERVGDLQHMGTRAEAMNFDKAK
                     SAMRTGFSTGHGQQLRVASSASLARVARLFHEDPAPGGADKDARAASHRATAAATGFS
                     TGHGQQLQVASSASLARVARLFHEDPAPGGADKDARAASHRATAAATGFSTGHGQQLQ
                     VASSASLARVARLFSEEAENRPPVACDASPFSEIKSIEDCHIRQEFANSRAFPCEFRN
                     QDASSMSIDCGMNEPQVAHMGPSSCVNAYAAPSKRCIWPASNSNLPRKRPPCSMDNSK
                     RAGNINDQDNGISVCHARPPFADVTSVEAPARPLSSRARRFTPPSKAEAPMTSIHRSK
                     TSTDAHGAGDAPEIQSLPVCPEHDPKAGAHAAFRGDAARRTGYWSPALVPKCFPRPPC
                     DIDLEHPSVHAIRAAFAPWESIRFRFKCSRNDADALITKLESLHATGRDDTATERLVT
                     KLRAQGAVLDAWDFFCFFCVDDTVQENPKPDPTDTFWLVSQQDFEPTVNASQVVNRVG
                     SLAWFRRYWCLIIYEMSLIELAVPQALFGRVLTVWQVLYQLIGRFWRCHRRMEQQRSS
                     SMFEAIARAPDAFSYLPPMRLLLVPGYDCETSIETEHVCLLLCDGHYLVFAKGTQPVE
                     AWLHHLRVFAATERALQYRPQIGYRSVSAPHRLWTRAGCLYIGAARVECSAAAPHHAS
                     RRSIRTAAAQIERISLTLSLNSVHPAPLFQKQRWSMKRIGDSVHQAIGRVQSALMAVT
                     LPQTDPLGGTVPALDVVLHRVHPLRFVAETLHHHQQQRQLDKNGAYVSPRQPGTLPGK
                     PRYLLSATYTAQIVADAEHGQLHACPVPIFSWSPDAAPRTPGAWSACGHPEHLESDAC
                     TDAVHASGHVDKFPPKIGSLLTLGVADPLGKHLAKVEVWDCPLDLAQLLRTKYEGSLV
                     RLCCVVPVSAQPGVWRLLGSAKFGVNIVPLETDGKLGARVFTRRVYVHWPRQRIRVSG
                     LETLTPFDTFDAAPGLRLLYVGALRGGDIRQAQRYAYAADDPDGPLLVIRLRYEDAVH
                     PPRCLALDSRSSNGTDARISPVYPLIHFEHCQYRCYESALDAHVVDATPYTTWHASPE
                     NDADACAACVAFEDIACIASRIAHGQALGHLLRRCRERRRARVKAWISKGAFFRSNVS
                     EPG"
     gene            <257383..>258210
                     /locus_tag="CYME_CMH107C"
                     /db_xref="GeneID:16993434"
     mRNA            <257383..>258210
                     /locus_tag="CYME_CMH107C"
                     /product="ubiquinone biosynthesis protein COQ7"
                     /transcript_id="XM_005536016.1"
                     /db_xref="GeneID:16993434"
     CDS             257383..258210
                     /locus_tag="CYME_CMH107C"
                     /codon_start=1
                     /product="ubiquinone biosynthesis protein COQ7"
                     /protein_id="XP_005536073.1"
                     /db_xref="GeneID:16993434"
                     /translation="MAFYSSLSRPHWYRLLRVQVLRLSIENRQETCRLAFHEQKRNWR
                     QFASANGNAAGAADGNAVPNVEPSGTEQSSKEPNDLCTLESQRKAVLDRMIRVDHAGE
                     IGARRIYDGQLRVLGGTPAAPIIHHMAEQERRHAEVFDELVKRYRVRPTALLPLWNLA
                     GFLLGAGTALLGRESAMACTVAVEEVVAQHYDDQLRELIALEKQHASVDGDVGPAGAA
                     KSPEAQLRHYIRQFRDEELEHKDTGLEHGAELAPAYRLLSFAVRTACRAAIFVSERI"
     gene            complement(258989..261108)
                     /locus_tag="CYME_CMH108T"
                     /db_xref="GeneID:16993435"
     misc_RNA        complement(258989..261108)
                     /locus_tag="CYME_CMH108T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461300.1"
                     /db_xref="GeneID:16993435"
     gene            <261360..>266618
                     /locus_tag="CYME_CMH109C"
                     /db_xref="GeneID:16993436"
     mRNA            <261360..>266618
                     /locus_tag="CYME_CMH109C"
                     /product="raptor"
                     /transcript_id="XM_005536017.1"
                     /db_xref="GeneID:16993436"
     CDS             261360..266618
                     /locus_tag="CYME_CMH109C"
                     /codon_start=1
                     /product="raptor"
                     /protein_id="XP_005536074.1"
                     /db_xref="GeneID:16993436"
                     /translation="MPSLVSRVSRLPVENDDEHLTDASNDDALTNETKSEYSEALSTA
                     MSASLSLDTTKELPVVYAEPYRAMLVDQLLLESTRTRSTSVSFTRGIGAELDDSMGNQ
                     NGSVCELAAQPETNLTPSGTPNLAGSWQRPSRFETPHGSLDTIVHYLENVRQDIRAEN
                     ISEKYVPGTPAATLEVLDPTQILKSWRVRDRFKTAAVALVLCLNVGVDPPDVIKPTPC
                     ARVECWIDPFSMSPQKALDSIGKALQLQYERWQPRARYRVLTDPVADEVKKLCLGLRR
                     TAREERVLFHFNGHGVPRPTANGEIWVFNRNYTQYIPLSLYDLQSWLGAPAVYVFDCP
                     AAGLAIRAYLQFAEQREHEQPYQQHQTGASHPHMGAEDVPVQSAALASSSSGGGANAR
                     TSRASLAGESLAAGERAAAASSASSYASFVRDSFLLGACQADESLPTTPDLPADLFTA
                     CLTTPIKIALRWQALRSAGRSITMDMIDRIPGRLNDRKTMLGELNWIFTAVTDTIAWN
                     TFPRATFKRLYRQDLLVASLFRNFLLADRLMRQFNCTPVSYPPLQATHQHPLWQAWDH
                     AVEECFARLPSLLQQDASEGRVSGTGATTCLAMRTVAAAGAGRMATAGPLLNNANPLH
                     QGYGGMGGVAVPAAAAAAANTTVAQAPIHLLPNAPTDPGAPLTAANHLMRPEPRGNLE
                     VLHDLYDYREAGTTSCRTHDTVQAQTHHVGGMHRVQGPGVTNPAAQPTLDLSAATGAG
                     SNETGLTAPLYAHSPSEGDVSLPSPFFENQMAAFEVWLDLPAHRRSPPEQLPIVLQVL
                     LSQAHRLRALQLLSRFLDTGPWAVDLALSVGIFPYVLRLLQSPAAELRAELVFIWAKI
                     LAVDPACTEELFKESGERYFLTSYAAEDASAVHLACAAFVLCHVLNKAVDAFGDANLL
                     ALFLQRLEHASEPVRRWTLFCLTAWMESSRKVPSTGTVSTVLELLRTDLSPKVRAAAA
                     QTLATMLRFDYCTADIIEAFQQSALNEVSAVVRKEIALVTLAANRPAQTVLVRDPHPV
                     VAALAEHFGATLADAGAETAPVHVPGSPPRAAQMPAAAAAAAAAAADNDIDDDEEDAT
                     NAGASQVPAVSERWTASRPPEAMQLRPASATGTSSSDPVQQQQQQQHGPRQILRRASA
                     SWSNLRRYAWSSTTAAAAAATALAAEAPRTTGDRSQTSSAFPTDAHTEAAKAQKHIMG
                     ERGSSDAETRTSTAIAVRLARPQSQPELRAAATLELEERRASRSRHGRLDTYQPRDLF
                     RFPHEAFTFSRRRRMMHIRDYSYQEVLQSQTRERWSGHEPMEPTRLQQRMERRSEAAA
                     AAAALTRLRERWVTRLQAEQISALCFHPSQQLVLSGDASGNVVALQQENGERCWRLGV
                     GSNASAIAALRVVNAHTTWPLLLVATADGIVRFYESQQQVLAAFSAISQASRMPGMTD
                     ATPASPGTTSRRVSATTPGASTPRDRELVCCTTTTTTTAYSNTAGSRQCRSPSAPAIS
                     QTPNANSHATMPADVAGLASPPWRVSSAGGAGEAAALSPVDRARYDESMATGRAFVCD
                     WSPWHGWLLTGGLEQGTIRLFDAEREMCIWSCIASSYRVTAVAHLGSSLFAAGCADGS
                     VYTYDTRTGAIETELLEHSSPVISIAGRWSPTPALVTAAAAGDIRVWPLAAASSSVCV
                     VAHRRDLTAAAAHQGMPWIATGCASRCIKLFGEQGQLLQLIRHHDGAENPRIGSISCL
                     EFAAQDLMLAAGDVDSSVTLYTASSN"
     gene            complement(<267230..>269548)
                     /locus_tag="CYME_CMH110C"
                     /db_xref="GeneID:16993437"
     mRNA            complement(<267230..>269548)
                     /locus_tag="CYME_CMH110C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536018.1"
                     /db_xref="GeneID:16993437"
     CDS             complement(267230..269548)
                     /locus_tag="CYME_CMH110C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536075.1"
                     /db_xref="GeneID:16993437"
                     /translation="MDASWDASLKHPPLRSEAETSAEPSRLLDPSVETLEPQIAAERT
                     RLANLEQLLTERERSLSQVQVAVNQRRTSSLGSAATTKRALESSVLRLLQNTNAALER
                     LNAAYEEVLDLTRQRLELAGGEEPREDETLRALLHQLSEREAMRQRYLRERELLQTRI
                     GAWQQVTRMTEPLRRRLEHLQSEIERLRRENAERTAQIAAGESEKTRLAAELSSLENE
                     IQAGEQEFHKLKTQRDQQLQRLQGLDEENAIQADLVQVLRAQKQALVTSALPASPDAT
                     APAQRHPIGIVSRAGAEPAVPESVPGSSGGTSDLSICAVASGVSPERTSGSVSLKNNA
                     QIPEMPWTHPRELSENDAPGVPLREMRLSQTPSASHSTRLESGASVRRARPAAARLAS
                     SWSKQSIETVAPLDLAAVEAQPATSSARLSAWRAADTPGGRGAERVPEDIETLHEDQI
                     EPLTPSRKLGCQAQPHGHETSQHLSPSVAGSLARGGAPAAEAAAATATATLHEHSQGT
                     RPERSERTEIPSDRIQADARLVIQGECFNNRTLTAVMNGLESSSGPRVRWYHLSRRTA
                     SITPYAYRAEGYRYRTTADDVGMRLAAVTEATAGLPALQAFTAPIEVDPTMEERLSVW
                     MLEGRAAFLVRDEASGAPRCILVHKRYLSVQRPAQSYQASGAGAGAGAADPWTESLYH
                     ATEDFDPREGHWITEEKKSWTSFIKVALDETDAHAFSLTLKHTFAFRANSAEQRDLIA
                     LCVRQFALRYRSSSSSSSGGTLSGQRRECRMQ"
     gene            <269816..>270538
                     /locus_tag="CYME_CMH111C"
                     /db_xref="GeneID:16993438"
     mRNA            <269816..>270538
                     /locus_tag="CYME_CMH111C"
                     /product="similar to 4-hydroxybenzoyl-CoA thioesterase"
                     /transcript_id="XM_005536019.1"
                     /db_xref="GeneID:16993438"
     CDS             269816..270538
                     /locus_tag="CYME_CMH111C"
                     /codon_start=1
                     /product="similar to 4-hydroxybenzoyl-CoA thioesterase"
                     /protein_id="XP_005536076.1"
                     /db_xref="GeneID:16993438"
                     /translation="MFVSGCKFWWCSLTDARARSTTEWSMPVRWRASTSERTRSRTSA
                     GDLNAIERRRFFTPVWSFRTAVTSCMALDETTPTQRERRESSGAHRLDGWFALRKRVL
                     PRDTDYAGVVWHGRYVDWLEEARVEFLAARGFTYEQLVRECQCETPVIQLSLSYKRPV
                     RFGEVADVLLRVCPRQRTSVRIIFECRIVAAAATVVLPENEQTPVGTVYVDGRVELTI
                     VDRNTGRVLRKLPPQLEKSLYG"
     misc_feature    complement(272592..272946)
                     /note="possible transcribed region"
     gene            complement(273957..275692)
                     /locus_tag="CYME_CMH113T"
                     /db_xref="GeneID:16993440"
     misc_RNA        complement(273957..275692)
                     /locus_tag="CYME_CMH113T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461301.1"
                     /db_xref="GeneID:16993440"
     gene            <275814..>277052
                     /locus_tag="CYME_CMH114C"
                     /db_xref="GeneID:16993441"
     mRNA            <275814..>277052
                     /locus_tag="CYME_CMH114C"
                     /product="similar to FKBP-type peptidyl-prolyl cis-trans
                     isomerase"
                     /transcript_id="XM_005536020.1"
                     /db_xref="GeneID:16993441"
     CDS             275814..277052
                     /locus_tag="CYME_CMH114C"
                     /codon_start=1
                     /product="similar to FKBP-type peptidyl-prolyl cis-trans
                     isomerase"
                     /protein_id="XP_005536077.1"
                     /db_xref="GeneID:16993441"
                     /translation="MFGIVRVAFSIHTSASFKAGSSAFKSHNCTDVRFQHKPLPRAAV
                     ARRRLWRSPLVLCDQRRKDASSKAETFGSANSNESTTNADATVNLERGQSAEAANPGV
                     PTSGGPRRRSPFEDLVDGASDGFGGPTSPGLPRRRSNLSEQNERIRALLGLEKRDTSE
                     RTQQRPAAPVPERPATTVTSTENAPGLIDLTGDGGVLRELLSRGAPEKAANKQTPVQS
                     TSGSRLRVHYVGKLAETGQIFDASRERQEPFEFILGEGSVIKGWEAGLVGLAAGDVVR
                     LVCAPAYAYGLRGVPPVIPPRAKLEFEVEVLEVLPAAPGNSEAQSKSSLRALDEDDVP
                     RTPEDISRAYIKRLEERAANPKKESKWFIISPFASATGERPPWWLNPNITFLIIFSVL
                     GLATYAVYVSGGIRQGFPPS"
     gene            complement(<278084..>279145)
                     /locus_tag="CYME_CMH115C"
                     /db_xref="GeneID:16993442"
     mRNA            complement(<278084..>279145)
                     /locus_tag="CYME_CMH115C"
                     /product="2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /transcript_id="XM_005536021.1"
                     /db_xref="GeneID:16993442"
     CDS             complement(278084..279145)
                     /locus_tag="CYME_CMH115C"
                     /codon_start=1
                     /product="2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /protein_id="XP_005536078.1"
                     /db_xref="GeneID:16993442"
                     /translation="MTPLNFVVHGLQAPVRAPGRCSCRASVATSAVSSGAFAERRSRP
                     PRQGWCTQVGSVRRRNFTSERLQFMTLLENGESILPAFGPMDDLGNGLVPPPVRQPVS
                     VILLAGGLGSRMRADRPKQFLQLCGKTVSERSLLLFLGLPEVTQIIIVVEKRYREAYF
                     GNYVLRDKRILFADPGLERQDSVRSGLALVPDTVDREKDETDDILVCVHDAARPLVSR
                     SCIRSCLRDASIYGAAAIGVPVKATIKESEDGQFVRRTIDRSRLWEIQTPQVVRARLL
                     RQGFENAMRRGLRVTDDVSVVELLDDKHYPVKITMGEYANIKITTPEDMILAEMIIRE
                     RCKMNGIAIEGTHPECENI"
     gene            <281576..>283882
                     /locus_tag="CYME_CMH116C"
                     /db_xref="GeneID:16993443"
     mRNA            <281576..>283882
                     /locus_tag="CYME_CMH116C"
                     /product="similar to indigoidine systhesis protein IdgA"
                     /transcript_id="XM_005536022.1"
                     /db_xref="GeneID:16993443"
     CDS             281576..283882
                     /locus_tag="CYME_CMH116C"
                     /codon_start=1
                     /product="similar to indigoidine systhesis protein IdgA"
                     /protein_id="XP_005536079.1"
                     /db_xref="GeneID:16993443"
                     /translation="MRLIWKGWPIELSERLAAQADWERRRWRTAIVALESTVVTHGLP
                     YPQNLELVDQIQTNIRQKGAQPALLAIIDGVITVDPDSAVSQRLAEQGARVFRKCNLR
                     DLSLAVAERWNGSLTVSAVMEVAHGLGFRVFVTGGIGGVHRDFTQNHDASADLTALAR
                     IPVCVVCAGVKSVLDIGATLERLETDAVPAIVFNSSEFPAFWCRRSGYAAPARLDTVE
                     QVATVLRLHLLPLLSSARVDHDGECTNAERLPCGMLVAVPIPAEAECSESETAIQQAL
                     AEATQRGIRGKALTPFLLERVAALTQGASVRANMALLLHNASFGAALASVMHHSCHGL
                     PLGSALRRYQHQQHQHHQLSYASITGSRHTIDEALNGCPSDDPEQRLLARNGPVHDDS
                     SASLEPALDADAAQPELAQHPKQRLTADCGASAPLRWLPVTVLGHWTLDIYAFASSNV
                     PFSSNLTAVPASYPGVIRSAYGGVGYNIALTLSYLAGGGASPYFTASEVMRDAHLGRL
                     AESSLTMANERRLGTFWSTRHPAATYVAVHNEARDLLFAVFDGADITPAMLGHVNSSR
                     PIVWDANLTPAAMAALPRASSFWYEPTSPAKAGRIVAAQRLEALPWMSPNELELIAIA
                     QAAGFSFQEGAIADDGSISDALITAAAAYLVNTRGVRNILVTQGARGVTWFYPDAGAL
                     GGIASRHFDAIRVEKSNVRSTTGAGDVFAAAVIFALCGWGPAPPLAPAQAISFGLEAA
                     AIACQYETAVPPADALRPIVQRMRRHRL"
     gene            complement(<284428..>287982)
                     /locus_tag="CYME_CMH117C"
                     /db_xref="GeneID:16993444"
     mRNA            complement(<284428..>287982)
                     /locus_tag="CYME_CMH117C"
                     /product="RNA polymerase II second largest subunit"
                     /transcript_id="XM_005536023.1"
                     /db_xref="GeneID:16993444"
     CDS             complement(284428..287982)
                     /locus_tag="CYME_CMH117C"
                     /codon_start=1
                     /product="RNA polymerase II second largest subunit"
                     /protein_id="XP_005536080.1"
                     /db_xref="GeneID:16993444"
                     /translation="MAKPQRASVSAEDQLSADDIWDVISAHFREKGLVKQQLDSFNEF
                     IGNACQTIVDETPDIVLRPQPQHVPGKRAPPEGTRTIISFGQLSAGKPTFTEVDGTPT
                     VLFPHEARLRNLSYSSPLYVEVTRIDIEIDPATKEEREFRHPARNLYLGRVPMMLHSD
                     FCHLNGLTEYQLQNIGECPYDQGGYFIINGSEKALIAQERMGNNAVYVFKRASTAPYS
                     HVAECRSVLDRGNKPARTTQVKITRGGVKGQSGQCIMVSLPYIRADIPLAVVFRALGL
                     ESDREIMERVIYDTDDEEMQTLLMPSLDMGSVITDQNLALDFIGKRGNSVGATRDRRI
                     RYAREVLQLEFLPHIGIGAYEPAKAWFLGYMTHQLLATVLGRREEDDRDHYGLKRLDL
                     AGPLLTGLFRQLFQKVVKDARSILQHQLDMGKELNIALAVKGRTITDNLKYAIATGNW
                     RADRKAAVRTGVSQVLNRLTYAASLSHLRRLNSPIGREGKLAKPRQLHNTQWGMICPA
                     ETPEGQSCGLVKNLALMAYISVGTPVADILEMLYNFEMEPLYEVTAERIKRQTKVFLN
                     GSWVGIHPRPEELVTALRVLRRSGEIADEVSIVFDVSHGELRIGTDAGRVCRPLFIVD
                     TETNLLRIRKQHIDLLRDYETTGYTFSRLVREGLVEYLDVNEEETVMIAMDQEHLATS
                     GDHATYTHMEIHPSMIFGVCASIIPFPDHNQSPRNTYQSAMGKQAMGMYLTNYNLRMD
                     TMAHVLYYPQKPLVTTRVMEHLQFRTLPAGINAVVAIACYSGYNQEDSLIMSQAAVDR
                     GLFRSVYYKTFKEEEQKKLFGQQETISKPDPAVTLGMKEAHAYSKLESDGLIGVGERV
                     RGGDVLVGKTAPLGASRAAVDAAEQETASGMAALSGMRTRKDCSLVMKRTERGVTDKV
                     LICTGEAGTRMVKVRVRTELIPQVGDKFASRHGQKGTMGLCMPEEDLPFNVDGIRPDI
                     IMNPHAVPSRMTIAHLIEALLGKVCALSGVEGDATAFTPVTVDAIGRELVRHGYDPRG
                     WELLFNGQTGRPMNAAIFMGVNYYQRLRHVVYQKLGARARGAVQVLTRQPVEGKSRGG
                     GLRIGEMEKDVFVAYGASAVLKERMCDVSDKYRVHVCERCGLIAIADLRRSIFECRGC
                     KNKTRIAAVEIPYACKLLFQELMSMAIAPRMVLTDLGE"
     misc_feature    288283..289527
                     /note="possible transcribed region"
     gene            <290311..>290958
                     /locus_tag="CYME_CMH119C"
                     /db_xref="GeneID:16993446"
     mRNA            <290311..>290958
                     /locus_tag="CYME_CMH119C"
                     /product="20S core proteasome subunit beta 4"
                     /transcript_id="XM_005536024.1"
                     /db_xref="GeneID:16993446"
     CDS             290311..290958
                     /locus_tag="CYME_CMH119C"
                     /codon_start=1
                     /product="20S core proteasome subunit beta 4"
                     /protein_id="XP_005536081.1"
                     /db_xref="GeneID:16993446"
                     /translation="MDTAISLAGKDFVLSAADVTAARSIVVMKEDQDKIQELDRFRLL
                     SAGGDLGDVAQFTEYIQRNVHLYELRAGTSLSTRQIAHFIRGELARALRERPYEINLI
                     LGGYDQGEGTSLYYIDYLGSLHMMKYTAQGYAAYFVLSTLDRLYRPNMNLEEALEVLR
                     ACLDEMGRRFLLKQRHFMVKIADERGVRVLENAFVDASGTPTSSVTGAAAAAATS"
     gene            complement(<291287..>292993)
                     /locus_tag="CYME_CMH120C"
                     /db_xref="GeneID:16993447"
     mRNA            complement(<291287..>292993)
                     /locus_tag="CYME_CMH120C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536025.1"
                     /db_xref="GeneID:16993447"
     CDS             complement(291287..292993)
                     /locus_tag="CYME_CMH120C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536082.1"
                     /db_xref="GeneID:16993447"
                     /translation="MTEHEGEAFYKKQLEIAARERKLLQERLEALEKENRDLRRSVFE
                     LSLRRSASETGVFDLTSALNDISPNPSKGVHVPEASRFVADFQVLSERTEAGLGAAES
                     IPGSRAASPAASLPVVVRRSGERQSSSSLSCRSQLIGHKGAVYALSWSSCGSYLASGS
                     FDRSVRVWSVDQSPRCAVAVADAHAANVVDLCWTQDNRYLYSAGFDHCIRVWDWSAFA
                     TEGNGSDARRQAVQSWSLPRGLVLCLAIDPDDAHCIYAGTSNGFVYRLDRRVQQMSQV
                     TGSRPSSPAAGVSARPEQTMSRVLTSASGIGMVNSMVFLEHDILMIGDSQGLLHTFDL
                     RRPETALSCQLNDEAASPVAHIQRSPSGRYVAVNAFDDCLRMYEVKALRTHQENTNTN
                     DVQLVLYQTHRGHRLGRLPLRCSLYERGFASDRGASIVDAAALAAPASTKASSGMPAL
                     YAADADVSGAATAVVHESRTLLAAASDVPIDGSGQPPASQQRSQQLDGVLNASSVASG
                     LVAATGSTNGRIFLYDSQSSAQEAVKTIDAHSDRVYCVAFHPHSMMLASCSADGSIKL
                     WD"
     gene            <295813..>297336
                     /locus_tag="CYME_CMH121C"
                     /db_xref="GeneID:16993448"
     mRNA            <295813..>297336
                     /locus_tag="CYME_CMH121C"
                     /product="cystathionine beta-lyase"
                     /transcript_id="XM_005536026.1"
                     /db_xref="GeneID:16993448"
     CDS             295813..297336
                     /locus_tag="CYME_CMH121C"
                     /codon_start=1
                     /product="cystathionine beta-lyase"
                     /protein_id="XP_005536083.1"
                     /db_xref="GeneID:16993448"
                     /translation="MFVAVSQLFPARHQGAPRTLRGANGRSTDTYRRTVGPAVPKDAE
                     GAYESASGRVCWQRYSALRAAADSESSPKDASQRVHSSLSSTGKGEHSKHMRLETKVV
                     HAGSHPEEYTTDPYGRTVVNPPVYHASTVLFPNVAAKDFASKDWPFRGFSYGRHGTPT
                     HWALEEAFAALEGGDNACCVSSGVAACNAALLAFLRSGDHILVADTVYEPTRLFCNSF
                     LARFGVETTYYDPAAPVESLEPLFKPKGRTKVVFVESPGSLSFEVQDVRAVSALAHAH
                     GAVVVMDNTYGPTLFQPFAAGVDVSYNAATKYIGGHSDLMMGLIACSRETYRKVKRSV
                     MELGCPPGPDDCYLALRGLRTLTVRLKQHEQNGLVVARWLETRPEVARVIHPLLPSHP
                     QHDLFKRDFRGANGLFTIQLRDVYSQKAVNAFVDSLKLFGLGFSWGGYESLILPIDIN
                     AVRTVTKFKYGDGYGPTLRLHVGLEDPQDLCADLAQGFAVLDAVAGLAGEVARTPPR"
     gene            complement(<297920..>298240)
                     /locus_tag="CYME_CMH122C"
                     /db_xref="GeneID:16993449"
     mRNA            complement(<297920..>298240)
                     /locus_tag="CYME_CMH122C"
                     /product="similar to DNA invertase"
                     /transcript_id="XM_005536027.1"
                     /db_xref="GeneID:16993449"
     CDS             complement(297920..298240)
                     /locus_tag="CYME_CMH122C"
                     /codon_start=1
                     /product="similar to DNA invertase"
                     /protein_id="XP_005536084.1"
                     /db_xref="GeneID:16993449"
                     /translation="MDGEETELYIGGPVENDGHLGMERHVHDQNRASPGLMLGDDLKE
                     SGSITVARAAEIFAVCPKTIRRWCDAGKLEHFRTPGGHRRIRTSSVIEIQQRTSHPKK
                     EERP"
     misc_feature    complement(298539..299615)
                     /note="possible transcribed region"
     gene            <299884..>301626
                     /locus_tag="CYME_CMH123C"
                     /db_xref="GeneID:16993604"
     mRNA            <299884..>301626
                     /locus_tag="CYME_CMH123C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536028.1"
                     /db_xref="GeneID:16993604"
     CDS             299884..301626
                     /locus_tag="CYME_CMH123C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536085.1"
                     /db_xref="GeneID:16993604"
                     /translation="MERLRNQVDTSLTRTVARSVVVGNILTVLLLGVLYANYRIFEAY
                     ISSFLLALLAAEALAESRDRLVRWLSTSESEAEGNDVQRPRRLWHFLLNQLGKLQQAV
                     RGKHWFVWLLSGTALLLLTVRVQHGGFLVFICLAVLGGSALCTLAAARFLVRLRWIHA
                     RTAAATLLLAAVVSLVCIFVLIFVTGVVQDLVGAARALARLAQDAATWNRIDPQGILA
                     KGLEQLQTFLAAHVEVAERFALRFRDVLKDLGFDMENTERWWVKSSDPSWWRDFLTGD
                     LHANAMLRETTSLRVPSWQQARTVAKRLWEGARKNVTPGSIARLGKHIRLHASSEQIY
                     TGARLVMIPVMRLAQAFGILLTYSDGTAAFLAMFFFLLRQPGSVVHALVQWIPFQNTE
                     RNRKLEQTLRTDLHRFVWSALSQLYLQSLFAWCVFVTFGLELEFLVALCVGVSVLIPV
                     LPGPLLWTTLLGLPQVMMRTSLGRLWRSHAALAFVCINLVGQKVLVRFSRNADDEDAE
                     QVQQRADGTLTPTNGLLTLSALLGWRILGGLRGALIASCCIFLTSLLVQCLVDDSSTR
                     GSENKIPHQSGGAA"
     misc_feature    complement(300885..303082)
                     /note="possible transcribed region"
     misc_feature    301950..303464
                     /note="possible transcribed region"
     gene            complement(<303551..>306679)
                     /locus_tag="CYME_CMH126C"
                     /db_xref="GeneID:16993453"
     mRNA            complement(<303551..>306679)
                     /locus_tag="CYME_CMH126C"
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit C"
                     /transcript_id="XM_005536029.1"
                     /db_xref="GeneID:16993453"
     CDS             complement(303551..306679)
                     /locus_tag="CYME_CMH126C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit C"
                     /protein_id="XP_005536086.1"
                     /db_xref="GeneID:16993453"
                     /translation="MTSRFFATGDTSEEESSSSSGELSDAVDVVPRAGSGPARVTGAT
                     GAVSSTVGGGFSRARFLMDEDESDSDSDGRRVVKSKETKKYEALVHSLRQLRNHLKIN
                     DWTSVQQDFDELNRRLERALSTDVARGGRPPVPRPYVKALVLLEDEIAKTLAEKPKLS
                     KTNTKALNTTRQRLRKNNREYEEAINEYRASGADPWESSEAGASSSGESETPELETLE
                     PEVLDRKRRSGKASFVGSRPAGTARGTSEASSSSAGTASDTDSESKSDASSSWATSSS
                     DEDESSSEESSESLAAEEPAEAVRGARAARWLRRESSASSSSSSSLSLSRSDESSDDS
                     SVSGRRGRQERRARAVRRKSRADEDADGFIRKYASPAREEKPEDLTAEQVEERIVQLV
                     AARGRKGTDRREQVRQMEWLSRAAKTPAQLVRVLLHMIAAQFDLGHTLGVMPRDMYQA
                     AANTAERLLQIAKSHPKVVRSAIRDLGAASGALGSTEAETLEYVMVDFAALVERLDDE
                     LTRAFQASNPHSTEYVERLRDEPRWLDFARRVQHYYEEQVGDACQAARVAARRILHLY
                     YQTSAMYQRMRLLKSATEPAAEEAEGSDLETLFTELTVLVYRHGDERAKAETMLAHVY
                     HLAIENQFFRARDLFLMTHLQESIQQQDIGLQIMYNRALAQLGLCAFRCGLIGETHAC
                     LADLCSPPQFFDPRTGTASTSMSRIRELLAQHAPPTRPAGPGTVNSNASDADRRRQVP
                     FHMQISTELLEAVHLTSAMLLEVPLMAAVSARNADWLARIDASAHGELFTSGWNQNLP
                     QASGLSSLQQQARQVSVSRAWQHFMRGSLRGQISGPPENTRDHIVVASKHLLQGDWRA
                     AYEVLASAKVWAQLEPGLSDSASSQESAAGQATQAASSAETEGPPTGRHASCLSRLQP
                     QLKEAALKAFVLAYAPYCDTFALETELAEHFELEPRRIHAILSKMIVQGELSARWDQP
                     TGVLAVHHRHMTRLQRLSIAWAEKLTQLLENNERLVDMRSDVELATSSAADPEHTPSA
                     ASSAGHGPRVSA"
     gene            <308322..>312092
                     /locus_tag="CYME_CMH127C"
                     /db_xref="GeneID:16993454"
     mRNA            <308322..>312092
                     /locus_tag="CYME_CMH127C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536030.1"
                     /db_xref="GeneID:16993454"
     CDS             308322..312092
                     /locus_tag="CYME_CMH127C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536087.1"
                     /db_xref="GeneID:16993454"
                     /translation="MPKLHRVRAACALCKEKEAVVYCCSHGCALCLTCDRKEHKSAVD
                     FGTRQFNTRRNVSAMEAVDSNKEGSRGKITEKLLREGPPSASQLEQASRRAERRAGAC
                     AQKQLQSDVEVAAQVGATAENNSGLPGVTRDCVDAASVAKRYLTDGPQVHSALENSGL
                     DTCRADARPVFPVIVPAIGVSALTQRPSESVPEPQATETKNCALAENPLFFKPDSELP
                     SGDSHWANQIYISSSGSSSVSGSGETAEKISDFREGAPSLETPPNEGQSSSQSSTFRD
                     GPGRTTSSSDLQTAGVLPCASADVQAHVRHPIVAPAVLILCDSCGAMPAVAYCTERAR
                     FHCELCMKYAHASGSAPDAPQELPMAWQVQCMKSGKAADADMKGAHRHEQDPYASSRS
                     RCGDSGDSGSAEREPTSESPSGGDQGTSHSGNGGSREPTSSSPAETAATTKPQNLEGP
                     STTAKSAHSQRKTYSDRGLSRSVAMMMLLDCSVEVPSRGSEELSAEGGDDASAESISE
                     QTDAESMSLGHESARSGEFRADPCTEPTLTSTGLPIKWATAISEEDLAAAAERAVRVF
                     AASSNSNGTRSTSSRHASSNDLSSAIVPGTGTHDVATAAPAVQSEAAAEAAPAQVTGF
                     EQPPLPACCIDITTTDARRAISIAKNEPFIIGQRSRPAYAPSSPLGQQPTSQSTGRRG
                     GTHQRRTADASEGAKRALPLKHQANTTASRWRKGRATGKNVDMRPDANHPEEEPLAPH
                     LTGLDVWGPHPETMAIIDSSTLAQAETARGLRSKTGAPRSAEQMRGTALKVEGAAICA
                     SSARAACSAEGQAVSAPRMRTSARALESSTRVDSTPLVPWRDLEVQQAPSLSKPQVPA
                     YVAAWSASPSQPSLADFVEAPLECRRSISKAASAQELRTASGRVPDSRHRSSRETAPG
                     LATRTSRESASHPASAQTAHLVEEGATSRGCPAGLVHLDAGPRGGHGVASIAVGTIDG
                     NPAKLRGFDDGTPAARLSPRSGTPVEGSFKMASGAGIPGSGSSQQARYPTVSGLSRRR
                     AESARAKVDRWLLGATQPAGVRRCESPFRQPQASYREVDVLDRAAAGPGVIAQPQADQ
                     GNEDTLMDDSDPALETGQLRNRTRELDKSAAAEPGQGSELDSKAEADLAMVDMLVPDF
                     SKYATPLPHGLMSRSTPSSSSGNGETSSTGGGDLEPSPLAAKRTLRVEVASEEARRMH
                     SRLQQHKSSGMLVPRMTASWSAEVKSAAHRRHSHAHLSSKDAEQKHPDETSA"
     gene            complement(<315131..>316237)
                     /locus_tag="CYME_CMH128C"
                     /db_xref="GeneID:16993455"
     mRNA            complement(<315131..>316237)
                     /locus_tag="CYME_CMH128C"
                     /product="cyclin dependent kinase, B-type"
                     /transcript_id="XM_005536031.1"
                     /db_xref="GeneID:16993455"
     CDS             complement(315131..316237)
                     /locus_tag="CYME_CMH128C"
                     /codon_start=1
                     /product="cyclin dependent kinase, B-type"
                     /protein_id="XP_005536088.1"
                     /db_xref="GeneID:16993455"
                     /translation="MERFRRLEVLGQGTYGTVYKALDLQTNRIVALKKTTLSNDDEGI
                     PATTLREVSILRALSDCENIVKLIDVIHAESRGKRPLLYLVFEYAESDLKQYMNRHRG
                     RGKGLPLQQAKCFAYQMLLGLQFCHLRGIMHRDLKPQNILVTNQDRTIKLADFGLGRA
                     FCIPVGRYTHEVVTLWYRAPEILLGTRCYSTPVDIWSVGCILAEMIRGRSLFCGESEI
                     EQLLAIFRVLGTPNEQTWPSVVELRDWHDFPQWKPRPLIQILPDLGESGCKLLSEMLQ
                     LDPARRITAADALRHPFFDDVRPLYASATLAVAPPRAMPVLNASDIAARNYNRNLRDH
                     QDSLQLPEDIMVSDTSTGTDENIPPGAENEVMLP"
     gene            <316724..>317215
                     /locus_tag="CYME_CMH129C"
                     /db_xref="GeneID:16993456"
     mRNA            <316724..>317215
                     /locus_tag="CYME_CMH129C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536032.1"
                     /db_xref="GeneID:16993456"
     CDS             316724..317215
                     /locus_tag="CYME_CMH129C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536089.1"
                     /db_xref="GeneID:16993456"
                     /translation="MMNTGRLTLILSMLSGLLHRISDTKYAGLPSLASYAASSRRVFV
                     AARESRFRCMGRLSTLFIQSRKLQSAFLLPLAYSLDTSPVRHPQRRHSAGVRRSVESA
                     RTPPSMAILWLVHASLSVRYVHWTGTEGSARCPVPLTQPVPYPLITRSFHAIPTVSTL
                     PAA"
     gene            318427..319217
                     /locus_tag="CYME_CMH130T"
                     /db_xref="GeneID:16993457"
     misc_RNA        318427..319217
                     /locus_tag="CYME_CMH130T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461302.1"
                     /db_xref="GeneID:16993457"
     gene            <321841..>322677
                     /locus_tag="CYME_CMH131C"
                     /db_xref="GeneID:16993458"
     mRNA            <321841..>322677
                     /locus_tag="CYME_CMH131C"
                     /product="similar to basal transcription factor ABT1"
                     /transcript_id="XM_005536033.1"
                     /db_xref="GeneID:16993458"
     CDS             321841..322677
                     /locus_tag="CYME_CMH131C"
                     /codon_start=1
                     /product="similar to basal transcription factor ABT1"
                     /protein_id="XP_005536090.1"
                     /db_xref="GeneID:16993458"
                     /translation="MSPADSEPASRTENLDQSPTNPLGTFSNAASDTSKSLNENQQRK
                     RPASVAGIVHVRRIPPGLSVAELRRILERYGRIGRVYLRKEQESERRERIMRGGSRRR
                     MALEAWVEFLDQQRAEQVAALLNATPMDPQRRRSRFHGDLWCIEYIRDLQWHHLSDQM
                     AAMRRERVLRIKNEVHASRRERDHWLERLREAHVDAAIQQKRQKRLQRNPGDYRAKSN
                     ESRERRMPPQHRPRAQRDIAPTERGVEASSTSPADCEPCLSSKEPSVERILRQIANPT
                     YT"
     gene            complement(<322834..>323907)
                     /locus_tag="CYME_CMH132C"
                     /db_xref="GeneID:16993459"
     mRNA            complement(<322834..>323907)
                     /locus_tag="CYME_CMH132C"
                     /product="succinyl-CoA synthetase alpha chain"
                     /transcript_id="XM_005536034.1"
                     /db_xref="GeneID:16993459"
     CDS             complement(322834..323907)
                     /locus_tag="CYME_CMH132C"
                     /codon_start=1
                     /product="succinyl-CoA synthetase alpha chain"
                     /protein_id="XP_005536091.1"
                     /db_xref="GeneID:16993459"
                     /translation="MHALRLLHGKLSVYGQSPCSMLRFLERGTRRWAQLPVSGLAVYR
                     TLTHQARSTKQNTEQVFRGKPSPFVSPETRVLVQGFTGKHGTFHSEQAIAYGTKIVCG
                     VSPSKAGTKHLGLPVFGTVAEAVRETGANASVVFVPPPAAAAAIEEAIDAQVPLIVVI
                     TEGIPQQDMVRIKRRLERTQMSRLVGPNCPGILHPGARCKLGIMPTSIVQPGRIGVVS
                     RSGTLTYEAVAQTTAAGLGQSLCIGIGGDPFNGTSFIDCLSYFFEDDNTDGIVMIGEI
                     GGQAEEEAAAFIREKSSHKPVASFIAGLSAPPGRRMGHAGAIVSGGLGTATSKVQALR
                     EAGAHVVQTPSELGLALRRALGR"
     gene            complement(<324981..>325919)
                     /locus_tag="CYME_CMH133C"
                     /db_xref="GeneID:16993460"
     mRNA            complement(<324981..>325919)
                     /locus_tag="CYME_CMH133C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536035.1"
                     /db_xref="GeneID:16993460"
     CDS             complement(324981..325919)
                     /locus_tag="CYME_CMH133C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536092.1"
                     /db_xref="GeneID:16993460"
                     /translation="MLGFVSSTAGVWIHQHTRCAPTSWLCGGTRLNSPSCRRHRTERS
                     PGIMTLGASLEGELATVVGAGRIGTLLASAKGDELAPVRLLRRQDSIEGGRKGPIYVC
                     TRNDDLAEVVAKCPPVRRGDLVFLQNGMLRSFLLEHNLEHATQALVFFAVPRVGDPPA
                     DGGGTVVWGPWAAAFAARVRSCGCQCTVLEDKQEFDCRMIEKLLWICIFGVLSESQNG
                     MPVGEIAEKQPDRVRQLVDELAPIAEREVGLEGKHALDRGQLLQSLLDYSKKIPDFVA
                     GFKEYRWRNGWFIERQRTPLHWELVERCRQRAAKPS"
     gene            329730..333019
                     /locus_tag="CYME_CMH134T"
                     /db_xref="GeneID:16993461"
     misc_RNA        329730..333019
                     /locus_tag="CYME_CMH134T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461303.1"
                     /db_xref="GeneID:16993461"
     gene            complement(<332384..>333211)
                     /locus_tag="CYME_CMH135C"
                     /db_xref="GeneID:16993462"
     mRNA            complement(<332384..>333211)
                     /locus_tag="CYME_CMH135C"
                     /product="unknown transcriptional coactivator"
                     /transcript_id="XM_005536036.1"
                     /db_xref="GeneID:16993462"
     CDS             complement(332384..333211)
                     /locus_tag="CYME_CMH135C"
                     /codon_start=1
                     /product="unknown transcriptional coactivator"
                     /protein_id="XP_005536093.1"
                     /db_xref="GeneID:16993462"
                     /translation="MQVDHTARVPKAVAQGRIRKAQRRRRVVQAGQRPGSKAVVVSVS
                     NLAPSVTSQDIADLFNSVGPTITAFIRHDREGKSKGVATVKYADMETAERAVKQFHSL
                     TLDGQPLVVQIESSGAAAALNTSGAHPQTQRSAVPPSMTPKRKLRLKERGARLPPVPK
                     PTAEAVGGLRIVAGKGGVRDVVRVLESTQTMERRRARRRRRLRMQAAGDGQQMETEST
                     ATPGFESEKHDSTAKRTTKARGRRRMRRPTRPRGQEAPSKSAEELDRELEEYRMADN"
     gene            332739..334523
                     /locus_tag="CYME_CMH136T"
                     /db_xref="GeneID:16993463"
     misc_RNA        332739..334523
                     /locus_tag="CYME_CMH136T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461304.1"
                     /db_xref="GeneID:16993463"
     gene            <335062..>336096
                     /locus_tag="CYME_CMH137C"
                     /db_xref="GeneID:16993464"
     mRNA            <335062..>336096
                     /locus_tag="CYME_CMH137C"
                     /product="similar to pyrroline-5-carboxylate reductase"
                     /transcript_id="XM_005536037.1"
                     /db_xref="GeneID:16993464"
     CDS             335062..336096
                     /locus_tag="CYME_CMH137C"
                     /codon_start=1
                     /product="similar to pyrroline-5-carboxylate reductase"
                     /protein_id="XP_005536094.1"
                     /db_xref="GeneID:16993464"
                     /translation="MHMQGAFVAAGKPPFRIHLVHEKQPKFLHGAGVRYSARSTRWYR
                     WSLRCTSSESRTTNTAAPTEKLGFIGGTGNMGSSIIKGLIEVQALSPQHILCSGRDAQ
                     KLERFSIETGCTAMTDLATLCAQSTALFLCVKPAQCQAVLERMVAEAGESLNGKRLIS
                     VAAGVPVSALERPLRVEAVEQCRCRVLRCMPNVLVRHGLGAMAVSRGTTATDEDVSWA
                     LQLLGRLGLVAELEESLMDATVAAAGSSPAFAFIFMEALTDAAVREGLPRHIARSFVA
                     QTLCGAAQMALRDSDAHFGELRNRVESPGGTTIAGSCALEENGFRKAVIAAAAAAAAK
                     SRAFADRFSA"
     gene            complement(<337284..>338345)
                     /locus_tag="CYME_CMH138C"
                     /db_xref="GeneID:16993465"
     mRNA            complement(<337284..>338345)
                     /locus_tag="CYME_CMH138C"
                     /product="pantoate--beta-alanine ligase"
                     /transcript_id="XM_005536038.1"
                     /db_xref="GeneID:16993465"
     CDS             complement(337284..338345)
                     /locus_tag="CYME_CMH138C"
                     /codon_start=1
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="XP_005536095.1"
                     /db_xref="GeneID:16993465"
                     /translation="MRVLRTVHEVRALRNDLQRNRNSAPRVAVVMTMGALHEGHESLI
                     NAAKSSGTFTFVTIFVNPLQFAAGEDLDRYPRTEQADLARCEKLGVDAVFAPLHSAEL
                     YPRGSAEQTVIDVPAGRPSQHPRSEAAFRPTFFLGVATVVCKLLHIVQPDDAWFGAKD
                     AQQCCVVRQMVQDLNMTVSIRIGPTCREPSGLAMSSRNKYLTDAEQATAAVVYRALSA
                     GQALWTEYRKRRLQQRQPLTYGALWEAATAALDVLKAESAVCVQYIGLSDAEEWRDLG
                     GGYPLEPQPPDLQADTLLPQTLLVAILSTAVIVGSARLIDNIALSIYEENAPVTGTAS
                     SEALASGMHPSTVTKVPRS"
     gene            <338711..>339250
                     /locus_tag="CYME_CMH139C"
                     /db_xref="GeneID:16993466"
     mRNA            <338711..>339250
                     /locus_tag="CYME_CMH139C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536039.1"
                     /db_xref="GeneID:16993466"
     CDS             338711..339250
                     /locus_tag="CYME_CMH139C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536096.1"
                     /db_xref="GeneID:16993466"
                     /translation="MFEPPAYIPVTAARSDLFRSPLVKSGASACGTGRLYVARATSSL
                     RSSGHRARVRPLHCSSGLRMLLRGFPNPGAFNSDGKRRIIEELVQFPTEFEFKVVGLR
                     QGDFTDDVVGLVAGALQRAENLDVRNTTSRDDRVRITKVRDRGKYRSLTIVAFCETGA
                     QVYSVYEALERDPRVLFKF"
     gene            complement(<340113..>340943)
                     /locus_tag="CYME_CMH285C"
                     /db_xref="GeneID:16993467"
     mRNA            complement(<340113..>340943)
                     /locus_tag="CYME_CMH285C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536040.1"
                     /db_xref="GeneID:16993467"
     CDS             complement(340113..340943)
                     /locus_tag="CYME_CMH285C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536097.1"
                     /db_xref="GeneID:16993467"
                     /translation="MSSVEADNSLEAEAGANLGTLGQQEPNRVSDESAELRLGHLRDT
                     LLRLQAKIDTLAGRDAKTASLVLNRVETVLGKGSVAAQRLVLLAAAYGLERCLFRRCP
                     AAYYTWTLEQRRQFLEPAPTVYHLCKSLILENTRANVDDEASGPGAAPRYVCVILPYP
                     ARLHTEKVTQAVRCSSELCQLCPAPRSQVHYQVAPAEQCQRITGYGYNAVTPLGMRTP
                     MPILVASVLEKWLKCCRDDCFWLGGGATDLKLNVSLSDFVRVFSRVHRLPVLIRDITY
                     "
     gene            complement(<342316..>345759)
                     /locus_tag="CYME_CMH140C"
                     /db_xref="GeneID:16993605"
     mRNA            complement(<342316..>345759)
                     /locus_tag="CYME_CMH140C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536041.1"
                     /db_xref="GeneID:16993605"
     CDS             complement(342316..345759)
                     /locus_tag="CYME_CMH140C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536098.1"
                     /db_xref="GeneID:16993605"
                     /translation="MPDQVETASSSGKSSEAASHRRVTSWLTSSIRRSATTVASQAMS
                     FHWHRSHGEPSAKVVADAPPPERQRLFRIVGTPMHFQLPTGYKQALAELLYAAALMRT
                     TQSSERHDGIVTEQDVSWFLRSRYRIKAFALEKQHQEEENLLRFADTEALFELVKRCQ
                     LLESERSFEAWRDQAAATTPPNHDSTLILDTTVVTQRAQSPVASSRIEDEEAAPQTNK
                     GDACAGERTGHPEPETMPPTNPELDLAEIAAELFGPELWRCSLWHSRMQAAASGMRNR
                     VSIEHTFDINDDLEVPDVAIRLAFEALAGGDEDAVLTPERLRAYMYRVGEKSLIPLVG
                     LLFAEIGSDKCDLDTFRSLLVADYFELASIHGGRGGADGFYVTESDGVGTATYFDDCD
                     AAFEAFTGVELERDIPISELAIIREVAESGGSVALVPGEETLLTMTDFHSGCHDAETA
                     EPTPEASTLTPEPSSTVSSGASTPQHRKSDNDEHRLRSRGKSFAQTTSKQLRKQAQRV
                     VDVGMRMVRDSQKVLDMVLDDARSLSYTMLVFLFFILTVVTYGIALLYVVDLAWKCSS
                     TVCVMARVGYSWIMTLLLSVIVGLIILVPLNMVNCRLSTPMSALISAWVTIVSTFVPF
                     FVTWFLVRINWGSSEFSRLRTDLRSGPYSALMIVTTIFGGICLFYQAYLAMVQSALFR
                     TRIPWFRSSSRWIRRPRFQRVSEQLLPWGRRKTLMLMREAISLHEKMRRAEDLGDLSV
                     FVELGQPRENFLQYAKRKFLYACESNRLIWTGRLLEKEGIVVPARIQIAQILQVILSC
                     ASFAGLIWFATFIVNVGWVVRGTRISPTPWVVYVSFSVGAVAGLVVTLAESFMMPGNY
                     RKLNHAYRSGRYSLVDREFMVNKNKLHRVSFVVGMSAWCTLWGFALTAIVIGGSLFLL
                     TWSRSRVIALGIALTWLATGVISITKNTLGYWMLNRMVATQLYRRRVFAFILTDIGES
                     AWILASGIWWVIGRVVIYLLLFALYIGRIDSNPWRKKLSVLDGFTAAFTTVALAYDAH
                     HHPFVNRLCTLLLLRACAWRQRDSNHERTKASAKMVTPNRTGNGVASGAVAEDAASGG
                     IPYTSPGTRAAHPPMAPIWRLLLVLALMPDMVWYRARTRIHSAMERRQVQQAEQKASP
                     A"
     gene            345993..347648
                     /locus_tag="CYME_CMH141T"
                     /db_xref="GeneID:16993468"
     misc_RNA        345993..347648
                     /locus_tag="CYME_CMH141T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461305.1"
                     /db_xref="GeneID:16993468"
     gene            complement(<347855..>348871)
                     /locus_tag="CYME_CMH142C"
                     /db_xref="GeneID:16993469"
     mRNA            complement(<347855..>348871)
                     /locus_tag="CYME_CMH142C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536042.1"
                     /db_xref="GeneID:16993469"
     CDS             complement(347855..348871)
                     /locus_tag="CYME_CMH142C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536099.1"
                     /db_xref="GeneID:16993469"
                     /translation="MSGSKRGSNAYEEAHADLERREQLWKVLARGSSALLLTSPRDSR
                     LVLRLRLERSLDSEPLRRAVERIFEPFAVRRERVNDFAEYQPNLLTPMAVSDHGAERV
                     PFLTIEIKPKRCGSFERLSYRACDLFANDLDLCRSALRSLLEGPQQLRKLLRLHWLHG
                     EQCLSEAMQRFRAGSSLVDWMARVIQTSPALARVHRVQQLHSCDHALVKRLFELERRR
                     LLSTPFGRRLRSGASRDERLSWFVGKTLDRRAAIWLVQNQSIIWSHIELSAASEPGSD
                     QFYALYNLACIANDCSILIRIDEQGFVIDHTIVDLDCKPFVLERITRRASVYGRGLCP
                     HEAG"
     gene            complement(<351643..>352251)
                     /locus_tag="CYME_CMH143C"
                     /db_xref="GeneID:16993470"
     mRNA            complement(<351643..>352251)
                     /locus_tag="CYME_CMH143C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536043.1"
                     /db_xref="GeneID:16993470"
     CDS             complement(351643..352251)
                     /locus_tag="CYME_CMH143C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536100.1"
                     /db_xref="GeneID:16993470"
                     /translation="MLKFWFLAPVTMIKFWSLLLRLLLFCLCYRRFPIRWSLCSLWLY
                     DQHSRDADGTIRVPIPRSPAVLNAFHAQVVVAIDASLFMSIWFAYNGGMAQEQSRVTT
                     ERRFPCASTTCQAPSAALRRVGARFIPWFQDPNGYSVLACIRPHAPATGIARYDHGPA
                     AGDQGNKSRVRWARKRTHYSIHWRICGSRCCPWWSTCSKETP"
     gene            <353148..>355730
                     /locus_tag="CYME_CMH144C"
                     /db_xref="GeneID:16993471"
     mRNA            <353148..>355730
                     /locus_tag="CYME_CMH144C"
                     /product="1,4-alpha-Glucan branching enzyme"
                     /transcript_id="XM_005536044.1"
                     /db_xref="GeneID:16993471"
     CDS             353148..355730
                     /locus_tag="CYME_CMH144C"
                     /codon_start=1
                     /product="1,4-alpha-Glucan branching enzyme"
                     /protein_id="XP_005536101.1"
                     /db_xref="GeneID:16993471"
                     /translation="MKEDGETRTRFWASQTDGTGVIADDPWLEPFQHDLRYRYAQYLA
                     KKKAIEANEGGLDKFTQGYRLFGFNLTDDGIWYREWAPNAAEVFLTGDFNGWNRRSHP
                     LKREEFGRWSIFLPNNEDGSRAIPHYTKLKVLIVTPTGMELMRNPAWSKFLIQNPDTY
                     LYDTLFWNPPPEWTYHWQHPTHVKRQDALRIYECHVGMSSNEPRIGTYAEFRDVVLPR
                     VKKLGYTAIQIMAIMEHAYYASFGYHVTNFFACSSRCGTPEDLKSLIDTAHAMGLQVL
                     MDVVHSHASSNILDGINHFDGTDNLYFHAGERGYHRLWDSRCFDYGSWEVLRFLLSNL
                     RWWMDEYHFDGFRFDGVTSMLYTHHGIGMSFSGDYREYFGLHIDMDACVYLMLANDFL
                     HTFYPDVALTIAEDVSGMPTLCRPVSEGGIGFDYRLAMAIPDKWIELLKKSDEEWDMG
                     NIAFTLMNRRYKEKSVAYCESHDQALVGDKTIAFWLMDKEMYDHMARDSAPSLLIDRG
                     IALHKMIRLITYGLGGEAYLNFMGNEFGHPEWIDFPREGNNFSYHHARRRWDLADNPS
                     LKYNFLQQFDINMHDIDTKYPFCRPDNHQWLVLAHRDDHVIAFERGDRLLFVFNFHPT
                     RSYNDYRIGVWWPGKYHIVLDTDSWDTGGQGRVHWDIIYETKAESWHGRPHYLQLYLP
                     CRTAQVYRCFEMAGTELVDNEARAGTRHEGLQPPAERPAVDGDAAASSDAAGRGPATA
                     AAAGEQPPQVTPEVAAQSETPSQSAAIATLPRGGDADAADVAQSSTIAPNASSAQHSE
                     RATPAQESMQAADDSSRPSPAAETATAAPQSAADPSTDRRSGSTDRREHAERKRRGLF
                     GRWG"
     gene            complement(<356243..>356965)
                     /locus_tag="CYME_CMH286C"
                     /db_xref="GeneID:16993472"
     mRNA            complement(<356243..>356965)
                     /locus_tag="CYME_CMH286C"
                     /product="chloroplast ribosomal protein L10"
                     /transcript_id="XM_005536045.1"
                     /db_xref="GeneID:16993472"
     CDS             complement(356243..356965)
                     /locus_tag="CYME_CMH286C"
                     /codon_start=1
                     /product="chloroplast ribosomal protein L10"
                     /protein_id="XP_005536102.1"
                     /db_xref="GeneID:16993472"
                     /translation="MHAFVSSVTQCGLEPRAKQGFWGSGSVCISAPRRPSAAARRVLP
                     GLHMGHQTRAQKEAIVQSLREQLRKAEAVVALPLEGLKHQQLERLKSSLPATVHCKVI
                     KNSYFQKAANGVTWLQSTSKEGEDALLAKPLLKLANFWFLAENLDDLPAAIRAYEAVI
                     EELKLEQTNKIRGGVLEGQLYDGDSMARVGKIPTKQELYRDIAIVMRMVPTRLARALK
                     ILPTNVARAVRLAKVDVDAAAS"
     misc_feature    complement(357869..359687)
                     /note="possible transcribed region"
     gene            <360581..>363265
                     /locus_tag="CYME_CMH145C"
                     /db_xref="GeneID:16993607"
     mRNA            <360581..>363265
                     /locus_tag="CYME_CMH145C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536046.1"
                     /db_xref="GeneID:16993607"
     CDS             360581..363265
                     /locus_tag="CYME_CMH145C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536103.1"
                     /db_xref="GeneID:16993607"
                     /translation="MWTAFTNGVVVVPGGFTLGAIRAKWFGTVSGNPLTKQLRRHSAK
                     FAQSVRWTEHIRRDGRRGWRMQDAGSEGASLFIEGPHTSAKNQHSWDAGDDAVSAPES
                     ANKVKKGSRTTLEGDADANPPNEQHTSETSTNKRSMSVADSTLASKPGAGGSAQTRSR
                     QSRRKASSTQATSREIARTEAAAGETGSIEQAAEAPVPAQAKTKRRSRKKSDQNSAAE
                     STEDTESAVVADDASEAPGHRQVHSLGTQKQTTRSSSTSRTTGSKARKKRDESVSNGQ
                     LPPADVESLPADASSVIPDPAMKTLEVNADAAVTTVANSRVFNAADEHLDEEPAEQSR
                     VGIQSRTPRSKKATRRSEKSTSRGSSTTFSTDGSAPNSGESTVYGSPGEAGPVAQHVP
                     AEMSDLGTNLSARASENDEDNNDELNASSTDFFGGQADLALDDDIETDFDVAALQDAN
                     IADAFDGETPTDSSFAWERDPIERARERAKAAHERMPSELRFRSETSSTEHSFPDESE
                     PVTDFDEYAWYENEPLVAPESPFQKAYQRLIHSHISYKEMDRWSQGGEPPRVLGLLFG
                     PPEPPPIPTPGQRFQVDEGPPLPIPDRPVWKSRDQASSDLNNTDLLTDIGFATSSDED
                     IEQALEELLQRDARTGGGRFRTQANKKNDIDAFDFDTQGMGFADSAFTEASDARSGES
                     LGIPGSQDDPAWGDFGGPASTTADAETASATDEYEPYRLRFANEAFPDDESTAGPDAN
                     EHSESARSPRLGGSGSSARWGPARKRLEDEEEERRRAGNPSPRIADEQRIAGVLTMPE
                     TFPAQYELRLLLRNPVPNEAVERILQDVESILRCEVEEDAFWIELVGDMKRVVVRVRV
                     QSASQIDSLYNQLCTHTTIAAMHGDQIDGIIGRDEEFV"
     gene            complement(<363469..>366198)
                     /locus_tag="CYME_CMH146C"
                     /db_xref="GeneID:16993473"
     mRNA            complement(<363469..>366198)
                     /locus_tag="CYME_CMH146C"
                     /product="polyribonucleotide nucleotidyltransferase"
                     /transcript_id="XM_005536047.1"
                     /db_xref="GeneID:16993473"
     CDS             complement(363469..366198)
                     /locus_tag="CYME_CMH146C"
                     /codon_start=1
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="XP_005536104.1"
                     /db_xref="GeneID:16993473"
                     /translation="MPSQENPWAYIPSTFVLCPGCTWSSHRSGVANLAPLPRASAAWT
                     TTTLGTFATPVSVLRRIRVPLDEFPASIESERRAACVWRTANPTGRLRQLFAKLERFS
                     VDINVPGAEAPIQLETGFFARQAGGAVAVRSGDTVVYCTACSDAELSPNIDFVPLRVD
                     YVEKFSAVGRTSAGYLKRERPGDREIQVSRLIDRPLRPCIAEGFFKETQVLANVFSFD
                     GTHQADTLAICGAGAALALSPVPMCARVAGVRIGMRQDGSFVVNPTEQQMRGECKYMD
                     MVVAGTSSAVLMIEAGCLFASEQQIAEAIEVAQRAIAQICEGIERLEALVTAAHPERA
                     PKDDADLRRVRDTLLEQTRKIARKMGLSQAIRIAEKKQREAALAEIREQVLEELLDAV
                     TEQELETHGAADEEAFETLCRMAWKRVLSSEMRRLIVREKVRADGRKPHQVRPIDIVQ
                     TPLPCAHGSTLFTRGETQTLAVVTLGGQDSAQRSESLLGEHTAHFYLQYMFPPFAVGE
                     VGRIGAPGRREIGHGMLAQRALEPVVPPREVFPYVIRVESNIMESNGSSSMASVCGGS
                     LALMDAGVPVSAAVAGVAMGLILDQTTEEPDVSRQSPSYLILTDILGMEDALGDMDFK
                     VAGTRTGITALQMDIKVEGITLGIIREALEQARDARIHMLDVMDAACSAPRSTVPSSV
                     PKIKIINIDPKRIGDVIGPGGRVVRSIIEACGGEENITIDIEPDGVVSILGPETELLE
                     RAARMIRNITMDVEVSQVFEQARVTKVLPFGAYVELDPLTGKEGWLHISEIAWHHIDR
                     IEDVLREDQVIAVKVLEVNARGQVRVSRKALLERPQPSDAAAGASANGTRANTSRNVT
                     LSDAPGSGSSARPGRSPSSSSSAPRSAPNRPSSSSTSGNPAIKPTQPAPPEET"
     gene            366411..368045
                     /locus_tag="CYME_CMH147T"
                     /db_xref="GeneID:16993474"
     misc_RNA        366411..368045
                     /locus_tag="CYME_CMH147T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461306.1"
                     /db_xref="GeneID:16993474"
     gene            complement(<367429..>368382)
                     /locus_tag="CYME_CMH148C"
                     /db_xref="GeneID:16993475"
     mRNA            complement(<367429..>368382)
                     /locus_tag="CYME_CMH148C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536048.1"
                     /db_xref="GeneID:16993475"
     CDS             complement(367429..368382)
                     /locus_tag="CYME_CMH148C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536105.1"
                     /db_xref="GeneID:16993475"
                     /translation="MEKRSRRVMRHRFEGFHLPGSVWAPTEYRELEKVEDDEPQNPVK
                     LEKFSHHTECKSQDSAKEPLEKPLVQEQARRISSPVKLPARAQQAHRFVSLEDSLVEK
                     RELENIQEKTDEKAIYGESPKTAADVADAARVEPSPQTEPETQVSPPRAKTSPKNHQY
                     RQVPKTRRWSIRQALSVRAPPAAPTSPVSAATVASVSDWSAGTGAATENAHEHQQTAA
                     TDTEHLTKTRPATTISLPDRVVKNNFPGIEAIENMSLPSVSPAAQSDASAFSVGDIVA
                     SSNDSGRWDEEPFEKLPSERIPKRASNRRRSALARMLVCFR"
     misc_feature    371073..372415
                     /note="possible transcribed region"
     gene            <373478..>374224
                     /locus_tag="CYME_CMH150C"
                     /db_xref="GeneID:16993477"
     mRNA            <373478..>374224
                     /locus_tag="CYME_CMH150C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536049.1"
                     /db_xref="GeneID:16993477"
     CDS             373478..374224
                     /locus_tag="CYME_CMH150C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536106.1"
                     /db_xref="GeneID:16993477"
                     /translation="MRRRGLLSSQVTGYCVGLTGRETLFGKRLCALRQRSTVRPQSSV
                     QCTLSAPQHVSRVLANLLVAVSVLVQPAVSLDLETAREIGEAKRAEQESRLPPRVRLP
                     SGVVYRELRPGDGLVLHWDEQPDVVLSWAVLRPTDLYYQFGSWNRVSLEDDLFRALPA
                     GEATLVCGLAHGLEGAREHALRRIWVPASLGYVRGDEVPQPRPDDFGAQRRFTRLRQR
                     NADLVFEVEVRRVRPNGGSKLHVCPLGSEQ"
     misc_feature    375423..377605
                     /note="possible transcribed region"
     misc_feature    complement(377045..378885)
                     /note="possible transcribed region"
     gene            complement(<379977..>381899)
                     /locus_tag="CYME_CMH153C"
                     /db_xref="GeneID:16993480"
     mRNA            complement(<379977..>381899)
                     /locus_tag="CYME_CMH153C"
                     /product="probable leucine aminopeptidase"
                     /transcript_id="XM_005536050.1"
                     /db_xref="GeneID:16993480"
     CDS             complement(379977..381899)
                     /locus_tag="CYME_CMH153C"
                     /codon_start=1
                     /product="probable leucine aminopeptidase"
                     /protein_id="XP_005536107.1"
                     /db_xref="GeneID:16993480"
                     /translation="MRAWVRPASCLGSERRNAFLQSNCGSFRADVPDLRARGRVRTRY
                     IANWHSLSHSRHVRLFHIYAKAGTPFSEYVPDESTPELLLAWGQRVLAYAGRFRQSWC
                     AAASATCTTPIDLFSSRGFDAWLAQQPEGLQVWLRTVETLSSVANTDTGDLFCQCIPS
                     PSLSSAAGAEEASSGSGIPQAPWSVLVRTDYVCSSDLLRVPWPLAAIPSRIPPGAYAL
                     RRGCAGLPPSAIALAWALGTYTFDAYKTREPRALRQLQWQVSDETKMVESFAEAAYLV
                     RDLINAPAEQLGPAALEACARALADRYGGSCRAIIGEALRTANFPQIYAVGRAAASRH
                     APRLVEMHFPLPEGRSPSRSPPSSSSSPNASKPLIVLIGKGVCFDSGGLDIKPAQAMR
                     LMKKDMGGAAHVLGLANLLRSDPQLAERHRLCVLLPAVENAISGDALRPGDILTARNG
                     MTTEVGNTDAEGRLILADALAYAMELNPQYIVDFATLTGAARVALGTDLPALFCSDEQ
                     VAREAMELGSLLGDPVWHMPLHRAYRKMLRSKVADIQNIGDSPYAGAILAALYLAEFV
                     QTGREALPSRQSPETAPAAKAADGSARGSPVWIHLDLMAYAVGSSAGRPEGGTEQGLY
                     TMYHLLRRRVLGAEVA"
     gene            <383142..>383984
                     /locus_tag="CYME_CMH154C"
                     /db_xref="GeneID:16993481"
     mRNA            <383142..>383984
                     /locus_tag="CYME_CMH154C"
                     /product="20S core proteasome subunit beta 1"
                     /transcript_id="XM_005536051.1"
                     /db_xref="GeneID:16993481"
     CDS             383142..383984
                     /locus_tag="CYME_CMH154C"
                     /codon_start=1
                     /product="20S core proteasome subunit beta 1"
                     /protein_id="XP_005536108.1"
                     /db_xref="GeneID:16993481"
                     /translation="MSRSHEATIPPARGFSSSSGGGLKTSTPASLELLYAAAAASDPF
                     EGIASAMSFTKHLLMHNCDVWTPDWYNPTQDPQLGTTIMAVEYDGGVVLAADSRTSTG
                     TYVANRVSDKITAVAPPYIYCARSGSAADTQMLADTVRRYVTALALETQRPATVRTAA
                     ALFRELIYQNKSRLTAGVICAGWDPLNGGQVYSITLGGTLVRQPFSIGGSGSTYIYGY
                     CDASYRKGMNREACIAFCQQAASLAMARDGSSGGVLRMVCIEESGAQRLLFTEDQLPR
                     GWQG"
     gene            complement(<383947..>386712)
                     /locus_tag="CYME_CMH155C"
                     /db_xref="GeneID:16993482"
     mRNA            complement(<383947..>386712)
                     /locus_tag="CYME_CMH155C"
                     /product="probable ATP-dependent DNA helicase RecQ"
                     /transcript_id="XM_005536052.1"
                     /db_xref="GeneID:16993482"
     CDS             complement(383947..386712)
                     /locus_tag="CYME_CMH155C"
                     /codon_start=1
                     /product="probable ATP-dependent DNA helicase RecQ"
                     /protein_id="XP_005536109.1"
                     /db_xref="GeneID:16993482"
                     /translation="MEPAPGPQVVTTPAVRVTAPPPTFGRFQTKKKRKRALARPNDAR
                     AGFAQRRRRGEHRTGLWAGRSRWSHPLRQATCVDDSLADPERATLTAEDVADCPWQPD
                     GQQVPLDPPVCREHNQPCIRRVSRGYGGRIQRAYYVCGQRPRCSFFLWEHVHRLQCQA
                     ATSWLLESAPQPSCDISMLRQCERAPALYQVSESSDFRSPVPELMPGLELRSEQSEAL
                     QHLLRGESVLLGIRPGSRRSMIYELYAALTSGTVLVCEPFRSLIREALENLPSQLPAA
                     EITNNGFKTACGFQSLEATQIGAYKVLFCTPERLCQPQVQSFVEHLHPSAVVLDEAHL
                     LLPWSAMFRPSYWQIQPLLKQHLAADTGCVLLAQTATPTPAVRACLATVVSGALVEAL
                     PPKSDLVPSKLHFSFSTPVDRYRTLVRMLSKDEQWTGPVLIYVSRQRDADALAAWLQN
                     HLIDARSYHAGLNPEQRRKVEEAFRQHHCRVVVATSSSALRTLAPAACCTVHWSIPNS
                     IEDLLQQTSCAGKDRSSAFSHLFYDAADTERLRALALAEQVEPALIRKLVRSLVASVV
                     VTSESSHPGNEGAAERFTLLDLATLQNTLDIPATILEQLIIRFTVIAGEALSTVGAAP
                     WRARQRVPTTLRITLHQAVSCLPEDIRSFCQELVRLSAAEAPHRLRHPSICNVRLDAV
                     SQALSMSPFEVLDRCSRLQYQGIITMQTIGECLVVCHSGQPPPPPLATQVRAWTDALV
                     AERLAHQRAFLERLEQMELLARAVLQLGRTEACSSQIEAHFREWVDHYFRTGQLPPAC
                     VAISSPRTPVSAHTGLANDHALLMADIRALLHSLYRSGQEMHAEQDLCTPPRIPCTAL
                     QITRILQGIGSPGFPATRWKTFPFWGKYVHASFAYIQETVEHVLQRLLSQEDAFTPAN
                     RAEADPP"
     gene            <391506..>393149
                     /locus_tag="CYME_CMH156C"
                     /db_xref="GeneID:16993483"
     mRNA            <391506..>393149
                     /locus_tag="CYME_CMH156C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536053.1"
                     /db_xref="GeneID:16993483"
     CDS             391506..393149
                     /locus_tag="CYME_CMH156C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536110.1"
                     /db_xref="GeneID:16993483"
                     /translation="MPSVDTSSDADGKSTPIQVARGLYNFLRVVGGTNYERSALVTDL
                     SIGLALLIQRKEREREQERESWLASLEREQVQLEAAELKRLHHFARLAHGAYSANDEE
                     LFKHTPVYAKTLLKARWSSSQEEPAYYIAIDEAFRSIVLAIRGTDTFSDVFTDLSLHP
                     TPFLGGTAHAGMTRAALRLYDEVREMLRTARTNYPEYDLVFTGHSLGGGVASILTMKL
                     LWEDDPLLRLFEQHNRPKLLAYSYGTPACVSLELARKIQGSPPDLRDALTTVVLGDDL
                     VPRASAASMDRIVRELAAFNWREQIANEFSEYVNTSSLARWSQHVIRWSIPRDQVQRF
                     VTEIGQRLSKASSSIKGARLGNTFGLVAAVAGSASGWMNWYGNLFQKEQPQEREAVNR
                     AEPRLAEPVALPQFYPPGGCIWHLHEVSLRAGDQRGLPEGAASEHGRVRQQLVQDISN
                     ISREVWNELPTLKQPNESPEAPGNDWDRSNAPEDAAESIGAEPQRLLLLRTSPDAFHD
                     IVLSRRCFNDHLMRNIRRALARLYEQQYRQPRLGEHGSS"
     gene            complement(<393738..>394709)
                     /locus_tag="CYME_CMH157C"
                     /db_xref="GeneID:16993484"
     mRNA            complement(<393738..>394709)
                     /locus_tag="CYME_CMH157C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536054.1"
                     /db_xref="GeneID:16993484"
     CDS             complement(393738..394709)
                     /locus_tag="CYME_CMH157C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536111.1"
                     /db_xref="GeneID:16993484"
                     /translation="MQRVSNVTSHEQKPSKPLLLSKGLVGASRTGRNAPRCLLFQRLF
                     MTCASELLWQSNSAVIEQALQTSWLRELAQGTLSESNLASFLSVDTEFLAGYWRCLGL
                     LCFTAETGWEHQVLAELSHAIAAERGSVSAQEQVAAKHGAQQLVAAAAAPTATATRSV
                     SSTNRQNSAPALHKVCQGYLRLLMRHSRGLLEELIHASGAFHEEQGGIAPVEASWRRA
                     RLLLVAAMVPCMSLYAFIGRKLSVHIQAADDHDPRKSARATWVATYSSPKFQELAESF
                     ELLLDLYAEQWCSATSETLERLVQQLNEIAYAPAMQFEMQLFAEACP"
     gene            <396499..>397998
                     /locus_tag="CYME_CMH158C"
                     /db_xref="GeneID:16993485"
     mRNA            <396499..>397998
                     /locus_tag="CYME_CMH158C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536055.1"
                     /db_xref="GeneID:16993485"
     CDS             396499..397998
                     /locus_tag="CYME_CMH158C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536112.1"
                     /db_xref="GeneID:16993485"
                     /translation="MDGLWARKDGGNGLVDEQGLRAPLSGGLGWESRMRSRWNDWLRK
                     LDVYPKTVEDVRLRSVTGGIIALFSYICIGILVVSEFLRWLQPQLHSNVLVDARSILD
                     TEPITVDLGIDLLAVGCDEFSLDALTANGAQLPNSVVELRKRPLDASGQPVIFPRGAF
                     GRSRLRNERGGVAPAPQALTEDPPNTQQLEGRVSQEVRAQLKQYREEAIAFRDRLAAL
                     NKTGVAYCGSCYGAVPQTDQVGEANQITSGVCCNTCDEIRVLYEERNWAFDQVLRTAE
                     QCAEKRYLTLLHEAGRVQSGGCRVSARLQLPRVAGNFHFAPGKGHTHRMGHHVHSVDD
                     QLLHRTYNFSHRIRHLRFGPLFPHQQNPLDGAMRILEQPPPGSPFGNMVLYYCKLIPT
                     TYRRDRQRGDALRSMEYAAADLTQSSEQDRVGITHSTGALPGIFFFYEPQPLQIAYFE
                     GRMYGLLHFIVQLCAIVGGVFTVSSMIDRFVFGAGTFIRAQKRRLGKLG"
     gene            complement(<402683..>403777)
                     /locus_tag="CYME_CMH159C"
                     /db_xref="GeneID:16993486"
     mRNA            complement(<402683..>403777)
                     /locus_tag="CYME_CMH159C"
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit G"
                     /transcript_id="XM_005536056.1"
                     /db_xref="GeneID:16993486"
     CDS             complement(402683..403777)
                     /locus_tag="CYME_CMH159C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit G"
                     /protein_id="XP_005536113.1"
                     /db_xref="GeneID:16993486"
                     /translation="MSLRVATVEPTTSEDAWDETENDSPDAVASLGRALTTQLDKGGG
                     GLPPPRVSEPDADGIVTIVDYYVNDEGYVVQRTRRVRRRLERRRVCAAVAERRRCWRK
                     FGVAATENANTTTQANEDIPIEWNTRNTEVSDDEESGEAVPSLGAAPSSASGGGGGGS
                     GSGEDLMTNKSIVVCRICGRVGDHWTLRCPYKGLQGAADGLGLPGSAASTAPDGILGA
                     TGAVGAPSAGSGGSMAASATSSGATRYVPPSMRSGASARLREGDSLYGRREENSIRIS
                     NLTEGATEDDLRQLLEPFGRVVRIYLARDKYTGAPKGFAFAAFAERSAAERCIAKLNG
                     FGYDHLILSVEWARPSGDRANAASSVNPGA"
     misc_feature    403379..404847
                     /note="possible transcribed region"
     gene            complement(<406326..>407189)
                     /locus_tag="CYME_CMH161C"
                     /db_xref="GeneID:16993488"
     mRNA            complement(<406326..>407189)
                     /locus_tag="CYME_CMH161C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536057.1"
                     /db_xref="GeneID:16993488"
     CDS             complement(406326..407189)
                     /locus_tag="CYME_CMH161C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536114.1"
                     /db_xref="GeneID:16993488"
                     /translation="MKAMRQSTGQGSRWQLRQGRFEMMTKFRIYNCSRHYNERPCTLP
                     SDILSISTPTSLRGLCPLSAHIEMTSHHVHRKAPSVVSLRVVLLLILLLVFLLIFLAD
                     EHLLVLFAHLLIVRALLPVLLTSLFILKTLALSILDALVLVLHALLNLLVLCSILRTF
                     VFVLLILDAVLLLLTHLLHRHFLLVPATIPVLLLNHLLLLLALLLVCKLDAFLLVLDT
                     DLHWLLHSLIVLALLLLLHANLLVLLALLIWLKAYILILLALVHILRTHLLYLALLLV
                     FICLSKRCKRC"
     gene            <408595..>411393
                     /locus_tag="CYME_CMH162C"
                     /db_xref="GeneID:16993489"
     mRNA            <408595..>411393
                     /locus_tag="CYME_CMH162C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536058.1"
                     /db_xref="GeneID:16993489"
     CDS             408595..411393
                     /locus_tag="CYME_CMH162C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536115.1"
                     /db_xref="GeneID:16993489"
                     /translation="MSACLSRADPPKTDEKPAQTPPRLLAVQAVLDSRSCFSETASAR
                     VHLELQPCALAPSESVACLPSLFPCTMDQSEEAPLPGRRFILQGDWALSPITPAVRQP
                     PMERRAPGTMLPEGFSEAATSTHGMSMGTYYSMRLGSPVPRGGRMRTTRPWPGMALSP
                     AHGYALQTLAPSSALLDEYRRQALGLNTEPHSEQDVIDTDPFSPSDADLAMEAGVSVT
                     PMRPGASSPPMSSPVYAGVGLAFAVDGGSPALGPGSCVGAFGAGVMTGCSLMQPAAWS
                     NSAAALTPLTARLREQSRVAADLDPDFAQVALATNDQRLRIKRYRQIYGGIQSPTTSA
                     AGVSQPDPRVSLNVPLESSQVVSKATHAQRIATGISVPSATSGCWDPDFAAKKQQADP
                     YVRPLSCESARPPRECSQATTSTSIANAYCRFEHPVYLDATDLNDEDATHSEAFNESN
                     ENIRLEASFSSETPAGALQTSSTRDEMHSRAHLSAHAAGDMGPPYGIPVLQVLQERQL
                     PNYIETAHGNESMHSRDPSLHQQPKGSSNRKRSRHETDPMAYQAGTRHPDGGYCPSRP
                     YCSMQKTESAHTSASSSSDDLVMSQNTSKTLSQDRSCVRCFESGLERKRVLFAVHPTG
                     VDERSLPSTSIATDTVRENRQSLFPSPHEVQDGHFAPTEDNGMRPLPFAASGSERSAL
                     APPPVSVPDARVICPAYESVSAAQSLASADQHCLDHHRDTFSINQTINCWSSGRTRYA
                     PEPQTHAMVSLDGTQAEHTVDPYLPSEVHPGATASAAALVLDPAAAAELQRASRRLQT
                     PRTNTLRIASKRCRCRRSRCLKKYCDCFAAGSFCGPECECEGCGNHQDNQEQVERARQ
                     SASQRSSTSGEALNGEPSASERSSRGCRCKRTGCLKRYCECFQAGRECTAQCACEGCL
                     NCRGLSEHLLVEIRRRLA"
     gene            complement(<411748..>412620)
                     /locus_tag="CYME_CMH163C"
                     /db_xref="GeneID:16993490"
     mRNA            complement(<411748..>412620)
                     /locus_tag="CYME_CMH163C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536059.1"
                     /db_xref="GeneID:16993490"
     CDS             complement(411748..412620)
                     /locus_tag="CYME_CMH163C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536116.1"
                     /db_xref="GeneID:16993490"
                     /translation="MPADVDREPVSPSKGYWDEWVHECRRLERDIAQLKSFWDAPALD
                     THTRDPAEAVAPAADLFRQAVHLCRGLESARWLAERLPTASALSDTVTSLVQQNERFL
                     ELIARALDIEAAPVATPLSERRQAVTTPSPQERAASDAADEHRLSLWQEVAPKTPTVE
                     DLHLASSTLAQLQLAPDESPISALTSSDSAKPGRKLNGDALESLYREKVSQFVQRQVS
                     VNELATWWQRLRDLWASNGDTWLSADALLHQWETERTRLKLVLLALTQMEMLTSRWEN
                     NACWYALNEPARSP"
     gene            <414679..>418203
                     /locus_tag="CYME_CMH164C"
                     /db_xref="GeneID:16993491"
     mRNA            <414679..>418203
                     /locus_tag="CYME_CMH164C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536060.1"
                     /db_xref="GeneID:16993491"
     CDS             414679..418203
                     /locus_tag="CYME_CMH164C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536117.1"
                     /db_xref="GeneID:16993491"
                     /translation="MSLLRIGDEAYWLRVEDPEVDTTPPETCSTTHEALLFRGSSATP
                     LARLVACGPRTGSGFLETLRGQRIALLVQRSTLFPARIVAAVWVHTPCAPLVCGPQLW
                     IVHEDGELCRYADSGCSLGVYRLLPRAPAADTQPEGIRAVAVQPLCGTCTYVVAWVST
                     RNRLWAGRIRLNVSDDLIRSGKLTIASEPLNSEEDAVDVHPLRTLPPAFAGASSLELC
                     WLADGKRLSICSNTGEWWIDSISFDENVDVAMTGNLVVATEKVRDATTSAATRRLTSD
                     RLRLGSASPDGRYCIWNTADGRHLLLVESSTTKVSVQRSLYRIQQPAGRWNVIRTDGL
                     WLPSLGGHPNAHCCTFLRHALMQQPDTNTHWWCWSFLSLPSGVSLSIMVRSRLTRDWN
                     GPGELVSIPEPDGSTLLWIQENGARSLARLQSVATCQRPLIEWGVNAPGVLLYEAFAT
                     RSVIPTQGQTEAVAGLRPNSECASSSLEPCHGSTLTLADLECLEDAASQPTSKAPSHI
                     LVLEELRAQRLLVDAAEQCVTWAFHTMVNDTSRATRLLEAARWALAAACWDNWHQMDN
                     WLRGSPESACRSDNTLERVPSAYGKRLARACYWWHRVVQWLRFRNRLATLMPLSAHQL
                     QQPGMLRQVIGSIVRYAAATALSGGQGVPATATTRTSTTSTTAAHQVSIEERISALYD
                     LIEESLQLTVCLSRADITTAFAVALLRHGAAYHRDGCLQRAEQWIRALFLPASLAGEK
                     CTPIQQALSERMAPFLRYAAASAIAFQIGLDRLAYELALTEPDPGRRIRALCGLSDAT
                     AAAQALQVFVGFYPRLSIEYLLIILDWYLERDASLHELSKTLQAYPMLQDIILTELNQ
                     RGDKITYAQVLRLLGRRARRVTEAPPLDDRIAFEHKEPSPGANRSRFWSLAQWLDWGS
                     VGVGDQAPEMSQGQLLPRLRADLTQTLQAMPRATTLAPILEECLAADWVRIPAKLLIA
                     ALLLDIMQPATTNVHRTRSELASRCLKVEARWAQHVALVLLKKRALPYAADSSEALEP
                     EYLRARWMTYLTHLANLATRNRRVAASTPFMGASASVLRSAASGFHRHRAGHSGMPRD
                     AFTAAAESTGLPWGRPASPLADWDRQLLLDMCLTIWSSRVSGAERETLRQCIRDVQAS
                     LEDEALRQTYAERWQRLEHIESVAPGQS"
     gene            complement(<418638..>420890)
                     /locus_tag="CYME_CMH165C"
                     /db_xref="GeneID:16993492"
     mRNA            complement(<418638..>420890)
                     /locus_tag="CYME_CMH165C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536061.1"
                     /db_xref="GeneID:16993492"
     CDS             complement(418638..420890)
                     /locus_tag="CYME_CMH165C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536118.1"
                     /db_xref="GeneID:16993492"
                     /translation="MGTSPARRPPAGRPRRGICRRTDLAPVMAPLKLTSRRGRTTSAG
                     RQQPSGRIVSVQSHLATPATSLAGFRIDYPCWPVPERRVRDSLMPGQGPHEDRYQAGR
                     LACGTELQETGTNPAPAKTRSRVRSSGCGSRAASVHGGANPARAVKRALESDWFCIGP
                     ADVSGSSLLQRAQHMFLEARHHSHENAHMACRSVPSETRISRSACEKRSMRNQLASSA
                     EERGARSVIIWWLFAAAAEMQFRRETAGLAVHFFDCIRGNVTLSAWLEHAASCLLIAG
                     KVQERYPIKDESASVVRVLEWLLRKTSTTSPHPERTGWQLKSLSQSLHLEQDTGDLSG
                     VPSTSDRSSSLPGNCPGVAAPAHQRTSRIEQLKSFQAKLLCFEPAAWRSFSTITPLRQ
                     GSWRSPITSKLPCQLQALPGRKPEASDAEQAGAVSTESDSQAIWRRIRSIEPQVLDWL
                     HWELQCPTIYSCLYLLYRLYQDTNDQLWNEQNRYYSRVEEATTPVRARCLTGAIRSST
                     TDPAIENPAQPTSTRLPAQLIEASLSPRTENMEIPEQESPHACFTPVRSGTWPAPDQL
                     LALAESYADHCLQDLSILQFSSDVIASACLIEALGERGYDERRRYVALLAQQQLSVGA
                     EALRSCCKQLREKLPCCRAVPCTPCPETLVSHVHPTQCSPSVVAGPQSHQMPARRGSG
                     SVSNLSSHSLECPEAAFTPICRVMYEPMRQRWDNLLFPESLLETAGCGPFAQKTSNDI
                     SPVDISQGRF"
     gene            <421677..>424115
                     /locus_tag="CYME_CMH166C"
                     /db_xref="GeneID:16993493"
     mRNA            <421677..>424115
                     /locus_tag="CYME_CMH166C"
                     /product="DNA gyrase subunit B"
                     /transcript_id="XM_005536062.1"
                     /db_xref="GeneID:16993493"
     CDS             421677..424115
                     /locus_tag="CYME_CMH166C"
                     /codon_start=1
                     /product="DNA gyrase subunit B"
                     /protein_id="XP_005536119.1"
                     /db_xref="GeneID:16993493"
                     /translation="MNATYAFVSTIGVGCGSYWSGTCLCRSSSRERPNAPKLSSRWPQ
                     RGALLCSGVEQVQPVPGFRDSTASNANTFPKSGSEYTAAQIDVLENLEPVRRRPGMYI
                     GSTGARGLHQLAYEVIDNSVDEALAGYCDKVLITLHEDGSLSVLDNGRGIPTDKHPKT
                     GKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGVSVVNALSAWLEAAVYRDGVCYTMR
                     FARGEVVEALRVVAAAPNPYPGFMERSGTYIRFAPDPSIFTTTTEFSYDVLATRLNEL
                     AYLNAGLSIWFVDRRVGAVPSQNLLSIAQNGSETLAMRPVSTKTTIKPADAAVTKYDD
                     DTDPEVGSRDTLVDENRAASARRASADLSAPVSLITETDIPSVYGGARFYHSGGIAEY
                     VRDLTEGKERIHPEAIYLRRELQNVEVQIALQWCRDQYNDILLSFANNIRTIDGGTHV
                     DGFKFTLTRVLNALARQRGMLRENNSNLSGDYFREGLTAIISVKVPDPEFEGQTKSRL
                     GNPEVRSIVDAVVAEELSLYFDQRPRVFADIFEKAWQAYQAAEAARRARDLVRRKSVL
                     ESSTLPGKLADCASRDPRESEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKC
                     DDSKVYKNTEIQALITAIGLGVKGEEFDANQLRYHRIIIMTDADVDGAHIRTLLLTFF
                     FRYQRSVIENGYLYIARPPLFKLEIGGGKQRQTRYLYSDAACEQALARLLRNKPDARY
                     TLQRFKGLGEMMPQQLWETTMDPARRTLDRVSVQDAGAADRIFNTLMGDRVFPRRQFI
                     EQHAESLKLDDLDI"
     gene            complement(<424318..>431505)
                     /locus_tag="CYME_CMH168C"
                     /db_xref="GeneID:16993494"
     mRNA            complement(<424318..>431505)
                     /locus_tag="CYME_CMH168C"
                     /product="pre-mRNA splicing factor PRP8"
                     /transcript_id="XM_005536063.1"
                     /db_xref="GeneID:16993494"
     CDS             complement(424318..431505)
                     /locus_tag="CYME_CMH168C"
                     /codon_start=1
                     /product="pre-mRNA splicing factor PRP8"
                     /protein_id="XP_005536120.1"
                     /db_xref="GeneID:16993494"
                     /translation="MPKRAFFGRDEEADQTLDLKRKRPRRAFGADQPFFKPYTSPDIF
                     RKLASLARIELERSENDLENSAHRGNRDRHISRNTDALTLNALRYLPHAVYKWLEHMP
                     APWEPTRFVPVIFHHTGALAFIEGSRRVPEVVHRAQWARWCAYLDRRRHEAHVASTSS
                     GKRQRDLTRSFVRLQVPAFDDDEPSPSFREFVYHRTLPTPFANDADAAAEYERIQQLA
                     ANLHTPEARAALYRMSLPWAPHPNDLDPSQFYLRNRLTLRRVHRLEHERANLRRKSLH
                     AGSLHSEGAHLLQEDWDDFTELGMHSILPGQRRAPELHQAYPYLYDAFDERTPNPEQP
                     LWHHHAPRPLMWPPTPPPHPLWPSAWSWQPTLAPLLHSSAQGAGERIIPDTSEGASAQ
                     RTRYRAHPALGDFDLDACGERVGAWLDLLYAPRPYKGRCVRKRKRMQDIDMERELYWQ
                     LERVHYMRPKSTAAVHSLLKRRCRQAEAQRLRYLRKERGRGRKQSTLAIQSASGDAGD
                     EAEKQHRRPDLLRTLRQSGFFYRTSMDWLEVGIWLCDAARSMFLLLLRRKRFFFLSMD
                     YNFQIVPLRTLTTKERKQSRFGNAFHLMREWMRMVKLIVDVHLRYRAGLGADAIQLAD
                     SITYIESHIGELTGLYRYKYRVMRQIHATKDLKHLMYQRFGWSGPGKACWQPLWRQWV
                     HLLRGLMPLLEQWLGNLLNRHFEGREPLRMAQRTVTKQRLESQFDVALRQETIARLRQ
                     LLPAARQPLYTRRVLQHMHQAWRCWKANIPWHVRDMPPEIDRLVRDYVQQRAQWWIEG
                     ARRFAIAFRSGRSMDKALVRQMYGRLARLAVHHEQAHQRQYLEHGPFLLPTEAASILY
                     RFATYLEKAGVADSCPWQLPWFAADNADSGLAPALLQLAIERLRPETEGEHCPPGLGE
                     LVTEAEAAPAAMLYRIRQRLQAVQMRHQVELRFYDDADLTPVYRIDSFERLVDAFLDQ
                     WLWYKATETRLFPAHVQPCDDELPPVHVLRFVERLDAIPHLWTLGTAPNKSFLVLIQT
                     PLPGLFQRADLLVLDRLLRQLLAPEIVDYLIARCNATITFKDMRYTQSVGILPGWEFS
                     GFLQQLYGLAAVDLAFRAPDMDADLLSLPSWPPAELAGDHDVRRNDARSCPSMRLLAY
                     ERILDRLYALIRVPEETARVAVTRLEQRYERHPERETLLDAALYPSRRCWPSAVRMRL
                     RPFDCLLGRALFDAIRDRIGPGVSALRPLVEMPESQTAVSVVSGPENPSLFFEMFGFE
                     VRMLASGFDRILPAGMGSARPASEAAATAGMRWSLPSGRTVAYVRVSPHALQRWALDV
                     QRLLMATIHAPFTRVAARWNALALHFAGMYRQVAANDPTVRQFVQHAQERVQNRIKLG
                     LNSKMPVRFPPVVFYAPRSLGGLEMMNIGHDPVPSLWSFIPSWLDEIADAELLERELQ
                     ERAQAFGAHLDRRLLPPAWLHRGLPRLAARYHPQGALWTLDHGYRVRSLLRVHVTGRK
                     NALWWLDFMHDGRLWELDDYRSQVTHALGGVPAILSHTLFAATGYRDWRGIVWGDHGF
                     EHKLAGRPLTRAQRSGLVQIPNRRFTLWWSPTINRSRVYMGFRAQLDLTGIFMYGKLS
                     TLKISLLQVFRGHLWQRIHESLVLDLCKALDTELGARSREARVAVTVQKERIHPRKSY
                     RMHWSSADIRIDFEQPILVSGDALPVDEAVAFESNAGGQGRSSLRPPGSDAAAKIYWI
                     DVQLRWGDYDDHDAAQYAAQKFRAYTAPGASSLYPSHHGLVVVFDLAYGEWSAFGHAC
                     AMGVVSIVTEESRRMLMHNQALALLRERIRKALQLYVMETVESETLQAATTTTSASDT
                     IPLLVGCGGDLWRQRLWIVDDRTAYRPHANGVIWIWETSTGRLFVKIVHRTTWAGQTR
                     RAQLAKWKCAEHVLTMLRSQPTEELPRGIVLAQTASMDPLKTLLAGTEYAKIPVRAGA
                     AAMPLQALMALPEIRDRTQTARSSELSIWSGYADWLEHVPVWIASARFLLLLHALDRA
                     PERVLQLVWPQRSADEESAGSATPWLWPALPETDWRRLELELQSLVPVRLRPAHVAGD
                     QPGGRDDDGTEQVLEHTRPKTVAAFDRYGNVISVETTTPFERQEYRTSSVTVTNAEQQ
                     RLLSLYRRLPDVLENLHVVEPGHTSGSLYGGERPEQATISAMPHLAKRFELHLPRGLV
                     RGLLLAGMTCGQLWGTRTANADTVVWIAWALRHHDAEASTPLPSMVEAAACFRPGSVQ
                     AIGWIQACLDVGRPPAPGPGVHAPHDVQVILYLQGEERQIDLASPSLDRHAAEAVQTH
                     DVHASRAPSAHAFGHVIGSTHAMSRALGVLQAWTGGGSGDVNDPQSVHVRVRLRDDLS
                     AVFLYAKDGRLIARPPGRLFETIPAPIEEGT"
     gene            424870..426662
                     /locus_tag="CYME_CMH167T"
                     /db_xref="GeneID:16993495"
     misc_RNA        424870..426662
                     /locus_tag="CYME_CMH167T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461307.1"
                     /db_xref="GeneID:16993495"
     misc_feature    431806..433429
                     /note="possible transcribed region"
     gene            <434390..>436165
                     /locus_tag="CYME_CMH170C"
                     /db_xref="GeneID:16993496"
     mRNA            <434390..>436165
                     /locus_tag="CYME_CMH170C"
                     /product="probable class II DNA photolyase"
                     /transcript_id="XM_005536064.1"
                     /db_xref="GeneID:16993496"
     CDS             434390..436165
                     /locus_tag="CYME_CMH170C"
                     /codon_start=1
                     /product="probable class II DNA photolyase"
                     /protein_id="XP_005536121.1"
                     /db_xref="GeneID:16993496"
                     /translation="MLCDPSCWVTRCNTPGIRKQSVLFVQPWLARAERRYASLQTACV
                     AGLPVATVALRRRLSLCAGQRTSVFWCNAQRINMSRKLKSVATASTVEPERVRVANTK
                     PVYPDRRYVLYWVQASPRILENHALEYAIERANALNKPLVACFGVTDKYPEANLRHYR
                     FLLEGLSELWEDLRKKRGVAFHVLYGPPDEVAAQCARGAACEVVTDLGYMRIQRQWRE
                     RLAQALDCRLTLVESEAVVPVELASEKHEFAARTLRPRIWAYIQRFCVPQAPQTLHHS
                     QLEIPVDHGPYSELFEECPIDDSEAPERIDAALERLESLDRSVPAVSRYFRGGTSEAL
                     RRLEIFCSTKLSFYGEGRNQPQSDHTSCLSAYLHFGQISPITIALAVWSRKETPRESR
                     DAFIEELIVRRELSFNHCWYRPDDYDKLDSLPEWVHRTYAEHRDDPREHLYDLASLEQ
                     AQTHDPYWNAAQKEMVLTGRMHGMMRMYWAKKVIEWTPSWECAFDWLIYLNNKYELDG
                     RDANSFVGVLWSFGLHDRAHAERAIFGKLRWMSRDGLERKFPMHAYLERIRALDNGAS
                     WEDAVSSAASATKDDGKKRIKRPRR"
     misc_feature    complement(436594..438148)
                     /note="repetitive element"
     gene            <440671..>441939
                     /locus_tag="CYME_CMH172C"
                     /db_xref="GeneID:16993497"
     mRNA            <440671..>441939
                     /locus_tag="CYME_CMH172C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536065.1"
                     /db_xref="GeneID:16993497"
     CDS             440671..441939
                     /locus_tag="CYME_CMH172C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536122.1"
                     /db_xref="GeneID:16993497"
                     /translation="MFVGAPFYGVGSFGPFDEGRLQSPQRGFRTRTRRAGHCSVRTLA
                     LQASGPHRARSSRKKTKRRASQTEGSTEEFEITDIPLSNFSFIQADGSVDWERFETFS
                     SRSWEETQTVVREVPEDLPLNADPDVIQASDEQTTELGAGPGPAALTLSRDELQSPGK
                     YERITSLGALGVIARDGLVEPLDTAARALREQELVYVTFSVSLERDGDAFVRGRVRTR
                     FRNESCDRCATRLEMEVRSSFDVWMASREDAVPNAEAGDPRIEEAIEPFHAGIEAVDF
                     TKHVREAIWLGIPSRVLCADQQLCRTRMQQIGWQFSGNSGDATIQNFGPDDLVTRNQQ
                     RSPSVIPQKDARKSSKKKEIQPGQRQPQTTTQAMAVDTRTLRSLAARNPEAAKKLSEI
                     RERLLSGENEQQTPPRSPSSEGPHESHPRI"
     gene            complement(<444482..>445558)
                     /locus_tag="CYME_CMH173C"
                     /db_xref="GeneID:16993498"
     mRNA            complement(<444482..>445558)
                     /locus_tag="CYME_CMH173C"
                     /product="similar to mitochondrial uncoupling protein"
                     /transcript_id="XM_005536066.1"
                     /db_xref="GeneID:16993498"
     CDS             complement(444482..445558)
                     /locus_tag="CYME_CMH173C"
                     /codon_start=1
                     /product="similar to mitochondrial uncoupling protein"
                     /protein_id="XP_005536123.1"
                     /db_xref="GeneID:16993498"
                     /translation="MQSTVPSTKAPEASNGTVARQSTEAVHQQRSKPGLFAQLAVGSL
                     AAGTATCVSAPFDLIKARLQLQRLDSSEHSDASTVEAHRATKRYRGMLHAGYRIIREE
                     GPLALWSGLEAAFWRALTYSGVRLGLYQPIRDWYAGVFERRLRYTSADAGSVPEASSV
                     PSAPVLVKLAAGATSGALGALVGTPFEAAKVRMQSGRYPCRNTWQVLQEMAAEGRAHA
                     GSSRFGVIWGLWNGASATAVRAATITATQVGLYDVVKTKIADISGWPATDTRVFLSSA
                     MMAGFFSTTSSSAFDVIKTTQQGSRRGAYRGMLDCAVQIWRKEGAFAFLKGWVPAYVR
                     LGPHTMITLWVYEFARRVLGYTAL"
     gene            <449884..>452619
                     /locus_tag="CYME_CMH174C"
                     /db_xref="GeneID:16993499"
     mRNA            <449884..>452619
                     /locus_tag="CYME_CMH174C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536067.1"
                     /db_xref="GeneID:16993499"
     CDS             449884..452619
                     /locus_tag="CYME_CMH174C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536124.1"
                     /db_xref="GeneID:16993499"
                     /translation="MFGLDLANVSSLCCSASISAWMMLFVRVMRMVYCMLAAQRHAPS
                     TGAQAGNICKKSTRSVRLLLLLLLCSSLMDPQSAPGHGTVVNNGLYLFREAYTPTPHD
                     SPEFPNATLPSAWKRFNYHTYSSMVITLARLAYSYPAFARLYTTQAAFGLPAAGESCS
                     IDTHQPMSQEALTGLDQKQRLAVKRLIEELRTQDGLSRNACRVWVLEIADRSSVAQGS
                     VGSVLDPPAILISGALHGDERIGPTAVTELARVLLEASRLPAGSVDTHRWRASAAEEA
                     DGSIFGSTAGSLSSWLRFLVGHRRITIVPAANAIGFALGERTELGVDPNRDFPWNQPY
                     GASCLESVAARSIHELVLANTYQMMLTFHGGTTVIGYEWGDLTHCPEQQYCRRNSPAP
                     DIIAMQTIAYALRLHAGNGTRYGARPFDIGTMGDTVYPVAGGMEDWAYGASAPVQTSL
                     VSICNASRYGGYAPVKVQAVRQLPVARMIALLIETADDKQPSVETLGVRPLGAAGNAP
                     WQADVRLITETPTVSADGSESDSELVVEGHVWRNLRLALQAIDILQPYAAFTRYPGDG
                     RTQAADNATAASIVCWRVGGAYHVAETQLQGWYDSGAAARIRQNQDSAPDFVSEAFID
                     ASPDPVPFFPAVRLGQGTRWSPDNHGGREFCVNLQQQQQQQQQPFTGAKRPPRGSSIL
                     LRVRFQADVDWGRLPPSTLGAQPPNTRPWSFLAQSRVEYNSNSTKFADERPSTSEEDG
                     VARGTNWFSRGLHCRASEVSTGHQPQVWTCVHSEVARGTELGESGAMSGWSKLLLAIS
                     VFLLAPGSFPLLLFLSFLLWRLVRGQSVHPAEVWFEARQRMEMWMQGLRALGRARGPS
                     GTRVSGSFARSTDLDDTKRRMLSPTASSAAAAERDASSSAHDLDLEASTRRPDRP"
     misc_feature    455492..458723
                     /note="repetitive element"
     gene            <459038..>459799
                     /locus_tag="CYME_CMH176C"
                     /db_xref="GeneID:16993500"
     mRNA            <459038..>459799
                     /locus_tag="CYME_CMH176C"
                     /product="similar to synaptobrevin-type protein transport
                     protein"
                     /transcript_id="XM_005536068.1"
                     /db_xref="GeneID:16993500"
     CDS             459038..459799
                     /locus_tag="CYME_CMH176C"
                     /codon_start=1
                     /product="similar to synaptobrevin-type protein transport
                     protein"
                     /protein_id="XP_005536125.1"
                     /db_xref="GeneID:16993500"
                     /translation="MGDAGAPTSSDNVPNLLYCAICRWEDRVVLARYAAPRAGVALAE
                     TGASTAAFAETLRRILQSKKIAEHKRLTIEEKQLGMIHYDNDGTCMYVVFCRASYPQR
                     LAFQFLNELRSEFLRTVGSRPEDVASATENSLTKLCRPLMSELCTLYDTPSGLDKMSR
                     IRMQVEEVKGHMQDNIHQVMKNTDDLEQLQTQSEGLRGEASAFHRSAGTVERKYWWKN
                     ARMICVLVVLVILIIIAIIVPIIVTRNNNSSSSSG"
     gene            complement(<460552..>461337)
                     /locus_tag="CYME_CMH177C"
                     /db_xref="GeneID:16993501"
     mRNA            complement(<460552..>461337)
                     /locus_tag="CYME_CMH177C"
                     /product="similar to fructose-2,6-bisphosphatase"
                     /transcript_id="XM_005536069.1"
                     /db_xref="GeneID:16993501"
     CDS             complement(460552..461337)
                     /locus_tag="CYME_CMH177C"
                     /codon_start=1
                     /product="similar to fructose-2,6-bisphosphatase"
                     /protein_id="XP_005536126.1"
                     /db_xref="GeneID:16993501"
                     /translation="MVRIRWFFIRHAESEANVVERWRIAGRSEAARLTERGERQARVV
                     GEAVAIRLEQVLRVDGGDAGGVSGDAGRRRVLAPVAFTSPLLRARQTAALVLEQVAQP
                     VKLEPVDDLAEVYQGLWEDALRSEVHTPETLQAMARNPYEFRAPGGEAQADVERRVLR
                     AVSRMSQRVLSLLSLELEENEQTDVIVLVFTHGYVCKCLIRSVLDASPHLTGQIQVDN
                     GALVELWLEPAAQQGALTSAAELGMWTVLRINDTWGQLTASMR"
     gene            <461759..>462559
                     /locus_tag="CYME_CMH178C"
                     /db_xref="GeneID:16993502"
     mRNA            <461759..>462559
                     /locus_tag="CYME_CMH178C"
                     /product="similar to GTPase-activating protein"
                     /transcript_id="XM_005536070.1"
                     /db_xref="GeneID:16993502"
     CDS             461759..462559
                     /locus_tag="CYME_CMH178C"
                     /codon_start=1
                     /product="similar to GTPase-activating protein"
                     /protein_id="XP_005536127.1"
                     /db_xref="GeneID:16993502"
                     /translation="MSDQTRQFSEKEQESAQPRKEEAVRSSSPEQASRTPPAPTGFRF
                     VVPTTATATGGDAGQGSDREANQSAAPVKAPQVVFGGVTESVDQDVGAADDDGAAETL
                     GEEDASTADWKPLVQLDLVQIKSGEEDEDVVAKYRAKLYRFDKSMREWKERGTGEIKF
                     LKHRVSGRIRLLMRRQQTLKICANHYLLPEMRLEENMGSDRSWVWTAVDYADEERDEA
                     VLAIRFKDSETAKRFYDTFEELRKEMQSLLVSGKSATEQSRQGEQTAI"
     gene            complement(<463267..>468117)
                     /locus_tag="CYME_CMH179C"
                     /db_xref="GeneID:16993503"
     mRNA            complement(<463267..>468117)
                     /locus_tag="CYME_CMH179C"
                     /product="similar to nucleoporin 155kD"
                     /transcript_id="XM_005536071.1"
                     /db_xref="GeneID:16993503"
     CDS             complement(463267..468117)
                     /locus_tag="CYME_CMH179C"
                     /codon_start=1
                     /product="similar to nucleoporin 155kD"
                     /protein_id="XP_005536128.1"
                     /db_xref="GeneID:16993503"
                     /translation="MDSSESRFDLRTQSGLSALESKPSTADASISRTAKGHNLAALEA
                     AAADLELAIDLDEQWLSVRRSWETAEPDYIRYPPSQSQFLAKRTVPLPAALLAQYQYL
                     ESKSFMGLLPQIGRAWISIDHRLFLWDYVEGSDFAVYEELDQVISCVALATPRPGVFI
                     DEIEYLLVIATALQVVLLGIVRSPNSRARSRGSRGSDSVTLVPTGLSVPTDGVVMLKI
                     EVSHHTGRIFMAGRDGSLHELVYEPQSWFGNVPKARRVNRSRGFAGAAAAALVPAFLR
                     RLFHADDPLIDLVVDDSRGLLYTLSQRGIVSAYRLERTCSECDTELVSSKRSWFDAGV
                     LRLLGSLDAASELQRRMVSTQARALSLHAVPLRYSRRVHLLVVSTAGERLLCTTAGEA
                     SVRRPSTRWTNDTKAAGASAPSLLGRVGGEHPACLRVIGYRSPIVSNLSASIYLAFWC
                     KGQFLAADDQDQLLAVGAEPPPLEFLPRQDPESSLFMSRTATAPSAERRSFGIASAAA
                     VSQSRIFESVSGLQISGKAYALAEAPLFGDLGVSAGGHLDEREPAGLLTREDVSRGWL
                     CLTQASLVLLCPVRPLDTLRTLLGASPQDAEVLDFFRRYGAAQACSWCLELALQAEQR
                     PSGAIGLVDKAFRACLAFGGEPQLLASTAALPADSALSQVEEARQRDAPAAGAVNTTM
                     RADRSMSSWQTTADGFSVGSVSLPEAPLRYSGRHDGVVLLLARILQPVWSEPVTTGDK
                     LARLRFSFVVLLSTHAELRAFERVLYRLFGAELEQAARRERPSYGDTQERIGDTSTTR
                     TTTRISLAPGMLPPTTGARSTAPDTLGSAWSASAWHPDLIAGKATLRHSNSALHQARR
                     LELESIASLLGLAERSAQALELVRTLAESTHLPRLVASLEPTDQARLRQLRFEDLVTR
                     PAEAELMTSIIFKVLESYAPEDSDSMESLLETLTARCPVFFGETQVAVYRALRHLRKR
                     EIEQTMQWLRPVAAHLTLSPPLVTEFKAAGAFAELVALARLAGDQQLVLQTLEAAMNL
                     SSTESSSLGTGADRETLQRRCLVEALATDETTQLDQLFRFLLRMGPAGSALLLQLPQL
                     AKQPDINFGNMSEESFRKNAQLTKALQRLEWFLLHEDIDLAWKLYAQQERFVEAAMIL
                     ADLAGVPTAPNRHPGTSEVATEDLTPLVQQPRRRRATLRNGDVLSPRRTRLLPIHERI
                     ALLIRALHFARAGASLGDGRALALVPELQDALEVAHIQQRALDEVRRVVLSGPERSEL
                     EQRLEGISGGADQAAAGLLDPNTLYVEIARPYALWETELDILRWAGHQDPELSRRLWN
                     NIIARELALSAGVVRQRATKATQSTLDTSLQAESLRPTPETLQQRFTALAKVFYPSPI
                     AFPLEWLVASLEMLAFSQAELARAPETVNPTCTTDHDDDDDDNDDDDDDEIVTAWSLE
                     AFSLNWLQPTLVEVIGVPRTDLVHIYREMLQDPEAFYEHHGPLPVVVTHALPPGLGPW
                     WLSLAAQHWWARSLLGMVQRWMALADTTLDHSLQLDASVTGYATLARASTDWQALVAL
                     TPALVATLRVLRSRFTSRQSLTATASKAERARPMLQLCSELESVERELERLSRAGAKQ
                     QQRYLY"
     misc_feature    complement(468549..470138)
                     /note="possible transcribed region"
     misc_feature    469636..470669
                     /note="possible transcribed region"
     gene            complement(<470820..>474122)
                     /locus_tag="CYME_CMH182C"
                     /db_xref="GeneID:16993506"
     mRNA            complement(<470820..>474122)
                     /locus_tag="CYME_CMH182C"
                     /product="similar to ubiquitin specific protease"
                     /transcript_id="XM_005536072.1"
                     /db_xref="GeneID:16993506"
     CDS             complement(470820..474122)
                     /locus_tag="CYME_CMH182C"
                     /codon_start=1
                     /product="similar to ubiquitin specific protease"
                     /protein_id="XP_005536129.1"
                     /db_xref="GeneID:16993506"
                     /translation="MDAAATPVAPTTASNRAANTGVPSQARPQVWNKDSESVRFNAAD
                     CSELYPPVSEPEESAVETLTTSATASQSALCVALWNLLQRQPLRDEDRAMQLFKFQAL
                     DLSNKNPGQTNGITAVRVIARFLHTWSTVFGRPGHSPAVPQLHCFDVTCSRPYDDLYF
                     CLHRVIISCAQHIVQFNMNSGGVFRFWMRLDGSFAIYDAMPIIQALRRRGSGGDHTAS
                     DDDHVTMETLESTGASQMPKRKKAKSSVSSGPHDDRDTKAVTHSRSAEIVALHRVVPD
                     PLIEGAIWREQARSLARSMLLRFSGSMQALPNVPLSTLEGGLAVDASIRADGIAERLP
                     GTCQQSQNRVLARRHRDLWRKERKLQLLFFAARPSEPSWVLSWREKHAIAHFTDWAYN
                     ECEDNDEFRDDWMASMAHAYRHDSRLPPRRMDQEHQTMATGGNVANASVATRVRDASE
                     TSCAHSGLSTCTGTARCRYGGVVGLTNLGNTCYMSAVLQVFMRLCPVRNFFLGDLHQS
                     FCLRRVEALAQSQDPERTCFNCALDALMTQSYLASLSQAQSHGYWRPVAEAALSDRET
                     QLSNLHTGASGSVRSASSAAKEFVDSGRPGTAHASSSSTSESSSLALSLSSSSSSMSG
                     SIRAARHARTPSAEAARPHEIALLNQSKPLQGRRRRGTERMSALEKKDTLSDVTTEAD
                     DRLRGSGKRKRRERTRPNDQKSSAARTHSTSATKGALLSDKQTDREPMPEHFQKAQYV
                     RYPLKVPVLVPQKLLDVTWKFMEPLATYAQHDAHEYLLSALNLMHAHWTPTLDDGERR
                     LQLQRRFVESASEEQLALQSVAAQLSLRCSCLAHRTFAGLIQSEICCTKCLTSSQRYE
                     EFLDISLDLIRPEDEHAGSAAATAATATTTSSAARSLPNTLTGCLQRFTQEEPLDAIG
                     ATSSCSCEEEARSAGDVPPIRTKQLSLKQLPPVICFHLKRFKQSGSGSQVTPSKLDVD
                     VIFPVRGLDMTPFMSASVRRRNGVGSEAMAAQHPHRCMHHELQDSGPRILYDLIGYVS
                     HIGSIDQGHYIAHVRHGRYPEWFVFDDESVSVECRTVCEDTEPDASNARITSKDAYVL
                     FYEVRPECLWVR"
     gene            complement(<475985..>476737)
                     /locus_tag="CYME_CMH183C"
                     /db_xref="GeneID:16993508"
     mRNA            complement(<475985..>476737)
                     /locus_tag="CYME_CMH183C"
                     /product="small GTP-binding protein of Rho family"
                     /transcript_id="XM_005536073.1"
                     /db_xref="GeneID:16993508"
     CDS             complement(475985..476737)
                     /locus_tag="CYME_CMH183C"
                     /codon_start=1
                     /product="small GTP-binding protein of Rho family"
                     /protein_id="XP_005536130.1"
                     /db_xref="GeneID:16993508"
                     /translation="MHGVHLPPETFDADDSAIKVVVVGDGSVGKTCMLMSYTSNQFPT
                     DYVPTIFDNYSAVVLCNGQEVPIELWDTAGQEDYKRLRALSYWNADVFILAFSLVAPA
                     SFENVAVKWVPDLRASNPETPIILVGTKLDLRESYPVVKELEARGETAITADMGRRLA
                     TEIGAIQYLECSALTQVGLKAVFDAAILAGLKARRERPKSDQAGPKATELPKRSPHAS
                     AGHRPTDSGNESRRVAKHEPHDQRKDACCSVQ"
     misc_feature    complement(476942..478975)
                     /note="possible transcribed region"
     gene            <478586..>480847
                     /locus_tag="CYME_CMH185C"
                     /db_xref="GeneID:16993510"
     mRNA            <478586..>480847
                     /locus_tag="CYME_CMH185C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536074.1"
                     /db_xref="GeneID:16993510"
     CDS             478586..480847
                     /locus_tag="CYME_CMH185C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536131.1"
                     /db_xref="GeneID:16993510"
                     /translation="MFRSPSESLRRVLRSPAKAVARLGRKGSKHIVYFRIHRLVQEEE
                     AYKSALAGVVDQTDGRDPDQTRASALKARSLRVCIQFLDDRAGSVLQTSSTTNGVWEE
                     TLESNVTLYPLANEKRFEPLVAQVKLYDVQRDQPIGVGEVDVAQFAPACVNRNTGDGA
                     EAPAAHRFHRRTGSTDFGECLLELRSSTSESRNTPKSNRIRAVLLISISIDQPHTFTD
                     VSASIGSRDSASQASSTESSASVPDLMSANRNSMPEPFKGNRPRATHGTRTVAAGGYQ
                     GAPLTSSTAQASLTALRASTMARERIHSAQNEGGSEDFAKKTSAGGQASTAASPHAQS
                     LHPAASMPSSVTSLLQDRDRGPNSGTAERIPQPDEASLWKRERDRFAKQLLLQAETFQ
                     EEIRELSATNSALRVQLAALCREREAQQLFSVPAERRQSARTHPGDHGLPLATTGLAL
                     ARSTAKEDIGAELDPVPVDWDRERLAREWQIARAGLRAAVAQARLEVEAALRDAASRS
                     IASLRYFTHWHRQREDEALAPHHDLAAMMTSRDASKETSAELDPSSTAGRSAPEETAL
                     VRELEQQLIATKLAHAESEDKLEELRRALREMQGRLLREQQRTVQLAQELSQLHGQQV
                     VTATPAATAAVADALHHRTTGSTQSNAAELVSGASESRLWRRFSALDETRTIDTTAAR
                     EQHAHREGANEATDAAARRRAFSVSNDASLASGAGDVSATQRRSVEHARSRRFFWNRR
                     HRANSHTEPSSYG"
     gene            <481795..>483342
                     /locus_tag="CYME_CMH186C"
                     /db_xref="GeneID:16993511"
     mRNA            <481795..>483342
                     /locus_tag="CYME_CMH186C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536075.1"
                     /db_xref="GeneID:16993511"
     CDS             481795..483342
                     /locus_tag="CYME_CMH186C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536132.1"
                     /db_xref="GeneID:16993511"
                     /translation="MMIMMMMTCSPPPPPPKISAPRCRRAAAWRQRFQMPRSLFWRPS
                     CLLTPLPGRCSAVTLASKLGTPAMQWGKFIDAFGKPIERTSAKAVVEEPFSTARRSAT
                     VAAEASPEAAGRGGAFDEALKLVQDLEDQNECFDGSKVEQLWFLLRTGILDRCKYALD
                     SETSSSCGGLNASGQCPYCQSLDAIRPDWERFSALFRQLSFGSSAGRCTNDTASPMSV
                     TSCRAPSNMQQVLRDSNDVHDASTELQERLESLLLYRDVFLAHATQVVRARLEERAAL
                     QEAIAGKRDLITKLRKRIAEIQRLGLPREPQVPLTMPKNEGTPRDAHEATASPVALDE
                     SIDDAGVAGNKSPAIGTGPLPMMHNELTLSNDDALSSGAFSLSSARSGFVSEHVRVAK
                     TTHGDKVSSVAEITALNNLANVALQRLLGSESPSAAPTAVVCGTSPHAFNAVSADVLP
                     VRNVLRAFTRHPEGVPISELPAMMLRETGDPVVANEIVESLLNACVLEYDENYTSVRL
                     FSEFHLG"
     gene            complement(<484114..>485364)
                     /locus_tag="CYME_CMH187C"
                     /db_xref="GeneID:16993512"
     mRNA            complement(<484114..>485364)
                     /locus_tag="CYME_CMH187C"
                     /product="similar to shaggy-related protein kinase"
                     /transcript_id="XM_005536076.1"
                     /db_xref="GeneID:16993512"
     CDS             complement(484114..485364)
                     /locus_tag="CYME_CMH187C"
                     /codon_start=1
                     /product="similar to shaggy-related protein kinase"
                     /protein_id="XP_005536133.1"
                     /db_xref="GeneID:16993512"
                     /translation="MASKGGQEFTDCNEYDSETMFAERHAEEHPSEEAVQPGSLPATP
                     RASSLDVPFASPATFKLVELLGQGSYGEVWLAVSRASDSQFVIKRLHRYPFARNHELE
                     RWRLWNAPSSNAAPIDYAERERELVSQIPPHPNLVQCIAWLPWSFPEEANEAGLGSEG
                     VEPDLALVMERGYPLAHLFQRDQNLVSDSLWLRLIRVVCRALFSALAHLHAHGFVHRD
                     IRLDHVLSRVDPEALGLSLQAGRLPQAETFFLCDYSLLRRCSANTDADGASSPTLTYA
                     PMRSPELYFGETRRLPSSDIWAAGCVLLELLFRQAGEPVFDCGTGTAMSELRSLKTVF
                     DLLGNPPECFKQQPLAPASHTESVSSPHGSDNIAARIHRCWNNDVDQDVIEQAIDLVQ
                     RLLDYCEARRPAAVQVLEHPFLQI"
     gene            <485795..>487030
                     /locus_tag="CYME_CMH188C"
                     /db_xref="GeneID:16993513"
     mRNA            <485795..>487030
                     /locus_tag="CYME_CMH188C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536077.1"
                     /db_xref="GeneID:16993513"
     CDS             485795..487030
                     /locus_tag="CYME_CMH188C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536134.1"
                     /db_xref="GeneID:16993513"
                     /translation="MFALVPEWATRSRLRFCGWVSRPKRKPFDAQVHIERIRSTTISP
                     TRTVRRRQIQRVSLRALAGRNQPSKDAPSAETGGVLPLATSAVSDIWELDFYSRPVVG
                     ADGKRLWELVVCDRDGSFVHVEAFPNNMVNSRELARAVKTLIEESSVRPRIIRFFRAQ
                     MRNMIQIAMQNISGVETRPSRRTYALFLALAYRERNVYPRLPGYEGKSIGIGNRSGTR
                     GAELSLAESIGNMLKTPVDLKVAARLPDELQGDRFAFVTILLRDVTQMNAAGFGELCP
                     VSLSAESMNLDIQMRTSGNAGSTQSAALDLGAPSPETLVPGVVIYSRRALPLAAWFSG
                     TELAYIIADEQQKEIYLECGLDAAYLFARIQPSLEAEARAFNEAKKAARGLHFLAIQE
                     KPDDEDVCGFWLLRDVAYL"
     gene            <490854..>491897
                     /locus_tag="CYME_CMH189C"
                     /db_xref="GeneID:16993514"
     mRNA            <490854..>491897
                     /locus_tag="CYME_CMH189C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536078.1"
                     /db_xref="GeneID:16993514"
     CDS             490854..491897
                     /locus_tag="CYME_CMH189C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536135.1"
                     /db_xref="GeneID:16993514"
                     /translation="MAHVSEGSFDADQINQIRLSVSRPTSSEWSQVHLLRERLERASL
                     LVDPVIRRWATDRCLRRYLRARSHNLDRALDMIRRSIQWRLEYHPEQRFCRACKANPR
                     SHTYRRVGRTLTGQPVMFSTFVGVENYDPADNIEHLSSGIEHAVGVNARWPDLDPFPE
                     TYVWVLDFAGFHARHLSPGVGRASLALFSDHYPERLQLAIIHDAPAIFRGLWFALKPF
                     IDRQTCKKILFIRRAHAAKLFERIFPPELCEWLEKELREVRDKRVAREKQWWREWCPA
                     WDDDKKPLSELFPGVVIPEKGPLEGNSRCTQWIRMGAVDDAMEVSKNSDETFYDAMEN
                     DFGSSTFARHHAA"
     gene            complement(<493242..>493850)
                     /locus_tag="CYME_CMH190C"
                     /db_xref="GeneID:16993515"
     mRNA            complement(<493242..>493850)
                     /locus_tag="CYME_CMH190C"
                     /product="similar to histidine triad protein"
                     /transcript_id="XM_005536079.1"
                     /db_xref="GeneID:16993515"
     CDS             complement(493242..493850)
                     /locus_tag="CYME_CMH190C"
                     /codon_start=1
                     /product="similar to histidine triad protein"
                     /protein_id="XP_005536136.1"
                     /db_xref="GeneID:16993515"
                     /translation="MFVSLQRSALPAWTASSLAIGKLASRCARKQYLFTCRRPVRCGT
                     PEPSSRRSLRMASSDPAQDCIFCKIISGELPCYKVFSDENCTAFLDLFPATSGHTLLV
                     PRSHHEVLETMPPEEVSAVFARVPLLGKAIKAAVGAPSYNLLVNNGREAGQVVPHVHI
                     HIIPRKPGDGLIRHPGGGPRLEPDKAEPLLRVLKEKLGRAGP"
     misc_feature    complement(493858..496463)
                     /note="repetitive element"
     gene            <496797..>498689
                     /locus_tag="CYME_CMH192C"
                     /db_xref="GeneID:16993516"
     mRNA            <496797..>498689
                     /locus_tag="CYME_CMH192C"
                     /product="unknown zinc finger protein"
                     /transcript_id="XM_005536080.1"
                     /db_xref="GeneID:16993516"
     CDS             496797..498689
                     /locus_tag="CYME_CMH192C"
                     /codon_start=1
                     /product="unknown zinc finger protein"
                     /protein_id="XP_005536137.1"
                     /db_xref="GeneID:16993516"
                     /translation="MQERNRESAKEQSAGEPAQQVDMWASLMGSSPILKLEKLNNVMM
                     EVPPCVGSLGIERWYGQDARYSKDASAGVGANEEQAPDTSRDCSFDETLSVSSSSTSA
                     VTGAPTLNTDNRVDAPFVPGTTAGTSALRFVCPRCERSFSSASHLRRHTRDVHQNVRK
                     HGCDLCGMAFKRRQHLTSHYEACARRLRYPMRPDQNACLVGTHPSHAPAGVIQEHGPQ
                     HDVACRTSDVMLTDAERFLPPLNPVDSAHRRCVRGPAAAAAAPVASERRSRLQKREKA
                     HSCSDLLLLDQAERNAAKLYAESRPPADWFSELHSSSLASSAASNETVLMGEVECTGG
                     KRGKGLESCYGVPGSTLEDRLSFFTNNSSGTGSYPDWLAGFRDASSEVMRARSASDPS
                     TCMPPQDARRAVTLSQAAPHAQGAALDTTLRASRSDSRESADPEMLRILDSYARYVCI
                     SKLFEDTVTKLRGTDTGSDAKSTAAASSAAKMQPPMLDELYAIISEGSHLAPDSASCP
                     HHQSMPVSSTAPTGATTNAAAPKRGESLHADALMAPAPLPTNLYTHIPSDTCGDERCW
                     RDESMRFHVGERSGRSRPYRECPQGVSAMNSAGSSGRSRAPSAMKNRGPPQTGASGDE
                     SGSGGL"
     gene            <502051..>511488
                     /locus_tag="CYME_CMH194C"
                     /db_xref="GeneID:16993519"
     mRNA            <502051..>511488
                     /locus_tag="CYME_CMH194C"
                     /product="similar to translational activator GCN1"
                     /transcript_id="XM_005536081.1"
                     /db_xref="GeneID:16993519"
     CDS             502051..511488
                     /locus_tag="CYME_CMH194C"
                     /codon_start=1
                     /product="similar to translational activator GCN1"
                     /protein_id="XP_005536138.1"
                     /db_xref="GeneID:16993519"
                     /translation="MGASWEDTPAASRIESNFHEWIELQYAAAGSTEAAAPARQTIEA
                     LVRSAISLDGLHARHPSSTRSKLFYAWITDRLARALAAAWQRSSTESTAGLAVLPTTF
                     REARSRFPSSDAFIETCLLVSQAVLRLSCAQPDLPGSELLAGERGASLALLAQTVLDE
                     LFSLKFEQCGWLRWRRLLQKNRWWILLFLSKSEASVLQQFGEAVTRALKRTPGQSWGA
                     LTLLLRTLLPSRSRTCTKMTQTDCRARAGRIAPGSIAALQQLLEYHVLPVLPRALCSE
                     SLAVQRAAVRVVRLSTTIAAHSGAGAESKPFTWHAVLLEQLQSTHGARAQPVICALRA
                     LTLANSAGTDAGLAATCAADAMNALLGWLAAETDPPTRVVAVRCLASYVAVASSRALI
                     DAAQRRKLEHAYSDAFGMRQQLDSAPEFPTAPYIAAELLAWARMDLDLRHRRLRSTNA
                     SESPTTRPKERRTAATGAVAAPCSEEHKERTRKLQKQPLLAVCAYASSIESEADRLTV
                     IEPTELAEMLTLLQHVQRTLAPDDGMAILTGGSRIGAAALATCPVDACDACDVARTCV
                     IAARMLYRWCVRSVTTPALLQAFANVWLAFSTLDLRVFTPKNVTADTHAAPVENSKEN
                     WLHVREVARLARLELRATDRVDVAEALWSALRSKFVPSLLDRLEQICIAVPRYAEYTN
                     AAGVSYWPVYSTRRGWLRGFRKRFAALIASMPLDVQSPNAIASALMFMVHPLATRQAR
                     RRYEAFTQWHMPEAPLSTLLREMSSVADTLGRAPHTAIAEFSIDALGLLRASIRTWGW
                     LLIEIGLKHFPDLYSLSTNVFETFVLPALTEIWRESWTADDLRLVHDAMPSPPQPPQE
                     PVRKPPRDRNPADGISSNRTKQEQQAERDRYQTAMIRYEELLSIYREKERRREHLLQQ
                     QRALHDALAGIWAGWCEMLTTLRLSEFGSELCDLFLLSMEVLHRVTKHLDRNRAREVW
                     MALLRSVQRLVHSSPMAAEDSAQNARQRMLAAVLSVPLHADAVVEHHALSGGIPALPR
                     YPLDFIRGALPIVLASMQSTLRTTENQVLTLAPWLFLAESIALEPRTSRAALPVLLPL
                     YKLVTDEIDHGPMNDLLVSCVWRSFGLTVLLCFLTGQCGLESVETETREDLESMLWKQ
                     SRCWRRAMRSDRASAEERCAASPRTAFEPLPPEIESRLLAELRGLPGPAGASPPSDDD
                     DDDDPIAAAETSASFCRWRDVLCRALPFPWSSQGLLIHRSILELLPGVLGTNASVRSV
                     CVFLAEQIPAEWRRHSLAWRLTLTLASHDRVQEVAWKAQQLLEQPIHDVSMLAPWLEH
                     PHAFLRQAAADGIADSVVRAADPLALLRQWLPVWFARFPKPVSIDPRASPGAPRKRPE
                     QVMHASEQFFGEGLSQVLIALATRDERPVSADLLPMIFTFLCARGWLHLAASVRQRLR
                     QAAICFIEQHGSVAVHTLLAFLSSALENPPADLEITLQDLRQENIVIALGMLALHIPS
                     HEPALLGDVGARLARVALATPAADVQQAAADVLARLIPKWMIIDDATVRERIESWFEC
                     ALSSGSYGERRGAALLWAAAQSATTGAAAPAATSWSGSLPAQRIRRILADRDAPLEAR
                     LGALTLLEALAMRLESAYEPIGVEMLPLLLQASGDTMTSVRQASADASRAFMRHLSKA
                     RMSAVLDSLIGQLDQTGAAWRTRMAALDMLGSMADMGPEQLSQALPEIVPRLVTALTD
                     VHPRVQETASLALSRMAELAMQVPAEELETENDNAKLQQALARSLSKRLVQALSHPEQ
                     YLLPVLHELRRELQRTLMLSGIRGGGSSASVLLLDALLLPLLRRALSHRQLSVREGGL
                     DVLLERMRTSDRCAGYRGSKAYDALSFSWTLAQLEQDVVSVILRDPSPEQRHRAALAL
                     RELMRPLSSAADATPWQRATRDCAALDAVAGDVSERASTTCDTAERSGVLVSARDSTG
                     RIASPPDPGVFLASLWDRLVAELFSERNAFTERSGAAEALASLASLWWRGTGNEVRTG
                     TVADEQTPVPPPQAGHVAARHGERQRYEAFLRPLVWDALESGAPSGSSSSIRRESALL
                     FVGALARHGIPEHTSLWRAVLGSLHDAQEPVRQAALSAGAALIHAALQETARSEATGY
                     SARELPSPGTSSHDAQQIARRGTHGLEHWFEAPCWQALEQGLLASHWRERWACLELGD
                     QAGRCTELLVTGDVIAQAPATLLVAGVQAGTSDAALSISVSQANGVTTKARIPSQEPG
                     TAFADIGDLVFRSRPGFVARLYILRFDPSTTVQSRANALWKKWVLNPARMLHALASSI
                     LDIALVGFQSASRSSTAVTGDEDLMQALQGALADLCGKLGTNVTARALDALQHLIIDD
                     GSREGTVGATAAAHALVQIVEALPYTVREQLGDPHLLQVARHCLEQDSEAFEPVRQAG
                     GTLLSLLVPVVGERRVLDHLVLPLWERFERATPIGATAAVAHCNVTQSSASTTTSVPP
                     LGDAARGLVQALSLAGLGVRLQTLLVPRWLDAGRWDALAALIALLDTALAPNLIPVAL
                     SRLFETPSAAQRDLVSDETISTVFGSEASTKAAEALARYMPTAVVTFAQDELASADVT
                     RRRRAITLLRFIFVDNPVDALSSQRLIESTSQTRISDIFARLVRALADTDDFIVQQAA
                     QVFQYSVARVAPGARVAAVAPVREALRALGGGTGEPGAGTPVRGLCLEPYNVLGISPV
                     LSLYQHALSDPETRPETQEQAALGIAELVQQVPPAVAQPHALRLMGLAIRLLSDRQTH
                     WPVTVALLKALTAFWVQAARSARALAPALQSVLLRYLRDSQRMVRHASAEAFVWLVLE
                     HPRPETALSELARLAQSQDVNATQRLVAMECLAKLLRVAAERRSRAPSHRDPVEQSPI
                     ATPLEQVLRSSGVWPQRLQETVRAALGSALDAERLCAAQLLAAVHRYWFEDVEVRHQC
                     VQMAVTLDTGREQSKSAVACQHGQLLALQTMLADGDLAWSPKQLADIDAQARRYLTSE
                     AAPLRKAAIQVIAALALHTEESTQHQQWTRLVVERLHEDTFSEVREAALQALGTVGTL
                     DTVLPLLLQWSYRRSGERAPSLRTAAIEALQQRLVDDLMAAVRWDVLRQAQQLIRGSG
                     EPDASSQSDWLERLALNTVASKSLTNR"
     misc_feature    complement(504754..508347)
                     /note="possible transcribed region"
     gene            complement(<511867..>515865)
                     /locus_tag="CYME_CMH195C"
                     /db_xref="GeneID:16993521"
     mRNA            complement(<511867..>515865)
                     /locus_tag="CYME_CMH195C"
                     /product="chromatin remodeling complex SWI/SNF component,
                     Snf2"
                     /transcript_id="XM_005536082.1"
                     /db_xref="GeneID:16993521"
     CDS             complement(511867..515865)
                     /locus_tag="CYME_CMH195C"
                     /codon_start=1
                     /product="chromatin remodeling complex SWI/SNF component,
                     Snf2"
                     /protein_id="XP_005536139.1"
                     /db_xref="GeneID:16993521"
                     /translation="MQATPSSSGSQRDVQPVWQANAAAEPATKPLGNQEQGTNHECAE
                     DGKPQVSTKFQTDESTTAAPAQKLEEVQAGLSLAAGSRKSEATVVWRRRPLNADQLHA
                     LLSLAAFVRAVPKPPTNEQVAKTIHASADEGPDQRQLLLQYHRPYQTVLRLLAAQACV
                     KRHGAFTFPQLKALQLQLQAQRYLRLAEAAARAATAAGRHPRAVFRRTGAVLPAVLRR
                     AMVTGLICGRFPDGTRMPSTEECLQVMTEIEQQCQSEFPKWEELYAAEAALASSEAQY
                     TEQVCAQCSGERWLPVGKVMNAQGVELSRPPPLDPILVCRERDREVHHRLNEARRALD
                     TILHALESEFRAAYTQDAAPIPEHLVRTYVHVRIRHAMLRLLRLQQRIRERILEAGTE
                     ARGSNASSHGRLSKKRIRSELARYEREERRAREADEREQRRHTLSMWRAVEEYATSFR
                     AFFREEKTRNRLRLNREIHRFFEERERSDQRREREEERRRIQALRENNEEAYRALVQN
                     TKNERLKLILEQTDDYLRQLGAIVSENRSVLTDRAADAADPASSLSLSSSSMAGQRAA
                     DSYYELAHRVRERVLNQSSLLTGGELKHYQLVGVEWLLSLYNNRLNGVLADEMGLGKT
                     VQTIALLCHLIEFKQDEGPFLIVVPLSTVSNWESELAHWAPSLKVSVFKGDRTARRRL
                     ANELFVRDASGRFPFHILLTTYEYALRARAALSKIIWSYIIVDEGHRIKNAASKLAQV
                     LGQKYRSRNRLLLTGTPLHNSLSELWSLLNFLLPQIFSSCDTFEAWFNAPFATMPGEH
                     LELTEEESLLIINRLHKVLRPFLLRRLKNEILRGGEKLPEKREVLFLCDMSAWQRLVY
                     RQLIRHERVVFTDKSGRHRHDRLSNSKMQLRKIVNHPYLFHPEYEKGGVNELVRASGK
                     FQILDSCIQKLLRTGHRVLIFNQMTRIMDLQERLLRARNIPFLRLQGLTTADERRELV
                     QEFNRPGTKYNVFLLTTRAGGLGVNLQTADTVILFDSDWNPQMDIQAQDRAHRIGQKK
                     AVRVLRIVTARSVEQHVLDKAELKLDLEQKIIRAGMFHQEAKDSDREAFLRHLIRESA
                     MNEVEEEDDEDDGDDGDAAANPGRRRGARIHTLEEINRLLARSDEEYEIFCQIDREYL
                     ARLWGVDSHDPILQDLSQYYPPLLEEHEIPDFVRNPEKHGYRRGQDDMLAAWALELEA
                     DLAQRLEQRDDAGSSAPGGRRRHRASAKRQRVHEAMQRASRKAPQSSEMKPPASSASS
                     SSTSAASASSVEEDSEAQRRVAADLDEDTEIDDESDDEENAPQSAITSDESALEDDDN
                     DDDDDEDAWSAS"
     misc_feature    516848..519562
                     /note="repetitive element"
     gene            <519641..>521431
                     /locus_tag="CYME_CMH197C"
                     /db_xref="GeneID:16993523"
     mRNA            <519641..>521431
                     /locus_tag="CYME_CMH197C"
                     /product="mitochondrial F-type ATPase F1 subunit beta,
                     precursor"
                     /transcript_id="XM_005536083.1"
                     /db_xref="GeneID:16993523"
     CDS             519641..521431
                     /locus_tag="CYME_CMH197C"
                     /codon_start=1
                     /product="mitochondrial F-type ATPase F1 subunit beta,
                     precursor"
                     /protein_id="XP_005536140.1"
                     /db_xref="GeneID:16993523"
                     /translation="MRCVRSIGRTASALARSGKTTFSSTWTSCSKVASIGGCKISTSV
                     PRAVHGVDCFGRFAAVPASLTSLLIGYGARTLATKAGSTTASSASATEVASAGTGKAS
                     SASAEHSATSKRPGSPATAVSRGRVLQVIGAVVDVQFDGTLPKILDALEVEGTEHRLV
                     LEVAQHIGENTVRCIAMDATEGLVRGQVVIATGQPIMVPVGPATLGRIMNVIGEPIDE
                     RGPIETEHYYPIHRPAPAFVDQKTSASVLVTGIKVIDLLAPYALGGKIGLFGGAGVGK
                     TVYLMELINNIAKKHGGYSVFCGVGERTREGNDLYHEMITAGVIKLGGDSKASLVYGQ
                     MNEPPGARARVALTGLAVAEYFRDEQGLDVLLFIDNIFRFTQAGAEVSALLGRIPSAV
                     GYQPTLATDLGGLQERITTTKKGSVTSVQAIYVPADDLTDPAPATTFSHLDATTVLSR
                     SIAERGIYPAVDPLDSTSRMLDPSIVGEEQYAVAQRVQQTLQAYKSLQDIIAILGMDE
                     LSEADKLVVARARKIERFLSQPFSVAEVFTGYEGRYVELQDTIRGFKGILDGEYDDLP
                     EKAFYMVGGIDEAIRNANRMAAEAAATASA"
     gene            complement(<521809..>522003)
                     /locus_tag="CYME_CMH198C"
                     /db_xref="GeneID:16993524"
     mRNA            complement(<521809..>522003)
                     /locus_tag="CYME_CMH198C"
                     /product="box H/ACA snoRNP component Nop10p"
                     /transcript_id="XM_005536084.1"
                     /db_xref="GeneID:16993524"
     CDS             complement(521809..522003)
                     /locus_tag="CYME_CMH198C"
                     /codon_start=1
                     /product="box H/ACA snoRNP component Nop10p"
                     /protein_id="XP_005536141.1"
                     /db_xref="GeneID:16993524"
                     /translation="MYLMKCSKDPKHGYTLQKLCPKCQEPTVSAHPARFSPDDKFSKQ
                     RVTLKKRFGLLPTQQPPEVF"
     gene            <525670..>526914
                     /locus_tag="CYME_CMH199C"
                     /db_xref="GeneID:16993526"
     mRNA            <525670..>526914
                     /locus_tag="CYME_CMH199C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536085.1"
                     /db_xref="GeneID:16993526"
     CDS             525670..526914
                     /locus_tag="CYME_CMH199C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536142.1"
                     /db_xref="GeneID:16993526"
                     /translation="MGLSTIDADVLRSYTEVVEAAAPASERKAGFLVQQHGALGDGGD
                     ASQPAGGATEAGAANSEGDAGSNVDMFYFEHALATAISSQQQHSAGGGGGGGGAPDPS
                     TVHTTGSATTTEGVSNLTRLVVEEQKTLDLFHKLKFNWLELQTKQYFLEVLLGCPKGV
                     TPNDLCPSDAAIAELEISSAQAKQELKKIKQQTKNLHEQMESLCTELARAHGIYLASF
                     NECRTAVEDLCARVQERAYRDQLVERDAELASLRQQEAEMLAKKAKLEWETRPLEQSI
                     DALREEIAATETRLESGNSASEKEPDAALRARYQAMVAWYQAMIPLLESISGIRIERF
                     ETDRLVISMEHAVSDQKQQAVLDLIPGSCLISRITLEPPPSPTSGLDAAEIETLLRRA
                     NETNDMGWLIRTLQQRLYLCAR"
     gene            complement(<527043..>527426)
                     /locus_tag="CYME_CMH200C"
                     /db_xref="GeneID:16993527"
     mRNA            complement(<527043..>527426)
                     /locus_tag="CYME_CMH200C"
                     /product="similar to V-type ATPase V1 subunit G"
                     /transcript_id="XM_005536086.1"
                     /db_xref="GeneID:16993527"
     CDS             complement(527043..527426)
                     /locus_tag="CYME_CMH200C"
                     /codon_start=1
                     /product="similar to V-type ATPase V1 subunit G"
                     /protein_id="XP_005536143.1"
                     /db_xref="GeneID:16993527"
                     /translation="MSKERTGLKMDGGLGPEANKTADTVRLLLQAEAEAAERIQLARK
                     EREDRLRLAVSEAEKDIAAYRERKEASFRQMQAELAGTTEGLGQKLQEKAEQLINADR
                     ARTAERLATAVDALVQAVLRCEPDP"
     gene            <528750..>529871
                     /locus_tag="CYME_CMH201C"
                     /db_xref="GeneID:16993528"
     mRNA            <528750..>529871
                     /locus_tag="CYME_CMH201C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536087.1"
                     /db_xref="GeneID:16993528"
     CDS             528750..529871
                     /locus_tag="CYME_CMH201C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536144.1"
                     /db_xref="GeneID:16993528"
                     /translation="MPVISLGRIEDAHEKGVWAITKLGNGRFLSGGLDGALKLWQLGA
                     QERGPVDAAPAASAQEGDTATSTSAGDEVAELVAHWPQAHHLAVTSLDSVPAQNLAVS
                     TGFDGRIRVWKLDATTPEQAALSEHQLNPLEAFQVAVSAGADSVAIGGDVFAGASQPQ
                     RICLAALYRLPLLEKAHSLEVERDARLEQYRFTTCVRFAASAATTAPANMLLCGGNNG
                     TLVAVDINTEAWDCVTLASDHQSGASVSEIKSSGLPVRALAQTKKEPSIVFCASEDEC
                     IHVVDWRMCEEASIFATAGSGPLFAVTVTEEEPVLVFAAGADGQVRAYDRRSGECVYT
                     QNAETRKAIWSLESIDREGLGAPRIVLGGDDGYLEVLKA"
     gene            <531610..>532218
                     /locus_tag="CYME_CMH202C"
                     /db_xref="GeneID:16993530"
     mRNA            <531610..>532218
                     /locus_tag="CYME_CMH202C"
                     /product="probable isoprenylcysteine methyltransferase"
                     /transcript_id="XM_005536088.1"
                     /db_xref="GeneID:16993530"
     CDS             531610..532218
                     /locus_tag="CYME_CMH202C"
                     /codon_start=1
                     /product="probable isoprenylcysteine methyltransferase"
                     /protein_id="XP_005536145.1"
                     /db_xref="GeneID:16993530"
                     /translation="MLDADFGLWLLLLAFFHISEGLFAYVKHGKRPSGRSFLFSAPYM
                     LALALATAEHLLMGHCLWARSQSTGGSSLASLLVIKDHNRSVGLALCILGETIRKTSI
                     LTLGDAFTHEIAVKQRASHRLQTRGLYAVCRHPAYTGWLLWLVGTQILLRNVVCGIAL
                     PCIAWNFFRQRISFEEDHLERFFGDAYREYRAKTFSGIPGIP"
     gene            complement(531920..533757)
                     /locus_tag="CYME_CMH203T"
                     /db_xref="GeneID:16993531"
     misc_RNA        complement(531920..533757)
                     /locus_tag="CYME_CMH203T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461308.1"
                     /db_xref="GeneID:16993531"
     gene            <533872..>536541
                     /locus_tag="CYME_CMH204C"
                     /db_xref="GeneID:16993553"
     mRNA            <533872..>536541
                     /locus_tag="CYME_CMH204C"
                     /product="similar to phosphatidic acid-preferring
                     phospholipase A1"
                     /transcript_id="XM_005536089.1"
                     /db_xref="GeneID:16993553"
     CDS             533872..536541
                     /locus_tag="CYME_CMH204C"
                     /codon_start=1
                     /product="similar to phosphatidic acid-preferring
                     phospholipase A1"
                     /protein_id="XP_005536146.1"
                     /db_xref="GeneID:16993553"
                     /translation="MGAFCDHYLVLVIHGVGDQYADNNFITSLERCTEALARLIERQS
                     KRIREQLRSTSQARGCFADALLENWPSVDVRCIEWHSKLQYKHGWNHMVERVTPAGIE
                     EVRRIMRETFGDIALFMSPKWHQVIMEEVVRELTLAYERKREQVRQAVSLDGAVPSVR
                     VALLCHSLGALIGFDLIRLGYALPFQVEHVFLCGSPLGAYLSLLPNGEQLARKYLLDL
                     WIERQRDEDVVGKATPAERFASNTQMRLRSGRADRTGIRHTREHVDGYAASSRNAAAA
                     GATLQPRFYNLFHPLDPAAFRLEPWLDPSMALQESVELPLPLELERLLSSRAPAQVPA
                     APRMQTAATAFTTTSAMTAPTATNAATLPKGIDACPEQQPPRYAPCAASALSVEGPAA
                     SAGDDMSASSIPDDVDAQSTGSFSSAEVLTRASSTRRSLSSPRLSQLGGEGTYRDDPF
                     ATTGLGAALRGRTAVGLSRSSSNPEFTVPLTAAETDLPAKDSVPAESLDPDRMGCTCG
                     EAHSLDRKRLQCAIRTCTRRGAKTGRSEQAKQVELPGTQFPDSVQDWCRPYREPEFSL
                     DDTRVYKRPHGNPEVGCYFRRVDYVVHDPQVARSGRVWQFVQCLRSHACYWTSDEVAS
                     FVVGILYDCLRQPRARLNEMGALMGTDLGSMASAQRFGNGHARFCTDAVPDAVASLAD
                     GRDANAPAANRETDTSAPSGNGMLARRRASPARRSASAASLDPAQRKPECCQQCIPGA
                     STVAFTSVGRPGELLTVSTKNSVRSRNGAGHRASVSPTNSAYAKHGSPDPDENHDHHT
                     GQFRLLHEVSSLSPAPTVGFLVGDSAPRPLRMISDLLEKLVTEGRWVAALMLVSGAFI
                     MSCGLVALILALLLRSLYVTLFLKQKHPLGFLS"
     gene            complement(<536759..>537721)
                     /locus_tag="CYME_CMH205C"
                     /db_xref="GeneID:16993532"
     mRNA            complement(<536759..>537721)
                     /locus_tag="CYME_CMH205C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536090.1"
                     /db_xref="GeneID:16993532"
     CDS             complement(536759..537721)
                     /locus_tag="CYME_CMH205C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536147.1"
                     /db_xref="GeneID:16993532"
                     /translation="MRARTLPYACTPERASKCESFCVWTVRKAACIHWLFEKPFWAQA
                     TGIGVDSARFTGTKEARAWRSFFFVMAGNPDAPRDTPVVTCYASSSANAPEHYQQAAF
                     ELGVAIAKRGWSQRNGGGRFGLMGKLTEGALSVGGRVDAVILDIFRVHNCHPELPSVR
                     TVTNMAERKRGLYLDSDAFVALPGGLGTLEELAEVLSWRQLGFHNKPIVLFDVDGYWE
                     PIVEWMRAAASLKMINAHFLHHGGVRCESTAEGVCDAIEQAWRAPAPSLEDAPSRCKI
                     ADRMTAGTRDKLDTDGTAIDAAADWTWTATYPSVDPARSRRAIG"
     gene            <538105..>538920
                     /locus_tag="CYME_CMH206C"
                     /db_xref="GeneID:16993550"
     mRNA            <538105..>538920
                     /locus_tag="CYME_CMH206C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536091.1"
                     /db_xref="GeneID:16993550"
     CDS             538105..538920
                     /locus_tag="CYME_CMH206C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536148.1"
                     /db_xref="GeneID:16993550"
                     /translation="MFQVVPAIQRRVPGHQSGYSWATRLEARRRRQLRAGRFTMLWPF
                     GALEKRRRAFAELFTNPNFPPSWPYTASDFERLDESPDELFYTQPRFVTHIDDDAIAA
                     LKSFYGETLRDGTDLLDLCSSWISHLPEQYRPRQVVGLGLNDLELKKNTRLDRWVVQN
                     LNENPVFPFADDSFDYVTCVVSVDYLTKPLQVFREIRRVLRPGGMAIIAQSNRCFMQK
                     VIAIWLSTNDLEHAYIIGSYFHYAGGFENLLARDISRGRGDPMFVVTATKQRT"
     gene            complement(<538901..>540754)
                     /locus_tag="CYME_CMH207C"
                     /db_xref="GeneID:16993525"
     mRNA            complement(<538901..>540754)
                     /locus_tag="CYME_CMH207C"
                     /product="probable peptidylprolyl isomerase"
                     /transcript_id="XM_005536092.1"
                     /db_xref="GeneID:16993525"
     CDS             complement(538901..540754)
                     /locus_tag="CYME_CMH207C"
                     /codon_start=1
                     /product="probable peptidylprolyl isomerase"
                     /protein_id="XP_005536149.1"
                     /db_xref="GeneID:16993525"
                     /translation="MVTLRSRKSRKTTRQDTANKAMNQAQSEPTKDTEKVTEPETGLP
                     EPTPIAADESEFKGDGESLDELAPENVGGGIDDDMDDAEPLKDDKEKDLTGDGGVLKR
                     VIKRSQTSWEHPESGDEVCVHYVGRLKSDGTQFDSSRERGEPFEFTLDSGSVIKGWDI
                     AVKSMAKGEVAVFEIAPSYAYGEAGAPPKIPPNATLEFEIELLSWHSVRDLFGDRGCV
                     RKVIREGSGWEHVRDGDEAVTFYRLVRRNGEPVQDSAEHELIFAVRRDTEMRPSYQGM
                     PVPRCVERAIRDMKKGEVVELTCAPQYAQEFTTLGLGASDSAVIELRLAKWHRTTSLA
                     DGQVTVKVLEEGEGWERPNEIDSRCRIVIDGSGGGIEEEVTLGDGSMACTGLEMALAK
                     MKKGAEAVVTIHSKQYADPATPESELPKSYHVKLCGFTNGKQSYEMSPQEKIEAARRH
                     KEIGNKLYKEQRYDRAEPHYDFIVNAFSYDADLPADLKAEAAELMRAARLNLAAVYEK
                     RRRPDKVIEHCNKVLERESAQTKALYRRACAYIARADYDEAASDLRRILELEPRNEPA
                     QRKFQELKRILREQDRRDKAFFASMFRDAKRHPSSSSSSAAAPAATMSSAS"
     gene            complement(<542476..>542997)
                     /locus_tag="CYME_CMH208C"
                     /db_xref="GeneID:16993529"
     mRNA            complement(<542476..>542997)
                     /locus_tag="CYME_CMH208C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536093.1"
                     /db_xref="GeneID:16993529"
     CDS             complement(542476..542997)
                     /locus_tag="CYME_CMH208C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536150.1"
                     /db_xref="GeneID:16993529"
                     /translation="MPGRKRKLAAKTAELAPEAGEGSESTSLVGSADASASTAAGVAH
                     TEQQEMPSGGLHESFLESIPPAASFLEELAWVESLASPSYVAYLCQMRRFDDVVAQRR
                     LTTLQRWRQDPAYRQHVSQPIALFFLEQLCSAEFREALRHPAVAALYERQVDLYRRCY
                     GNLLNTGESRVLR"
     gene            <543634..>544515
                     /locus_tag="CYME_CMH209C"
                     /db_xref="GeneID:16993507"
     mRNA            <543634..>544515
                     /locus_tag="CYME_CMH209C"
                     /product="heme oxygenase"
                     /transcript_id="XM_005536094.1"
                     /db_xref="GeneID:16993507"
     CDS             543634..544515
                     /locus_tag="CYME_CMH209C"
                     /codon_start=1
                     /product="heme oxygenase"
                     /protein_id="XP_005536151.1"
                     /db_xref="GeneID:16993507"
                     /translation="MVFVTSAGIAAARSGCSWFGAARSPAALRRTVCSRRPQQLLASA
                     YPGSRPPHAHEAVHHDGAHRPGERKGFVQEMRVVAMRLHTKDQAREGKQEESALPITE
                     WRPTRADFLQFLVDSKAVYDFMEGYVAGEASKGNPLFKPFVNTGLERGQALASDIAWF
                     RDELGYQVPEPTEAAQRYIDYLRGLFERSPEAVLCHWYNYYFAHTAGGRMIGRNMENM
                     LFGDGPNAKRFEFYKWERDVKQILDEVRERIDEVAKDWPREVKDACLNETGLAFAYSG
                     TILNNLAKRAEEPAPAS"
     gene            complement(<545356..>546660)
                     /locus_tag="CYME_CMH210C"
                     /db_xref="GeneID:16993520"
     mRNA            complement(<545356..>546660)
                     /locus_tag="CYME_CMH210C"
                     /product="similar to peptidyl-prolyl cis-trans isomerase
                     Ess1p"
                     /transcript_id="XM_005536095.1"
                     /db_xref="GeneID:16993520"
     CDS             complement(545356..546660)
                     /locus_tag="CYME_CMH210C"
                     /codon_start=1
                     /product="similar to peptidyl-prolyl cis-trans isomerase
                     Ess1p"
                     /protein_id="XP_005536152.1"
                     /db_xref="GeneID:16993520"
                     /translation="MEAARKASGVKAQPTFKEPRWLGAAPSGARLDVYTQKSNERVRK
                     VPFPANRGYLLVGNGQGKATAVDIVLADASDVGALHAAVAFHREHRKFYLIDLGAGAT
                     RVRGQQVEPLKPLVIAEGSRIEFGSSSQYVRLRLGGAPERQSPAESTAAAPVPGQVRA
                     RHILIKHRDVRNPVSKRTGQPVSISRDEARAVIESLRQHILSGEASFEEVARIESDCN
                     SYKRGGDLGWFDYTTMQEPFARVAFLELKHTGDISDVVETSSGFHLIQLLGRRCPEQQ
                     ASPASGITGGDTDATQSNATRAPDDVFYVRHILLKHTGSRNPSDLKGHPIVRSKAEAR
                     ALLSKFQKTIQSGLVSFEQLALQHSDCKSSRYGGRIRPFGPGEMHAEFERAVRNLEPG
                     QLSGIVETPSGLHLIELLARGDDVWRMAKAGSQETPAFNGSV"
     misc_feature    546830..548676
                     /note="pseudo-gene of inorganic phosphate transporter"
     gene            <549155..>549796
                     /locus_tag="CYME_CMH212C"
                     /db_xref="GeneID:16993517"
     mRNA            <549155..>549796
                     /locus_tag="CYME_CMH212C"
                     /product="probable 5-formyltetrahydrofolate cyclo-ligase"
                     /transcript_id="XM_005536096.1"
                     /db_xref="GeneID:16993517"
     CDS             549155..549796
                     /locus_tag="CYME_CMH212C"
                     /codon_start=1
                     /product="probable 5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="XP_005536153.1"
                     /db_xref="GeneID:16993517"
                     /translation="MGSTQDVLLMKRELRKRMRELLRQVSRNDLRERSAEACRQLTNS
                     EVFRSARTVAAFCHMPTSEVETTDLLAACFAEGKRVFLPRVDEGSVRKMLFLEAHGLQ
                     DVESWPLNAMGIREPPSTWNGQVRREVRTLVERERKPLDLIVVPGLAFDTFGRRLGRG
                     KGYYDTFLATCEHLHHEMQLPPPRRVGLALSCQMVTEVPVSAHDQVVEAVFYA"
     misc_feature    complement(549778..552315)
                     /note="pseudo-gene of eukaryotic peptide chain release
                     factor eRF subunit 1"
     gene            <552608..>553651
                     /locus_tag="CYME_CMH214C"
                     /db_xref="GeneID:16993534"
     mRNA            <552608..>553651
                     /locus_tag="CYME_CMH214C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536097.1"
                     /db_xref="GeneID:16993534"
     CDS             552608..553651
                     /locus_tag="CYME_CMH214C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536154.1"
                     /db_xref="GeneID:16993534"
                     /translation="MRLLLQRWSQTMRHGSRNALGIVRLRSFPGCLSGSESRSHWRPV
                     TVWSTCAAVIAASLASVQRPEWRPWLCYAEASTSLESTHNFTAATEKVAPLSDAAEPA
                     TILWKQLPDSLAELRKADIVLYQYETCPFCNKLRAYLDYWRIPYKVVEVNPVGKKELK
                     FSSYRKVPILVVNGTQLNDSAAIIKALARITDPDRALNTQWFDWIDSWFVHTLPPNIY
                     RTRHEALETFDYITEKEKFSPWQRFTIRYVGAAAMYFVSRRLKKKYHIVDERQALYDA
                     CRDWLQAVGWPERRFLGGARPCAADLAMFGVLRSIEGFTAFHELAANVPEIVQWYRIM
                     KDQVGPSARIDSM"
     gene            complement(<554376..>554693)
                     /locus_tag="CYME_CMH215C"
                     /db_xref="GeneID:16993535"
     mRNA            complement(<554376..>554693)
                     /locus_tag="CYME_CMH215C"
                     /product="Sm protein E"
                     /transcript_id="XM_005536098.1"
                     /db_xref="GeneID:16993535"
     CDS             complement(554376..554693)
                     /locus_tag="CYME_CMH215C"
                     /codon_start=1
                     /product="Sm protein E"
                     /protein_id="XP_005536155.1"
                     /db_xref="GeneID:16993535"
                     /translation="MPKDALDRRIVPEQLLATLARQQARVEVWLFENTRYSLEGTLRG
                     FDEHTNLVLVDTVEQWGSTAKHKRRTVALGTILLKGENVVLVRSLGMPTQRKEVTHSA
                     TRE"
     gene            complement(<556713..>558599)
                     /locus_tag="CYME_CMH216C"
                     /db_xref="GeneID:16993536"
     mRNA            complement(<556713..>558599)
                     /locus_tag="CYME_CMH216C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536099.1"
                     /db_xref="GeneID:16993536"
     CDS             complement(556713..558599)
                     /locus_tag="CYME_CMH216C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536156.1"
                     /db_xref="GeneID:16993536"
                     /translation="MNAHHNDWTPDKVLDTVREYVDAGALSECAALDLLERLPLPLLG
                     WTLEEYAVRASLEASDSDAVPSDNIFDSIRVLTKTMEKLVKLSATSARVRHVVPTEQV
                     LQLIQLGLSSRYPLVRTAALRLLCLLLERNDLPEAFCQQVADTIIERFESTNELRPEI
                     EAAQAPGPEVDAPSTTAQHASDILSLVLLSFRDDPSTEAAGLCEKILKNLVQLKPFRG
                     AVVLFSEARGAQILVQEMLSGAAGAVAHIRALSFLLEICDYSSVAEIAARRLLPTVLV
                     AKIAAPVRLDEDLLLRLNLLDVLGAFMQRSAIAAELLDQISVFDVLLRQHLAHLLAPD
                     EPASSDLAERWFIWMCGILRFVRTSAGSSRCAFHAWMNANLVEILGRFLLLHVVDGET
                     ETAHWSVRLDQVRRTTLLVHLISAVGALGLCERGMDVLLADVDTLKLTLRFIQTASVC
                     DIRVASLRALSVFLAGLDEPLSSAAVSGYGAAESDLEFRQQRVLHLFTDAIRDADPVK
                     AFTNALPIVLDCARHPSEEERLAAAAVFAALGLSRIGVVALASMAGFVDWLCDPTDAS
                     LEVLEAKMRVARRLVELQASDGEVAFGALKWSRIVAVVSNRSDPQAVRQRRVPAVNIA
                     TLNR"
     misc_feature    558811..561529
                     /note="repetitive element"
     gene            <561825..>562598
                     /locus_tag="CYME_CMH218C"
                     /db_xref="GeneID:16993537"
     mRNA            <561825..>562598
                     /locus_tag="CYME_CMH218C"
                     /product="40S ribosomal protein S4"
                     /transcript_id="XM_005536100.1"
                     /db_xref="GeneID:16993537"
     CDS             561825..562598
                     /locus_tag="CYME_CMH218C"
                     /codon_start=1
                     /product="40S ribosomal protein S4"
                     /protein_id="XP_005536157.1"
                     /db_xref="GeneID:16993537"
                     /translation="MARGPKKHLKRLAAPRHWMLAKLGGIWAPRPSAGPHKLRECLPL
                     IIILRNRLKYALTGREAMQILMQRLVRVDGKVRTDRTFPAGFMDVIHIEKTNETFRLL
                     YDTKGRFVLHRITPEEGKYKLCRIKRQQLGARGIPYIVTHDGRTIRYPDPLIKVHDTV
                     VLDIETGKITDFVKFDIGALCMITGGHNIGRVGVVQHRERHPGATEIVHLKDAAGREF
                     ATQISNVFVIGREKSLVSLPRGKGVKLSVVEERERRGLL"
     gene            complement(562822..564352)
                     /locus_tag="CYME_CMH219T"
                     /db_xref="GeneID:16993538"
     misc_RNA        complement(562822..564352)
                     /locus_tag="CYME_CMH219T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461309.1"
                     /db_xref="GeneID:16993538"
     gene            <564690..>567746
                     /locus_tag="CYME_CMH220C"
                     /db_xref="GeneID:16993539"
     mRNA            <564690..>567746
                     /locus_tag="CYME_CMH220C"
                     /product="retromer component VPS35"
                     /transcript_id="XM_005536101.1"
                     /db_xref="GeneID:16993539"
     CDS             564690..567746
                     /locus_tag="CYME_CMH220C"
                     /codon_start=1
                     /product="retromer component VPS35"
                     /protein_id="XP_005536158.1"
                     /db_xref="GeneID:16993539"
                     /translation="MRTTRPSRRSKDATENSEEAVRATLQFVERLLSRIDKDALLFPA
                     GTFYGPGGVRADPLALERHSPTARTVAAVPSREAPALARPCKLENCTDSKLKKSLVLY
                     FETHATIAVRLWFLYRSLTEAERWQYAEPSTTEAFEQAAAAPAAQMSHPPAATNEAEI
                     RKIPEPFVSKESSQPNEATQRRSTSGPCDVHQLARLYEIAQCWSAVCPRLYVLSTVAG
                     ALIACHPSRRDEIAQDLLEMLAGVQHPLLSLPLRTFVAKLLVDAWKPQEGATDLETEH
                     LVDHLMDNWENMVDALMRVPSYGFELRPLSSSSARNDLAACRWVLAEQLSILLGSQFT
                     VLARTAFVKGAIFREKMLPMLSQRILRIAEAPLQEYLLECLIQAFPEEFLAFAAQHYL
                     DMIQRTRVGVRHARLLARFWERLHRWLQRSPAWTQAVQDLPLVVCGIEALTWASPVRT
                     PFESVDRLDACEMLIELALKMGGIHHTSLNELLTLYLRAWKRAYADLCPKSPVSARYL
                     VPPTTTTLVSLPGARSACELTPSQCPCELHSPCSPDMEERVDLGGIFAPCARSTEASS
                     CTTEQAYLGAARLVRLCKRLVRAAGCWSDLLMVPAFNDLLTLLPMDDRRRLARQLALW
                     IVLDRPSSATVLRPELCLRRTNAEALKISRHYASILIWLDALVRGAKALETDEEIGYQ
                     EASQHSTKAARQQTAHDLDVDAAGCLRSMPEPTTDDALYDVMLCSCVVGKFTWNDIPL
                     LDQLMNWVLGTPAAARRQLLPTCASTVMRLLAEQASASEFLRTQLWERMHAMLANLAQ
                     IESAQAAVLSIDAALLADQVAVDSPALVRNLLVQALVILEEDRLSARAYRTILLRVID
                     ALRVLERLEYDALLRLASQVAHQAESCWVPVDRCQALCAVANLYACIAAAHEQSTSAP
                     MLQAGTQALQCWKRALVIAMEACGVSERAHLLLDVYRAGRQLTVTVCASGFPDSFRDE
                     LDATCFECVASVQQIIRQFGWSHHAEHLHLAWARLVRLAASREVPR"
     gene            <568768..>569328
                     /locus_tag="CYME_CMH221C"
                     /db_xref="GeneID:16993540"
     mRNA            <568768..>569328
                     /locus_tag="CYME_CMH221C"
                     /product="similar to PUA domain containing RNA binding
                     protein MCT-1"
                     /transcript_id="XM_005536102.1"
                     /db_xref="GeneID:16993540"
     CDS             568768..569328
                     /locus_tag="CYME_CMH221C"
                     /codon_start=1
                     /product="similar to PUA domain containing RNA binding
                     protein MCT-1"
                     /protein_id="XP_005536159.1"
                     /db_xref="GeneID:16993540"
                     /translation="MFKKFDADEQVSGQAQLKSSATRALRTAVCTQMPRFEPYVDDVV
                     PKKARIFQVRLHNHYQLLCDEAGRVLFLQDRDGRLYPTLRLLHAYPFMLPWVQVDRGA
                     IRHVLRGANVMCPGLTSPGGYVPPELAADQVVAVMAEGKARALAVGRMLLSVAQVLQQ
                     NQGVAIENVHVLGDEIWKRERWSASG"
     gene            complement(<570010..>571032)
                     /locus_tag="CYME_CMH222C"
                     /db_xref="GeneID:16993541"
     mRNA            complement(<570010..>571032)
                     /locus_tag="CYME_CMH222C"
                     /product="TATA-box binding protein-associated factor 11"
                     /transcript_id="XM_005536103.1"
                     /db_xref="GeneID:16993541"
     CDS             complement(570010..571032)
                     /locus_tag="CYME_CMH222C"
                     /codon_start=1
                     /product="TATA-box binding protein-associated factor 11"
                     /protein_id="XP_005536160.1"
                     /db_xref="GeneID:16993541"
                     /translation="MTTQEARGASIRFALGVGDAPESVATQSGPAAAPESSASPKPKR
                     RRSDGNRKRTDSNEQAVSGKDDTAAGAGAPVEAKATQKRTTTPRGRGRGRRSRITETG
                     ELEGPQSEAAYRRPRGRGGRTAGAQRHARGGRTAAPAPGSGYRAETALDKDSEERAPE
                     QGSLSQFVLLGDDAEQVLGDLKPDAADLDTSMDSDLLDGIDAQIFPEYSAILSNPLAK
                     PERSEHEFRSFRELTNEQFEMLTEAQKERYVEFRRAALRPQNLRRFVNALVGGASGYA
                     PGHPFLIALQGLGKMFVGDLVETAVQIKCEWDRNREIATRGEAVHASPNWTGWSAADS
                     ARTTPY"
     gene            complement(<573467..>573664)
                     /locus_tag="CYME_CMH223C"
                     /db_xref="GeneID:16993542"
     mRNA            complement(<573467..>573664)
                     /locus_tag="CYME_CMH223C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536104.1"
                     /db_xref="GeneID:16993542"
     CDS             complement(573467..573664)
                     /locus_tag="CYME_CMH223C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536161.1"
                     /db_xref="GeneID:16993542"
                     /translation="MWRRCLSFLETAWQQQPVLVLSVALGTFGVLGPLVYRVERPDRQ
                     REQQRLRSIASVESRTNPEYR"
     gene            <574000..>574680
                     /locus_tag="CYME_CMH224C"
                     /db_xref="GeneID:16993543"
     mRNA            <574000..>574680
                     /locus_tag="CYME_CMH224C"
                     /product="mitochondrial ribosomal protein L13 precursor"
                     /transcript_id="XM_005536105.1"
                     /db_xref="GeneID:16993543"
     CDS             574000..574680
                     /locus_tag="CYME_CMH224C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L13 precursor"
                     /protein_id="XP_005536162.1"
                     /db_xref="GeneID:16993543"
                     /translation="MGRGSLYTARFAAIKRIVEEDRCWRLFDARDQVLGRLASRVACI
                     LLGKHKPYALPYVNPQPGDGVIVINARHVGLTGKKLDQKLYRHHTGYPGGLKSELARS
                     LLARKPERVIELAVRRMLPPDRRRRNLVRDLLRVYPDEKHPFPEEQLVHMGLVWRRVG
                     EGGIADDTDEERYRAQFEFEWNRLVLLASPERVREILREEFAASRVIERKEVAEQSNE
                     RDEDAFSS"
     misc_feature    complement(575857..576788)
                     /note="possible transcribed region"
     gene            <577185..>578537
                     /locus_tag="CYME_CMH226C"
                     /db_xref="GeneID:16993545"
     mRNA            <577185..>578537
                     /locus_tag="CYME_CMH226C"
                     /product="eukaryotic translation elongation factor 1
                     alpha"
                     /transcript_id="XM_005536106.1"
                     /db_xref="GeneID:16993545"
     CDS             577185..578537
                     /locus_tag="CYME_CMH226C"
                     /codon_start=1
                     /product="eukaryotic translation elongation factor 1
                     alpha"
                     /protein_id="XP_005536163.1"
                     /db_xref="GeneID:16993545"
                     /translation="MGKEKTHVSVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK
                     EANEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETDKYYFTIIDAPGHRDFIKNM
                     ITGTSQADLAILVVASPPGEFEAGISSNGQTREHALLAYTLGVKQMIVAVNKMDDKNV
                     NWSQSRYDEITKELNLYLKKVGYNPDKVPKVPISGWTGDNLFERVPSDHPLAKWYKGP
                     ALLEALDAIEPPKRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPTG
                     LTTEVKSVEMHHESLPEAGPGDNVGFNVKNVSVKELKRGFVCGDSKNDPPKAAEDFKA
                     QVIILNHPGEIRAGYAPVVDCHTAHIACRFAELLEKIDRRTGKKIEENPEKVKAGDAC
                     MVRMIPSKPMCVETFSEYPPLGRFAVRDMRQTVAVGVIKEVNKKEAEGKVTKAAAKKA
                     "
     gene            complement(<581440..>582171)
                     /locus_tag="CYME_CMH227C"
                     /db_xref="GeneID:16993546"
     mRNA            complement(<581440..>582171)
                     /locus_tag="CYME_CMH227C"
                     /product="probable ubiquitin conjugating enzyme E2"
                     /transcript_id="XM_005536107.1"
                     /db_xref="GeneID:16993546"
     CDS             complement(581440..582171)
                     /locus_tag="CYME_CMH227C"
                     /codon_start=1
                     /product="probable ubiquitin conjugating enzyme E2"
                     /protein_id="XP_005536164.1"
                     /db_xref="GeneID:16993546"
                     /translation="MSSPGRRREMDIMKLVMADYEVEMANEDSNAEFYVKFRGPKDTP
                     YEGGVWKVHVELPEAYPYKSPSIGFVNAIYHPNIDQMSGSVCLDVINQTWSPLFDLLN
                     VFEVFLPQLLTYPNSQDPLNGEAAALHLREPQRFQQKVREFVNRYAREEDYPVASRTQ
                     ALRRHQQSRSAQPSTSSLASSSKGATANAAADSAHDTTRAASNGSASELESLSDSDDE
                     ERNALDDGAQAFSFSGRRLVGNGNS"
     misc_feature    complement(582314..584197)
                     /note="repetitive element"
     gene            complement(<584534..>586711)
                     /locus_tag="CYME_CMH229C"
                     /db_xref="GeneID:16993547"
     mRNA            complement(<584534..>586711)
                     /locus_tag="CYME_CMH229C"
                     /product="probable sulfate permease"
                     /transcript_id="XM_005536108.1"
                     /db_xref="GeneID:16993547"
     CDS             complement(584534..586711)
                     /locus_tag="CYME_CMH229C"
                     /codon_start=1
                     /product="probable sulfate permease"
                     /protein_id="XP_005536165.1"
                     /db_xref="GeneID:16993547"
                     /translation="MPDTPHIIDSCGDQTARHPRLHVRISALASEASAMHERLVVHCL
                     FTGHARYFRRNMGVENALGGFIVTNTFSGSGVRFVVRNRSQCNSLVVPGFRARRRTRC
                     GALARVRGTGSAPGGTPDAEARHRPKPGERGLFPLVAPREDIGRYFVGERRILDERTA
                     RYPLRSTVEEVLAGITVAMALLPAAASCALATGVPPLAGIVSTGLLCAITAALGGRPG
                     MISGTSAALIILQAPLYQQYGAAAVAAAVVLSGILQLFFGIYRLGKFVRLISYPTFLG
                     FISGIAILTATSQVYAFQLPAGTGLSPGAPWLQGNMLRAALIVAALAAGVAHVWPLII
                     QRLERRRPDSTHRWQHRLAELLRWLPSPLAGILVASIYAEVTQAPVRRLGDFLRDTLA
                     QSGAIGVSWAALPSTPLAWMAILSTALGLAFIGLLESLLTMTLVDEVTESRGSTRREC
                     LALGAGNIAAGLFGGVGGCGLLGQSLLNTKSGGRGRLSGLTAALCLLVLARNPSGLMI
                     RIPVPAIASLMVLVALGSFEWASLRLFRAIPLADSLTIVSVALMTVATRNVALAVLFG
                     VVFSALVFAYKASRRITAQSFISEDEQTRGWRGYRIDGPLFFGTAERFSRLFDPARDR
                     AEGHEHVIIDFSGSRIWDATALEALDSLARQYRSYGIRLHLWGLSRDSARLLREARAY
                     IDESVTNENALYLYERVVADYPTNDSLEVEYELFAKRESGNAA"
     gene            complement(<587376..>588950)
                     /locus_tag="CYME_CMH230C"
                     /db_xref="GeneID:16993548"
     mRNA            complement(<587376..>588950)
                     /locus_tag="CYME_CMH230C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536109.1"
                     /db_xref="GeneID:16993548"
     CDS             complement(587376..588950)
                     /locus_tag="CYME_CMH230C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536166.1"
                     /db_xref="GeneID:16993548"
                     /translation="MNSALIGAVRTAGRCCAILRHQRLGRWAGTCSTTSSGEACRRQG
                     GINWILQLQARFSSDLGYPSNGFRRTWTDSLQKRTLSSYLRKHTQWWLRVHVPADTPC
                     TAAMQSHGTALQVAALATASVVDVGGISTPAAPPPPPPPPPSSPSTLRVHKQRKTKAR
                     SGSSGEAVRICAAYCLASGYRLEELRDLLRSVPLVTTVDASTLSRDVLHCRVRPATRQ
                     EQVRMPHADGHVFFFESGAAVFWDVDEETRRELLRLARRCDIQPGYNSNVTFEEFDHE
                     FEFSYLMDSAQSSTDTLSDAPDGTSPSGGAALAASAAPASPNRLATAEHALPMPSALG
                     RAKLRPALQAPLSRNQERIPNSLTQFRNDRIFLHDYADALSMLAISFGLAQSVKLLVF
                     ELSIDRLVEETRRLPEELAKYGRFRTVAQDDLRRRIGQLLTAKYSVALLSDILDTPEI
                     FWEYPSSETVYNQSVQVVDLQKRARLLDKRMDIVQDSLALLNSELATSTTHRVERAIV
                     ALIAIELGLQVFNKLF"
     misc_feature    589139..589554
                     /note="possible transcribed region"
     gene            complement(<590474..>592948)
                     /locus_tag="CYME_CMH231C"
                     /db_xref="GeneID:16993608"
     mRNA            complement(<590474..>592948)
                     /locus_tag="CYME_CMH231C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536110.1"
                     /db_xref="GeneID:16993608"
     CDS             complement(590474..592948)
                     /locus_tag="CYME_CMH231C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536167.1"
                     /db_xref="GeneID:16993608"
                     /translation="MLTTWTEHREVEFRPAKRVCNELHLTPPSKAAPDTREHALNWER
                     FLLQKRLQRRIRIATNRHGAEHVRSTIALSLSADGTRLASTHGDHVVRTYRIRRGETE
                     NARPESSQVRELCQDTGCSFSLELSAELYGHPRTPWSVHFHPRDSDLMVSGCLGGHCY
                     VWYRDQCVARYTVSEQHPENFAFFPEYGPSSISCVVFDPSGEVVIIAARRSLFFWQWR
                     RTLWSRTLLRTMTRPMIGAGTAATREPSPRHALYGDRGRRSAAAGQTTNTNRVLVGAS
                     TYSAGREAHIHTRTALEDRVTRGDTRASSVATASTLDTAASFDTIGAGRSGALAGDAA
                     SFQTSLGSASRFPWPPDRERQRQAVGSSSVAGIVGTRRARHASRQIQNARSNENADEA
                     DLSAQHPMDMQRVTAGRPERHPAESTDETLVEDSQQRSACYYLGVPIHLVNALAGASI
                     LLVGTRSPVLSTEQEAELFRVAAAPFTLDIQLYQLREEPLRYIDSAPNSSSNGDVGGS
                     GYGFQRSRSTPVCNTLCPGVLIGKIPQVVAYNEAGISVSTDGRYLLVCILQSQLRRPP
                     PHCPSDSHASSLHSGTERSAPRSHGAGVPRSAVRSPVPDTAHAPAGLESRNVWVRAAQ
                     ERVPSGGASTFVAHIVIYEILPVSAVSGQARKSPVLDSCFLTSIDGAVSSVELRERAR
                     MPLDACHTRALTNLRFVPSPNTGFGKVSPDRDRIYFLAGYSYRESMTHSETLEAAEMR
                     PILDLFEADLRTGSMHCLRSIPAARPHAGIAPGDASTALDWRSFEEVDGINCALFLPM
                     YSANYPQLVQGIVYGTQRGDIYALVD"
     gene            <594037..>594828
                     /locus_tag="CYME_CMH232C"
                     /db_xref="GeneID:16993551"
     mRNA            <594037..>594828
                     /locus_tag="CYME_CMH232C"
                     /product="probable adenylate kinase"
                     /transcript_id="XM_005536111.1"
                     /db_xref="GeneID:16993551"
     CDS             594037..594828
                     /locus_tag="CYME_CMH232C"
                     /codon_start=1
                     /product="probable adenylate kinase"
                     /protein_id="XP_005536168.1"
                     /db_xref="GeneID:16993551"
                     /translation="MAHQTAEVLRRVPTEELLKELERREATRGTNKQQQQRLVLIGPP
                     GSGKGTQASFLRERLCLCQLATGDLLRNAVAQGTELGKEAKKVMEAGGLVSDQIVLGL
                     VRENLRRPECKNGFILDGFPRTLEQARKLDELLATDGIGPLSAVLNFAVPDELLKRRI
                     LGRWVHPASGRTYHEEFHPPKVPMRDDETGEPLVQRSDDQPDVLVKRLAAFHASTKPV
                     LDYYEKRGILHQIDASKSIPQVRQQLSEVLSVDLSDNTERAEANG"
     gene            complement(<595880..>597187)
                     /locus_tag="CYME_CMH233C"
                     /db_xref="GeneID:16993552"
     mRNA            complement(<595880..>597187)
                     /locus_tag="CYME_CMH233C"
                     /product="probable tRNA splicing endonuclease subunit
                     Sen34"
                     /transcript_id="XM_005536112.1"
                     /db_xref="GeneID:16993552"
     CDS             complement(595880..597187)
                     /locus_tag="CYME_CMH233C"
                     /codon_start=1
                     /product="probable tRNA splicing endonuclease subunit
                     Sen34"
                     /protein_id="XP_005536169.1"
                     /db_xref="GeneID:16993552"
                     /translation="MYPSVQSLETSEADTRIRTSSQSVRVVSSGPGAFFVWSIREAEQ
                     LRSVHRIIGELVGCAANHVGQNQFLGLPLALDVVEVALGLTEGFITLEEAPWTRYRGC
                     TPELRQAFESERETSRLEQLAAEAKLAEQRRLQFMAAEEWRIARERKRFGQTAARKRP
                     HSGECIVHGHYQAADELCEGSATAQDVPLCEDAGQPSPPRKRPRFLQNVDPIRTAARL
                     LSHVHMESLLGVFRRVWLASRACWQSTAYVLTSSVLSQRYRSESRDWETVPASAVQHA
                     RSSKPQGEATLQSAADSKRVRPYRIRIHTERAPFEVLNADTAETVLLDHTNVYGHEFW
                     RSITRSPRFLVFRDLWRRGFYLTSGHKFGADFLAYAHDPCLFHAGLCVIVLNKNDILR
                     PRDIISAGRLGVATKKRATLACVEDIEQGIVSYRGIAWCEALP"
     gene            <599619..>601568
                     /locus_tag="CYME_CMH234C"
                     /db_xref="GeneID:16993554"
     mRNA            <599619..>601568
                     /locus_tag="CYME_CMH234C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536113.1"
                     /db_xref="GeneID:16993554"
     CDS             599619..601568
                     /locus_tag="CYME_CMH234C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536170.1"
                     /db_xref="GeneID:16993554"
                     /translation="MSVELGSLSMDWRIALQLAHSTLHTLRPLIPSEAIAGKPAVSCL
                     KRPLKNSRCLRLSCKKHVFSNTVFYSHMYSCSKLLRFLLVVIATGLSPGGMALAKDVC
                     PYCADLGRACQVQSQRCVPCTSSANCSSLQSCNINTGYCDPKSLFHPFVWNDGIMVPL
                     MFISSAVHNAAGTGGGTSYIALFVLVLGFRVATASANSHAFIFAGMIANVLVNLWARH
                     PFRDMPRIDWNLVATSVPLFLAGSSIGVFLNQLFPNYFLSLLLAFLMLLLTMLVVWLG
                     VRLTWREMKRHPLESNRDPCPGDVLAEQDSLTCGPETSKAHTKTAIATDLSMEDKTLL
                     ERSRTSTTGSLEASSWTASTAKSMEASTAVASPGESTPIPRLEGGTLPGIWLPRWLDP
                     LLHSRTLDEMMQFERPWFQWRYWLFLASCWSVLFVARYLSGSREARSPVGMPLCGVVF
                     WVVFALQEAFLVIAALVMCLRNIRLRRLRELLGFPRYVDANDMGDFPLHSGFLVPYMS
                     FTFLAGILDTWIGVSGSALLVPYLYVLGRVEPFTVQSSVSAVIFVTSSAGAVQFLVYG
                     KLIISYALFYGLWSLLGSLFGVVLVYYIALRYRMKAIFLLALAAACAFSFGTLVYVGI
                     RNVVHVAAADAGWVFNSICSAASRA"
     gene            <603594..>606584
                     /locus_tag="CYME_CMH235C"
                     /db_xref="GeneID:16993555"
     mRNA            <603594..>606584
                     /locus_tag="CYME_CMH235C"
                     /product="ATP-binding cassette, sub-family A"
                     /transcript_id="XM_005536114.1"
                     /db_xref="GeneID:16993555"
     CDS             603594..606584
                     /locus_tag="CYME_CMH235C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family A"
                     /protein_id="XP_005536171.1"
                     /db_xref="GeneID:16993555"
                     /translation="MEAGIGSERAAYVAGTGRAETAVETVHGPPLVPEHADVRDPHGL
                     RDLRPSTRGLRSAQFRALLIKTYHYQRRQWCDSVCIFLMPFVFLLAAFILGKIVNSSI
                     THKQVTAAEQNPRGGFAPTFFDPNLCAEYGSLGCELGPFLPAIDIAVGGVSVDVPLVF
                     PYAGPASSATNLGRVNYAICNPLFSTSACEALAAAGPSVREGLFGNFTLLPFLYNGSD
                     IYNVNDLLLKVFSNDTSNKRYQALVNSSKASPSYLNNIYGLSVESFGDGSSGREALLR
                     QLYNVFYTSDRYAFPQYFGAYVISDTSSFPNISATVYYNNTNLNLPYQSLPLTVPANE
                     FCYPDGNCQLIAGVSHLYDVVAKANGKLGVENLLRIVPKVKGIQSNFNFVQLVTAVLI
                     GILLHFMIPSILRNLVMERESGIRQNMLIMGLRLPTYYVVTYLGFLLMYLLVMISTVI
                     FGLAFRIPFFTLNTPLLYFATFLLWGLAMISFCMFLAPFFWEPSTALILGWTYVVVIN
                     FIGGQYIGNLFTYGASSATFLATFLLPSFSFFYSVYYAGGVNVAGVGIHVRSDNTTVP
                     GVNLGMCAGNSLICYSYLYLAVEAIVLLLIGLYLDQVIPHRFQVRKHPLFFLGFKRRV
                     ASKVVIDEEKANTLTSKAAIDSSVQAEEEAAAAALAVPYDENAPSVCIHRLSVAYPGR
                     PPFHAVRGLSLALRRDETFAIIGQNGSGKSTTMNCLTGLLDITSGDVRILGLEVPGDL
                     NEIQLQMGVCPQFDVLWSDLTGEEHLYFYARLKNVPRAKIRYAVQDALESVRLDAPHV
                     RHRLARKYSGGMRRRLSVAIALIGGSKLVILDEPSTGLDPQSRYDLWACIQQHRAGRT
                     ILLTTHSMEETERLADRVGIMCMGQMRAIGRPNELRLRLGQGYRLVLQTTLSRAVVAH
                     ERILEKLSSRAVLEATVGGQFVYMLPREDLQLSQVFDVMNAMQLSGIVTDWSVSQATL
                     EDVFLRVTREAEREAEEHRDKWGL"
     gene            complement(<607536..>608543)
                     /locus_tag="CYME_CMH236C"
                     /db_xref="GeneID:16993556"
     mRNA            complement(<607536..>608543)
                     /locus_tag="CYME_CMH236C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536115.1"
                     /db_xref="GeneID:16993556"
     CDS             complement(607536..608543)
                     /locus_tag="CYME_CMH236C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536172.1"
                     /db_xref="GeneID:16993556"
                     /translation="MHLLRSAWQAIRHLRTGSAQHRFGIFPPSPPRPPTKVYFSRRQS
                     QETSPWGSPSSRQWLFIGVTFAGGVVYYVVHIDRAPLTQRRRMIDISADQEAAIGKAN
                     FQMVLTQYHGRILPATSATSRYVERIGKRIAASAEAISPPGVHYQWEFVVIDSPEPNA
                     FCLPGGKVAVFTGILPILVDENSVAAVLAHEIAHAVARHGAEKLAFAKILLLLQIVIN
                     QFIDTRLLTNLLMQLLLTLPFSRRMESEADYIGLHLMAAACFDPQAMAPMFERMKALR
                     EKLMRGHRSPPSYLSTHPADEDRVAAIIRWLPEVLPEYEAKCLPSGREWRRTLRSLSP
                     F"
     gene            <610235..>610867
                     /locus_tag="CYME_CMH237C"
                     /db_xref="GeneID:16993557"
     mRNA            <610235..>610867
                     /locus_tag="CYME_CMH237C"
                     /product="zinc finger protein"
                     /transcript_id="XM_005536116.1"
                     /db_xref="GeneID:16993557"
     CDS             610235..610867
                     /locus_tag="CYME_CMH237C"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_005536173.1"
                     /db_xref="GeneID:16993557"
                     /translation="METTSDHFAAVNRRRLRPQNYKCPQCPQAFTSKQHRTVHVRVIH
                     EKRRDYGCGTCGQTFSRKSAQVSHIRYVHEGRRDHECPICKVRFGRRNGLNKHVVAVH
                     WKRRTFRCDCGAAFTRKDCLLRHQRGVHEGQSRPGQSSVQSPSYGSGLAHGSAALVRT
                     PVPSKTTTSNASPRSPLSKPMASSGASGAPSSSGAFTQSYADRNSPLAGT"
     gene            complement(<611969..>612991)
                     /locus_tag="CYME_CMH238C"
                     /db_xref="GeneID:16993558"
     mRNA            complement(<611969..>612991)
                     /locus_tag="CYME_CMH238C"
                     /product="similar to glucose-6-phosphate/phosphate
                     translocator"
                     /transcript_id="XM_005536117.1"
                     /db_xref="GeneID:16993558"
     CDS             complement(611969..612991)
                     /locus_tag="CYME_CMH238C"
                     /codon_start=1
                     /product="similar to glucose-6-phosphate/phosphate
                     translocator"
                     /protein_id="XP_005536174.1"
                     /db_xref="GeneID:16993558"
                     /translation="MLPKASHWGASRSIAAMAFNFLSSVGIVAANKQVFRAAFHFATS
                     LTFWHYFVTALGLALLLQVRVFQAKHLDWRKCARLALGNISFVVFSNLSLQHNSVAFY
                     QLMKHLSTPVVLFIEFYFYNQSFDTSLVRSLLIMVAGMVVAFATDFNLNALGTCFALI
                     SVVACACYAVWTGRLQKELDANPLQLQLYVAPMVAAMLIPFVLVADLFSKEPGRRVID
                     YAYTAENVRLLSYSGIAALCVNVSVFMVIGYTSSVTYCVLGIAKTSAIILTDFLFFGR
                     PLEMMNLLGILIALAGVTYYSILKLQIASRKASTINANAMEKHDHISFESSPEKKQER
                     APVQVR"
     gene            complement(<615080..>615706)
                     /locus_tag="CYME_CMH239C"
                     /db_xref="GeneID:16993560"
     mRNA            complement(<615080..>615706)
                     /locus_tag="CYME_CMH239C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536118.1"
                     /db_xref="GeneID:16993560"
     CDS             complement(615080..615706)
                     /locus_tag="CYME_CMH239C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536175.1"
                     /db_xref="GeneID:16993560"
                     /translation="MAFVISSGFIGTRSGAVQSRCSRRTRAATARRALVSQLQAEPQP
                     GEPGYKPPVTQTAPTSELVKKGVVKSPFKDVPERREEDDDDDVPEAAKPPIRAPMAAI
                     GRPKVVPKRAKTKQEEEEEQRQRTAQARSFAEARTGATQQQEQQPVATAAAPKAENRP
                     GSTLARRSILDTGNVPKFPGLPPYLQPLPEDTREQREKLRARIPVNRK"
     gene            complement(<618474..>618734)
                     /locus_tag="CYME_CMH240C"
                     /db_xref="GeneID:16993559"
     mRNA            complement(<618474..>618734)
                     /locus_tag="CYME_CMH240C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536119.1"
                     /db_xref="GeneID:16993559"
     CDS             complement(618474..618734)
                     /locus_tag="CYME_CMH240C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536176.1"
                     /db_xref="GeneID:16993559"
                     /translation="MCSLDGLTGRCRTGGRGVCQGTGAFDAAGAGCARCVETSQVPGS
                     CDWSGTLASRRFREMMTTKPIVCSLSAEVPMLRLVSYTPLTG"
     gene            <618942..>620621
                     /locus_tag="CYME_CMH241C"
                     /db_xref="GeneID:16993561"
     mRNA            <618942..>620621
                     /locus_tag="CYME_CMH241C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536120.1"
                     /db_xref="GeneID:16993561"
     CDS             618942..620621
                     /locus_tag="CYME_CMH241C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536177.1"
                     /db_xref="GeneID:16993561"
                     /translation="MEPWYASRGSSQVFHRLLVPWRDEHEWLEVCTDLVNSPATAIAS
                     TTWQQVHVWRARMALPPAIAVLVDATGSMEQLLQTCAAVAVEPGPPQCSRSQALQTQR
                     LAAALALSRAVSVLTDRVQQRHKYAQSVGNLAKTLGIPALLVEVRHATVHQTLPSVAA
                     LVEAYSAWTDFVRTRYIETRKRSIASFESNLRALARMWYSTRPVPHHGEQGPMQQVAA
                     PLLQAPGTADTDSTAAAFAEALLHPSAYVEVRWFAALVAQHMLEYARETSASDNALPS
                     RERLEAWFRYLCPLHETWPHFLPSLVCALVMALRTTAVETETATTDATGISGATHSPA
                     TPHATVVSASVWRPSAAVLLVGLLETLRARLSQATSLEPWVIDHDCHWLEWLLHTQFA
                     QENDVLRLYCERWIQQSRVGKRRQAPRERTSRTLKKTPALWHQTKRWRWRWCWWWQHS
                     LRYRAAVSWKTGPSPRWEPQFGPLYGAWRRCVSWPTCPLGTLPVGYDAAAVQRGTSLG
                     MCSADPATNTVFTAKENELAQRLVQRTLYLLDEYDQVEHQAGMSACADAST"
     gene            complement(<621050..>624328)
                     /locus_tag="CYME_CMH242C"
                     /db_xref="GeneID:16993562"
     mRNA            complement(<621050..>624328)
                     /locus_tag="CYME_CMH242C"
                     /product="oxysterol binding protein"
                     /transcript_id="XM_005536121.1"
                     /db_xref="GeneID:16993562"
     CDS             complement(621050..624328)
                     /locus_tag="CYME_CMH242C"
                     /codon_start=1
                     /product="oxysterol binding protein"
                     /protein_id="XP_005536178.1"
                     /db_xref="GeneID:16993562"
                     /translation="MERDPFLGQEQHALDANARERTLTKENLAQLTPVHRAAQSTLVP
                     APASNAVDDNKGLFVTSGGAPDAECGASRKSPKMDDEKAKRETCSVPGAEVASETDPG
                     TAVQPSTAQEASIEPTETTLVTEHAVPQSLLPAADKDEYKPASRRLKSTKTDRLPFRG
                     VPRMEGHLYKWTNYLKGWQRRLFVLENGVLSYYVERTAHAGAADEAHALSATSNAAAS
                     GNPNAPGVASLLSPRRLFGSWNAPESPEVERACKGRINLQLAVITRHDTELSRLIIDT
                     GTQIYHLRAESNDLCQQWLDALLRSKSYFERLARRAAARRLKAVGDTPGDANPSAGDH
                     PPSEHAHHSSRSEPGANGQPSKRSPTPGVVVAASRESAPGSRGELEADRTATDEDDDE
                     EDEDARLEREFGEEDEATLQARQAREELLAELVRFQGHVREAVTQLSPPDLLHVLVKG
                     LWNEEPSTESAGGTHDVVAVLSALLELLTWCIHVLQSDGALWRHRLVAERARALRAEA
                     EGAALQRQLDALLRELERIEWFSQASPEWETNDRSRSPSQHVASVADTDDGTGDTDEF
                     FDAGSGSVVSTPWSSPSTATATEATGVEAGISATSLTPGSSAIRPSWVPTSSESLAER
                     TWRVLERLRRASTEARRRSPNLCEANLLTQPPASADNQLQSSTSSAVTETSSSCASAV
                     VVPQNETFVTIPREPRRRLPISDSETPPKPSLWSILKDAVGKDLSRISIPVVFNEPIS
                     FLQRLVEDVEGAALLDRAAATVDPALRLLLVAAFAVSHYASTLGRTGKPFNPLLGETF
                     EFVTPEPSSIRVLCEQVSHHPPVSASYAVGRDKRWVYHTTCEVRNKFWGKSIEVFPYG
                     KCHVHIPEFDDHITYRKATTCVHNILVGKMWIDNYGEMVLVNHRNGYRCVVKLTKTGA
                     FWGSRDTYGSVSGRVFDADGRECPLRLAGSWLSALRVEFLQEPLGDQPRVLRAETVWT
                     RPVEPPPGASGPFHMTQFAIALNELTEELRVVLPPTDSRFRPDQRFLENADYSKATAE
                     KLRLEEKQRAARKAREQAGKPWKPLWFEPERDPQSGDIEWSFNGRYWSARQRYDWSQC
                     PDIF"
     misc_feature    622307..625690
                     /note="possible transcribed region"
     gene            complement(624776..626285)
                     /locus_tag="CYME_CMH244T"
                     /db_xref="GeneID:16993564"
     misc_RNA        complement(624776..626285)
                     /locus_tag="CYME_CMH244T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461310.1"
                     /db_xref="GeneID:16993564"
     gene            <626569..>629472
                     /locus_tag="CYME_CMH245C"
                     /db_xref="GeneID:16993565"
     mRNA            <626569..>629472
                     /locus_tag="CYME_CMH245C"
                     /product="DNA repair helicase rad25"
                     /transcript_id="XM_005536122.1"
                     /db_xref="GeneID:16993565"
     CDS             626569..629472
                     /locus_tag="CYME_CMH245C"
                     /codon_start=1
                     /product="DNA repair helicase rad25"
                     /protein_id="XP_005536179.1"
                     /db_xref="GeneID:16993565"
                     /translation="MDVGVESAAVRRSVRTRKRSLRAEEAALDEELLLEHLDDDIEDI
                     LRYGHDEDETENDLDYEAEFVTDEADGKAVQRRSRGKRRPSDADTDRSAVRDAAAERR
                     AAVLQAESDAAKTCFRVPTDLAEIAALEQAQLATGLGVDYARALHLKPDHVQRPIWVL
                     PNGRIFLEAFSPLYRQASDFLVAVAEPYSRPEWIHEYLLTPYSLYAAVSVGLETEAIQ
                     TVLERLSKTELPLSVVKLIDKCTRTYGKAKLVLHHNRYYVQSPYPEVLRFLLQDEQIA
                     RARVQPAEGAEEFGRIRSEALAAQADVLPWQNKPQHKEHEAEKTMAREQLIEQLERQL
                     EDDTANTNSNTSMSTTSTDDEADLRLPQRPTGTTGKHATSGGRAGPKFLLSSSSSQAP
                     PRDDEERALAAARELGLDATMFAEQTRFRDLLSFEVHPMEVDQVKRRCLELDYPLLEE
                     YDFRNDTVNPSIVIDLKPQTRIRPYQEKSLAKMFGNGRARSGVIVLPCGAGKTLVGVT
                     ACCTIKKTCLILCTSAVSVEQWRHQLLLWSTIDEQRITRFTAEQRPNVLGDITITTYT
                     MVAFGGRRSSESERLLQQIREREWGLMILDEVHVVPANMFRKVLGIVKAHSKLGLTAT
                     LVREDLLITDINFLIGPKLYEANWLDLQRQGYLATVQCAEVWCPMTAEFYREYLQRGS
                     AKRRLLYAMNPTKYRTCEFLMKFHEARGDKVIIFSDNIFALRYYATLLRRPFIYGPTS
                     QTERMRILTQFQRNPVCNTIMLSKVGDTSIDLPEANVIIQISGQYGSRRQEAQRLGRI
                     LRPKPRPDQNFNAFYYSLVSTDTSEVYFAAKRQQFLIDQGYAFKVIAHIPEMETSPST
                     GMPDKESELNALAAVLAAEDAEGADTSLADELQRRRLAQLANAPVPKARRVVHTSTQS
                     LTGAGNLLYGEFTHDDAVPAASVPPMLERRVVQHPLFRRRRRQQAAATKRAND"
     gene            complement(<630226..>634494)
                     /locus_tag="CYME_CMH246C"
                     /db_xref="GeneID:16993566"
     mRNA            complement(<630226..>634494)
                     /locus_tag="CYME_CMH246C"
                     /product="probable DNA repair protein SPR18"
                     /transcript_id="XM_005536123.1"
                     /db_xref="GeneID:16993566"
     CDS             complement(630226..634494)
                     /locus_tag="CYME_CMH246C"
                     /codon_start=1
                     /product="probable DNA repair protein SPR18"
                     /protein_id="XP_005536180.1"
                     /db_xref="GeneID:16993566"
                     /translation="MPRVKQQKRRESSLRRGIDAESPTAASDDPFAFCSDSESDHEPA
                     LVATSPSRKRTHIRKEPERHAAHKRVDVYYGSRADLTSAADSDRQATAKRKQRPTSAA
                     PETIQEGHKHGTARSGRSTAEHTSKTQVATGAECSQAEAQVSPRTRETRLNVRKRGNA
                     AKSSTRAQVPEEELEQFFRGASSTYGRSTVPAAATAEAAVVRVASRAQRDSSESPSKR
                     LSPESIPQCSRTASTRTLPPALNTFTGPESQRALTAASSSDDESDVHDEKAHSEASAL
                     PAALGRCSTAETLTGPDQVADTAGKVSPAPALRVATGLVTSSGPSRAAGSALHGSAAL
                     SQPGPADAATATTAMRPRLHRDKRHIQLDPAATVTESCHSGQETAGWRRGQLLRLRLH
                     HFLAFDEMEIRPGRTLNLVVGPNGSGKSSIVAGICIGLGGKLELLSRAPVLSSYIKHG
                     CERARIDVELFDPDASGTRRRISRSFSRDGRGGFTLDGESVSKRTIEELCAHYDIQLD
                     NICTFLPQERVPELVECTPTELLRQTIRAVFGSAALEAFEALAEQQANGAAWASRLAA
                     HEARLADWIRQNEALEAQLRFYEERQALLQEIEQMRLYRPYCIYEICRQEAIAARDAF
                     KTVDRVYRAKCADWERLCAPLRAMQQEWLQLQHERDAQKQVLSDLSVAARQQQADMNE
                     ALARFDEANDALARLAQDLAERKRNYEGCQHKVERLETELAALMQRTGTEAELEKRIE
                     EKRRERQQIAERLLSVSDAMRNLEQQHLAPLQSQFQELQNQRDRLRNIRQQRLALIQR
                     RNPHSQVIECYQFITAQREAGRFRGQVWGPLPLEVRTSDAFYSDVLETVLGGWLEVVF
                     VFEHPEDERIVFQESQRNHWRVNTIALVRPDVSLAPPAPVASVEPLGVRAFLSDCFEA
                     PENLKKALADAVPIHLIAVADAEAGRHVRELALKHRVYAVFTPQNGYRSRLSRYNAES
                     VSIRVEALQRRRAGLYAMPDERQVAQLDDQLAQLDAQRAHWRAQAAALAEQEKALRIQ
                     ERSLQQELASLLEDRKQLRHAQQRLTMQRSLMETIARDLQNTAKDDEKRKRWQRAASE
                     AAHHYAQLVIAGAEQLAQHQAAIAALVERTWLMLDKQRLLSAGERSLATAALEMQTLL
                     QQRDDARQRVDEAKSRMRQKRQEAEAVAPLTAALQQQLRAWQFPTSVEELDERIARAQ
                     ARADALTSVSAEVVQVYERRQQQIEALRQQLERERAQHATALRELHQESQRWLRDLRT
                     LVRSISLAFSRLLQQLHCAGQVDLLEDEELRRLALRIQVQFRANEPLRTLSAQHHSGG
                     EKMVATMLFLLAMQRHARPPIRVIDEINQGMDPHNERAIIQMMMEEAQVSDDASSQFP
                     QTLLVSPKLLLDLKYNQQLVMHCVWNGPHMRLQADGDSSESTSA"
     misc_feature    634123..634729
                     /note="possible transcribed region"
     gene            <639120..>642185
                     /locus_tag="CYME_CMH248C"
                     /db_xref="GeneID:16993568"
     mRNA            <639120..>642185
                     /locus_tag="CYME_CMH248C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536124.1"
                     /db_xref="GeneID:16993568"
     CDS             639120..642185
                     /locus_tag="CYME_CMH248C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536181.1"
                     /db_xref="GeneID:16993568"
                     /translation="MQSDDATELGKHASHQDRETHSPEDSATKARALGTAADPLERYR
                     ALLSDSRSSSSRPPELPLLQELYGDVHAALVDVCCTFLDRLARLLQDEAATSAALGTG
                     EALLQHNIALLTSVREARAVLLDPAQGSLWFPLRKAYAYRSRLAEAEKCYQIAVQAER
                     IARHLATQDVVHDLTSFGRTLASLHESLEELRRFPSLKAATEELFSLEERSWSQFQQA
                     WRKQLARWLAEMQHLPSTNLEETAVKSYNWPGIEVFFLRCQRQADFVEIVARLTAESI
                     EQRLRTNAAVARVEEALTTLATESAQPGRQLRLVWGPGALLADSMTATWILGGKEQLE
                     ALQTLATHVPSALEQYQEQLQTYSRLWQELLETSAPAAARAPAQSPTTDTDFKRGTSA
                     SVSSSPLDERQQAAASDASSAQQPDASISTRHAALVTMLFRMSLSRLWNEFTRLASLD
                     TFRSQQILEASTAPDGFALTPVAALASLTQTLYRSGTETLRCLWHTLVVTPTDTSTVS
                     TVRNALLEKELIRVYDLCLMPRLVVAMSAGHGLLAPQVLMEAPLHPEGTEDIPEVAAL
                     QSLASTGDAFAMHSPRTLEALCVEMRALCEQSAQQTCSERTQNMRKATRILKKMTGFS
                     VSLRLAFGRRLEQQWKEWLPQDCGLSLLGSLLPAMQDEVVRFQTWFTEAFCSMLHLVR
                     VQRAEPSTTVPSLSPGLTSNGSIAEERLSANDASDYSRAFQTVFEALHELLSWTLDVV
                     ASVAHQKDATRQVQETQRLAELVQLLEDQPLALQRVSESAVSASASPLAVLWALARDP
                     ALRDTYFADWNDTEHPVSRSVEQLARSVVPALVQARTLIRALGEALFAETLLRLEATL
                     RLPGVHPEPDYDTSLDLPALSEHPSEAMIAFGERLLALPSLLEPVLSNVRSVVHLRCL
                     TLPLSLPDDTAMQSNWEAHMQRIVGQVYRDSRDMERSPRGSGTSIELATAARSWLLCM
                     LTPLTERAFRALRGAETEPSLSQRSRQVSVDRTYLEQVLGRLGYFGNTR"
     gene            complement(<643006..>644559)
                     /locus_tag="CYME_CMH249C"
                     /db_xref="GeneID:16993569"
     mRNA            complement(<643006..>644559)
                     /locus_tag="CYME_CMH249C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536125.1"
                     /db_xref="GeneID:16993569"
     CDS             complement(643006..644559)
                     /locus_tag="CYME_CMH249C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536182.1"
                     /db_xref="GeneID:16993569"
                     /translation="MRTAKTALDTRCTQPAGVRWRSQLRFDVKLCDAHQCSKKTIPPS
                     TEAHAPLTVSGMGGCYSLLDGRHDTGQFEVIVPVDLFVYVPGRKYTRALEATAADTAL
                     SLRQRYVAADSAGASKATRVHVKRLTRSRVAKYLQALSKEDASAEENAKYAWTGLLAS
                     GDRFHKGDSGFEVVNVVYALALSTLMRAKRVASDPEGELTDSVFDPERIPDQDSKRRN
                     GSRKQSAPRKAPAWDTRRERVQQLLVEAAEELQALKEIRNEHYPNEEAVSALPVDLQD
                     AVIDALLLQCLGHAEMVAVVRGFRAKLPKATAGTLPQHEDLSGWAASAHAAMARFEEA
                     LTVLEDITPTDAHSRTEVDGERLQGWVEYLRFRLRTSTAWARMLQGMSLWSQDETEKQ
                     NRGAALAACHDGFETLEAARRHVHKTWCGRERTQRESVLTALTQLEMQFMRIYEPIAN
                     QNMNIYLVGRDDQPPALPTAQPMIPEPAAWLWSSAAEAEPSSEASLAPEASTEISVVE
                     GKHENQNSL"
     gene            <646938..>647981
                     /locus_tag="CYME_CMH250C"
                     /db_xref="GeneID:16993570"
     mRNA            <646938..>647981
                     /locus_tag="CYME_CMH250C"
                     /product="cytochrome-b5 reductase"
                     /transcript_id="XM_005536126.1"
                     /db_xref="GeneID:16993570"
     CDS             646938..647981
                     /locus_tag="CYME_CMH250C"
                     /codon_start=1
                     /product="cytochrome-b5 reductase"
                     /protein_id="XP_005536183.1"
                     /db_xref="GeneID:16993570"
                     /translation="MLRLGRMRSLASAAAAATAAAVLSLTTVDSGSNGSLGTPPAALR
                     FNALLRRAAGTWSAEAQSLDLRLGGGQLVLRPDAWTSWKLVRATAETPTTKRLVLEPI
                     ADPESGITVATSTPLEIPPISCVLFRATPGEPAGEPVVRPYNPISPRYTNGPLTFLVR
                     QYPDGRMSNLLHDMRPGDTIQLKGPFEQYRFVEKDHANQQIVFIAGGTGLTPCLQLIH
                     DLVERQREPEPEKRPSKLTLIFANNTEMEILLREELDEMAASSNGFLDIHYLVREAPL
                     VPGPQLMQGIVSRRYLEERLPPPEQNPLIFVCGPPGMMELVSGPKTKDKKQGQLAGIL
                     RDLGYTESHVWKL"
     gene            complement(<650861..>653182)
                     /locus_tag="CYME_CMH251C"
                     /db_xref="GeneID:16993571"
     mRNA            complement(<650861..>653182)
                     /locus_tag="CYME_CMH251C"
                     /product="similar to tRNA-pseudouridine synthase I"
                     /transcript_id="XM_005536127.1"
                     /db_xref="GeneID:16993571"
     CDS             complement(650861..653182)
                     /locus_tag="CYME_CMH251C"
                     /codon_start=1
                     /product="similar to tRNA-pseudouridine synthase I"
                     /protein_id="XP_005536184.1"
                     /db_xref="GeneID:16993571"
                     /translation="MPRLWTVCWSSWGVSDIGCLSRGRTLPWTRSATQLGSRTLRRDQ
                     QLGTSGCKPERLWYPLARPIRLTAHRWLSAMSESASSESTDNLKKRNIALWFGYAGTE
                     FRGSQVLEPRRRQPVATAANEAGSGDRAVDLRDGTVEGELAQALYRIGAVTELNFMKL
                     SKICWSRASRTDKGVHAVANVVSAKLLLDLRRDLTSNDELTDLFVDRLNAQLPPNIRV
                     FGGQRMSKGFRARSACTLREYDYLLPRWVLDGREDLFLQALRCFEGTHRFHNFSGKER
                     RIQGRGKQTSHDALAKVLNGDMDGADDDNDDDVDDEDGDDDEDEAIDCDRDDHHESRS
                     DGAEADASTRTWMNATAGEQCERDDDEKGRASLHRFRDDRAQGFFGTTSPAAHYRSGS
                     GASVQAAAAKRNRADLQGNEQEQSDADGSSHGPVPHHESESQNGHGNNASAQGEMEGT
                     MQARTTTRPPSRFQQELDIAKQVIQEIHPDKERAPIEHDDARCVQLEAREPFRRMVQV
                     AYPVAHLDRLRRPYYLRTLYRFHVEPFLSRDDHGCDFLLVRVRGQSFVLHQIRRLIGA
                     GILVARGHLSLEALEAALEGPYRVVFWRAPGSCLMLYQPSFWDPRRRLFRLVPSPRIK
                     ARMQRFRQETLIPQVCAIGQLEWKAFLDPAQGAKVVYCHQEQLVEQYRLWRERVTAAA
                     EERRHQSMPTDPQKAHRAGSTVELPRGIQTTMAIHFNLLPGPELARLRQELQAAAENG
                     KLPRQPSTVECLAYCERLYTDRAVDIQGVACVE"
     gene            <657381..>659702
                     /locus_tag="CYME_CMH252C"
                     /db_xref="GeneID:16993572"
     mRNA            <657381..>659702
                     /locus_tag="CYME_CMH252C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536128.1"
                     /db_xref="GeneID:16993572"
     CDS             657381..659702
                     /locus_tag="CYME_CMH252C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536185.1"
                     /db_xref="GeneID:16993572"
                     /translation="MFYATSLIKRRSSFAKVWIAATLGTERLPRSFLIRVSIARICRE
                     LLETIHINALSLRLEALLLVGIARIYERQVLLFCTLAEDWFSRERLQARVCILSTDGR
                     QHDDSAAAGAEVASDASVATDANAADADQFAARNSRDTRYLLHRIGASRRKQLCARYG
                     SITWGPDSRSLEPVPQQTNAPHTSGEYFAHVDVLWHLYDSELYGRHERAALLAAPQHG
                     LVATAAAAMQPYELAASVPEAATEPSGSVERAWPLSPTPFRVNDQDTITLRQPRIEFS
                     SGSLSIIPQLDERERFPEDRDASGDSSIAPRRLLEALDAAALALIPDDTSAQTNMAPL
                     PNHGNETTTGHAQDAPQRLVPNSVPTKEQQERLGSQRSLRRRNALSSVACLQLDELDA
                     LALPPRRLQMNMHHTRDLVLACQQSNRSTNSATAAQGPYHQSPGTEAGSAPTQLQRLT
                     QSLDENTYVSNLLATKDFVYRCLSQGIFAVAVARTSRLRAIFEAVLRPHFEAQPQRPA
                     TDPKDMHGMPHAGEERHPPPESEDNAQLRASLPQSASFSGSAPERLRGYATADGFEVP
                     SLDTDTPGAYAVALRAASSEHSASLPRMTVPDLRLSGVPAARSPLDSGDQCSPGLAMS
                     RIHTELMPVMENAGQGTSHASIVSIEGDRRPTVTPQSYRETLIRCIERQRAGDASSPG
                     SCRWVNFSALLGAFVSAFDAKNDTPSAQSTENQTKPYPAAWSRPCAALLFATTLKLAT
                     TGQVTAHQTTPYGSIALHWNGDKDPGTAPIAAS"
     gene            complement(657383..660120)
                     /locus_tag="CYME_CMH253T"
                     /db_xref="GeneID:16993573"
     misc_RNA        complement(657383..660120)
                     /locus_tag="CYME_CMH253T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461311.1"
                     /db_xref="GeneID:16993573"
     gene            complement(<660958..>661449)
                     /locus_tag="CYME_CMH254C"
                     /db_xref="GeneID:16993574"
     mRNA            complement(<660958..>661449)
                     /locus_tag="CYME_CMH254C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536129.1"
                     /db_xref="GeneID:16993574"
     CDS             complement(660958..661449)
                     /locus_tag="CYME_CMH254C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536186.1"
                     /db_xref="GeneID:16993574"
                     /translation="MNSAAVFTQGALSAAHWNTAALVLGAGVALAGDLQLRGRYAPAQ
                     GFAIKLPKLGFPKLPGKLPSLPSLPKVSLGSGKAAKSGGSAASAAAKTGSRTPARGAA
                     APGVRVRPATTQSNLPSGPTFVDPTQARVMDQGKGWKAFPGRRLPGKNMEQFLDMARS
                     LRS"
     gene            <662046..>663137
                     /locus_tag="CYME_CMH255C"
                     /db_xref="GeneID:16993575"
     mRNA            <662046..>663137
                     /locus_tag="CYME_CMH255C"
                     /product="probable inositol monophosphatase inositol
                     monophosphatase"
                     /transcript_id="XM_005536130.1"
                     /db_xref="GeneID:16993575"
     CDS             662046..663137
                     /locus_tag="CYME_CMH255C"
                     /codon_start=1
                     /product="probable inositol monophosphatase inositol
                     monophosphatase"
                     /protein_id="XP_005536187.1"
                     /db_xref="GeneID:16993575"
                     /translation="MGITEQLDETVSKTETSGVLPSVSAVAELVAGWFGFDEVQDQDL
                     YSETIAAAVAVVAGGLILKAAWNQLHCPQALYADSSSAPAGSKSQVLVATKTSSADIV
                     TSVDRQIESEIRRILVPAFPGYAFIGEESAYVSSTVTMNAAKTGAPAWMVDPLDGTTN
                     FVSGVPHICTSVALLRERHVVLGAVYNPLTDDLWVAVRNRGAFLNGRRLYCQRHVPLS
                     DAVVVTEFGYERSAEGARRMCAVVERLLCERVRAIRMLGSGILDLLFTAQGVVHVVYA
                     GIAGEGWQPWDYAAGVLIAKEAGCVVASLESPPGMTCDGEFLSRCAHDFDIFGQSILC
                     ASSRDLALEVHHVIREACDRVSEKHPADA"
     gene            complement(<664291..>665832)
                     /locus_tag="CYME_CMH256C"
                     /db_xref="GeneID:16993576"
     mRNA            complement(<664291..>665832)
                     /locus_tag="CYME_CMH256C"
                     /product="squalene monooxygenase"
                     /transcript_id="XM_005536131.1"
                     /db_xref="GeneID:16993576"
     CDS             complement(664291..665832)
                     /locus_tag="CYME_CMH256C"
                     /codon_start=1
                     /product="squalene monooxygenase"
                     /protein_id="XP_005536188.1"
                     /db_xref="GeneID:16993576"
                     /translation="MTDTQIPRNEHDVIIVGAGVAGAALATVLARDGRRVLAIERDLR
                     EPDRIVGELLQPGGCAKLRDLGLEAALEGIDAQQVFGYGLFLEGRRSCIEYNEACREP
                     KNAKAAEQPLLLGRSFHNGRFVRRLRELAQAEPNCELVEGVVTELLFDARPGQRPPRV
                     VGVVYRAGTSSTEQRVAYAALTIACDGCASRLRKQALPSAQHQVPSNFVGLILTECSL
                     PFPGHGHVVLTDRAPVLFYPISSSEVRCLVDVPGGKLPLDANGRQMDLRTYMEQVIGP
                     QIPEPLQHPFLTAVAKEDFRSMPNRVMPARPLALKGAILLGDSFNMRHPLTGGGMTVA
                     LSDVALIRRFLRLIPDLHDDEALRFHLELFYRNRRPLSATINILANALYGILCGSPER
                     ARKDMRHAFLDYLQLGGRCAADPIRMLGGLEPSPSLLVAHFFAVAVFGCGRVLLPVPT
                     PARLAKAWDLFCTAFNIAKPLIDGEGVTPLAYIPVSRIPAGSGWLICTVFVTLAIFIG
                     YTWIR"
     misc_feature    667038..668550
                     /note="possible transcribed region"
     gene            complement(<668113..>669114)
                     /locus_tag="CYME_CMH258C"
                     /db_xref="GeneID:16993578"
     mRNA            complement(<668113..>669114)
                     /locus_tag="CYME_CMH258C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536132.1"
                     /db_xref="GeneID:16993578"
     CDS             complement(668113..669114)
                     /locus_tag="CYME_CMH258C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536189.1"
                     /db_xref="GeneID:16993578"
                     /translation="MWCTTWAVKRRHGCTSAARTPWCSPWGLERAESLCPRAGDGALQ
                     SGLARATYCRRRCQVRACAAQLENAVAQSLSGSSTVDLILIAFGDESAEQLRDEPQSR
                     INLPALPGATAQRIGKCPQGVACVATMQALAPSEAVLAALRQHLATTESGLYGSASSY
                     AIEEPWVRRVQLRISEHHDGYLDEALDALIYYMKCRSFFQTVDALTDVLRSVASQMAR
                     GGDVTILSREPDVVRSLGALLFARTELIKQQSAVYRSGWMSDRGRSRGSTFEQLDAQV
                     FHARERLAYLEPDLATLRDGLVLMNSQIEFRINSRIERMILLLLAVEVVFAIWDAFF"
     gene            669331..672452
                     /locus_tag="CYME_CMH259T"
                     /db_xref="GeneID:16993579"
     misc_RNA        669331..672452
                     /locus_tag="CYME_CMH259T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461312.1"
                     /db_xref="GeneID:16993579"
     gene            complement(<670974..>672074)
                     /locus_tag="CYME_CMH260C"
                     /db_xref="GeneID:16993580"
     mRNA            complement(<670974..>672074)
                     /locus_tag="CYME_CMH260C"
                     /product="WD-repeat protein"
                     /transcript_id="XM_005536133.1"
                     /db_xref="GeneID:16993580"
     CDS             complement(670974..672074)
                     /locus_tag="CYME_CMH260C"
                     /codon_start=1
                     /product="WD-repeat protein"
                     /protein_id="XP_005536190.1"
                     /db_xref="GeneID:16993580"
                     /translation="MSKKVILATGGYDHTVRFWEAASGVCFRTIQFPESHINRLVFSP
                     DKVFLAVAANPRIVVFDALNNVASPVIGLEGHRGNVVSVGYEAFGSWLYSGSEDGTIC
                     TWDPRSGKRSHVFCNRAGVTAVCLHPSQRELISADCQGTVRTWDLIANRLNRELKPQD
                     DVPISTMALAADGSLLSVCNHEGACYVWRVCQAGTGTGEADAEFYELERLRDASPIPL
                     TRSDSDLTEMQHWNRSPSRQRVVQRPGTPATEPVDFQPSTTWSAHTRYVLQSSFSPNG
                     KMLAMALDSGFIRLWGVQRSVGATWQQTQVLGRHQKWAWDLVFSDNSEFLFSCSSDRR
                     ACLWDLSSGSVIRTYEGHKLAVTALAVSVTTL"
     gene            complement(<675221..>676594)
                     /locus_tag="CYME_CMH261C"
                     /db_xref="GeneID:16993581"
     mRNA            complement(<675221..>676594)
                     /locus_tag="CYME_CMH261C"
                     /product="similar to ribose methyltransferase"
                     /transcript_id="XM_005536134.1"
                     /db_xref="GeneID:16993581"
     CDS             complement(675221..676594)
                     /locus_tag="CYME_CMH261C"
                     /codon_start=1
                     /product="similar to ribose methyltransferase"
                     /protein_id="XP_005536191.1"
                     /db_xref="GeneID:16993581"
                     /translation="MERNFCAQPEFDWRDKFRKMPSEHCVSLDQRMDPAVAWIAGLHR
                     WTPAVLASRFGGIGAGLGRRLRARSVYRVRWYAAASESEPRPQVPKQRSGKRAPFPRS
                     ADRAPSFPKPETELTERQWRRGPGARPPRQRDVLSPLQEKLQSGHDFLYGLAPVFAAL
                     SARRRAHFYELFLLDRLAVSVEHQEQQYPVPRRETKKAVEEQILLAANQQGVKIQRVD
                     KGTLNTLCGNRPHQGFVLECSALEPVPMVSPEAFEPRPRVYSPTNENHEPRHPCWLAL
                     DEVWDPQNLGALLRSAYFFGCDGVMVSRKNSAGLTATVSKASSGAMEFMQVHAVSNMP
                     RFLEQAHRVHGWRVLGTALPTSGMILQTREHLSDGGGAPRHAQASRPVTPCAELALHT
                     PTILVLGNEGHGLRTNVERACTAFAFIERGLVAAEDAALAAVDSLNVSVAGAILLHRL
                     LHDRGMR"
     gene            <677032..>682347
                     /locus_tag="CYME_CMH262C"
                     /db_xref="GeneID:16993582"
     mRNA            <677032..>682347
                     /locus_tag="CYME_CMH262C"
                     /product="TATA-box binding protein-associated factor 1"
                     /transcript_id="XM_005536135.1"
                     /db_xref="GeneID:16993582"
     CDS             677032..682347
                     /locus_tag="CYME_CMH262C"
                     /codon_start=1
                     /product="TATA-box binding protein-associated factor 1"
                     /protein_id="XP_005536192.1"
                     /db_xref="GeneID:16993582"
                     /translation="MSSDNGAVPRGDSSEFQDANWPADAAPALSGFLFGNVDAEGRLE
                     ADYLDADAKASLHVIAPMVLPDDAEVFTVATARASKNFNDGHELGADPRASSALGRGV
                     SQVLTSAPLNGDTGLVHAASAAPETEQDRVRPLRSTPSLVQDRSASPENLDFYDASDL
                     SEDLDTSFDSPGFMKPSSSAPQRTLEVVVGASEGALPSAESSEHQHRHGDENAYSLHE
                     QAAREALLSTDYDALSEGDDETGDSKLKVAEPARLGPGTSSAGSERALLSAERAPLQP
                     QPAAKASSPQQNLCSDTDIPRFTRFLVPEELVHPFHATKRKRIRWQSKSTQADDPSER
                     LVGEELLFQRPEDLRWIRFPYAYLILDDMQEVQELLRKTIHRRVLAGRAGESKANTRR
                     CTPLVAEAVTEIASSREGTPATPAHQAVEAPVADAHRSNGRLAAGERTRAAAPCARPH
                     TTSADDTCAAFLWQQWQWEQDVCWEETNKSTTLRYLPASERLEHDAQRNEALVNGAWT
                     QLVAWEGPAPVWQRWRHQLGKKTTSVLELDEHAIAISRRFSWLHLDENDPQLILCRAA
                     NRLLTQSAPNLYLPQQLGQIESLLMNASNDRFYGIEMTGQRRRSARTEALANLRHALK
                     ARQGYTSAWCYGYTEPQSYYRPNILPILWQLCGQRAVPLLLFAAKSAPSMLPHEMRAW
                     VPKSWSDLSGISPKAGGDIYLFEYPLEADPFLVQLPGMASRLLTYSRRAADDTVSNPS
                     EDPDTVYLAADDLPPLHTGDVRPGQVLRVYENNAFAAPFEPVSPPQTDFLVVCSAQRG
                     LYVRPIKQVLAIGRLEPRNRPKVMIPNSDRMKRFVKNKIELDVTRELIRRGDTGVERS
                     EVIQMFPRRRVYPETTIASVLRETCDNARNRYVIKKNYVETVWPKRELELLRFVTPEE
                     TCAFESMEIGWEQLSAKGITIFSSPSMQGNIVGGAEKAGLGARGIEIARYIREELAKT
                     RWVRTEVLVRAQKSLQFALRSVLSAASLAMDILRGNPAADDRLKTMSRDDALRFLKVQ
                     FSCNLNPSQRAAIDVAETRAATVRQIALERARQRPLVPLAVQVQRLIDEHVQTVRALS
                     LEHQLVLLREGYPRSATGRPSGSGLNNNIGRKALQRMENSRATNMPKPADDWEERQEL
                     SRLLASQRRSVPAPMDSGLSVSGSDRRSEASSAPVQYVRKRRLKIIRRINGQVQVLYL
                     EDPQEIEAYLQHRRMREEALRTGIGGGIGFAARSMTQSRKAGKKGTAEERLRERLEEL
                     AEAARRINAWMLGPTTALGAAKPATTMTTTTGAAGAATSASNGASTAQSSHAIAEALS
                     GAVHTIRESIRISGASTNQAVGTLGDTGRLQQRPAAPPATSMRAETGAASMQHHQAGL
                     WLDASASNSTDVSWLRVTLPNQQQQQQQQQQPAGTPPVASFRSVAERDGEASLLEPSQ
                     AGFPAAHRKPDTIESGQHGDQIPSVEHSDQQGAFAWLAPDRANALTSDLSQSSSRNAS
                     PKPSSLVTNGAGAPSRLKLRIPAALATEAPGLSQGAQLHGTAESTSGVPAPALTSEAP
                     PSSGVPRIFIWAPKDEPEGSLSASTRTSSGFEASTALAKDTTLWVEQGSSPRPGPRVR
                     VSKRSSGKVHLNNILREVETCVRDAEGVVVATTPYISVVRVRPGEALPPGGLDRPAKL
                     AVAGNIDFINPVRDAAYRKKIPLPKQMYLQRIRRKCEEVAYNSVDEFLSDMRQIVENA
                     RQYHTAPEAHWVVQHAEYLHEAAEEELKKRQQDIDEAIQRDAQAP"
     gene            complement(<684238..>684954)
                     /locus_tag="CYME_CMH263C"
                     /db_xref="GeneID:16993583"
     mRNA            complement(<684238..>684954)
                     /locus_tag="CYME_CMH263C"
                     /product="cyclophilin-type peptidyl-prolyl cis-trans
                     isomerase"
                     /transcript_id="XM_005536136.1"
                     /db_xref="GeneID:16993583"
     CDS             complement(684238..684954)
                     /locus_tag="CYME_CMH263C"
                     /codon_start=1
                     /product="cyclophilin-type peptidyl-prolyl cis-trans
                     isomerase"
                     /protein_id="XP_005536193.1"
                     /db_xref="GeneID:16993583"
                     /translation="MKAGTSLFKLFLLGTLVALVCCTRFLPSGRCVLAAGAGAERPRN
                     PSSKWERITHYAYLDMAIDSERIGRVTIGLFGDTTPRTVQNFLRLARNQGVGDGKGKG
                     TGFRQSHSHRIIPKFMIQMGDITAGDGTGGICADGRPRLPDENFLVRHRGRGYVSMAN
                     AGPHTGSSQFFITFQETPWLDGHHVVFGKIVGAESERVLAQLEAVGSASGTPKRLVTI
                     VDSGELSPDGVQSDDVHGEL"
     gene            complement(<685656..>688466)
                     /locus_tag="CYME_CMH264C"
                     /db_xref="GeneID:16993584"
     mRNA            complement(<685656..>688466)
                     /locus_tag="CYME_CMH264C"
                     /product="DNA replication licensing factor MCM3"
                     /transcript_id="XM_005536137.1"
                     /db_xref="GeneID:16993584"
     CDS             complement(685656..688466)
                     /locus_tag="CYME_CMH264C"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM3"
                     /protein_id="XP_005536194.1"
                     /db_xref="GeneID:16993584"
                     /translation="METAFQSLFTAPDQDQDFRSKIRDLFESEAPVWEPLQQQLEALR
                     RGRQRRLIVSLDLLRREEPTIAKLLFENPLRFLPIFEEVLTDYIAQWNTALAAAGAAG
                     RERQRLHVGFEGAFGALHATPRSLRASMLNSMVCVDGIITRVSAVRPKVVESVHFIPA
                     KNEIVHRVYRDGISLDVAQNRGLGAAIYPTRDEDGNPMETEFGLSAYRDFQTATLQEM
                     PERTPPGQLPRTVDIVFEADLVDVCKPGMRVRIIGTYRALGGKTTTYFATKIVANHCI
                     PLSDTQHRLKFSERDLANIREVASTPGGIELLTASIAPSICGHYFIKKAVLLQLVGGA
                     EKNLSNGTHLRGDINILLVGDPSTAKSQMLRFVLHVAPSAISTTGRGSSGVGLTAAVT
                     TDPDTGERHLEAGAMVLADRGVVCIDEFDKMSDADRVAIHEVMEQQTVTIAKAGIHTT
                     LNARCSVLAAANPIYGSYDRRRKPAENIALPDSLLSRFDLVFIVLDTISRERDELIAR
                     HVLRVHQYRNPDRAGRAELAGYAGADVDTPLDERATPENNAPPAEATTVESTDDQGFE
                     SDAAAAAGAARASDDPMTAPLFVSHQANEAIQGAAAHRILSVPFLQKYIHYARELSPQ
                     LTEEAAAYIASRYRDLRAKDDARTLPITARQLETMIRLATAHAKLRLSLTVDITDARA
                     AFDLLNFALYHETQIDREHDVARAAPVRSPDANTSPVSASAAAPLPQRSGTRRRTAPA
                     SRRLDPFAFDDDDDNNGDGDDGDESEAASNASASDEPSYSPGRRQAASRSSRASQQRI
                     RRRVRSGAALGSSVTPQASDIAAHSTLSPQAGGISSGPETRPVTENLAALRVTGERVT
                     PPNQQADAMTVPLVDDALLERVQQAIEAITSAERSESTSFDQLVEQLADPTIEREQVE
                     RALQALEAMGLIMYRSNLIFRI"
     gene            <691408..>692160
                     /locus_tag="CYME_CMH265C"
                     /db_xref="GeneID:16993585"
     mRNA            <691408..>692160
                     /locus_tag="CYME_CMH265C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536138.1"
                     /db_xref="GeneID:16993585"
     CDS             691408..692160
                     /locus_tag="CYME_CMH265C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536195.1"
                     /db_xref="GeneID:16993585"
                     /translation="MEAQVRLLQLKEQRLRLYRVFATEPYAESVRKRSAARVWQDPGL
                     QLRLARSVAQGWLAAPDCSCERCMAIFENEQDAKQRLARQGSTALDRLDVRRVRKALV
                     HELAYCPLLANSWRREGAPTWSLEQRETLCRGPDKRARESASTRRNESTSAGDTRSPS
                     LSGSESTTSMAVDAEIEDGGQEQFPGREPPWAVQLMELQQVWEVATTPVPLHEAFAAA
                     TPSRDTLHVPDSDADDSEDHQNPVNQDESPSR"
     gene            complement(<692722..>694914)
                     /locus_tag="CYME_CMH266C"
                     /db_xref="GeneID:16993586"
     mRNA            complement(<692722..>694914)
                     /locus_tag="CYME_CMH266C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536139.1"
                     /db_xref="GeneID:16993586"
     CDS             complement(692722..694914)
                     /locus_tag="CYME_CMH266C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536196.1"
                     /db_xref="GeneID:16993586"
                     /translation="MNGHCAAPEAVACSSVDCVNGVVYDYTSDNRILADHEDKEKAVA
                     QVRCMPEFVSVLQFLVALQGFINEEIRTYFRAGRPKKPTDALVPQIDPGRLEADIVHG
                     LRERPPADDAHASTTAQSSTATSHQEGTSQELLLSRVHAGLLNCLHVRKVDAIHAYGK
                     DGWIELLAAELRTRPELYDLSGPAAGSDPGCSLYDQDGASILDRCRYEMLHPRMRVVI
                     LLALCEVVSETNESLRRVIWEMAKQEQECSQRLGQPTRRHRRARKQQEQRQAPFHTRR
                     STTAAAGRSRTDGCISKAKALRTGFDSTRKPSVSDWEAAMDDSKSVKAPSCDQVYRRG
                     DGATRIDAFGEDDYGWRYWVPGGLRAAAACGCFRIYRLRYGGGVSEAHSNGSASLTGE
                     RLDGGAAAQCSVPPQIEVVVRDYADRVQAMERLFQELGGDAMSSRNRRLWSCIQDSVI
                     AELEHGYLAAVRREVRISKQAARESCLDQEAAITTSATEMPHRSARTGRRQRPTYNED
                     ELFDAAFAQMTDSSAEGACSSTFDSASFESDTSWSETNASSLCSDSDSDADGELGAGA
                     RLPDLHESVSLSSDDRNRNRFNLNRQRRLVCLEHGTSSATGHQQLFRNNSNNTSSGSG
                     SCDRLGHSWDARDDDDDDDDDDDIRTPTSDMNAENAGALLRHGRAAETAWAKASSGQV
                     SERREAVRKHDAAIPSFVTELVPASGAGTPDAACWNAYADPIDNFSPD"
     misc_feature    693382..695019
                     /note="possible transcribed region"
     gene            <697935..>698591
                     /locus_tag="CYME_CMH268C"
                     /db_xref="GeneID:16993589"
     mRNA            <697935..>698591
                     /locus_tag="CYME_CMH268C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536140.1"
                     /db_xref="GeneID:16993589"
     CDS             697935..698591
                     /locus_tag="CYME_CMH268C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536197.1"
                     /db_xref="GeneID:16993589"
                     /translation="MFVFGAYWFDCGERAVLPANSRGALRPQCTRLRFWRGRYWHRGA
                     VSALRRVRPLSASTPSPRVLDGSQSLADTPDNVQQLLQHMSQELDSVVQSMVHLEEYA
                     LEQVEKLKGAMEADLRKLALYEEEQAFAQKLTEQLQKKEGAVFEAMRHFLFHVVGLQE
                     QTVAITNELQVLHEFVSENHERVELVLESLRERGLFGSRQDVFEGEVKKKLDRFDPEI
                     "
     misc_feature    complement(699074..701589)
                     /note="possible transcribed region"
     gene            <700081..>702144
                     /locus_tag="CYME_CMH270C"
                     /db_xref="GeneID:16993590"
     mRNA            <700081..>702144
                     /locus_tag="CYME_CMH270C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536141.1"
                     /db_xref="GeneID:16993590"
     CDS             700081..702144
                     /locus_tag="CYME_CMH270C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536198.1"
                     /db_xref="GeneID:16993590"
                     /translation="MAEEPATPADTELRDSQGADTSQEGSWSPHEYLIEQPLHVKQHQ
                     GDEASVAADSALPTAETAMCTAPALMEYEGDRQSKRARASELDWPPALPQGKDEASAT
                     AHKTNSEHRGSESPDDVEKSSTPGRTDTELDRNSTLVSNADHAREPLERRPGGDYDER
                     DACATTAMTTGAAPQDPGDECNGDSDAASTVDTELLFETPLAILKKFLDGHWVDAGRG
                     PVRILRLRRCSESSGNTETFLRMDSGLRPVLYLRLEHETARTARWEKVRERSIRFLCP
                     VSGQGPVMCVLQLRNAATADKLLALIEQVAFAAAEKAPVASYTERSTGVQYSSSFTEL
                     WTRFQADTVPVLEQYRAKALDDDETATAPRVVRLEQLIDASRKTLELQDAAQERLLQL
                     LEEARETCTRTERELQTVHQRLCRRIAAVEPQLSKLRSSLGPVDSPAPLTSDPAKALS
                     NNDLMITSVETRAAEASAYADPADFLGFCARLCSFRPSCFKQMRLEEKGAQGTGYPLV
                     IELALGGWTYLLSGALHCGRCGATSAVSELVNESESSTQGCRHQPGCRWLSERSPTTF
                     ASFRADSSTSRTEACWALHLADAVRYLRDALERSASPNASVTERVAFRKLASHGWVCQ
                     TRQERLLFSCMFCGTPRFMAQGEIERSLDSTAAAGHHRRYCAFADTTVAVDIEQQLRN
                     GTSAA"
     gene            <703370..>705190
                     /locus_tag="CYME_CMH271C"
                     /db_xref="GeneID:16993591"
     mRNA            <703370..>705190
                     /locus_tag="CYME_CMH271C"
                     /product="threonine dehydratase, biosynthetic"
                     /transcript_id="XM_005536142.1"
                     /db_xref="GeneID:16993591"
     CDS             703370..705190
                     /locus_tag="CYME_CMH271C"
                     /codon_start=1
                     /product="threonine dehydratase, biosynthetic"
                     /protein_id="XP_005536199.1"
                     /db_xref="GeneID:16993591"
                     /translation="MFITAHCFRHCIQGVGSTSWHTRDCPRGRSKRCRPVCASRALPA
                     LRATQDRTETAAKLTVASNGDAPVYCYIASSPFKNDYLERVLNARVYEAAVETPLDNA
                     PLLSRRLGRRVLLKREDLQPVFSFKIRGAYNMIALTDMSQYEGGVVAASAGNHAQGVA
                     LSAQLLGLRATIVMPCTTPSIKVNAVHQRGAEAVLHGDTFDDAQAHALALAAERGALF
                     VPPFDHPDIIAGQGTIALEILRKHPGPIEAIFVPVGGGGLIAGIAVVVKRLRPEIRII
                     GVEPFDADAMYQSLQASQRVRLAQVGVFADGVAVKEVGTETFRLCRDLVDEVIRVEND
                     EICAAIKDMFEDTRSILEPAGALAIAGLKRYAQRNMDTSTSTSNSTSSSSSSSNSSSS
                     GTLIAIASGANTNFDRLRHVSERAEIGEHREAVLAVRIPERPGAFRAMMNALGPGANI
                     TEFNYRYASPEVAHVFVGLSVSDRRGAAAAISKLAAQGFVATDLTDNEMAKLHLRHCV
                     GGMGGPHFAPAHEIVYRFEFPERPGALARFLNGLRGWNITLFHYRNHGSDVGRVLVGL
                     QVPPLERSTFLEFVERLGYAYVDETQNIAYRMFLRLGDTP"
     misc_feature    complement(705232..706890)
                     /note="possible transcribed region"
     gene            <706531..>707988
                     /locus_tag="CYME_CMH273C"
                     /db_xref="GeneID:16993593"
     mRNA            <706531..>707988
                     /locus_tag="CYME_CMH273C"
                     /product="similar to nuclear import protein NPL4"
                     /transcript_id="XM_005536143.1"
                     /db_xref="GeneID:16993593"
     CDS             706531..707988
                     /locus_tag="CYME_CMH273C"
                     /codon_start=1
                     /product="similar to nuclear import protein NPL4"
                     /protein_id="XP_005536200.1"
                     /db_xref="GeneID:16993593"
                     /translation="MLVRVRKEDGTVVRFTVEPQTTVGELKREILRLGHSNRVDLELL
                     KDPSLTDSRLQDETASLEACGVTHGDLLVIERDLQKPPNGESVSAPPSGARSPAPNAT
                     AQGGCQNSTEPTATPQYLVSYAPSGLFTESEYERACEAYSRLMDERRKRKQHEFMERR
                     GLGGLKGMTVDYLEWLDAQHFRLRSQDESPCSQCSIDRQAADAFQSYLLRIHDSQMRY
                     GILYGDVVASEGLVKVEAIFEPPQAGDADRYLPLPESEVAIREADTLAHYLGMRRVGW
                     IFTHRAEDRSHALHARDVAYAAKLQLETTAYHLAEQERDQTPEASFDWSRYFVTIAVS
                     IQPDGRRHFEAYQLSDQCLLMAQAGILMPVSDSGELHTLDEVVVEGNRVRRVDTDFFL
                     VLVPIRDHQGWLRTAFPIENREVEPQSITDVQRVLESGYGKFTERIADFHLLLFLSRI
                     LGMESDMPLLANAIVERRDLEPAELGYQLLIESLR"
     gene            complement(<708396..>710573)
                     /locus_tag="CYME_CMH274C"
                     /db_xref="GeneID:16993594"
     mRNA            complement(<708396..>710573)
                     /locus_tag="CYME_CMH274C"
                     /product="probable DNA photolyase"
                     /transcript_id="XM_005536144.1"
                     /db_xref="GeneID:16993594"
     CDS             complement(708396..710573)
                     /locus_tag="CYME_CMH274C"
                     /codon_start=1
                     /product="probable DNA photolyase"
                     /protein_id="XP_005536201.1"
                     /db_xref="GeneID:16993594"
                     /translation="MHHCVTVNGSSLLFCEVIPRSTYGWCPGERYCSDSQGFTAQRDL
                     VDARPRSYNGRRTPSRYRALLRMRKAKRRPVESSNRATDSPDTLFSKIDAQKTAVKRS
                     SSSAATIVWLRGRGDLRIHDNPLLLQAQRLNEPLFIMFTWSSADADKNYGFGEAQRVF
                     LFSAVDALNRALNMRFQQVIHYVRLSDDAGLEEYLQLFHFLEASLSARTLLMARRYEP
                     PLLQLDMELECTLTKQRKWKVYTHNMHLLHEPWTVAYDGDATSSAGHFGTLLPFWQAW
                     QRNADLPPEPAAAPSTLPPAAALERCEPRTPACCEKPPPLAGDAFVDRTTRCAPFQFV
                     TSLVETGLHPVRPGTKRWDTVLLGSWAVDEERVRAFLRDFLEHRLPLYEKNKSRADLE
                     VVSRLSPYLALGMLSAREVFHATRAASRRLAASKRSKTFERRLIWRDLAYWTLYMFPE
                     AVTTPIRSHYASQEWNEDPRLLAAWQRGSTGYPIIDAGMRQLWQTGWMPQNIRMAAAS
                     FLVEYLNIHWIHGLQWFHRTLIDLDIAINAMMWQNAGRTGLDMWNFVIHPETSARSSD
                     PTGAYVRKWLPELAQLPNAYIHAPWKAPESVLSSAGVQLGATYPQRIIADLGAARKQS
                     QAAVLEMRSRSMPQFFNADGYDRIRVPVLKAVSLPHERFQQTATADNTVWRHVFTRRE
                     FREAPFATHLPHETEACDRQEAQLLPKDSTRAMQGKSDAQAAA"
     gene            complement(<713364..>714380)
                     /locus_tag="CYME_CMH275C"
                     /db_xref="GeneID:16993595"
     mRNA            complement(<713364..>714380)
                     /locus_tag="CYME_CMH275C"
                     /product="mitochondrial ribosomal protein L46"
                     /transcript_id="XM_005536145.1"
                     /db_xref="GeneID:16993595"
     CDS             complement(713364..714380)
                     /locus_tag="CYME_CMH275C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L46"
                     /protein_id="XP_005536202.1"
                     /db_xref="GeneID:16993595"
                     /translation="MAASLLHTWKRYLCSSCLNQALAASRRCLRLARYQLPPNGFPRR
                     GSASKAGASKPSTEPQRLPYRYAVATILERTPIIMPEPTPEERAFLKFQLLMANAQAR
                     ELSPEVMQRLFGESGDTIPDKHPFLNSKVFELDDSEYVPAPRETEADRTNDRRSLRRK
                     LDQWLFLIVQRKLGPTGRSLWQFPQRFIEEERLMQSSNDPMPLRAGTDAAAASAEALG
                     TSGGAETRCSKTFFFRGEAEKALQSLIETGGTDGDDENDFEAHFIGNAPCAHLKHIYS
                     PALQEAQGISGIKIFFYRAQLISGCITGVRAPAAVDYAWVTAEELPEYLPPDYYRSVA
                     PVVW"
     gene            complement(<715105..>715683)
                     /locus_tag="CYME_CMH276C"
                     /db_xref="GeneID:16993596"
     mRNA            complement(<715105..>715683)
                     /locus_tag="CYME_CMH276C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536146.1"
                     /db_xref="GeneID:16993596"
     CDS             complement(715105..715683)
                     /locus_tag="CYME_CMH276C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536203.1"
                     /db_xref="GeneID:16993596"
                     /translation="MRTLSQLFYVGVAIPSKDAGLTPQVSNARPRFLRTCFLARAGQR
                     AGRLHGTGAATRVRNRQSASLGRRIQRVRHSSTLLALVPMLPSLDRLPSADELVTFLF
                     QVSIIPYAGFLYVLWTRERTLTTITKIGLSYLLVFVLGTIVAGVIALRVYHEKLANVD
                     YLHGTAEMLLTMTNICILMGVKDQALNEDAGE"
     gene            <715957..>717141
                     /locus_tag="CYME_CMH277C"
                     /db_xref="GeneID:16993597"
     mRNA            <715957..>717141
                     /locus_tag="CYME_CMH277C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536147.1"
                     /db_xref="GeneID:16993597"
     CDS             715957..717141
                     /locus_tag="CYME_CMH277C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536204.1"
                     /db_xref="GeneID:16993597"
                     /translation="MVVEVGAAGEASLGRRQAQVQQDTRGANSEPAHVVSGGRAQDST
                     ASVAQASVQEERTSPLGAELNELERANGELEKTVNEYGSLIERYTKLQQQLCQLAAKQ
                     QKRLVHLERTLANQRETMRPRNNSPDLRQETRAVLERSRKLLRERVEPLLPSDGGWFV
                     RLFLGTINVRFMDKRTRLSFKREYEQFKQQTAPALVIASVVCLLWTSSRWPSLLLQMF
                     IAYYYSALALRESVLVANGSNIRRWWRLHHYLSLVLAVVVLTWPDGEAYAEFRGEIHF
                     LGLYLSLLQILQARYQMSRLYTLRSLGKAGELDVANTDSPAQLHWGANMSLLLPAILV
                     AHALQAWTAVRAFQVYFKYPRVAQALLGGTITLITCIGNVVTTFRTLREKAVLSGQHA
                     SS"
     gene            complement(<723461..>726700)
                     /locus_tag="CYME_CMH278C"
                     /db_xref="GeneID:16993598"
     mRNA            complement(<723461..>726700)
                     /locus_tag="CYME_CMH278C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536148.1"
                     /db_xref="GeneID:16993598"
     CDS             complement(723461..726700)
                     /locus_tag="CYME_CMH278C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536205.1"
                     /db_xref="GeneID:16993598"
                     /translation="MKKRVDERVRQLLVRAYETHTRALFFVVGDHAKDQVPFFYHLLT
                     RIGTRPRPDVLWMYKKELGFSSHRRKRLRQLRKKLRHGGVSVDAKTEDLFELFVSTAN
                     IRFSYYSESEKVLGNTYGLLVLQDFGALTPNLLARTIETVQGGGLVLFLLHNMESLRQ
                     LYTLKMDVHAHYRTESCPDIVPRFNRRLVLSLETCPMALAVDDELNVLPAVGGASCSS
                     AYSIPQAANADDSSRAQDLASIPRIHVRSPPEVGGTVGDSNVTSEAEFRQKQLEILWS
                     SRADLQVLGPLLRRTRTLDQARVLETLHALLARNVDTTTPAALAASMVVLTAARGRGK
                     SAALGLAAAAALALGYTSIVVTAPAADNVQTLFSLLVSGLNELKLQEHTDYVLESRHD
                     RCISKLSMLGRRVRQVSYLEPEAIRRVDAATIGALVSADLVIIDEAAAIPLVLVKRIL
                     SLLPSKSCHVFLSSTIFGYEGTGRSLSLKLIAQARRHVQQNTSVAAESRLVPPPMPED
                     VSHTPNGGIEPPVEHGCDSSTRQYGRRFHELVLEEPIRYARNDPVEAWLHALLCLETT
                     EAPALQTRALPHPSMCTLCQVNRDVLFSGHALAEIFLRRVMALFVSSHYKNTPNDLQM
                     LSDASNQQLYVLLGPTSSDPKRLPDVLCAIQLGLEGRLSREHTESQLSRGKRAAGDLI
                     PWTLTQQFQETAFAQLAGARVIRIATHPDVQGMGYGTRAMECLVEHFRRRVASGVQQH
                     ERKTLRETDDAQPDLSVGSINDDTVPEPLLYRLSEQRVPDLDYLGVSFGLSHGLYRFW
                     NRIGMLPVYVRLTPNEVTAEHTCIMLRSLKQAHEQGFRALHLDWRARFLSLLSYDFRS
                     LPLGLVLDVLRAAPPDASLWNAAQLRLLLSMHDLRRLQAYANHLLDYHVILDIIPVLS
                     RLYFEGHFAAERITLSPAQQAILVGVGLQRRPLEELGAEMQVESAQLLALFGKICRKF
                     ANEWKRLAEEEASTDLPLHPITERAASSRNGDVSQVAAADHSSSSTSRQLTRSQQTLD
                     SLRPDSTPYVDIGGKSSESRPRFALDTNMQPADSGAAPVRLVSLPARRS"
     misc_feature    complement(726847..730017)
                     /note="repetitive element"
     misc_feature    730532..731751
                     /note="pseudo-gene of NADPH:protochlorophyllide
                     oxidoreductase"
     misc_feature    complement(731671..733198)
                     /note="possible transcribed region"
     gene            <732289..>733410
                     /locus_tag="CYME_CMH282C"
                     /db_xref="GeneID:16993601"
     mRNA            <732289..>733410
                     /locus_tag="CYME_CMH282C"
                     /product="similar to trefoil factor"
                     /transcript_id="XM_005536149.1"
                     /db_xref="GeneID:16993601"
     CDS             732289..733410
                     /locus_tag="CYME_CMH282C"
                     /codon_start=1
                     /product="similar to trefoil factor"
                     /protein_id="XP_005536206.1"
                     /db_xref="GeneID:16993601"
                     /translation="MFKHACSDFLNDVFALRKAFPTPTPKTSRTPTTICSNELCGSPG
                     QCINQDAYEQVGCCFNSQTNACTLKSVSAACSAVPVTQRVPCGWSYIYPDDCTAIPGC
                     CWQPTANGILAPWCYYDINHAPQASVALQEVQAPVPLCPSPGAQRQPCGNAGINQFTC
                     YAQGCCYDSQAQNQWVQNGKQQCDFASNPYCFQPEKTCAVGEFERQPCTNAVNHNQQL
                     TNNINNNQFVRLLNTLLYGEQHGTQRTSYAPQQCLEAGCCLGLCNECCQPVTENVCQT
                     YGYVSNSLSGTTGNVSNSSYIPCGPECCNAEIENCTYNPFSNSNNLRQQQQQQQVLLP
                     SFCVCKDPTKQCGTYLIASDNLVNKVRCCRSGEECINNE"
     gene            <734209..>736431
                     /locus_tag="CYME_CMH283C"
                     /db_xref="GeneID:16993602"
     mRNA            <734209..>736431
                     /locus_tag="CYME_CMH283C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005536150.1"
                     /db_xref="GeneID:16993602"
     CDS             734209..736431
                     /locus_tag="CYME_CMH283C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005536207.1"
                     /db_xref="GeneID:16993602"
                     /translation="MRRRYFSILRLLVVVLVVSGTHTVRGVLSSEDTFLWTWIGGSNS
                     TSSSGSYGVQGVPNTSNVPPARYGAAFWTGADGVLWLFGGGSDLRDVFGDLWNYNLST
                     FSWTWVGGSASLNSGGVYGSRGVPNKSNYPPSRTESAAWSDSNGNLWLYGGHNLNSGY
                     SDMWMYNVSSGEWTWEQGSNKTNVPPTYGTLGNSSSSNTPGARFQPATWVGLDGQFYL
                     FAGSSPNGTYYGDLWQYNTVTNEWSWIGGTQQQIPSGSYGAFRQASPSNYPAGRLGAT
                     SWRDLDGNFWLFSGYGQIDGNGGSLNDLWLYNVSSKEWTWMSGNDSVGSDGAVYGEKG
                     VPSSSNTPGYRSSSSGFVDSSNTLYLFGGYSPGFCNDLWTFNTTSLEWTWVDGDNTTD
                     GAYSYGELNKTSNTTLPPPRAYAVLWNTDQNDPVLFGGVGNSGSLNDLFTLYIATPTP
                     TPTPTPTPTPTPTPTPTPTASPTPSVTAPPSATTNVTQTAVGEGSAVCFPADAPVLID
                     GLGNHLQISELRSGMAVMGVNGRGQLVEDSVLGWLHNEAGATAEILAIKTLSGKQLRL
                     TRQHLVYRMIEHSRDFYGMTTAFSCISQKQQQQHQQEHIRQSLELGTSAVEAVFAEDI
                     RVGDALLDVAAHLPDPVVAIETVVTHNGLYAPLTRSGRLVVDGVLVSCYGTYASHAAA
                     HAVLWPARVDALRKIWTSGLGTEGIVGIMPYAERLYHVWTSAARVLTEARVSVVVAAC
                     "
CONTIG      join(AP006490.2:1..739753)
//
DBGET integrated database retrieval system