GenomeNet

Database: RefSeq
Entry: NC_010136
LinkDB: NC_010136
Original site: NC_010136 
LOCUS       NC_010136             839707 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 10, complete
            genome.
ACCESSION   NC_010136
VERSION     NC_010136.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 839707)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 839707)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006492.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..839707
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="10"
     misc_feature    768..3361
                     /note="repetitive element"
     gene            complement(<4509..>5339)
                     /locus_tag="CYME_CMJ002C"
                     /db_xref="GeneID:16994091"
     mRNA            complement(<4509..>5339)
                     /locus_tag="CYME_CMJ002C"
                     /product="L-lactate dehydrogenase"
                     /transcript_id="XM_005534707.1"
                     /db_xref="GeneID:16994091"
     CDS             complement(4509..5339)
                     /locus_tag="CYME_CMJ002C"
                     /codon_start=1
                     /product="L-lactate dehydrogenase"
                     /protein_id="XP_005534764.1"
                     /db_xref="GeneID:16994091"
                     /translation="MDLQHGGAFYSTRIRAAESYEDTAHSAVCIITAGVRQRPGESRL
                     ELMDRNAALFKGIIPPLVQYSQNTILLVVSNPVDLLTHLAWQMSGLPRERVIGSGTYL
                     DSSRFRTLLAQRLGIDTASVQAMVLGEHGDSSFVYRSGITVGGVPLRTCFERMTDAAS
                     ASTAFYDLVKGVHQQVVAAAYEVIKLKGYTNWAIGSAVGSIVTTIVHDRRKVLPITTH
                     AGSLRGLESADVFLSLPCVLGRNGVVEVLQILPFMESDEKEDLQSSIEALQSTPKKAS
                     "
     misc_feature    6051..9385
                     /note="repetitive element"
     gene            complement(<10586..>14011)
                     /locus_tag="CYME_CMJ005C"
                     /db_xref="GeneID:16994097"
     mRNA            complement(<10586..>14011)
                     /locus_tag="CYME_CMJ005C"
                     /product="similar to cell surface glycoprotein"
                     /transcript_id="XM_005534708.1"
                     /db_xref="GeneID:16994097"
     CDS             complement(10586..14011)
                     /locus_tag="CYME_CMJ005C"
                     /codon_start=1
                     /product="similar to cell surface glycoprotein"
                     /protein_id="XP_005534765.1"
                     /db_xref="GeneID:16994097"
                     /translation="MFRARSLVRGLVVAVCLLLAATFSVSLVAALSPVSTVSWTWIGG
                     ETGRDNPGNYGTLNQTSADSVPGGRYDSAAWVGSSSLVYLFGGVGGGNPYLSYFNDLW
                     TFNLTSHEWTWIGGSSEADQPGVYGTVGTGSPANTPGSRYRSAYWQMDEQHFWLFGGL
                     GYDRNANFGPMNDMWMYDTESRVWTWVSGNDTVNAGTIYGAEGVFGPSYNPGSRGSAS
                     FWLGADGTFWLFGGENNLGDSVSDLWSFNPTTLQWAYRGGSQLANQPGNYSAPGVANN
                     SSAPGARIVANTWTDFEGNLWMFGGLGYGDSTAPGQGKLNDLWVYNISQSVWIFIAGN
                     TTINNPGSYGSLGAFAPTSYPGARDSGVSFVDSLGNLLLFGGEGYGNTRESPGDLNDL
                     WVFDMTLGQWAWINGSQNGFALSVYGFLNKTSPSVSPGGRTGSVFWNTSGTDPVMFGG
                     FGYSNTSIPGYLNDVFALSETFFTPTPTPTPTSTPTLTPTITPTATATPTPTLTPTPT
                     PTPTATPTPTPTPTATPTATPTATLTPTPTLTPTPTPTPTPTPTPTATMTPTITSSPT
                     ITVTESPTTVTMTPTMTPTATTSPTIVPTTISTSIAISVQNLSLCLAVATDLQNDLEA
                     RFTGQVVNVSVTDNCDTVFGSGTSRRLATTLDKSNLRLERALVRTSGGSVVTYVIKIS
                     GDTSLASELQSVLQTFTDQLSTILPSGATLAIITPTPSATPTPVCTSEICGSPGQYTN
                     QDACEQVGCCFNSQTNACTLKSVSAACSAVPVTQRVPCGWSYIYPDECTAIPGCCWQP
                     TANGILAPWCYYDINHAPQASVALQEVQAPVPVCPSPGAQRQPCGNAGINQFTCYAQG
                     CCYDSQAQNQWVQNGKQQSDFESNPYCFQPEKTCAVGEFERQPCTNAVNQNQQLNNNI
                     NNNQFVRLLNTLLYGEQHGTQRTSYSPQQCLEAGCCLGLSNECFQPMTEYVCQTYGYV
                     SNSLSGTTSNVSNSSYIACGPECCNAETQNCTYNPFSNNNNQQQQQQLQQQQQQQVLL
                     PSFCVCKDPTKQCGTYLIPSDNLVSKVRCCRADEECINNQCVVISSTPTPSPVAVTAA
                     PSATVSATVSATASATVSASASTSASASASVSASVSTSASASESATSSAPPTA"
     gene            10709..12605
                     /locus_tag="CYME_CMJ004T"
                     /db_xref="GeneID:16994096"
     misc_RNA        10709..12605
                     /locus_tag="CYME_CMJ004T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461343.1"
                     /db_xref="GeneID:16994096"
     misc_feature    complement(16802..18065)
                     /note="pseudo-gene of NADPH:protochlorophyllide
                     oxidoreductase"
     misc_feature    19447..21717
                     /note="repetitive element"
     gene            <21722..>23482
                     /locus_tag="CYME_CMJ008C"
                     /db_xref="GeneID:16994100"
     mRNA            <21722..>23482
                     /locus_tag="CYME_CMJ008C"
                     /product="similar to retinoblastoma-binding protein 5"
                     /transcript_id="XM_005534709.1"
                     /db_xref="GeneID:16994100"
     CDS             21722..23482
                     /locus_tag="CYME_CMJ008C"
                     /codon_start=1
                     /product="similar to retinoblastoma-binding protein 5"
                     /protein_id="XP_005534766.1"
                     /db_xref="GeneID:16994100"
                     /translation="MNRVLLDRLFPFVRAQVPEQVEFSLSEHGTGRCFAFTPLYGNVL
                     AVGLADGTIALYDLVTRALAKKLYGHTSDVFSLSFVPRSTWLLSTSLDGSLRLWDVSQ
                     LRCIVCVRFEAQLARASAHPRFRQNRLCCVSQTGQPVLLVQLPVEPGEYHVTQCPSVW
                     VLWSGPASTLTMSAQERTPTETLQVPECAHVHASDTEDGNSVCTRNSDALPPVPERAP
                     LLRELGTHGAVELPPTLTGSITMPVAYLAAEFDPTGAYIITHAAEQPGLLKVFKIERA
                     TEAGSGPRLTVHCSASFALPPRAFVKQIQFAERGDLFLVVAHDRIVRVFEWKPFEPNK
                     VRLWRELKDRVSSVQWRWAAFASHDEFLVAGTAASADHRLYIWDLKANQLVKQLDGRP
                     KESLSMLAYHANLHALLVLVYQSGSILVYHKTVAENWSAYAPSFREVSENVEYVEAED
                     EFDFDPDGSSVYDRRRRKHFAPADEDATVVDITGRLPDSDPGYQRFAEAGWNASSSSS
                     MSSSNEELLCLPVDIPLDLPPLASEASWIGEYRALRRHESEQQSCSATTLRQDDASAG
                     TSSQAVMRTVRDDPAGQLAK"
     gene            complement(<24764..>27118)
                     /locus_tag="CYME_CMJ009C"
                     /db_xref="GeneID:16994098"
     mRNA            complement(<24764..>27118)
                     /locus_tag="CYME_CMJ009C"
                     /product="cycloartenol synthase"
                     /transcript_id="XM_005534710.1"
                     /db_xref="GeneID:16994098"
     CDS             complement(24764..27118)
                     /locus_tag="CYME_CMJ009C"
                     /codon_start=1
                     /product="cycloartenol synthase"
                     /protein_id="XP_005534767.1"
                     /db_xref="GeneID:16994098"
                     /translation="MWRLHSDHGRQWWTFSTSDAETNLDDPALAKEAALIEEARRTFH
                     EHRFERKQAADQVYRIQALLRAQGVLSNAELSEEYAKAATLGELDATLWRGFCWYARL
                     QQPDGHWPGDYGGPMFLLPGLLIVCYISRTALPEPYRVEMRRYLLNMQNPDGGWGLHI
                     EAPSGMFGTVLNYVALRLLGMEASEEPLVSARRFIHEHGGAVMTPSWGKFWLACLGCY
                     SWRGMNPLTPEMWLLPYGSGDPTGSTRPAIGWFANPIMPARYWCHCRVVYLPMSHIYG
                     KRASGPETPLVLALREELYIEPYDQIDWPRYRHVCSSLDEYTHRPRVQKWLWDVLYVY
                     EWSNNPLIRRLRDRWLRPRALQETLLQVRQEDYNTKWICIGPVNKAINMLVAWYDRTS
                     SDAEAHFRAHQDRVKDYLWVAEDGMKMQGYNGSQLWDTAFAAQAYAESADLFLDTDSC
                     LERVLLACWRYLEMSQVLEDVPEAARFYRHISKGAWPFSTRDHGWPISDCTAEGLRAV
                     LAIRALFRERGKEALLEPPINDERIFDAVNVILSFQNPSGGWATYENTRSYPWLEYLN
                     PSEVFSDIMIDWDHVECTSACVRTLIVFLKAYPNHPRTAEIATAIRRGVQFMKRIQLP
                     DGSWYGNWGVCFTYGTWFAVEALVDAGERLDSCPALERACQFLEEHQHPSGLGGWGET
                     FESCSKKRWHHSPEIQTVNTAWALMTLLAARWYQRGPEQRELVHRAARVLMSAQRTSD
                     GSWDQQLIRGVFNRNCMITYNYETVFAIWALGRYRRALQTDLVA"
     gene            complement(<31328..>31903)
                     /locus_tag="CYME_CMJ010C"
                     /db_xref="GeneID:16994099"
     mRNA            complement(<31328..>31903)
                     /locus_tag="CYME_CMJ010C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534711.1"
                     /db_xref="GeneID:16994099"
     CDS             complement(31328..31903)
                     /locus_tag="CYME_CMJ010C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534768.1"
                     /db_xref="GeneID:16994099"
                     /translation="MPTESGLQQRWRRGCAGGAGPQWWPPGRKPHGAGGTMPQPPTRD
                     APPEVLDAYLRERRRRWPRLDAETSEAAARNSTEAASTSSSVTPRERAGPASSIGQPS
                     SSRDVLPGNEACFERNRPGSAAAQSNISESVASAVVFHEKPPQCRRRFAETRPTARFR
                     ALLESDAKAEEQQEVILDCLETIARLQGWIE"
     gene            complement(<37576..>38412)
                     /locus_tag="CYME_CMJ011C"
                     /db_xref="GeneID:16994108"
     mRNA            complement(<37576..>38412)
                     /locus_tag="CYME_CMJ011C"
                     /product="26S proteasome regulatory subunit RPN12"
                     /transcript_id="XM_005534712.1"
                     /db_xref="GeneID:16994108"
     CDS             complement(37576..38412)
                     /locus_tag="CYME_CMJ011C"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN12"
                     /protein_id="XP_005534769.1"
                     /db_xref="GeneID:16994108"
                     /translation="MRPESMTDGVPGSDSPAAAAAAASVTTSLHDLQVLVERGTLSGP
                     EKQQADHLVTSLKRELVLRRVGDHLAERTFHELCVRLAVMERDWAAMERHIQQLMPLY
                     ELDRQAGIQSPHRDLLVGLNLMRLLAQNRLAEYHMELELLPTTEPQQNPYVLFPFQVE
                     QALTEGSYQKILHIEAGAEWLPFIELLRETTIQEMVTSWAEAYAHVTLEELASMAALP
                     VEQVPALLARVLDCTQYVVQNETVHFIASDHIREAPSQYLLAKEAVSRTMEYIRGLER
                     IV"
     gene            <39356..>40705
                     /locus_tag="CYME_CMJ012C"
                     /db_xref="GeneID:16994107"
     mRNA            <39356..>40705
                     /locus_tag="CYME_CMJ012C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534713.1"
                     /db_xref="GeneID:16994107"
     CDS             39356..40705
                     /locus_tag="CYME_CMJ012C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534770.1"
                     /db_xref="GeneID:16994107"
                     /translation="MLGTDQRINSDTLLRRAPRFYCGSGFVFAALPPWLEPRTACKHR
                     ARSPVPLQRHPRLFQRCGTSVSRHALITLRAKNERPSPPWQLILSFAALVVFGAPLVK
                     PLVDTLATHVAPGSQVALRTSSALSEEEIAEKLRVIPVFCVTDREGRPILTEVGSASN
                     TPAGAAAQAELDEPETLSGALGLLDIDSQQRVQKRRAGPATAHRIGSFYLSYDDASRF
                     LEQLSERSAQDKQNLIRDARIVVVPLDEALSFVTPREGGRGKVPDPSDEFHLVPSEQS
                     VRFAERVLKANGALGVNARIRGVPLFTIRGFALQRVVEKDAGAGSEATQVSETANLST
                     EPLLLTPVFFTLDDVQFAWDRLRQVSNNQGTALPSKLPLDRVYVTDLRTVIQGMRQGS
                     SALELTDGSADYHSVVFLPSRSAMPGTRTDASGSQRTDAQPVLETRATTERHDGAGR"
     gene            complement(<42498..>44342)
                     /locus_tag="CYME_CMJ013C"
                     /db_xref="GeneID:16994103"
     mRNA            complement(<42498..>44342)
                     /locus_tag="CYME_CMJ013C"
                     /product="similar to CCR4-NOT transcription complex,
                     subunit 2; NOT2"
                     /transcript_id="XM_005534714.1"
                     /db_xref="GeneID:16994103"
     CDS             complement(42498..44342)
                     /locus_tag="CYME_CMJ013C"
                     /codon_start=1
                     /product="similar to CCR4-NOT transcription complex,
                     subunit 2; NOT2"
                     /protein_id="XP_005534771.1"
                     /db_xref="GeneID:16994103"
                     /translation="MPTNAGAGGGQGLTTSGSAGWSPPLLGRFQSFAQQLHGPSALAS
                     GALATTPPASAGPANDSNAGFGSGPLNASAAAATTTTTATTSAGLTVSPALLTSGSPL
                     FPPLGQTPPASSESHMGQQTAVFDLTDFPALGVGMMLNHGQGATSQASLGESANNSGA
                     GNAMMGYGRVLGSPYSMSQRVELTARDFPALGSKLQNPATLGVHSRLNPSLGTIGGNV
                     TAGAVPNSFVAGTGAGAGNGASGTGALAAMSIPPASSTSTVGFLGAPSATGSSTAPTS
                     LPPYAAGPAPATPSAPPPLPSAPLATPPSLPTLASLATTTTTTTSSASSSSGPAGSRS
                     DAPEWSTRLNAEPNPSARLGMGQFSTEAGARSGVFSAAGTAAASATSMALNLLNLAHG
                     SGTASGQAAGAENGTWGSPYGMLGLLATIRSQNADLSLLAHGVDLTALGLNLNSAEPL
                     YPSFSSPFGPDLSRNGAPLEDTRTDETVGNSLDAFAALPSCYSACTVSLKPAHFKRFS
                     TETLILIFYGYPRDLVQVYAALELFNRGWRYHKELKTWFARSGPGVESLAPDPSDAKS
                     ISSSGNQLVYFDLHNWSLKPFANAGTLPNLMRGFLTEAELREMMAACK"
     gene            <47024..>48493
                     /locus_tag="CYME_CMJ014C"
                     /db_xref="GeneID:16994101"
     mRNA            <47024..>48493
                     /locus_tag="CYME_CMJ014C"
                     /product="mercuric reductase"
                     /transcript_id="XM_005534715.1"
                     /db_xref="GeneID:16994101"
     CDS             47024..48493
                     /locus_tag="CYME_CMJ014C"
                     /codon_start=1
                     /product="mercuric reductase"
                     /protein_id="XP_005534772.1"
                     /db_xref="GeneID:16994101"
                     /translation="MASTCCSATAIDTTQIVILGSGGAAMAAAITAAERGAQVHVVER
                     GTIGGTCVNVGCIPSKHLVRCGQLEHWCELHKHQTVSNAVNGCPCPGMLDAPKLRTAR
                     QALVEQLRYQKYERVLGENPRITTWHGEARFHDPQSVWVRTTADDGSRVDTLLRFDRC
                     LIAVGAAPCIPPIDGLAEVPFWTSTEALASDQIPRRLAVIGSSAVALELAQAYARLGS
                     RVWILARHGLCTRTDPLVGDTLGAALVSDGRIEIRCHTRVERVRYRDGLFTMTLDSQE
                     TSVEVDALLVACGRRPNTAALQLDAAGVHWDAASGTVPVNDRMQTNVPNIYAAGDCTN
                     MPQLVYVAAAAGTRAAIQMTGGDAKLDLSLVPWVIFTDPQVAAVGLTEAEAHALGLQT
                     QVRTLPVTNVPRSIVHGEKYGFLKVVADITSKRILGAQAVASEASDMIATVAVAMRGG
                     LTVPDLAELLIPYLTASEAVKLVAQSFTRDVQKLSCCAG"
     gene            complement(<49184..>50383)
                     /locus_tag="CYME_CMJ015C"
                     /db_xref="GeneID:16994102"
     mRNA            complement(<49184..>50383)
                     /locus_tag="CYME_CMJ015C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534716.1"
                     /db_xref="GeneID:16994102"
     CDS             complement(49184..50383)
                     /locus_tag="CYME_CMJ015C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534773.1"
                     /db_xref="GeneID:16994102"
                     /translation="MASAGLTLVDWKRTCEDALHRLRADVLASLWKVRPAFARVTAAG
                     PSVRRPAVRRLLALGDVHGDLASLRKCLSLANVINENGEWIGGDAVVVQVGDVFDRGD
                     AERAVLHFLDTLDRQARERGGAVYRLLGNHEVMNVDLDFRYVTPGGFAEFRRRDWELA
                     GRALEKAYRELPPVLRQRVKALPREQRARAMALAPGCPTARLLAERGQLVLIIGDTLF
                     VHGGLRPDHVAYGLERLNAETRAWMERRAAAAWSTRLPMNPWKATIPRITESVPRVGV
                     ARFGSTAAAAAAAADVSSKPEFLKGSRSPVWMRTYSAPHLRSDSDACRELEETLRRAG
                     VRRMVVGHTPQVVINGACRGRVWRVDTGMSAAYGGACEVLEISETHGIRIFTDHGVVR
                     GERRLLP"
     gene            <51739..>53568
                     /locus_tag="CYME_CMJ016C"
                     /db_xref="GeneID:16994109"
     mRNA            <51739..>53568
                     /locus_tag="CYME_CMJ016C"
                     /product="aspartate kinase"
                     /transcript_id="XM_005534717.1"
                     /db_xref="GeneID:16994109"
     CDS             51739..53568
                     /locus_tag="CYME_CMJ016C"
                     /codon_start=1
                     /product="aspartate kinase"
                     /protein_id="XP_005534774.1"
                     /db_xref="GeneID:16994109"
                     /translation="MHSALQPAAQPCFILAPGLTSNRNGLTRASCAHELRRAPCVWLA
                     RRRFPRQTAGPQHDASCLVPSFHRQELHRQRVVALSRRRTKRTAPLDIVAERSDSGNA
                     QAVSGTQFQQEATPTGAPGKVYDRVVCKFGGSSVADAERMREVARLVRRQIELSRQYP
                     VVVLSAMGSTTNDLIAAGDAALYEGIVDSTVVRNRAYAVCDALGLDREALVDPLLMQL
                     DQLLMGVKFIRELSPRTRDYLVSFGERLSVRIFAAHLLYNEGLPARAFDAFDVGFRTD
                     SNFQNAEILEETYDLIRSFFERVVSNQTLAVITGFIAKDNEGHVTTLGRGGSDLTATT
                     LGAALGATEVQVWKDVDGIMTTDPRLVPNAIPVAEMSFEEAAELAYFGAKVLHPVAMQ
                     PALRFNIPVRVKNSYNPEAPGTVILRRESATMDRPVTALSVKRGVQLVDIVSTRMVGA
                     YGFLARVFACFATHQLSVDVIATSEVSLSLTLDANACDMTRQQRIIKELQQIAQVSFS
                     SGRAIISIISNVRRSSEILARAMKVLHEQNIEVQMISQGASKFNISLVVHNDEAITAV
                     RALHDEFFHCSPSASNGTSTSATAAAAAAAAANADGVRVAGAA"
     gene            complement(<53880..>57509)
                     /locus_tag="CYME_CMJ018C"
                     /db_xref="GeneID:16994128"
     mRNA            complement(<53880..>57509)
                     /locus_tag="CYME_CMJ018C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534718.1"
                     /db_xref="GeneID:16994128"
     CDS             complement(53880..57509)
                     /locus_tag="CYME_CMJ018C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534775.1"
                     /db_xref="GeneID:16994128"
                     /translation="MRRRATEAAPEDALLPREAAEALSCTTSEIVRGLRVLVQVQAAN
                     SRDAGATATGAGSNESLPALGTAPPGSWDASGVPVEHASPCLLITQAGSQDVDLGALS
                     SLVQDLLAFLGEWDEFLNPSYGGEVDTDGAPPVPTLDWYVDADGVVAEAGLAPLAARR
                     GLLRTGVLGVALESFAYLPPPTRSFPDMDMTSSAAAACHARLEALMHLLRSFMKLIVA
                     VILPPPASLIRQIANVLQQTPQQRPSRASETDFADASIPNSSPLVVAALAFREALDEI
                     HAAVLQLGALLVRHRTHQRSAGEDAPFSALDWIADMFVSAVRALPATWSDVELCLLLF
                     SAFIREPACLDRPTPWSKKHIPAAFDREARLATHREAQSIAQELLLQLMCPEELDLFR
                     LIHAVVMQAPHLESATATTTCSMTDSVMNAAVEIYHAAWVRFFPVEHFAEHVFTECGT
                     PVDHARKAFLDGWQPLQARLDRERDQRANRHGLMRTARWAAQRPSTWIVVPKCSPSDG
                     IRGTGTSRKRVALDPDDLWSELQQDAPCFQQALRRCGRAGDWHGERARRSDLGTLQPE
                     NASVFYNPSKRVGTLPPSWTRLAALSATETEPGLGPLVRHAGTTVDSSPQAAAAWALW
                     VRQAGLALYELGQYGLRQLVRAVRNPSAAPWSELPAFLELASAIMQFHFWEQAAQVAE
                     PTWCARSRAVLLLLEAHGYGRVPDDLSAWPSLCLSEMVHDSDIADKLHHELTQRFYRD
                     QRPTLPEASTGERFTQHAPPNSKWKQALMDALLGDVPLQAALQILCACIRVHSGGCRR
                     RSAAAEEHQDAWEQDSFGTESEPPVLAVAYLVPPETIMRFVFLQWRALLAEVDGLRRL
                     AAFCCANRTAVCTVARAIPRLDGRRCSRLYLDRAFSLLWLFAFVGKCVLPRPHHDLDA
                     CTPAENHEFARCIYGLPRLGHCLLLPLYEVLVQTWPAPLYQTSGWLRALDLLAQCWTA
                     AAAFGDAEPATAAVSSHMFSWHALLVCSAAFERRADHQRSQSGLRLSACRDAASALDD
                     MVQLSRTLASAWRKRLAERPLLLIEALIGRCKGRPAAVSEARESLAMHRAPPRSSASP
                     DRHLTVPSTAGQSLGQPPTGTVADERTQPTSWFASSPSSSSSSSSPLMLTTPPAPKDA
                     RGVDALAAPTARAPANGLAARMRDRRGMRPSRPVLLSDATESTVDACTTQIRSSEFAP
                     CADSA"
     gene            complement(<59337..>61457)
                     /locus_tag="CYME_CMJ019C"
                     /db_xref="GeneID:16994129"
     mRNA            complement(<59337..>61457)
                     /locus_tag="CYME_CMJ019C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534719.1"
                     /db_xref="GeneID:16994129"
     CDS             complement(59337..61457)
                     /locus_tag="CYME_CMJ019C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534776.1"
                     /db_xref="GeneID:16994129"
                     /translation="MRLHARIAPQNLEPGSLFCLVLVLDTTGNEPTGTARQVPVPEHE
                     LEFLACAVAGAWRSDARWTKPEAHRRPATAAVVTGQAKANGEHEPSTAPGLVEAERTK
                     RFATTFWDWEGEELAPDLLDGPEDAVPAEAMPWLAALWDLLEANAYPVRSAQGSQHSE
                     LPAHHGLVFASRACCVARKLRLERDKLLAFLVRGCLPSMIPPSFDGTYVRYEYGVAVV
                     AQRTGSAPVKLHLRFRIHPPISSRMAKVPVLSAPDAMSAATAAAAAAPVAALRDHERD
                     ASRADGMPPLQDPNEVLRVRLDAVSRAAVTRPDRMMAEVIRPASAAGARAAGSSTGSA
                     SPPPLPQMSPTWSERRISSPSLLTLSASVPRSPAMPEFLPSASASASASLEQVSTRGE
                     PPQEHAAGNADAPLRMELKAFQVALEISNNLEFILSATSNSRLTAYPVTTPSEWDDST
                     ILDTLPGKSGIASRSHAADGTNSGTSPVVDGTTQASGLRSGSVSPTTAPLDQLESVWM
                     PFIARVEATGLGRIATVHLQRRGFVLGELVPVSIDLSVATSSCVYIRGTLDALEILHP
                     ECANDFSKSSLEKCARVPPKRRKRATLCHRRRYAERAEPCAGLCRWHWTPRIPSEEDT
                     PVSFATRVVQVRWTLSIHFLVRVSDTGQRASEDDSNQGRNPLRLVTLPIPLQVGGYLP
                     ANTALPSAGSLSVNTVSLASEVAL"
     gene            complement(<62743..>63405)
                     /locus_tag="CYME_CMJ020C"
                     /db_xref="GeneID:16994120"
     mRNA            complement(<62743..>63405)
                     /locus_tag="CYME_CMJ020C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534720.1"
                     /db_xref="GeneID:16994120"
     CDS             complement(62743..63405)
                     /locus_tag="CYME_CMJ020C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534777.1"
                     /db_xref="GeneID:16994120"
                     /translation="MMLFVPAARPFLGRTTFRWSPPPRVHTLKLDSKISVLLGSSAPR
                     MQHGGVNRAANRETERKFLVHADQVRRLLCTSQGTHLAQGYLCSEPDRTVRVRVAGMS
                     GFLTIKGRTHGCTRAEYEYPIPVEDARELLNTLCVQPLIEKVRYRIPAKEAGLVWEID
                     EFLGDNAPLILAEIELPTPETAFERPTWLADEVTLDERYYNSALQKRPYRVWGTETDD
                     SR"
     gene            complement(<68902..>69510)
                     /locus_tag="CYME_CMJ021C"
                     /db_xref="GeneID:16994106"
     mRNA            complement(<68902..>69510)
                     /locus_tag="CYME_CMJ021C"
                     /product="probable 1-acylglycerol-3-phosphate
                     O-acyltransferase"
                     /transcript_id="XM_005534721.1"
                     /db_xref="GeneID:16994106"
     CDS             complement(68902..69510)
                     /locus_tag="CYME_CMJ021C"
                     /codon_start=1
                     /product="probable 1-acylglycerol-3-phosphate
                     O-acyltransferase"
                     /protein_id="XP_005534778.1"
                     /db_xref="GeneID:16994106"
                     /translation="MIRDPYRARAYDWIAMLCMRLSMLSTGIHQRAVGTENLLPPDAT
                     VLYVCNHNSYLDIYTVSFLGRFFKFVSKRSIFAIPSIGWAVGMARQIGIERDSRRDQL
                     RVFREMVSRLERGVSLLLFPEGTRSKDGMLRAFKQRPFRVAKQAGVPIVSLTITGTAE
                     VMPPWALAPLRRPRQRITLTIHPAIQTADHANHSSCDPNCGS"
     misc_feature    complement(69509..71113)
                     /note="repetitive element"
     gene            <73218..>74582
                     /locus_tag="CYME_CMJ023C"
                     /db_xref="GeneID:16994117"
     mRNA            <73218..>74582
                     /locus_tag="CYME_CMJ023C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534722.1"
                     /db_xref="GeneID:16994117"
     CDS             73218..74582
                     /locus_tag="CYME_CMJ023C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534779.1"
                     /db_xref="GeneID:16994117"
                     /translation="MERLGDAWAGFGNGNCNCGYSDCCGTGEICKHGTEVPMQVCGDV
                     AEIDRTTPQAGCTASPGSASAPTRQTRRLTNRFGAAVLAAARGWTERPLSTTAADNEA
                     EPELAENLPSHLPLRRRLISRTGVSDLPVSTSEHEFWDLFYRQKRDRFFKHRYNLRAA
                     FPELVPPSVRAAPHRHVPVHEPLRPLVPDARHVLEASPDEPSHWMLDDFEPALTHGKV
                     VVAECGCGVGNALIPLLRANPDLFFFAFDYSLVALRLLLLQPEFDQARIYAYCADLGA
                     PAAHTTAFEAPHAAAETRSAAEAPVRSAPAAQRWTTGVYRAPPLTCDFVTCVWTLSAL
                     PVASLPLAASRLAAMLRPGGALLLRDYAVGDLAELRHPACARVGTDPQRHEYLRGDGT
                     RVHYFQVAELENLFQQAGLQTEYAHIVEREIVNRQKRLVMHRRWIAGKWRKPDLAPAP
                     ARIR"
     gene            complement(<75023..>78790)
                     /locus_tag="CYME_CMJ024C"
                     /db_xref="GeneID:16994115"
     mRNA            complement(<75023..>78790)
                     /locus_tag="CYME_CMJ024C"
                     /product="similar to plant adhesion molecule 1"
                     /transcript_id="XM_005534723.1"
                     /db_xref="GeneID:16994115"
     CDS             complement(75023..78790)
                     /locus_tag="CYME_CMJ024C"
                     /codon_start=1
                     /product="similar to plant adhesion molecule 1"
                     /protein_id="XP_005534780.1"
                     /db_xref="GeneID:16994115"
                     /translation="MNSEAFASRSSPALTARLVTTLERLRTAGTAAEDVDSSLASQLC
                     ALLENLKILSLKPSEATRVAVLLAEEFTRRHEQSSAERAPSGEFALGFLSLSARNWRL
                     RSRYEAFKLYELKSRTRRADRVPWPVALGAGPVSQTAASCDDPTEAREHTESDLELAA
                     VSVCAQLVTRIPQDVLTLCCSATDACNSPNGRKVLQFLAGIVLGAADGRILRYFTKLM
                     QHQTADGRNVSSAGHHGQRQRSKRQSHRRTSEKAIDALVESPNCSPVTPGATDDDVGS
                     EQSWDSHDAEGFIDPSLATDPNEAEFWDAFEYARVLAAANRSDASSCLRTASQRVVRL
                     AEGNTDGRIEEAATPVQFPTAPESPLASAPRYLYTKPYRHSVLLPAEDSSTTIPEPSA
                     NIHAACQVRHPSMALSRCPIMSDADEQALILSDFPYHAAAYAFLHVLESCAAVSRPNP
                     ESMAATAADPLYLAFSTSLVLPAFAFVLRNDIMDRSSFCMRFPPLIMKKAFDTIRATN
                     EPRFGALHRLWRQAGLGAFLAVAARRYSELGEIPLSMLATDAACVLAGKWEDCFGFLV
                     TNRPESQLLDDDPLVQTPEQHAAGRRRSSSRGTQSERRASLRMRARRLDWRSRRPWRP
                     FAAGLEGRDATAAAPEASTAIEDALQLAERLESSESARQQTEASARTGAAASDAAGPD
                     TPTAATTSAPRNTKDQLTATLDSASIEAAPARLLRRTSSRHSHSLSGAEPAGEAARAP
                     RPGATPIDEKASVVPAAPETLDTESVGPGRRLCCASMFAHTQRIPSEPPSTWLELLRA
                     WRRFNESDEPRCPPELFRRTQRLVRRCGIPDRLRKYFWPLFLEVERRRGRSPPNWYRT
                     LLRKATAAPDSSRADTTGSRGGAAASTMPAPGSGPVPREVLDIIDRDVTRTFCNHRLF
                     WRGGAALGLGALRNILRAYACLDPAVGYCQGMSSITGALYIYAGGSEERCFFMLVQFM
                     QGALQFREFFLPGFTRLCQSVEAFAWLLHRKLPRTARLLEAKGITPMMFADKWYLTAL
                     LYNFPFPLVSRVWDALLLDGHVKVLHRATLTLLKRAEHAGRLSPEIPFEDLLMYLQRG
                     FATDKAVIPSIGVFMNDVWHSVSFSRRQLHPLEQAPETATGTRMQHCAPTGRRMLLFA
                     RFRQRMEAFRNAQKRKQQAHREAAMPRKTQARTEEEGSLRQVLAESVAAEQIASLHRT
                     DSAITSLDSFYTEKGGWKRDPPPVCTERYRRRGMLFTLGHRMLPCVFPGDG"
     misc_feature    complement(80357..81261)
                     /note="possible transcribed region"
     gene            82288..84485
                     /locus_tag="CYME_CMJ025T"
                     /db_xref="GeneID:16994034"
     misc_RNA        82288..84485
                     /locus_tag="CYME_CMJ025T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461344.1"
                     /db_xref="GeneID:16994034"
     gene            84709..87218
                     /locus_tag="CYME_CMJ026T"
                     /db_xref="GeneID:16994112"
     misc_RNA        84709..87218
                     /locus_tag="CYME_CMJ026T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461345.1"
                     /db_xref="GeneID:16994112"
     gene            complement(<86373..>87731)
                     /locus_tag="CYME_CMJ027C"
                     /db_xref="GeneID:16994113"
     mRNA            complement(<86373..>87731)
                     /locus_tag="CYME_CMJ027C"
                     /product="glycerol-3-phosphate O-acyltransferase"
                     /transcript_id="XM_005534724.1"
                     /db_xref="GeneID:16994113"
     CDS             complement(86373..87731)
                     /locus_tag="CYME_CMJ027C"
                     /codon_start=1
                     /product="glycerol-3-phosphate O-acyltransferase"
                     /protein_id="XP_005534781.1"
                     /db_xref="GeneID:16994113"
                     /translation="MWVSCISFGLRGSRQRTKRQLSLLLTRQRLHWQLQRRKRALPRW
                     VALAAESNAPGARTLFAQTAENESFRFPIELLCPTPTCCDRKLFSDANPKLTFLERLE
                     LFRQRSLLSTRACSVLRGWYESYEKAALAAAADGALVLFGCPSTDPKQVLRWCSDNFS
                     TLFDILIYELKHPFHFKPYHQAVSGPEFNYTAFGNRFSRPLCDLQRSYLDPSSEASFA
                     CIRAQLAAGDNVCLVGNHQSEADPFAIYHMFRHHFGESGAALAESILYMAGDRVRDDP
                     LAAPFSVGRSMLTVYSKKHILDEPDRRSEKQAHNRKTLREMERLFADGGRCVWFAPSG
                     GRDRRSPETGRVTCASFDPDAIELFRLSAEKAGRPCHYYPMAIGTFNMLPPPDQVEKE
                     KGEQRVVSYARLWMSLMPQVDLDAGISPALSKSEKRQARAENLYHLVVQKYTQMGAYD
                     AQ"
     gene            87888..89259
                     /locus_tag="CYME_CMJ028T"
                     /db_xref="GeneID:16994111"
     misc_RNA        87888..89259
                     /locus_tag="CYME_CMJ028T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461346.1"
                     /db_xref="GeneID:16994111"
     gene            <89499..>90665
                     /locus_tag="CYME_CMJ029C"
                     /db_xref="GeneID:16994104"
     mRNA            <89499..>90665
                     /locus_tag="CYME_CMJ029C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534725.1"
                     /db_xref="GeneID:16994104"
     CDS             89499..90665
                     /locus_tag="CYME_CMJ029C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534782.1"
                     /db_xref="GeneID:16994104"
                     /translation="MSAEGGASESKSVDRADEDVVMPGDVQQRTPMETSSSREPEQAS
                     PPSPARRDSDAGAHSSVTPTVPLHAEERTSPRQDQTGAGTDATAIASTAPSPGGANAS
                     GLPDPQELELAAARKRRRQWLYSQERNDPEEAFQRERPFLQHVPLAATAAGATESVPE
                     ALLCQLRRNPYGDSRASALAYTLGLGGRLLLHSTALYCRRMTGMWGESPKGRCIQRVC
                     ARKIDAETGTVLYWCGIRANEDAGDSTNTDSVTWRWLRRRTLARLAPEKLLDFDRRHP
                     ETPHIARLETLKQQGKVRYTREALDPCLVRLQIAHGRLNLDIYASHVEITLPDTHLRP
                     YRPTLHLAGKVCALPSTDSSALSSLMTEPASRFYARLRHSLAKSLGNGADDSHP"
     gene            complement(<90941..>93328)
                     /locus_tag="CYME_CMJ030C"
                     /db_xref="GeneID:16994105"
     mRNA            complement(<90941..>93328)
                     /locus_tag="CYME_CMJ030C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534726.1"
                     /db_xref="GeneID:16994105"
     CDS             complement(90941..93328)
                     /locus_tag="CYME_CMJ030C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534783.1"
                     /db_xref="GeneID:16994105"
                     /translation="MDGASENASEPVQGHDTYQEPFMRSPGLTRGRMAGACASPASVG
                     CDQAQVVFRAGSTRDTAHALPAQAYVLGSQDAPQQRLEHAERARTAEAARPSSAGPAF
                     AWVIYQGQFRRFRVTSSLTAGQLLDEAQRFFVGPTTESDGAFSGVYGTPVSDWCLMDL
                     QGTLIPRACLLISREGAKSATFESAAGGAPLDGLFPEEVLRNAQSLEAMGAGAGSGNE
                     ASALALWLWPVFHLVRSPAASQRRRLSSIRSAQLATCIASGTSLPTFGHPATAAAATA
                     MDVQPSGASVTEPLRAAPAPVHFAPSPGDAEARAKPADDSSTETEADTDSDQGHASRF
                     RSNDRRLVVVSPNESKTTRFEQTRMVMNDTSTSQQPRNTAEPRMTSLQACGICGQASG
                     EMRFCILSSCRRAFHPSCMGAAEHAETPFLCDQHGCSVCGHQPTDYGYLCKMCTRCFC
                     ARHAPAGRRHEPFAIRHALEPGLRIGIITCAQCVHEHPLPEPASRLLEPDMVVLNAQG
                     APWVPPRVAMGPLTWTSTTPASGTRLPRASRRRASSTARQVPLPPAAPLRPEEEEAGP
                     LLVMTMLDDGRRYVLGTRTRGLTGYDEAAGLSNNRFLQAAFLVLREAEWMRRRRVVEY
                     SSRAETQGEGVSDQDRDRLSKARAALPARVEMDAREILRIARARGFNPTVSPEPHNTF
                     SSQIYRNMKRRRESSPFRKADRGKFTLAPWVLDQLNWALPASTTEAGVRSVSGPVPRT
                     QHGGGFEVAKTTDATQPDTPADASPGISVPLPVCVNEAAPIADANSTNPALDTPT"
     misc_feature    93578..94864
                     /note="possible transcribed region"
     gene            complement(93615..94921)
                     /locus_tag="CYME_CMJ032T"
                     /db_xref="GeneID:16994110"
     misc_RNA        complement(93615..94921)
                     /locus_tag="CYME_CMJ032T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461347.1"
                     /db_xref="GeneID:16994110"
     gene            <95117..>96133
                     /locus_tag="CYME_CMJ033C"
                     /db_xref="GeneID:16994124"
     mRNA            <95117..>96133
                     /locus_tag="CYME_CMJ033C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534727.1"
                     /db_xref="GeneID:16994124"
     CDS             95117..96133
                     /locus_tag="CYME_CMJ033C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534784.1"
                     /db_xref="GeneID:16994124"
                     /translation="MDPNRKKLCCFLGLFLPAGKLLTKRKQRKRESSAFAGRCSPALT
                     LCAVTTSEQTPKPVQSTAAEDSAESELQLQLLGPLRRRSLWERVDHYRQQVAAETPSL
                     PSTRNALLSNFVPRNKAAAEEGLGLEWDEAIEELACGAPATICPVIRFTCRRGHVVSV
                     AANSKLASRGECPVCQYAARCGRASSLREYRPLQSKRFERYTLDMLKAAAMERGGELL
                     STEYVNARRKLLWRCGQCKHEWFATTDNILRLGSWCPKCARRQGRNRVTLADMQAIAD
                     MHGGVCLSKEYRGAMVPLQFRCAEGHEFWANPNNIRRGIRGHGTQRKPSWCPHCARER
                     RQKS"
     gene            <100436..>102151
                     /locus_tag="CYME_CMJ034C"
                     /db_xref="GeneID:16994125"
     mRNA            <100436..>102151
                     /locus_tag="CYME_CMJ034C"
                     /product="bZIP transcription factor"
                     /transcript_id="XM_005534728.1"
                     /db_xref="GeneID:16994125"
     CDS             100436..102151
                     /locus_tag="CYME_CMJ034C"
                     /codon_start=1
                     /product="bZIP transcription factor"
                     /protein_id="XP_005534785.1"
                     /db_xref="GeneID:16994125"
                     /translation="MSEERVHQSSPPACFRGPESTPSVSSTDELAGTKREHLVDSERS
                     YLQLPALTDHSDLSLASLPLLVQVSDTQSGDSAKSDSERAYALVHVSPIATVREVKQE
                     LVKQGIIPVEDLPSVQLIFGEETLSENSPLTEYFLPELYDYSEALLRMIDQGGLDVEQ
                     KHEAMERALQVIGSMRDGISSGRESSSTKPSVASAVQRAAAPGSERLQLPGIDMLPRP
                     LGTSAVHLENEGATDVVATRNVSPGKGVTAAPLWSPMLPSLSPTGASVIATEPYALWT
                     PMQLSTPMDMAERLHMLEPRLFTPEGVSAVGAFVPLSARLRQQNGGHSARLIAQEPAL
                     QPGGGAISGTSSFVDARTRSLAEAGPLESSVIRGSEAPCDIPKKRAKYARAASGARTS
                     TAGSSYSSDMTGQSRCDQDCESPQPGDASSLARSGPHEHTASVQSAANQRLVSNLKNL
                     PDRWVMEGAHEGQVPVRGRSQASQGTEASSSDSRPVRLASLSPEERRRRRMEQNRKSA
                     ERSRLRKKELEQRYRAAVRQLSEENAELRRQLDSFREQIQRMQQLLAVQMRATSAPLD
                     TPSQQ"
     misc_feature    complement(102336..104590)
                     /note="repetitive element"
     gene            <105729..>106115
                     /locus_tag="CYME_CMJ036C"
                     /db_xref="GeneID:16994130"
     mRNA            <105729..>106115
                     /locus_tag="CYME_CMJ036C"
                     /product="cytochrome c oxidase subunit VIa"
                     /transcript_id="XM_005534729.1"
                     /db_xref="GeneID:16994130"
     CDS             105729..106115
                     /locus_tag="CYME_CMJ036C"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit VIa"
                     /protein_id="XP_005534786.1"
                     /db_xref="GeneID:16994130"
                     /translation="MATRHMLWMLGRYIRKVPLGRLGDSARARALSSSAARGHASSSH
                     VAGSEGAHANATFERWRLMSALGALPVLIYGVWLFRQPHEHAEPPPPYPYLRRRVRDP
                     AFPWGNHELLGTPWDHESPHAHTDSE"
     gene            <106446..>107876
                     /locus_tag="CYME_CMJ037C"
                     /db_xref="GeneID:16994127"
     mRNA            <106446..>107876
                     /locus_tag="CYME_CMJ037C"
                     /product="probable GTP-binding protein"
                     /transcript_id="XM_005534730.1"
                     /db_xref="GeneID:16994127"
     CDS             106446..107876
                     /locus_tag="CYME_CMJ037C"
                     /codon_start=1
                     /product="probable GTP-binding protein"
                     /protein_id="XP_005534787.1"
                     /db_xref="GeneID:16994127"
                     /translation="MRKMLDTMLKNAPERPAASDIRIPGEPGGTGTSRARAHAPRIRA
                     PEHGSLSTSGPLPSSALAKLGFSTKVSGLRALVLRAVAGRGGPGCVSFARARFRRVGP
                     PDGGTGGDGGNVIVQVSASVSCLPSHRHVVVVRAENGAPGQRWERSGRRGKDVRFVVP
                     PGTWLRWLRDPSTIDSSRPHVFLNLNDTEDDQRMNDAVQALSALEPSCFARNDASDSV
                     KFDVDDGAATSASSDFPASVKSAPAHVLVKSSVVAAAGGKGGHGNTFYQSSVNRSPKQ
                     AQAGLEGAEQLVLLERLPVADIAIVGAPNAGKSSLLATLTRARPEIAPTPYTTTEPML
                     GVLEDHQTWMRSILVEIPSKTLEDAQQSPELVWHLFRACRHVVAVVDHQRTAGNTRLL
                     REQVRALQRMVAPRVLAGCVVRSHLLQGQPQKDQAMPQHMEGVALLTRLADVRQALLK
                     LTTEPPWVLHTDNEQGTRHSQRMLGR"
     gene            complement(<107901..>108968)
                     /locus_tag="CYME_CMJ038C"
                     /db_xref="GeneID:16994140"
     mRNA            complement(<107901..>108968)
                     /locus_tag="CYME_CMJ038C"
                     /product="similar to hydrolase, conserved unknown protein"
                     /transcript_id="XM_005534731.1"
                     /db_xref="GeneID:16994140"
     CDS             complement(107901..108968)
                     /locus_tag="CYME_CMJ038C"
                     /codon_start=1
                     /product="similar to hydrolase, conserved unknown protein"
                     /protein_id="XP_005534788.1"
                     /db_xref="GeneID:16994140"
                     /translation="MNAGTRMHARCVQCTCSAVAIAFGMAFLSVPFKGFNSTFRSCHE
                     SRCESVSPRPGLGAETRRVRKPSVHLGGLRATTTLPTSALKRLTPVAGRNKVVDIEGF
                     SIYYDFQLGTVRPFVFFLPGLAKSRMHSKASELEVFCRQTGQGMFCADYAGTGRSSGV
                     FTEIGTLSLWTSHAEALLEKVLGACGRVLLVGEGIGGWIALLLAMRRPERISGIIGLA
                     ADPDFTEDLVWPRMTPEQQRQVVEKGSIMWKHGFEEYPISRALVEDARSHLLLRGEPG
                     SLPIDVPVRLIHGLNDEEVPAERSILLAQLLRSRDVTVTLVKHGDHALERQEDFRRLN
                     DTITELCSAYFEFDLRTPQSG"
     gene            <110762..>113929
                     /locus_tag="CYME_CMJ039C"
                     /db_xref="GeneID:16994119"
     mRNA            <110762..>113929
                     /locus_tag="CYME_CMJ039C"
                     /product="ATP-binding cassette, sub-family A"
                     /transcript_id="XM_005534732.1"
                     /db_xref="GeneID:16994119"
     CDS             110762..113929
                     /locus_tag="CYME_CMJ039C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family A"
                     /protein_id="XP_005534789.1"
                     /db_xref="GeneID:16994119"
                     /translation="MGLVSFRQRSYRWFDRFSVMLTRNLRLVYRDTFALVLVLLVPFL
                     FTFFVFIAHLSYNDDAIFSRTTGPKPDPPAIPLSSYVEPCRAVVSDRCYNFAVVPGSN
                     STVVGWVQEVSRRLGLSTAVNESGGIITFETSDALNEFMVANPNVTQAAYVFEPEQLR
                     AIDAGRISFTVQYNQSCQQTFPGFICRYQEVYLVPGMIAAMNDVLLGTRLNLSSAFMP
                     HPKLQSALDAFEEFGPFMMFGSLVIVFVYYLMVLVGEKELKLREALKMIGLSQSLYFL
                     SEGVVFILVSTLSVFLLYAFGALFQFQFYLKNAFGCVFFTYWIFSLSLICWAFFFHVF
                     LTRSNQVSSAAFVFFILSYLLGSSGAYLYYDKPSGGPFVSRSLLFLRYVFALLSPVMF
                     YKCVTDLSIYSAVFTGLRWSDRASYTNLWPLTQCWSWMIWTGIVVLVLAIYLDNVLPN
                     VYGVSLPWWYPFSAAYWRGDALHLQQQKRKAWRLFRRHRRQRSQTDTTGDADDAEADE
                     AVSAAIAALTAQQRHVDADDAVNGKEGYEPKDAAAAAALTKSWAASALEHNGDMPAID
                     ASDHEGIIVAPETDAKAASAPLILASSSSSPMSSSTELESAREPDTTASFLERLQSMV
                     EVAREPSHRHSDDTPEAKTADAAVDADVAAEREAVLSGRGLSPASALVIRRLTKHFRK
                     QLAVDDLCLSADHGALTCLLGPNGSGKTTTFNMLTGVFRPTAGDAWVYGYSITQEQQL
                     LRPLMGVCPQHDIQWANLTAAEHVYLFATLKGIPRSKRHDEVSRRLEQVDLLRVSHKY
                     PRQMSGGMRRRLSVAMALVGDPLIVYLDEPTTGMDPSMRRAVWNMIAAAKPGRTIVHT
                     THSMEEADVLGDRIAIMYRGRLSVLGTPLRLKHKFGTGYRLSVTVQATQSEALHDRLR
                     ALYPRVKRLSISTLADQRYVLCEYELVPLESTNLFRTSDGGGTNQYRSVQAQRRLFQE
                     MENNASGWGIADFSVSGTSLESVFIRVFELNEQLQHTAEASARAAAAEPKRRTWPWLR
                     WPWVKSRRGELQSQPMQTAETETRR"
     gene            complement(113689..115731)
                     /locus_tag="CYME_CMJ040T"
                     /db_xref="GeneID:16994138"
     misc_RNA        complement(113689..115731)
                     /locus_tag="CYME_CMJ040T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461348.1"
                     /db_xref="GeneID:16994138"
     gene            <116250..>117818
                     /locus_tag="CYME_CMJ328C"
                     /db_xref="GeneID:16994139"
     mRNA            <116250..>117818
                     /locus_tag="CYME_CMJ328C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534733.1"
                     /db_xref="GeneID:16994139"
     CDS             116250..117818
                     /locus_tag="CYME_CMJ328C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534790.1"
                     /db_xref="GeneID:16994139"
                     /translation="MNEPPTFGSASALTDPRSQNGVPERADAFPGRYEQRVPFTVRCV
                     RTGSERTQVPLRVQLRADGADQEAGDDDASAPPWESSERYARGMGVSAASASELSTGR
                     RVAHVGPLALRTLRLRITDPADPIFLYEWRMTEEEYPRFKADQCLFVDFGRFPRTLVD
                     LFEQCRREGSGFHALLRLEDGAARLSVFETTAFRNLPHLALELQAASGERLQRYLVSS
                     LHSAERRATRLEESMEQMRRSLDERTARVQELMGQVAQLQQERSQAAEAARAQHQAEL
                     AEVREQALKEALQRQEQWQQERRALEERYREEIATLSERIRQNETDMQRLTDERYARE
                     QQIRQLELRLSAQQSEHETMRSELDRVRQDLRERARAVHELERQLDAVNAQIQGLERA
                     LQDKDAWIERMRQMLELANAQKSTLEETILAHREARARLERQLEAAAAEIERGNSLLE
                     RLQSALREAKTKARLKAAVAEQQEALLRERQREIDALREQLTALTTHTRPWRAPGAPP
                     EPTSASASSEISAP"
     gene            complement(<117958..>119364)
                     /locus_tag="CYME_CMJ329C"
                     /db_xref="GeneID:16994062"
     mRNA            complement(<117958..>119364)
                     /locus_tag="CYME_CMJ329C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534734.1"
                     /db_xref="GeneID:16994062"
     CDS             complement(117958..119364)
                     /locus_tag="CYME_CMJ329C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534791.1"
                     /db_xref="GeneID:16994062"
                     /translation="MAAAGQRQRPPLRQLDSLWVFTAREAVSRGTATKATRASETTAP
                     DAGALREDERRRRLVMAFMDRLCQRIGEPVTTSSSPSTTTLDAETAAGSHRAERSGVG
                     ERLRASLRLPITTLIAARLLFHRFFLLERFDATFDELDIATACVSIACKATENVVRMR
                     DLVRQSYALRTGGCLLLDEQLHQDLYVRCRERIAQAERDVLQTLNWDLDVGESVHRTM
                     FHQWALLEKLIRARNGDTVPWSETSVRTMLQVACSFLNEAHRTVCACLYPKEELAAAA
                     LCVAMCLCRLRAGEDIAQWLRECHIDAPTLASALDRFRADYFARLCRAQRRAADAAAW
                     QRLPASARALGAPSGATLAECAVEIVADTAQETTSRQLAGASRAPPPHAVGKHQQAEA
                     MRKEPSPSSGPLIRKPRHTSSDGRHAAEALQQQQQQQQQQGSYRHYKHHQWPATGKRR
                     RPKAETGPRSTPLEPPFQ"
     gene            119801..121750
                     /locus_tag="CYME_CMJ041T"
                     /db_xref="GeneID:16994060"
     misc_RNA        119801..121750
                     /locus_tag="CYME_CMJ041T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461349.1"
                     /db_xref="GeneID:16994060"
     gene            complement(<120540..>121751)
                     /locus_tag="CYME_CMJ042C"
                     /db_xref="GeneID:16994122"
     mRNA            complement(<120540..>121751)
                     /locus_tag="CYME_CMJ042C"
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /transcript_id="XM_005534735.1"
                     /db_xref="GeneID:16994122"
     CDS             complement(120540..121751)
                     /locus_tag="CYME_CMJ042C"
                     /codon_start=1
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="XP_005534792.1"
                     /db_xref="GeneID:16994122"
                     /translation="MVFTCAAFVAPVGGFRGTAVRATSREAVGPRLQAGDQPGAFTAR
                     TRSLGVPLTRSRQRAAHSNLVMKVRVAVSGFGRIGRNFVRCLQATPNANLELVGINDT
                     AGIKTAAHLLKYDSILGIAPFDVKVSGESTMLIDGKPVTVVSNRDPTQLPWRDLNVDI
                     VIEATGVFISRDGAGKHIEAGAKKVVITAPAKGEGVPTFVMGLNNTQYNHATDHVVSN
                     ASCTTNGMAPFVKVLDEEFGIVSGMMTTTHSYTGDQRLLDASHRDLRRARAAALNIVP
                     TSTGAAQAVALVYPPVKGKLTGIALRVPTPNVSIVDFVCTVKKPTFKEEVNAAFVRAA
                     EGPMKGILAVSDEPLVSSDYRMNVNSSIVDAALTTVMGDTLVKVVAWYDNEYGYSQRV
                     VDLANYIAQHF"
     gene            <122308..>123858
                     /locus_tag="CYME_CMJ043C"
                     /db_xref="GeneID:16994123"
     mRNA            <122308..>123858
                     /locus_tag="CYME_CMJ043C"
                     /product="phycocyanobilin lyase alpha subunit"
                     /transcript_id="XM_005534736.1"
                     /db_xref="GeneID:16994123"
     CDS             122308..123858
                     /locus_tag="CYME_CMJ043C"
                     /codon_start=1
                     /product="phycocyanobilin lyase alpha subunit"
                     /protein_id="XP_005534793.1"
                     /db_xref="GeneID:16994123"
                     /translation="MFLSLADIRRCSLRDRRWSGRRRAQPRSVCWQCAQRNASTRRQG
                     VAREDLYRVLGATRDSSPAEIRRAFLEQSQRWHPDRNPGDERASERFEAVKTAYQVLR
                     DATLRAAYDEAGFAGLDAVISVESRHERMKDALKEVQQLERDNASTEELAFWGLDGSN
                     LALLEGAEPVVPSDGGASSAVDQPTDARPRSVAEAIANLNHPDEGYRYYAVWWLSRFR
                     VREAADALVAVLRHSTDRTALGGYPLRRRAALALGNLGALEALTFLQEALGNDEDWHL
                     RHRAAEAIAKILMQQPSYMPNSQLTEALLSRLETFQSEAHNETESVTLPPGFDLSTLD
                     EAKRARLLEIFAKRRADEARARRSTQTPTLGVDLQSAMMQEPYEWLLKALGYVAGRMR
                     SDPAVWARYEDRFVSAMRPLTKHPVPLVQYAAHKAMYQATGKVEHLHALHGALEFGAE
                     HHFSQRVLVRDLGELGQLESASAIANCAMVENSFKVFAIRQIIQRCNLELTHSALDPL
                     FHLLDDLL"
     gene            complement(<124249..>125187)
                     /locus_tag="CYME_CMJ044C"
                     /db_xref="GeneID:16994121"
     mRNA            complement(<124249..>125187)
                     /locus_tag="CYME_CMJ044C"
                     /product="phycocyanobilin lyase beta subunit"
                     /transcript_id="XM_005534737.1"
                     /db_xref="GeneID:16994121"
     CDS             complement(124249..125187)
                     /locus_tag="CYME_CMJ044C"
                     /codon_start=1
                     /product="phycocyanobilin lyase beta subunit"
                     /protein_id="XP_005534794.1"
                     /db_xref="GeneID:16994121"
                     /translation="MFTTWTAHCVQRWRRSAAAARAPRCLSAPTARTWAVASRRYRPA
                     QRLQGPARTEPRMSGVNGGLAYDIDEQQLPDQIKPLVQMIVRGPDSPAAFIDAMERIA
                     DWLWQQQQSANDRGTRPPDTLIPFLVDSLGYNNPVAARIALDLLVRLYGKGAVPVLLQ
                     GVGALNYAVNAYALRALGAIGDADAVFTVAKQCALRGPIPNVRRAAVRCLAQLKYEES
                     ANGRARCEDAVASLSSLVGDPDWTIRYALVWSLSHLLHRKFIEKPEITNILAHIANQD
                     ADVVVRARAQRALAQFNEATSSPASSTARCVHAADT"
     gene            <126607..>130653
                     /locus_tag="CYME_CMJ045C"
                     /db_xref="GeneID:16994133"
     mRNA            <126607..>130653
                     /locus_tag="CYME_CMJ045C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534738.1"
                     /db_xref="GeneID:16994133"
     CDS             126607..130653
                     /locus_tag="CYME_CMJ045C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534795.1"
                     /db_xref="GeneID:16994133"
                     /translation="MSCADGALASLMTTVHNAIANTATCLQQCLETLTEDLRSQLCSG
                     QQQQVVPQRRRELFFRLRAWAAATARSKVRILEFATSGANALRQNGVISFDEQLLEWF
                     ATQLAHVQPEDRNGNSIVSPPETHHLAALFVLVEALRSWIQVQTKLVNLQRTGQHTKK
                     RVQELETLEEWYEWWRSKGLAALWRIVSEAFLKLLYGLASERGLLEFPASNLRSTAEA
                     HLGMRLWLISVLERMMLLWMEVFLQNTVDPAVEISDTDSSTESEQSIHLPPSGWPEAL
                     ALYSVRLVQGVAAVFAFASREASRSSPSLSSSLPTPSSPYLNLALTTMEATRILSRVH
                     CTCWASPEQAKQFLISLMRALFKSTDPALRTTSAVTFEEVARDALHFDVMRLVVRSHG
                     LDAVCLAMEQIAAGEVSSPSGLWMALCHCGSAWMESPDVVNALVAADLQEAEQTDERM
                     VDLVDGFLNMWDSTLWHASQRQAARTFTDESPGRPQQAAARGLDSIPEVAPDHEHYAG
                     FFLDCTYQIIESFLVSFLPRYVSALVARQCPPTLDWFPESQCSARLAVVASLLRWATR
                     PRLAAETSSSGAPILPHGLQLVGILERLVNQTLAHWQEAANSTSTPAGVLLVLLLTLL
                     GELIGDENLHDMDASASMHVPAAVMLQTCASLGIEHWCPWLEAVLHPPVRMLAAVAQQ
                     APALATCASGTRSDVDLAVMATLFDTLRRWSVITGPGPDPQAAVHRLCANWLLPAETA
                     VHLRSLLASNRFVELLGFSDEAQTSWRFLWLDRIRQTLDTVCVLHATNGAAAAAAALN
                     LLLQASRSWPSPASLAAETAWWEQLVALALPPQEEPWCERGYPWRPSELIRLGECLGW
                     AATKLLAVDEVHTMGPLSLWSACVTWWLQWIHPRVATLSNGNAIDHVRSGMAGAVSLS
                     PRDVSQVEERALHTLCLLRGLSRVLQRISMPDIVDPMDILAIAQQALCTFFAISRSCS
                     GVLRAVFYWLADLVRARVLSLQRLLEALGEPLFQTALETWLEPMARADRWCTPSSDFA
                     GSVVDHTTENLISWLAFWRAICDRCPVPASQRYVRSGSAPHAAGASSGALAPAVYQRL
                     WQMGLGQFLTLLHRADALWQILQVPCLQSELAAAIAAAAWLSIPYDTCLSVHDRNELR
                     NVLYVLLTRAHSASVVSSAAEAVADIWTHREASAYQISEAVLNPPDGVPKSAADDLDS
                     ERDAWIRFVPVVLQLLLTAFGSFRTQEALEDALFHMLLGMRCPPAVLHAQFMLVDWFA
                     VRAALLEPIGTDQHLECSAGGAANAVATEPVARCCRLASEALCAVGCRDPHDATNGTS
                     VQACFRREWRRWLQALRVQVFLEQVAET"
     gene            <132595..>135072
                     /locus_tag="CYME_CMJ046C"
                     /db_xref="GeneID:16994118"
     mRNA            <132595..>135072
                     /locus_tag="CYME_CMJ046C"
                     /product="similar to kinetoplast-associated protein"
                     /transcript_id="XM_005534739.1"
                     /db_xref="GeneID:16994118"
     CDS             132595..135072
                     /locus_tag="CYME_CMJ046C"
                     /codon_start=1
                     /product="similar to kinetoplast-associated protein"
                     /protein_id="XP_005534796.1"
                     /db_xref="GeneID:16994118"
                     /translation="MLEAHCSLLFVNASRLTAPESPFEWTSSVQRGRRLCSSRVAVQE
                     RFQLIAAADDKSANSSSSQKPKKEVGHGGSSSSVGQSPANGASVPRTEAKPSGFAAAA
                     DGAREAHSAEKPDQSADESVERTPARKTPARGQRQRQLTENLVRLADAAGKPIAALGG
                     GARARLDAAIDEILKNTDPQQASKRRAVSVLKGAADTTWTWWRTQAIPRFIRPRLPEP
                     LALRSDEAVAAGLHALFFVVFFALPGLFHGSPGTEKEALIKRHELESQTSRLEQRLSR
                     PSDGTQAPEKKPRDQGTQMNGSRSAPKSFATKGGVPSELSTRGSGREPSAAVPPRAPA
                     PEPSTLPPRALGNVVAALRDALPAEQRDWISEASYDSLSAEPLIVVEVRPSTFFKSTP
                     SDQIAFTTKLLDAAQKLGVNALRLVDGEGNTVASAGGRTVALSGTERRLQTEIRALRK
                     ELERAGAETAAARSETAAAREELAMAKETYAKERAELERNLQAIKAENVRLAADLQDA
                     QRELEQQPEREALLARAEHAEEERQKYAVAVESLGEQVAEARSAQQKAEQEAAQARSK
                     EAEAKEQLRSALNDIEAKLEGQRAQFAAEQQQLKAQHEKELAAAREEAQAEIRRLRDA
                     LAHAEQSKAEAVSQARSETQAEIEQLRKRLAEAAKERETAVAAAKQEAAQSMQALEKR
                     LQEAAAEQQRQLAQLEKQSQEQVRALESQLEKAKSNTETAVREATARLEKETERLLQA
                     KEQELVASRAAVASLEADSEKQMKRLRQESARQIASLEKQISNERKTAEQLRKRLQTL
                     EQRLRSRPGAPAESETPASSTATPATS"
     gene            complement(<135315..>136961)
                     /locus_tag="CYME_CMJ047C"
                     /db_xref="GeneID:16994136"
     mRNA            complement(<135315..>136961)
                     /locus_tag="CYME_CMJ047C"
                     /product="histidine--tRNA ligase"
                     /transcript_id="XM_005534740.1"
                     /db_xref="GeneID:16994136"
     CDS             complement(135315..136961)
                     /locus_tag="CYME_CMJ047C"
                     /codon_start=1
                     /product="histidine--tRNA ligase"
                     /protein_id="XP_005534797.1"
                     /db_xref="GeneID:16994136"
                     /translation="MFCAVTLRTAALSKSFRSAFLAQSTTAHIRSCSARVPRRTRALE
                     RTCAMSTGRRVCKVPKGTRDFLPEQMAIRQRVFALVTSVFERHGAVTIETPVFELKET
                     LLGQYGEESKLIYDIADQGGELLSLRYDLTVPFARFLATHGIVSLKRYQLGRVYRRDQ
                     PAIARGRFREFYQCDFDIAGQHPPMVPDAEVLRVLIEVLDEFAALSPYHRQRLGSYQV
                     KLSHRGLLDAILQLCGVPKELLRPICSSIDKLDKEPWDVVRKEMIDVKGLTAPCADRI
                     GQFVTRAGKPRELLRELQADHSLCCGKFGAEEALADLERLFSYLEAMGNVLERCTLNL
                     ALARGLDYYTGLIFEAVLTDGSTPLGSIGAGGRYDRLVEDFAGKPVPCVGTSIGIERI
                     FSLMEEAERELAQATGRVIRASKTQVLVVGIGKVDLVQRLKLCDELWRAHLAAECLYA
                     ERPKMARQLQYALERGIPVLAILGEDELAAGVVGLKRLSTQEQIQMQRGPPLVQAIRD
                     WLASESNQEAGQESVDRDGNCRPEPVASVRDPTATTPGAN"
     misc_feature    137784..141119
                     /note="repetitive element"
     gene            complement(<141949..>144291)
                     /locus_tag="CYME_CMJ049C"
                     /db_xref="GeneID:16994135"
     mRNA            complement(<141949..>144291)
                     /locus_tag="CYME_CMJ049C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534741.1"
                     /db_xref="GeneID:16994135"
     CDS             complement(141949..144291)
                     /locus_tag="CYME_CMJ049C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534798.1"
                     /db_xref="GeneID:16994135"
                     /translation="MSTKRAGQRSEATPEARAEARNLVAEPRIGIYEGRRRLALERWL
                     SEPPAPSHSSLQNTLNAVFKEPWRTLEEPPPRVSFLCRVTSVVWDIFVALSAGVIWIA
                     DAILLRVLLGARLVSSTSTAAQAALRRRQTRLERQRLLERLGQADSYSSYYETAAQLD
                     WLEGRSRWKTSLTDAFQLYDRKGLMRQLSQLSALYRQGDIQRLMFNLRGCLTRDFCGI
                     HRAELHRRCRVGTKREVEDFVYVVSWLLEYIATTEDPTVSWRERLEFFNQVRHAYGKS
                     ALLLSGGSTMGLSHFGVLKALQELRLLPRILSGASAGALVVAFAGVFSDEELIECLES
                     FRNPWTGRPLRFEIFDPSLSWYRAMRRFAKRGVLFDIRRLQGCMRENLGDLTFQEAYN
                     RTKRIINMTVTPAYGPPVLLNYLTAPNVLVWSAACASAALPLIFAPVELFAKDERGSI
                     IPYHPEGFQWSDGSISADIPLQRIGEMFNVNHFIVSQANPHFIPRGSMLMKARLMQAI
                     KAELKFRYSQLEGLGLVPRIFRMTISILTQPFEGDVTVLRDLSLADLRKLFRNPTLQD
                     IRAAVARGQRLAYTKLDEIHHNCLIEFTIDDCIEYIGRRFQDAATAVVTPRSSAETSS
                     TSRLFPRVPSWLWADFGSFGGGSANRSPPASPKTRGERRVHRISLGHGQRHATDATLE
                     TIPDTEAGEESACDESFHVRRASPDIRALHWKPASSSMTCRSPPRRSHSAEVLHKSDE
                     YLRISDSLDKRQPHGEERSEFPSSEQSPSDSADEDERVMC"
     gene            <145094..>146632
                     /locus_tag="CYME_CMJ050C"
                     /db_xref="GeneID:16994114"
     mRNA            <145094..>146632
                     /locus_tag="CYME_CMJ050C"
                     /product="lactation elevated 1"
                     /transcript_id="XM_005534742.1"
                     /db_xref="GeneID:16994114"
     CDS             145094..146632
                     /locus_tag="CYME_CMJ050C"
                     /codon_start=1
                     /product="lactation elevated 1"
                     /protein_id="XP_005534799.1"
                     /db_xref="GeneID:16994114"
                     /translation="MSAPALSRVTPSQLDGACNWSAGTACAALLAHGRSQRRPLPQHR
                     AWVRRIRGERRFLSTLKRPSTQESLEAVYLDYVKLHGLQRDLEQLRAVQVLQKVRDDL
                     VAYSQVSVAQQGAARQPPKGAYLWSTLPGTGKTMLMELFYNNVPLSNKKRVHFSAFML
                     EIHDRLHNFRKRVHNWDNEPRTKHQSNYGLFRIVLRALLGRPEEAARAEQHDLSTNPI
                     DIVAGDMANVCQLLCLDEMQVTDIADAMVLRRFYDVFRSRGGTLVATSNRAPANLYEN
                     GLQRDLFIPFIDAVQRDCHVVKLDSRVDYRLQALLEESADTSQLPLFIYPQTPANRER
                     FEQLLDKLAKRSEGSVRGSVSPVRYETVVVRTLGRALRVERAFPRASIARFYFDELCD
                     RPLAAVDYIALAERFQTFFLENIPSQIEDRNIARRFITLVDILYDRRARLICLAGGSP
                     EQIFHLPDEKSDEAFAAQRCISRLLDMQTKTYIKATSDPTEHLRESEKPRVATIEATS
                     SLIY"
     gene            complement(<150009..>151844)
                     /locus_tag="CYME_CMJ051C"
                     /db_xref="GeneID:16994134"
     mRNA            complement(<150009..>151844)
                     /locus_tag="CYME_CMJ051C"
                     /product="NADP-dependent malic enzyme"
                     /transcript_id="XM_005534743.1"
                     /db_xref="GeneID:16994134"
     CDS             complement(150009..151844)
                     /locus_tag="CYME_CMJ051C"
                     /codon_start=1
                     /product="NADP-dependent malic enzyme"
                     /protein_id="XP_005534800.1"
                     /db_xref="GeneID:16994134"
                     /translation="MVGFRIRHLVRTFTQQMKKSPSIAEQTHLRGLDLLRNPRYNRGM
                     AFTLQEREELGLQGLLPPRVLTIETQKKRIMESLGRCATDLDRYLQLIWLLQRNETLF
                     FRLLIDHVTELMPYVYTPTVGEACQRFGHIFKTPRGLFISFEDRGKIRKILDNWPEKD
                     VRVIVVTDGERILGLGDLGASGAGIPVGKLLLYVACGGVEPQRTLPVVLDVGTENLEL
                     LQDPLYPGLLRRRVRGADYDAFVDEFVEAVQNKWGENCLIQWEDFGNANAFRILERWR
                     GRHCSFNDDIQGTAAVALAGLLGALKMPGVKSNLSEHVFLFLGAGSAGIGIADLISLY
                     MVKQGLVGTVEEARKRCWFIDSKGLLYRGRALVTKEKQRYAQDIATETLATLGEAMEG
                     VSDATASKPDADAAASQQVPQRRIGLADAVRLLKPTALIGVSTIPKAFDADILAQMAA
                     NHERPIVFALSNPTSKSECTAREAYEFTGGRAVFASGSPFDPVKIQTGGDAQERCFVP
                     GQANNVYCFPGCGFGIHLAGATRFTDEMFIEAASAVAALVDESDLRQGCVFPPLSKIR
                     DVSAHIAVAIANEAARTGVATRRGSGSQGQFTPADAYALQYDPAY"
     gene            <152813..>155008
                     /locus_tag="CYME_CMJ052C"
                     /db_xref="GeneID:16994143"
     mRNA            <152813..>155008
                     /locus_tag="CYME_CMJ052C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534744.1"
                     /db_xref="GeneID:16994143"
     CDS             152813..155008
                     /locus_tag="CYME_CMJ052C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534801.1"
                     /db_xref="GeneID:16994143"
                     /translation="MADIRTAFQRAKQAAELQNDRGEQRQLLVEQQQWRNYNGAPNTV
                     VACPVCSELRFASSIESHLTVCLERAVSPGDDALQVTLDRCTRRLNCSTEPHMSQVTN
                     TVTNRALEHSVLRTLTKGPYTYRLLALSVHWCLQFERHLFSAAELDYLSAFVSLATAS
                     QWLYSWLFFRKGFSTGRWFRACSLQTRYREVDVAKASRELIQHGFLKDRPACTDDYFR
                     LLKSLTQAEVTTLCRDLGLQSACMLKTCVAGALFQTNKQKITPARRKLEETILPAVCS
                     CPEALQALLAAWAALAPLGLENMLRDGLELKDPLPPCLVERPLFSSRSALEAFQSARE
                     LEQSFEQMLGTSEPAALEISMTAEQRLREALKTSDEALIATRVTRYDQLCDLQRLYRE
                     PYTTVGVLANILWHSVSVAESHGHYLDSVRRLELLLNANLCLRRRGKFYDRLSLILAQ
                     RLADRAGAFRVCLDSLSDAFVRDAERSVLWKRASRLCRELGVDVRLPNDPALSIPIPE
                     RVLRGRALPGSGRRGGSVKFAGLDNTLAITVENLALQFYEAELGYTGAHLEGRTFEAL
                     FFIFFEDMLRLPVVDAFHVPCQAQPLDFGTEMFYVNRADNIRKRLLELSMLSESELSQ
                     WTREQLQRSAIESRRWTPTQAPVPWDVIVAGLGAQGLVQILTRLVTDLYYWRSGAPDL
                     LLWRSSGKSSCKLVEVKSTNDTLAPKQRRWLQELIAAGIDVELCLVRNH"
     gene            complement(<156571..>158964)
                     /locus_tag="CYME_CMJ053C"
                     /db_xref="GeneID:16994144"
     mRNA            complement(<156571..>158964)
                     /locus_tag="CYME_CMJ053C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534745.1"
                     /db_xref="GeneID:16994144"
     CDS             complement(156571..158964)
                     /locus_tag="CYME_CMJ053C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534802.1"
                     /db_xref="GeneID:16994144"
                     /translation="MLNGSTIGRPSSAYPGASHIAEATTPGEIGGPVEETELNGYLSA
                     NRKVAQATPLVQNQVHGRSTAHAFDEHIHVGSPPVQNGISQLNGGNFGPLVTASHAND
                     GVAFEFHPSGIFIPSSRNSNQQGPPGAFAPEWAPCARTWTAAPAQTVAGAVYTYPHRN
                     PAAWANSADGRYFSRSLGRGLSPGHSNAIPIHGVQKLGHTASPLKQESIEPGCLTDYY
                     DRNRVAIQLTGKLIASGQLESLLEQSPEDEHVTVWHPATGRTVAGNAAPYRRNLDAWL
                     EKNPGWVEKSFEEKSSKRRRASRRSRAAMAAFSSLSTANDHVRDILKEVDQKVREALR
                     ERRRTGTPEEAMMVAETVPIASEASFQDSFTTTVMNYVLKDWTSDEVVRLVELIVRCS
                     EELAHLGHGVDSDDECCDLAELAEHGSIEANITESFLNCRKHRSRGPCSVAMPLRTCA
                     AQREVAPGSGGGVGGGSGSGGGQLVPLDMDDIQFVPSPVRNETPCEIHPHSTDTNSAW
                     RKIFEALPSKHPSSVILRTHILFSQVLLAAAHRGTLTNLIQSPSPTSSTSLGRTHLEH
                     LNRALSSSHDSSYGAEQLAGFASLGLHAHSPSVSPATGLSCSAPTESNGTPRSMFRDV
                     RVTVWDPTTGKTISGNAAPCWRNLEIWMKEHPGWCVKPEDELSASRRSKHKRARELGI
                     PCSSSPFPASVSGFETALAEIRTRSDRLPGSRCAVAAGQADYSSMAHSLPDEHDCIEG
                     LLMMHAGRPLGNARAEVADLRASPYGKPPLPPQPLLLTTSSDQSSTPETMHANGETA"
     gene            <159964..>161562
                     /locus_tag="CYME_CMJ054C"
                     /db_xref="GeneID:16994137"
     mRNA            <159964..>161562
                     /locus_tag="CYME_CMJ054C"
                     /product="glutamyl-tRNA reductase"
                     /transcript_id="XM_005534746.1"
                     /db_xref="GeneID:16994137"
     CDS             159964..161562
                     /locus_tag="CYME_CMJ054C"
                     /codon_start=1
                     /product="glutamyl-tRNA reductase"
                     /protein_id="XP_005534803.1"
                     /db_xref="GeneID:16994137"
                     /translation="MEGLTAFVACAGVRRAVLSCSARFCSQSKVPNAYNAGTKLLVTA
                     CRGGARLLVADAASEVAAKAEEPPARGSLESRQKQNGSRTADDRIVVIGLSHHTASVD
                     LRERLAVPESEWKEAAALVVEACPSVNEVALLSTCNRFEVYFACADTKRGILEVTKFL
                     SQRSGIEIPELRSHLFMLVEEDAIWHLLRVSAGLDSLVVGEGQILAQVKRCYERATEP
                     GGMAGKLLTRLLNAAVSAGKRVRTETGISKGAVSISSAAVELMVARYADDILGGLHAA
                     PVEDMNNVSAALTSTQVCIVGAGAMSRLLVTHLLSRGVTRITIVNRSLQRARDLLKQF
                     PDVDIVIRPMSELFDAVIEADVVFTSTSSREPLLTADNLEEHFSRAEAALHSRIFIDI
                     SVPRNIAEDVNRIDGVHAYNVDDLKAVVARNQLRRRRLMIEAENLLRDELRQFRNWQS
                     SLGCIPAITKLQDRAEDIRLEELAKVTGKLADLTDKERDAVERLTKGIVNKLLHGPLS
                     HLRGLQDIDERRETIKNLESMFRL"
     gene            <163524..>164969
                     /locus_tag="CYME_CMJ055C"
                     /db_xref="GeneID:16994151"
     mRNA            <163524..>164969
                     /locus_tag="CYME_CMJ055C"
                     /product="2-oxoglutarate dehydrogenase E2 component"
                     /transcript_id="XM_005534747.1"
                     /db_xref="GeneID:16994151"
     CDS             163524..164969
                     /locus_tag="CYME_CMJ055C"
                     /codon_start=1
                     /product="2-oxoglutarate dehydrogenase E2 component"
                     /protein_id="XP_005534804.1"
                     /db_xref="GeneID:16994151"
                     /translation="MIPHVRSVLGRLGRQVRAPLGLSARPVRVWHRDPRIPSWSHRYI
                     CWVGALACSEQRLQRPLGSLLQKMCKRGLSMPSATRSSPLETVPVPTMGESITEGTLV
                     ALLKHVGDAVKEDEVVAQIETDKVTVDVRSPVSGVIREIMAAEGDNVTVGKDLFRVEV
                     GAQGETVAAQQRQAEKLSQSEPEPNHIEPQEERSGGPAGSPPPPPADVEHGEEHAEAA
                     AAQLTGRSVVQRGAAAAAAAGALLQQDEAGERRVPMSRMRRRIAERLKHAQNTAAMLT
                     TFNECDLTSLSEMRASFKDGFEKRYGSKLGYMSAFVKASAIALEEQPEVNAVIDGDEI
                     LYRDYVDISVAVSTPTGLVTPVLRGVEKMSFADIELQLADFAKRAREGQIQLEELQGG
                     TFTISNGGVFGSLLSTPIINMPQSAILGMHAIQRRPVVVGDEIAIRPMMYLALTYDHR
                     LIDGREAVTFLRRIKALIEDPRRMLVGVYGF"
     gene            complement(167094..167184)
                     /locus_tag="CYME_CMJ325R"
                     /db_xref="GeneID:16993950"
     tRNA            complement(join(167094..167129,167137..167154,
                     167168..167184))
                     /locus_tag="CYME_CMJ325R"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:16993950"
     gene            <167332..>168075
                     /locus_tag="CYME_CMJ056C"
                     /db_xref="GeneID:16994037"
     mRNA            <167332..>168075
                     /locus_tag="CYME_CMJ056C"
                     /product="similar to vesicle transport v-SNARE protein"
                     /transcript_id="XM_005534748.1"
                     /db_xref="GeneID:16994037"
     CDS             167332..168075
                     /locus_tag="CYME_CMJ056C"
                     /codon_start=1
                     /product="similar to vesicle transport v-SNARE protein"
                     /protein_id="XP_005534805.1"
                     /db_xref="GeneID:16994037"
                     /translation="MPQVSGDLRRYELELSHVIESANADISSLASEAGAEARRHVVSR
                     ITHWLRTANDLLARMELEAKSTEGDDLDRAAAESVVSDGRQRVVRLRRSLRGVEQALQ
                     REELISRSQQSSGPRVAREVDATDAPLLDTTKEHRAGVAGVTDTLVKASLHIQDSKRV
                     LAETESVGANVLADLEAQGRTLERSYSRLQSMGSRLLSSSGIISTMRGTERMRRLLIL
                     GLVGAVLLSIGALMTIKVWPHKGGVVDGN"
     gene            <172607..>173266
                     /locus_tag="CYME_CMJ057C"
                     /db_xref="GeneID:16994149"
     mRNA            <172607..>173266
                     /locus_tag="CYME_CMJ057C"
                     /product="60S ribosomal protein L19"
                     /transcript_id="XM_005534749.1"
                     /db_xref="GeneID:16994149"
     CDS             172607..173266
                     /locus_tag="CYME_CMJ057C"
                     /codon_start=1
                     /product="60S ribosomal protein L19"
                     /protein_id="XP_005534806.1"
                     /db_xref="GeneID:16994149"
                     /translation="MVTTSIKLQKRLAAAVAGVGKKKIWADPAEIEKIALANSRQSVR
                     KLLRDGVLVRKPPAMHSRARVRERLEAKRKGRHTGPGKRKGTRDARLPQRVVWMRRQR
                     VLRRLLRKYRAQGKIDKHLYHELYLRCKGNVFKNKRVLMEHIHRAKAEKAREKAISEQ
                     LEARRMKNKLLRERRANRAEERRLKEAGISMETTEREGETASRSRRRRGRRDEALAAD
                     S"
     misc_feature    complement(173658..175856)
                     /note="possible transcribed region"
     misc_feature    175214..175792
                     /note="possible transcribed region"
     gene            complement(<178661..>179017)
                     /locus_tag="CYME_CMJ060C"
                     /db_xref="GeneID:16994145"
     mRNA            complement(<178661..>179017)
                     /locus_tag="CYME_CMJ060C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534750.1"
                     /db_xref="GeneID:16994145"
     CDS             complement(178661..179017)
                     /locus_tag="CYME_CMJ060C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534807.1"
                     /db_xref="GeneID:16994145"
                     /translation="MTEASENIVVVPSEVQSSKLRACLSCGLVKSVAQFLAYGCENCP
                     GLFEAGTGDRERVLTFTTAEFSGLVALYRPKVSWVAKWQRLSRKVPGCYAIGILAELP
                     DDVLEELEALRFDVES"
     gene            <179120..>182017
                     /locus_tag="CYME_CMJ061C"
                     /db_xref="GeneID:16994146"
     mRNA            <179120..>182017
                     /locus_tag="CYME_CMJ061C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534751.1"
                     /db_xref="GeneID:16994146"
     CDS             179120..182017
                     /locus_tag="CYME_CMJ061C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534808.1"
                     /db_xref="GeneID:16994146"
                     /translation="MQRSQALSKRNLRFPRGQGLLKVFETLDSCVLDEQLATFLEPPL
                     KFCRGCSNVVVKVVDQHTGKAEALWLRRPSPFEGIQVKSRNVFELGVNEVSVFELCPL
                     RGSSATGTDSDFFYAATIGRPAHNARSRDPVRRDYELRVLEVRLEQEPRRSVGTESVT
                     SATETTAGLRTRLVSSISLSASAGYGAPVSMTLHHGMQGALVSFESGDVLVMIGEFLN
                     SSELNQVMLHVTDTPPSFTAFFGMRRLVFGTESALLCVRTSELFASGTSDTLTDQNQN
                     HSWKCSASSPFHVTEERPCSALVTPVDCSTALDRDTTSNALPPFLVYRRDPSVQLYHL
                     DSCFYLSAVSGHDPVSIESLPDGSVVQQLVVNPRVPEHPTEGVSNRASDAGCEPRPAG
                     GASEESASEPTWTVLSLFNGSVVIVSETLRNQLCILLRRPLFNVAREALTIGRYSLAL
                     RLCYDAEIMKYPESPTLMELRSRAFNGFRHQIAKQCKDDLVFCAYMEDLCGVHQNWIT
                     RVLANCSDPGIPKLLIERYESFLDYSVDLIGPEKREACAEGGVHCPEEFGDLGSPEHT
                     MHSAAETPRKETFCGQLEHMSRTPESCRKTKAKGKANDLDTLGKAHTSHVLDMHENTQ
                     ADRASAHQEALQPALAGCAPESVSHLPGKRDQVWCSLELTNIPNDIRDPVGSLQNIFD
                     RDLRLVLSDTADATERSRKLIDYITSQRVARILAKCPEALTPLQCAAIRHVVFSGEYA
                     VCILEAVFRLLTFCGNEVLRKDTSLIQVLLEQLQNPQDLERILEFAELYDLSSMTERL
                     YRRLKRWDELAIFLQNRGRCEDLLHLCSEIDIAESHLWEHGLVCALGEFLSSLREVEF
                     PVALGYAQGTREPAETSPKRWAPSYLKPGASLHSVVQWLRRHRIVSTAALPIMCERLC
                     LLEAGPCDDRLTISRRVTQAIRAEIHAEERRFIQELYESIFSTPRQIPLSL"
     gene            complement(<182683..>183558)
                     /locus_tag="CYME_CMJ062C"
                     /db_xref="GeneID:16994142"
     mRNA            complement(<182683..>183558)
                     /locus_tag="CYME_CMJ062C"
                     /product="similar to acetyltransferase, GNAT family"
                     /transcript_id="XM_005534752.1"
                     /db_xref="GeneID:16994142"
     CDS             complement(182683..183558)
                     /locus_tag="CYME_CMJ062C"
                     /codon_start=1
                     /product="similar to acetyltransferase, GNAT family"
                     /protein_id="XP_005534809.1"
                     /db_xref="GeneID:16994142"
                     /translation="MIKGQDLRDGMQGLVFRSFNTRDLSSELKNFILNLTERHMRAIY
                     NEAASLAHTRAVPPGSKGPRIGAWRRWSTKAKRRELFALASMFVIAFWQRNPAALGDP
                     AAQQSVTESSIVEIVNMYSSEKEVRSRTRSSTTQNVPTQHVLSQVSCSECNSELLVPV
                     AFACYRIVNEWVPRGTQSGRVVCEKHSLLYVYELHCLDTWRGCGIGTQLVHFVEGIAS
                     QLNVAGVALTCLKNNPESLIWYKRRGYERAPHCPDTDGGSVYQILWKELQERNALPGS
                     MTTTRARTAPFDRCC"
     misc_feature    184282..187097
                     /note="repetitive element"
     gene            <188848..>191550
                     /locus_tag="CYME_CMJ064C"
                     /db_xref="GeneID:16994153"
     mRNA            <188848..>191550
                     /locus_tag="CYME_CMJ064C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534753.1"
                     /db_xref="GeneID:16994153"
     CDS             188848..191550
                     /locus_tag="CYME_CMJ064C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534810.1"
                     /db_xref="GeneID:16994153"
                     /translation="MPDRDSGRSPSDASGRNVGAVDDHSGPGGVHAWLFKLKQGGVLA
                     PGDQITANYKRDVFIAEVDSAGFLVVLGAREASTGTDNSTEYQDLIGVRFGSPDSFME
                     AMTNIYLSRRRGRRGREGLDGWESCVAQRQQKSLGELYRELEQLVNASSDQSLEGGRG
                     KLEGSSVKRMTPGSRGSSRKRIQRKSNEPSTSSDEASAVHQSLSFAKRKSQVSRASEE
                     SPSQSESSQEQQTNELRLERRSTRAGSHDDATVSTSSGPRHDGKSSELHIEAHPRKYQ
                     AQQGGVEKKFPEKLPRRSSGVAAHRKDTAEPHPRGSSDSSPEELTESERTQKAIRDQH
                     KVHPAEANNSSFSTAQWESLNLEQIARRMLEMLTLKPKALFDDADPESLMRLQELSEH
                     VKAKLQSLSAHARAEEPILASFAAGYLKGIGEGRSAIAHVATKAVTSGSFEADGESEN
                     LSRIKGPQGTALAPSARSTEADTTIESDDTERPTEARTSESEKGSKRRKVEWDGLRTK
                     LEAEMMARQELELERRNLLVSLSDSQKFLVREAKRRRLLESELSAERMQSSELRGRID
                     RIHLRLSHLLGIDNENFLRIDGDERVDHSVQSAENAEKLSENHPQTVDEEEQIVSERG
                     SQFTTPGEFSRRAEDQPSHPTGSQFSLSENQVLKARLRRIERELREWKAMLVSERCVR
                     AILVDAKSRLESDIGDLRIISEKVQERKRPHKESSQKKSKKKASSKGHAQTLAPSQHM
                     GQSLSMLPNVPVIYGNEISAYDRMAGFVPPSMPETVPGFSAYSPVYYYPSLPQRNGLP
                     GEMPLIMSAQNMWPPQEVVQHQYGIAQPFVHLDAAQLPGHGVEANFPSGVEQETRYGY
                     MTENYPNFDGTFRGGVPGTIPSMVNQVFARDPPPFDYRNAQGSR"
     gene            complement(<199796..>201223)
                     /locus_tag="CYME_CMJ065C"
                     /db_xref="GeneID:16994167"
     mRNA            complement(<199796..>201223)
                     /locus_tag="CYME_CMJ065C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534754.1"
                     /db_xref="GeneID:16994167"
     CDS             complement(199796..201223)
                     /locus_tag="CYME_CMJ065C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534811.1"
                     /db_xref="GeneID:16994167"
                     /translation="MSAQALSLAELLRLRSLSSSGTSLGSTCPGASAWSKRRREKLFL
                     LRARAGEVQQTLSHSGSLLEEAHCSFCSIVDTSIAETDGNGVTGSDESQKQRLRAAIG
                     ATSRRTRGRAPRRLSTEIHGLEDVAQFWALYKALSTSKVDNKVGVDHVKIDDMETREV
                     STLHNRYSPLSESVLHTPDRNLVSVAQRLNFDPTDDRGASSYTPIHSSVGPAEHHQSS
                     DFHFVRGRKRSRIQSSESEGSARNALEGHSTLDSPQTKHHESVQVQRLEICTPEKYRA
                     SQLEHGFDLSFGDDAPQCDQGPVFEYTPENQKELSHDESANPEVRIVQLPAEPSSTVT
                     KAIQTENETTFEVVNRPRRVMCAGDFLSQTEREKYMSHRQKIKFTASDTFRNGRRSRM
                     RVLRFWRGETLEYAFNERFRFPTIDSVITAPASPRDMLPADRRRYCKATPKSGFRTFC
                     RSRIVTPERAAFYADVRPNMLWARS"
     gene            <201401..>202966
                     /locus_tag="CYME_CMJ066C"
                     /db_xref="GeneID:16994166"
     mRNA            <201401..>202966
                     /locus_tag="CYME_CMJ066C"
                     /product="phenylalanine hydroxylase"
                     /transcript_id="XM_005534755.1"
                     /db_xref="GeneID:16994166"
     CDS             201401..202966
                     /locus_tag="CYME_CMJ066C"
                     /codon_start=1
                     /product="phenylalanine hydroxylase"
                     /protein_id="XP_005534812.1"
                     /db_xref="GeneID:16994166"
                     /translation="MSSTVLRLLSPYSNIVERSSGLFRYYCSSVSTLSQLRHAGQTKA
                     SNYDNKTTVVFLVSDRPGSLRKALSIFDEEHFNLSGIRSQASLPDDSANDRAFEITVN
                     AEYVGSREVQGADCDHSPNNHKSALLSRVVQKLEDTGARVRYIMPSRSDEQGAVEKGG
                     SCERPVPPLGAVSNAEVALSMPWFPRRISDLDRFASRCLQFGAELDADHPGFRDDAYR
                     KRREVIANAAARYKHGDSLSDVDYTAAELDTWRTVYTELKTLRATHTSRRYQHSIQLL
                     EREIGFGSYRIPQLSEVSRFLSECTGWTLRPVMGLLSSRDFLNGLAFRVFHSTQYVRH
                     HSQPLYTPEPDVCHELLGHIPMLCDEAFSELNHLLGLASLGASDEDIVKLSRCYWFSV
                     EFGLCREGPAEELRAYGAGLLSSFGELKYALSGKPQTLPWNAFEAAKREYPITDYQPS
                     YFVARSIEDAVDQLRLFTESVEKPFELRFNPHNRSVSIIDDATQVAAFSNQLSNDLRT
                     LARTLRRLGVSTS"
     gene            complement(<202938..>203777)
                     /locus_tag="CYME_CMJ067C"
                     /db_xref="GeneID:16994150"
     mRNA            complement(<202938..>203777)
                     /locus_tag="CYME_CMJ067C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534756.1"
                     /db_xref="GeneID:16994150"
     CDS             complement(202938..203777)
                     /locus_tag="CYME_CMJ067C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534813.1"
                     /db_xref="GeneID:16994150"
                     /translation="MTAFKITCFAVSTKRQLGIGREAAAVCCTRRATCSTIAHHRERT
                     RKRFCSWLVSELLSREVFDEKLTRNELSIAFVGMSNSGKSFRSRKLATELGFDIVSVD
                     EEIEKLLQQELGDIQGAGTDALASWMGFPFHETFRERERRYLQIEEDITSNARPRKKT
                     NFALDTTGSVVYLSTECQEKIRRDYLIVYLEIAESSIAEMIETFFKCPKPVVWGDKYV
                     RLPEANSDEENLRMCYPELLRWRAERYKKLSDITVPSDLARSSQVSSEAFLDIMRSKL
                     RAF"
     gene            <206220..>206447
                     /locus_tag="CYME_CMJ068C"
                     /db_xref="GeneID:16994163"
     mRNA            <206220..>206447
                     /locus_tag="CYME_CMJ068C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534757.1"
                     /db_xref="GeneID:16994163"
     CDS             206220..206447
                     /locus_tag="CYME_CMJ068C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534814.1"
                     /db_xref="GeneID:16994163"
                     /translation="MPVSLKRLQARQERVASGLERKVTRVTSKGPKAKGVQSKNLNPY
                     LVGFLLFILVGGALLPHVQRYIMGFFASAEI"
     gene            complement(<208655..>210646)
                     /locus_tag="CYME_CMJ069C"
                     /db_xref="GeneID:16994161"
     mRNA            complement(<208655..>210646)
                     /locus_tag="CYME_CMJ069C"
                     /product="mitochondrial Rho GTP-binding protein Miro"
                     /transcript_id="XM_005534758.1"
                     /db_xref="GeneID:16994161"
     CDS             complement(208655..210646)
                     /locus_tag="CYME_CMJ069C"
                     /codon_start=1
                     /product="mitochondrial Rho GTP-binding protein Miro"
                     /protein_id="XP_005534815.1"
                     /db_xref="GeneID:16994161"
                     /translation="MKESVRIVVVGDHSAGKTSLIKTLISEEFDNEVPPTLPVVVIPP
                     EVVPERVHVSIVDTSSKPADKAQLEGELLRADVIVLVYDVSKKDALQRVRSFWLHEFD
                     RLRLDVPVILVGNKMDLRGGSAENPSYSLENEIMPIMNEYKNLETCIEASSKQLFNVA
                     EVFYFAQKAVLHPTAPIYDVKEHRLKPLAVAALKRIFRLCDADHDGKLNDHELNEFQF
                     KCFNVHLRNEELVGVKNVVRENARSGLDADGNLTFDGFLYLHTLFIIKGRAETCWTVF
                     RRFGYDDDLRLNLAQVVPELRRQPDQSIEMTEHCLKFLERIFGLCDADKDNALSPTEL
                     AEVFSPVPPDVSFHLYLGVENESNTEAVGTQYPVLTRLNPKGHLELEGFISCWCQRFL
                     ADPELALLNLIYVGYDGDALSAVRVTKRRRRERRATISSRTVLHACILGPTGAGKTSF
                     LRAFVGRRFSENLAHTKGRLAASASLKIALPNTGSATEPRVLTRTLVLTEISDHVVDE
                     FLASEREIESCDAAVLIYDLSDASSFGYVARLFGALRTIRPDLPCLILASKQDLPAVE
                     QEWPDSPSKFCMDEGLSLPTKISFRESPPVQVYSSVAMLCLTPTGRPQMESKSTVTRQ
                     VLRYAAGTALIGAVAGCVYLAGKKIYKMVKDGRPAARAN"
     gene            complement(<216247..>217374)
                     /locus_tag="CYME_CMJ070C"
                     /db_xref="GeneID:16994159"
     mRNA            complement(<216247..>217374)
                     /locus_tag="CYME_CMJ070C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534759.1"
                     /db_xref="GeneID:16994159"
     CDS             complement(216247..217374)
                     /locus_tag="CYME_CMJ070C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534816.1"
                     /db_xref="GeneID:16994159"
                     /translation="MFDSPAGMTDPRWSPPSPGLSSLGRGEFSSGLDGVSGSSGRLRD
                     ASSSKPSVNEFVTKAARSPAERLRADQSQLEEFLRRREQQLAAITLTIRAKRSGTTTS
                     VSASLEELEGARRKLEVDLFRARQALFALQHQAETEVIRSKVALEELDAALGIQDAQG
                     LHKVPQSFAAEQKPRPTEHIERDDLTLNDISLALQKLRREEAEQRIGETRVAIRKALH
                     YGAELASLFREPERQGLDQVFDEALLMPFQDRKPSDLPRTPKCTIFASDTELAHKRRR
                     LEMAPTRDYVKVLQPDAHTPFLNKVDAWQRLQPYHVFLGEVKSPGCGLSDQDLLGTHG
                     DKPFEANLREVVVRAEQRFSQLLSWYETATAKNDVFIETKP"
     misc_feature    217863..220053
                     /note="repetitive element"
     gene            <220246..>221322
                     /locus_tag="CYME_CMJ072C"
                     /db_xref="GeneID:16994158"
     mRNA            <220246..>221322
                     /locus_tag="CYME_CMJ072C"
                     /product="similar to ubiquinone/menaquinone biosynthesis
                     methyl transferase"
                     /transcript_id="XM_005534760.1"
                     /db_xref="GeneID:16994158"
     CDS             220246..221322
                     /locus_tag="CYME_CMJ072C"
                     /codon_start=1
                     /product="similar to ubiquinone/menaquinone biosynthesis
                     methyl transferase"
                     /protein_id="XP_005534817.1"
                     /db_xref="GeneID:16994158"
                     /translation="MWLQYVARHTLQNKPFADVFRNDLKTQGLSRKSGLGSLRTWCCC
                     GYANERRRFLWSLGCFLTFSCASGVLGAHGGEASGSATKSSRPLYDQWASTYDALNDR
                     NCITKLSGLDKARELAISYTFGRVLEIGFGTGISLRSFIQREKDHQSQASRPLKPLVQ
                     SIVGLDASSEMLQTARERAYHLDEDLPFELRLVHADLLAALPFEEEAFDCVLCAYTLC
                     TMPDLDAALRTALRLVRPGGRLILLDHVRSNAKLIAAYQDVVAPLVQRTAKDCRWNRD
                     LERALDENLEGSYHILESRRFLGGTVELLVAERLGAHDQNRLFRREPSAADAWQSCVD
                     SRRCSGPASRNVGHDPGLDSVLES"
     gene            complement(<221371..>222441)
                     /locus_tag="CYME_CMJ073C"
                     /db_xref="GeneID:16994152"
     mRNA            complement(<221371..>222441)
                     /locus_tag="CYME_CMJ073C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534761.1"
                     /db_xref="GeneID:16994152"
     CDS             complement(221371..222441)
                     /locus_tag="CYME_CMJ073C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534818.1"
                     /db_xref="GeneID:16994152"
                     /translation="MTSNSDRSRFCSVNSIRSCINFLNEELTSIGIAPRLILPPEQAE
                     LSERRQPLAERNSDEGPQTGKLQKPPATEYALAEALNVIFALINQIREQPLTAQYYDA
                     QVRALRAELDTQQGTLERLREEKLQVRTELAKTGQIFEKEREQMRRLIEEGRSQVEAL
                     RRQNAELSDKKLKAESQSRQLQSEIHHLRSFIDRTHSVSNRNCDDRARPSSVPHRATN
                     RYDLATTNTVHYATTQQNSDMQSAIAKAPSVPFCSATKQRQQYRAKRKASQPSPAREP
                     HTSSPAERHPPFSPKAHKAKTVGRLQQSANNFKEIDRNVDTAIEFERLTRECDWLRHQ
                     LDWYRVIVAEQEELLTYAISHS"
     gene            <224620..>226467
                     /locus_tag="CYME_CMJ074C"
                     /db_xref="GeneID:16994156"
     mRNA            <224620..>226467
                     /locus_tag="CYME_CMJ074C"
                     /product="probable carbon catabolite repressor Ccr4p"
                     /transcript_id="XM_005534762.1"
                     /db_xref="GeneID:16994156"
     CDS             224620..226467
                     /locus_tag="CYME_CMJ074C"
                     /codon_start=1
                     /product="probable carbon catabolite repressor Ccr4p"
                     /protein_id="XP_005534819.1"
                     /db_xref="GeneID:16994156"
                     /translation="MSSKEKPGSSLSKPNPREKERPPVATNEEGFATPISRKLLHEPA
                     VVRVELLQTRTPVEGCELTPFVLLKDLNGDQRTAEAMETRTKGVLAAQYRWYRREYRF
                     VCAKTGLPAQFECLELGRVRTELERLGDTSVANIAGLAYFHQSTEIIDIWSTFRELWR
                     RVRVLQQQKEARREPALRNKNALRIDQSRDEALVCEIPPENDSKLVECGFVRNYAPTM
                     VDIGRTLVLECRYIWKVPNEEIRIGPPVYFETLPVIPFPPPPPERRMFLVADTNCDYS
                     VKDRVCSGEPNCFPLRLLSYNCLAEIYANSDLYSYCPDWALSWNYRRRNLLREILSLE
                     ADVVCLQEIQADHFEEHFNPAMRRAGYEGIYKAKMRESMGRKGKVDGCATFYRRDRFQ
                     LIEKHEIEYSTVAREKVKEKRLLNRLMKDNVALLVVLEDTATNSRVCVANTHIFWDPD
                     QTDVKLFQVDTFLQEAERYIGPRNLPLLIAGDFNSLPESSIYELVVGNEVSGQRPDVI
                     DGMLEILKISPCQHNMLLRSVYGLGGEFTEPAYTNYTGHFVGTLDFIFFTPDKIVPVG
                     TLEILDEARLLGEEYTALPNPRWSSDHISIMADFDIRVLHPGQSTASWA"
     misc_feature    complement(226685..227439)
                     /note="possible transcribed region"
     gene            <227620..>229146
                     /locus_tag="CYME_CMJ076C"
                     /db_xref="GeneID:16994148"
     mRNA            <227620..>229146
                     /locus_tag="CYME_CMJ076C"
                     /product="similar to coenzyme F420-reducing hydrogenase,
                     beta subunit"
                     /transcript_id="XM_005534763.1"
                     /db_xref="GeneID:16994148"
     CDS             227620..229146
                     /locus_tag="CYME_CMJ076C"
                     /codon_start=1
                     /product="similar to coenzyme F420-reducing hydrogenase,
                     beta subunit"
                     /protein_id="XP_005534820.1"
                     /db_xref="GeneID:16994148"
                     /translation="MLPASVGGSISLETDNRGERTERAARRSFRGRLAFLGPKLGAWG
                     PTQSCSAAPNCAISEAQPRKGAGRGTAYRQGNSLRNVRFVLNANQETGAVGPAEAPHR
                     RLSNWGGLGGAYDTKVYPAKSLCSHCGLCDTRYITYVRDSCAFLNQHIAELEQKVHGR
                     SRALDSEDELYFGVFQSMLVARKKKPIAGAQWTGIVSSLAIAMLESGLVEGVVCVQSS
                     KDDRFKPVPVIARNRAEILAARVNKPTLSPNLSVLDAVERSGIKRLLFIGVGCQVEAL
                     RSVQDRIGLEKLYVLGTPCVDNVTRAGLQKFLDTTSSSPETVVYYEFMQDFRVHFKHD
                     DSVIGGPGRKWDEIVPFFALNTQELKEVFAPSCLSCFDYVNGLADLVVGYMGAPFGWQ
                     WLVARNETGLEMLELARQVCGLEEGPVDACGDRRAAVQQSITAYDRALTLPRWIAEFL
                     AIIIGKIGPKGLEYARFSIDSHFTRNYLYVRRRYPEKLDAHVPEYAKRIVSQYKLPDT
                     "
     gene            complement(<229185..>231326)
                     /locus_tag="CYME_CMJ077C"
                     /db_xref="GeneID:16994154"
     mRNA            complement(<229185..>231326)
                     /locus_tag="CYME_CMJ077C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534764.1"
                     /db_xref="GeneID:16994154"
     CDS             complement(229185..231326)
                     /locus_tag="CYME_CMJ077C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534821.1"
                     /db_xref="GeneID:16994154"
                     /translation="MTDAQSLSFPRNARSEQRTVTYWCRFPEQQHRYGINAVLALQKP
                     ESQSDAYLLVSAGRDGSVRLWSIDHRAQQGRIAKQAHLRSLEEHTDWVNDVVSPGGYP
                     TLVSCSSDATVKVWDLSAGACLATLVEHQDYVRALANVSSRQFVSTAYDNRIILWDLD
                     RMVAFSEMRGDENESIYCIASALHRDGALNGSADCFVVAAGHSDRSIRLYDLRTSRDV
                     MRLHGHADIVRRIRLSSNGLLCLSGGSDGAVRLWDIRQQRCLSVFHHVHEDSVWSLDV
                     PPSFSWFVSGSRDGTVCRTDLRNSKETRRLFEPDGHSARREQVCDWSKAVLDVCIAPT
                     ANYSSNLWIGFGESQLRCVSMKHPDPTHECVIEGLPSVVDYRVLNNRRHVLVRDSEHG
                     IHLWDVCRALNIRSFGRDRSLDDVIAEIDELVYVPSWFNVDTRMGSLGIRLRKSTVSD
                     ADVYAVDIGLEAESEDQKVNIGEHTLRGLFHWWRKQWLKRNPHVAETLNTGSGQSSDT
                     GSTTAEKKAAVLTPFVFPGDIPVVVNEQGHIEPLIHKLAHRFDGSEIEERLMPSWVID
                     IVGRNRTLAKEQVKISFGLEPAIGSTLQSLRQSKLTAPRILRIRKAMAYVSAKLSEQT
                     TSANQRASPGGHRGALGASRAATDALSSEPIVPPPQEIEILCRGHVLDPNMNLGTVRW
                     LIWKSPKDLELTYRRRGEQTSNPAPESHPVP"
     gene            <232650..>233504
                     /locus_tag="CYME_CMJ078C"
                     /db_xref="GeneID:16994160"
     mRNA            <232650..>233504
                     /locus_tag="CYME_CMJ078C"
                     /product="probable prohibitin"
                     /transcript_id="XM_005534765.1"
                     /db_xref="GeneID:16994160"
     CDS             232650..233504
                     /locus_tag="CYME_CMJ078C"
                     /codon_start=1
                     /product="probable prohibitin"
                     /protein_id="XP_005534822.1"
                     /db_xref="GeneID:16994160"
                     /translation="MGASGREAAAKLAKTLNTAAKYSIALGVLGSLLQTSLYTVEGGH
                     RAVIFNRFTGVEQRVVGEGTHLRIPWVQKPIIYDVRTRPRTITSVTGTKDLQMVNLTL
                     RVLSKPDKQQLPRIYSRLGVDYDERVLPSIGNEVLKAIVAQYNAEQLLTQREKVSRQI
                     RETLTARAKSFDIELDDVSMTHLTFGREFAQAIEQKQVAQQEAERSRYIVAIAEQERQ
                     AAITRAEGESEAAALVSQALQESGAGFIQLRRIEAAREIAETLSKAPNVVYLPATHGT
                     NILLNPGI"
     gene            complement(<233993..>235123)
                     /locus_tag="CYME_CMJ079C"
                     /db_xref="GeneID:16994155"
     mRNA            complement(<233993..>235123)
                     /locus_tag="CYME_CMJ079C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534766.1"
                     /db_xref="GeneID:16994155"
     CDS             complement(233993..235123)
                     /locus_tag="CYME_CMJ079C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534823.1"
                     /db_xref="GeneID:16994155"
                     /translation="MNKSDDRFRWLHTALPIGVALCGRPLVDSERFSQSTLFTARDES
                     VYTCYGDSSVILDRLSCQRLAFDGAFVFGSNDSPSQLYFDAAFRSQNLREQDASVPTS
                     QPVWSIQDAISAAIAGVADVCIFTYGGHMTGKSTTLRRVMLLAAQDIRRKLATSPAAV
                     CLHATEYRFDENDVELIRTLYTAEQVDADQLPSVLWHEFHRGELANGQPAPSTSHFVW
                     SMVFAHGSRIIFADTCGASRVTPKGLRCQVDLSIFSLEQAALHTVEHMQGTAFTRSIA
                     CGVGGHAIGIALCCFGQTAFHYFHENAQTFQIARSLMRIVNPIRLAASPSTTAATSLS
                     EFSQAPQLLNDSALGELCSLRRAHSPNVFGRDDSRHSVIFYD"
     gene            complement(<235640..>237292)
                     /locus_tag="CYME_CMJ080C"
                     /db_xref="GeneID:16994174"
     mRNA            complement(<235640..>237292)
                     /locus_tag="CYME_CMJ080C"
                     /product="similar to tRNA modification enzyme Trm5"
                     /transcript_id="XM_005534767.1"
                     /db_xref="GeneID:16994174"
     CDS             complement(235640..237292)
                     /locus_tag="CYME_CMJ080C"
                     /codon_start=1
                     /product="similar to tRNA modification enzyme Trm5"
                     /protein_id="XP_005534824.1"
                     /db_xref="GeneID:16994174"
                     /translation="MATHSEATHNEICAGVPAELKTRFQQEWVVYAVRVPLAEVATAR
                     RMLSPRHVLRLARKRSVVAPSPNHTASDQVRIILLRYLAGQQPREQFLPQESNFSTDF
                     QSRDVAALVHMLNEERSGTRSSEANGAVTREWKESMFTTYPLKLDYDDFGHDDVLRQL
                     LPASIPVPKAFEATGHVLHLNLRDVHHPYKYLIGQVLREKIPGIRVVVNKAANVGGVF
                     RTFEMEVLAAVPGCSLETCVRENGCVFHVDMSRVYWNSRLETEHRRVIDAIRTLHGST
                     QTGLDADPRDVSRIDERKQMIFADGSEPLRDSSKLPLVTPPVAAGPNAVPHTAASMRL
                     SSGQKPVLVADAFAGIGPFAVPLAKHGFIVYANDINPDAVEYLDRNIRENRIPPGRCT
                     TCCMDARAFLKKLLHSDRLPIQHIIMNLPAEAIHFLDALVGSIAPANPLPYIYCYCFA
                     HGENAYEWIVDQMNEVFDAALQRNSGKAAEEVNPTRHAGTDAAPIDRHSKRPRVDSFQ
                     LDPDRDQLRVRCVRHVAPEKYMYCVEFRLPESLARPNGSESA"
     gene            <238226..>239395
                     /locus_tag="CYME_CMJ081C"
                     /db_xref="GeneID:16994164"
     mRNA            <238226..>239395
                     /locus_tag="CYME_CMJ081C"
                     /product="indole-3-glycerol phosphate synthase"
                     /transcript_id="XM_005534768.1"
                     /db_xref="GeneID:16994164"
     CDS             238226..239395
                     /locus_tag="CYME_CMJ081C"
                     /codon_start=1
                     /product="indole-3-glycerol phosphate synthase"
                     /protein_id="XP_005534825.1"
                     /db_xref="GeneID:16994164"
                     /translation="MFIQLEAFCVQPLTGREFCAGRPLVCTQPSRWQLQAFSRRQLSV
                     RTGSTLRMSSAGGTVAADIDYRSVPDVLKEILRRKQQEVASLKAEVAQAGAEHPLQRR
                     LDAAAAGQIPKSRQFSSAIRKPKGSISVIAEIKRRSPSSGLIAEIPDVRQLSDLYYNG
                     GAAAISVLTDAAFDGTLDDLQTVVKHQQKFRGRYPGPCPVLRKDFIIDEIQIAEAAER
                     GAAAVLLIVAAIGEAGLRKLLEATHRHGLEALVEIHDEEELEIAKAAGAEIIGTNARD
                     LRTFNVDLNRCFELIGRYPPNVIPVAESGIHDVMDAWRLRDAGYSSILVGEALIRAAE
                     SSKLPSNAYQSSFNEAYGLLRAFTSKGSTKFGPISTTRIFGKGEGAKESLGYLEM"
     gene            <240457..>241773
                     /locus_tag="CYME_CMJ082C"
                     /db_xref="GeneID:16994172"
     mRNA            <240457..>241773
                     /locus_tag="CYME_CMJ082C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534769.1"
                     /db_xref="GeneID:16994172"
     CDS             240457..241773
                     /locus_tag="CYME_CMJ082C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534826.1"
                     /db_xref="GeneID:16994172"
                     /translation="MRSWLPERSLGPQPSWRLWYAEASLEALERLFREQQLPVYVGIL
                     VLSPVSEENASYDHWTEPIRACFTELESIQFVTQKCQLSPFELVQCLLGARQAGSAPA
                     VALSQEVHTQSRTGSSASAAAHVAPGGPACTALTRDPQQLMAVDAKRRFILPLEEALY
                     RRLGLIGRGHQPRLARRRYRRPVYGDGAFVIIDLALLQEKPESKYRQQVTRGLQRFTD
                     RLEWQLTSISGTDAPLSPELGVVEDTACRVYTGTATSTFPWLYRNVLPQAYTTAEEFH
                     DPLERAENFSMLMDALGFLMRAPRGKCIEDASQETRSYLQPMWSARADADTQAEQLSF
                     YRFEWGATQASLLPHAWWKRILPLVWKLHSTPTDSSLQIVLQVRYQGLADEATSRKHR
                     YNTLQHSPYTRNLVGFFGSTSELPFSSTRVNGAHDQIPFVSFEQPL"
     gene            complement(<242477..>260398)
                     /locus_tag="CYME_CMJ083C"
                     /db_xref="GeneID:16994170"
     mRNA            complement(<242477..>260398)
                     /locus_tag="CYME_CMJ083C"
                     /product="similar to midasin Mdn1p"
                     /transcript_id="XM_005534770.1"
                     /db_xref="GeneID:16994170"
     CDS             complement(242477..260398)
                     /locus_tag="CYME_CMJ083C"
                     /codon_start=1
                     /product="similar to midasin Mdn1p"
                     /protein_id="XP_005534827.1"
                     /db_xref="GeneID:16994170"
                     /translation="MESGVGLLSPATLNDLIALEQLDDQAFWESYVVPETPSAAATAT
                     SVDLRGATAAYSYPAPAYAESVELQRRPNVSALDEALFDRVYSLLGALDPRDLPQLVA
                     YLTSCGHSGAAVRLVAVTGGVATLTALLPRGWRATSRQVALLAYSAGGQAVLQRSVDL
                     RPCFADWHENAPDARSTMACLALSLTFGVRSSCTARFRPAGTHCPVHGRQHDAVLAMF
                     WHEIDYIEAARHALLATWRELVAGTRLSRHDGPQATTAARWPVGAPCPGPASEGSSRP
                     EAAATLLNAGQHAIPPVNGITCHGGGAQSALLNARTRMSAQCSRPVPCWPDGASTGRN
                     ESHPSSDTDTADPVLDSRALQRHQRYIVVPSRHRALNLLHLAVVYGAPVLLQGEPATG
                     KRALLHFLAKELKRPITAFYWDRLGFEEDAFLDAIAVIAPCGPGRFQWRLGPVGEALA
                     QGHWLVLEGLGSSSATNRRLATSVVQQLASIRPGAVFELPGRNFALQLHQDFRLFAIR
                     TGTSASLTTTDETSSSWIGWLVIDLPPYARAERHQLLGERFPTCTPWIDRVLASVDCT
                     AACCRKLADNLPLPGLNEAVRLATRLARTQEALTEPLTPEVALIHALDVLAPLLPPAA
                     AEDKHVEDALLTALASQWSLSAHEARIWWSLAWKQSPLPQLLERMAVAPTETSCTALG
                     QLYRALDHDEPVLLIGETGVGKTFMVQELAKSLGRRLVVLNMSQQSDLTELFGGYQPI
                     DTRKLLQDLAYELEVAFSTTFSTHRNQDLILQLRLMARRRDASRLVRLARSLFTRVAS
                     SGRLEGHQQRAHWDQVQRLVSQMEDAYGSTALEKRSRLRKRHRTLVTSTSEPASGSID
                     TSGARKVRWLDKRQHLQSRSDCSDAVATALDNEMDDDESDVLVRETPTAEAEPPLRFA
                     FREGLLALALRRGDLLLLDELNLAPAACLERLTGVLDSIWESTAHSPTASLPPRHRNQ
                     VAVLSASSSINRHPAFRLVACMNPETNIGRKALPASLQRRFTTIRLNDELPDEDLHRL
                     VEHLFTKRLHPSQARVDTEHSLTKRVVLFYQRVRGLARSSLSSAGDGTAPRFPLRTLS
                     RMLRLALHLTQCGLDARRALYEGACLGFSTFLAETSRQRVLHLAYELLAADLATPERH
                     LLTPVTKLLPAIPRKRPVVDVGGQWLTLVQPGASPASSQATNGEAQVPASESRREIRV
                     PGEHSVTAASGAACKQLLTKGVSATLSTASTRGCSPTFVCTRTMVKALSDIARALVDG
                     LQKTPVLIEGATAVGKTALVKHLAERTGHELIRLNQHEHTDVSEYLGRYLVGPDGCLR
                     FVEGPLVRAARHGHWVLLDELNLAPGDVLESINRLLDENRELVIPETGQVVQAHSQFA
                     LFATQNPSGSRYGGRKMLSPAFRSRFVLIHLPEMQDEELLEILGICYEVPASFASAMV
                     RILRDLQLRRCTERIFAGTEGLVTARDLFRWANRRARDRQALRFHGRCLLVERLREPA
                     ERNAVWRVLCQHIGLGVVEESPRNDARTSSGVQASTSEHAAAAAAAAAAAAASVTREH
                     TIMAMVDVLPPLTLRELLDSLPERDQCPWLNLFDSTGADQDHEAEMPQQQPQASADQV
                     YQTQQQQQQRHHQTGNALHRSGSVPLGTLLWQRIEATAVEALGLVMVPSLQRVLGLAL
                     HAILNQEPVLLIGETGIGKSTVCAVLAAALNRPLYTLNGHRHTEAADLVGRYVPVVST
                     EALNDPPSTAVPQSCATTASKVVTSTRKPRFKWQDGALTSAMRQGAFLLIDEINMIDD
                     AVVERLNSVLEPAGKLVLSEHGGEPLPEVQAAPGFGVFACMNPSGDFGKKELSAAIRN
                     RFTEIWIPYEGSCDDLFPVAAELLASEPPLVLELWKRALEWLLQRQRMLQQPAMSIRD
                     LVACIRIYRAQQQQQQQQQHRGAVVAALYEALEAFWESAWSLSPVSRLSLRNELQSLF
                     QDEHAVAIHGVQLQHERQVLQHQRQPVESTGRPSWCWTAPTVQRNLRRLERVRAVDQR
                     PVLLEGPPGVGKTQLVLALAETLSKKVHRVNLSEFTEMMDLVGTFVPHGSGFCFRRGP
                     LYTAMERGDWILVDELNLASQSVLEGLNAVLDHRRMLHVPELALSLPASEGFRFFATQ
                     NPAGTTLGRRSLPRSFLNRFWRIPCDDYDAADYEAVLRLRFPSLEQFPDVLQQLTHWW
                     PQKLSLVHAQPATMRDVLRLATLWNAYPSVPLRSWAQLLLPMPLEVAQRAVSVPETLA
                     VAHTGRKVDVAVHPVFGKDTVQGSSPGDAEAPGKASRVLAAVHEHATKSGAAAAAAAD
                     DDDDDDDDKNKDNDDSDHAHRKGYLSQTVTEKHPKGSLSLSRVFVTQRLDAHNGESNA
                     GNQVIPTPGRKRVTFEKYPPAPDGSWWSFRTPLPQVVLRMDAASTEEDHLCGIVDPVV
                     GGTASLVTCSCWQPRYVSAFREQLFRKWLQMDPCALFCRNNTSEHRADRATAMHAGPL
                     SQSLTRDDSSRTPHSMEAEQSSEIAPQFQTGNNVPVAVSGDALAENSGDAVPLGTVSA
                     HESKQLPSASDLYIGDTIQTPDASRNLKWCFCWGPVLVAGREVQGPSAHGLLGPSLAI
                     ESVPEWRPCQAPHWTALAVAVTQRWPCLLVGPASCGKASLVQGMAQILAMPLTEVVLS
                     NQTDITDLFGGYSHASEQRTRETICASSSLHNSSRARSSSSSARQDPEYFVWRPSRLL
                     TALEQGHWLLLRHVEALSPALLDRLNPLLEEDVFELPVPEAPPMLSQHDDPSDTGIRR
                     FVIHPRCRIFLTATCSEAAAGCAARQSPALSEALMSRCLTLWVGGSAASEQPVEAAHA
                     QASAFQGQALPCGDVTGRGNALAASATKPMDARCFAAASEVPAEALWSGITRTSISLF
                     YDPLRPVIEYDLDRLARVLDLFDTAAASWCEQNSTLPVAISVGGERSAPAAVSHEDAT
                     NASIWGSAPSRATEANVLAFWASRQVHLCRTRVIQALRQHAEAAGLFLMMSSPLDLGL
                     RLALIGLGPESYPLMPFSAETFRRASRSLAPVARLPRDGASSPGRTGSASLSGEPLLD
                     TLQLHPIPDTGTESTFAMQQQQVLVWLLLYWRCFWPWQIPWSTSTIQGPFRKQITAIR
                     LDALESLSRKRFQESGNDARWRASIMHPVGSSTRGYVAVFQPAWKRIRSALELDAACF
                     QVCSSSGERWCWWQRALPNAYTSNASSLLQRFYNQGREAAYAASVDWLTAAAKACCRL
                     TMPPGDPARESFTSNTLVQQDGAYAELDDPGESAAVEKSTPANAVAAAAAAAAVAAFT
                     TDASVRTRWLAEQPAQRAVSALLPRSTPRWLAWFVLMDLAGLLCASERLLSHEAAFAN
                     TQERGALQRRWMQLNNWLVRFSWPLVVVVATMRVALALGAPERENDWFVRCALRQVAL
                     SWHLVCWALHLLDDSEASETLHAMQSSEQAKERYFDPQRTCCGLPHHWESLMSGSCAF
                     HCLADALLQRQYDFGAYNDAQHIKPSTSTPADALDAYLWEALWERGLVPTLDAQRGAP
                     GPAGRSRNAPATTGGTTAPGTVPQRHAVLWWRIPRFEHPTAAPVLCIEEHDRSETEQS
                     ASRFEHPTAAPVLGIEEHGRSETGQSASRFQHPTAAPVLGIEEHGRSETEQSASRMPS
                     LPAVVDPAEVYGYLDEELLPWMEALRQRDDRIVEQAFNGYSCTLPGSADRSLLRRVDL
                     SEAQLAALRAEARARRFYRPSVPTLEAALAYGHAWREQQEPLLRMLPRESAAGWTHVW
                     SAAERLGALEGLQAAEALLPGGRFHALHDTAGLVVLDWYQEYHERLLLDAEKSVAGMC
                     TTDALDWSTLWRPRMLLLLESVFASEREPEPSLGARGGLLAPVRLARAPRRLLVSLQQ
                     LLCRQESAQTRFWHAWAVLLDVVLAGGVPGLDERRAQASASIPNGAAPETSAQEAWRT
                     LAAAAGMPWSRAGAVAAAEASDEALAHCRRLFESELEPLRQGSPERTASTGTACARMD
                     LDPDETPQWEALRLWHQYSLLSLEATHGTRDSQRAAAAVAPSDSYVSVIKDLERRADA
                     LPVPLAIPTGAASVPNAVLSEIDVLAAGQIACSTAFVRNAALSERNAIASGQIATDGG
                     CGRRWNSSEHPAVPPGSTCWQSLPGLLAQLVNTAAPGTSSVDTKTTQWCSGVVVALAL
                     LLIGMEALSCTQELPAQVLAALQKHSYEALLRSYVVASIQLLRIQPATTWWSVLQHPH
                     SLPYLWTAWQRPVAESSASLHGSAAEPTWRYGAALSSLGDQLRAWARQEPDRALWMHL
                     ATRWDSCSKRSEQLRALGREREALELLLGELLEPLAQEIAQRCAFSDADDSTNGALRD
                     TWEQLGSLLVSMRLACFAQTRWQREERALRYSKRVIDTLPCWLQVATLAESAAVSEQS
                     RAGCSLMDAMGKRTSAGQDPEMLLGDERVPQWLVCCGQGMETLAVGYVFPLLQLWRLL
                     ARYGSQLEPRLQAIQAQLVLVYRYYVRYCEIVQEAIDELQQKQLPQWQLQRLRFGMQM
                     QRPWRQLADWERYRAAVQQLQQEERQQWRALDHLLDSSVQSLWQRARERVAKQLLERS
                     QTALVSSTQESFMDTNVKAAGPALEQLSLVHEASLAALRELERLAHQNKCCWASIERC
                     YRSIFQLLRPMRIRKRPLREPLRLHWPAGVLYYGRAPWGYPLGQAERLRTQQQPQQQQ
                     QQPNTPYMSNTDDGDDDHAALFDVLDMLLLVDTKFWEQLTATTDPAELRGLRTVATLL
                     ALVRGLLSDLADQRETWQIAHAHPAVQVQTQASVRCAAAAAAAAETSPSNSEAVASWT
                     CAHDATRVLSKGAVPGRGAPVTELDTQTQRHAAEYSIIDEASVSTMDTRRVALELAVL
                     CRCWPDAASLGARFAALAAELGRQLHQHDWDGIESSATDLEQLLRTFQSGTSRTTSAA
                     ATALRTQLYRCALEQVARLRLQLQRRVPASLRGNGQMEAGPIPVSEDSRRDNEGPASE
                     RHPEASPRASPECQTATPTATPDWTLMELLHWRPSSSEAFVLCLGQVHGTANVSEHQH
                     GALERKLAMLRRLHWSLVRIVQVLLCLADRSLMLLHNAAVDAQRDAVGKDVMRQGAGF
                     ADTGALNADARDCSADLAASELGEELFASDRATNSAAEQGVPRSSDDLESNEELLTTA
                     AFSAPFTENETLGQAPEDDIDVDGDMNNPGGTEAPPATETAPTPCPEERALPADRTAT
                     SATALAATSMEEAAPDSMTDAPAEVVASGNESTVDAEAAPRLPCAVTGPAQPSMSPEA
                     SLNEPEQDAPDILEDLVHPDGNSSPDRVSEASEGLPFAEDWECDEPAVDSVSVDASEE
                     AEARSALHSDEDALSDNGDTMNASPADAERSQSDARDTSETREHTGRSPVSESSILAN
                     AALPELATGGESGNAASAPSQSAAATGAAAASSGTLPASAEAPVMQAVSENPRERPGA
                     AHTEVDAATTMPLAARNVPETIWSQDAMHWTTPPQPASWESTEEQRSASAQGAPAYAA
                     EAAVSLAPDRQAHVASSVAAEWSSGAAPTATPLDLPYPYTGETSTSLEQNKPAAADEQ
                     HRMPALTDDLWSDNQDPTGVPHQPQVQQMTGSNVDDLVVPAASHRNAQWSASSTLSPA
                     EASPGRQTSTAKTPEPERQRATQRQESLHHRDDENDKDDNQDIAPQHMDADHTRYSLE
                     QAAADADLITWFALERSHEATIAHLSRRLEPVLEYNQMTRFAGDFRTGKRLHMRRLID
                     YVASNYTRDRIWMRRIRPDRRRYDIVVAVDDSASMHESGASRLALESLVVVAAALQRL
                     ELAHLGVIRFGCDAQVVHSLHAGIPAAGSVGDQLLGQFTFQQQATNVVALLECASALF
                     REAREQQAGVIDSWQLLLILSDGRLGERDALRALIREANAQRLRIVFFILDQVAGTRE
                     QEQQASSAVRRTSVLDMKQVGFAPGGRMQVRRYLEDFPFPFYVIVEEIAALPAVFGDT
                     LRQWLAAGMDSGC"
     gene            <260893..>262446
                     /locus_tag="CYME_CMJ084C"
                     /db_xref="GeneID:16994168"
     mRNA            <260893..>262446
                     /locus_tag="CYME_CMJ084C"
                     /product="phosphoribosylamine--glycine ligase"
                     /transcript_id="XM_005534771.1"
                     /db_xref="GeneID:16994168"
     CDS             260893..262446
                     /locus_tag="CYME_CMJ084C"
                     /codon_start=1
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="XP_005534828.1"
                     /db_xref="GeneID:16994168"
                     /translation="MQLVSGQERCCSIRAWGTACISSQPRFGSGLQRLAFLTQVAVQR
                     FSGERRTFSRHSWRRKSRSALASNVRCSLKVLVIGSGGREHALCDKIAESPHLKSLYA
                     APGNPGMERVAHCVSDLDAADISAICGFVQEKSIDLVVIGPEAPLVSGLVDALGALKV
                     RAFGPSQAAARLEGSKAFSKAFMKRHGIPTADYDRCGSLEEATTVLGRRERFPVVIKA
                     DGLAAGKGVFIASNRGEAEDALRVLFVEQRLGEAGRTVVIEDYLIGEEASFFALVNGE
                     QVVPLLPAQDHKAAYDGDRGPNTGGMGAYAPAPVVTPQLAERILAQVVRPTAAGMVAE
                     GTPYRGLLYCGLMIESGDAFRVLEYNVRFGDPECQVLCMLLESDLLPVLFETASFTSS
                     ELPAQSLQWAADAAALTVVLASPGYPGPYRSGDVIRGLEEAETLPGVKIFHAGTSRDA
                     RGQLVAKGGRVLNVTAHAATLREAQQRAYEAIARIDWPDAFYRRDIGWRALEREQRQK
                     PPPNVSSAR"
     gene            <264903..>265529
                     /locus_tag="CYME_CMJ085C"
                     /db_xref="GeneID:16994169"
     mRNA            <264903..>265529
                     /locus_tag="CYME_CMJ085C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534772.1"
                     /db_xref="GeneID:16994169"
     CDS             264903..265529
                     /locus_tag="CYME_CMJ085C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534829.1"
                     /db_xref="GeneID:16994169"
                     /translation="MLSLKLSLVAVAPLCCARFRSLVPARKLETSLEQPVRKRTRSGG
                     SVRDVPEPALPTNEAVPAAIRELIRASAACSFWEETHIDALHDKGLVINGLVFNSRAL
                     LLLPHYVLSVPAVNRVSDVSRDALCFLELLRPMPGTLILGCDEANAPAARNLLPADSM
                     EYLEKHLGVSFESTTVARACATFNFLNEERRTPAALVILGSKPSASVK"
     gene            <267596..>268843
                     /locus_tag="CYME_CMJ086C"
                     /db_xref="GeneID:16994171"
     mRNA            <267596..>268843
                     /locus_tag="CYME_CMJ086C"
                     /product="probable gamma hydroxybutyrate dehydrogenase"
                     /transcript_id="XM_005534773.1"
                     /db_xref="GeneID:16994171"
     CDS             267596..268843
                     /locus_tag="CYME_CMJ086C"
                     /codon_start=1
                     /product="probable gamma hydroxybutyrate dehydrogenase"
                     /protein_id="XP_005534830.1"
                     /db_xref="GeneID:16994171"
                     /translation="MPRMCSESGALFRAPTAFATPCALNSVQRPSRQLRSKVTDDSNW
                     PPQKAWVSAHRLPRFSWRRRFERPLAGTQSPRTLHNSLELTACMHGEASAPDRKGATM
                     SAVGFIGLGIMGSGMARNLFRAGHSLYVWNRTRSAAEAFAKELVNEQCGESKGYSSGN
                     AQVHVADSPRSVAGACNVIYSMLSTPEAALSVHLDAERGTVQELGPQKMLIECSTLDV
                     STMERLSEAVHQRGALFLEAPVSGSKVPAQTGTLIFLCSGDRAAYDRVASSGLDVMGK
                     ASFFLGERCGVGTKMKIVVNMIMGSMMVALAEGASLAESCGLSTETLNEILGLGAMNS
                     PLFSMKLPNMISSQYEAHFPLKHQQKDLRFAISLGDEMEQWLPLSAIANEVFKAAQAS
                     GFGDYDFSAVVEALRNKKRRPSN"
     gene            complement(<268909..>270453)
                     /locus_tag="CYME_CMJ087C"
                     /db_xref="GeneID:16994165"
     mRNA            complement(<268909..>270453)
                     /locus_tag="CYME_CMJ087C"
                     /product="probable beta-amylase"
                     /transcript_id="XM_005534774.1"
                     /db_xref="GeneID:16994165"
     CDS             complement(268909..270453)
                     /locus_tag="CYME_CMJ087C"
                     /codon_start=1
                     /product="probable beta-amylase"
                     /protein_id="XP_005534831.1"
                     /db_xref="GeneID:16994165"
                     /translation="MQRTWNILRSFSRVVDSVPIYVMLPLEFPTMDENDCRRLVEQTI
                     PHVAGASKCAGFMVDLWWGLCEQEPRKYTWCEDRYRALFSMCQRLGVKCQVVLGFHKC
                     GGNVGDSVTYGLPEWVLARARELKEKENKVILYMDRHGYMSEEYISCGADEEPLFPVQ
                     SAAANSEQQAASGQDASSPATDAQASAETEAPAASAQVEMRSPLQCYEEFMNAFVKDF
                     GDEFFGTVIHEVHIGMGPASELRYPSYPLTDGKWKFPGIGEFQCYDTFLMKDLEKALA
                     NQKFSEDEIRKCIPPRDTAGSYCDTPDQSEFFRSLYATPAGRFFLKWYGSKLLEHGER
                     VLVVANKCFHSYIADRRVRLGIKVAGIHWWFKTPSHAAEMTAGYYHTADDPWTMYDGI
                     AALLRKHGIIWNFTCYEMRDSEQREGKCSPEGLVNRVRIAAQKHGVALAAENALPRYD
                     RKAYKQIVAQAKPSSWGISLPFGRKAETRKTLCGFTYLRLTPELLEKHHLREFANFVS
                     WMQGAK"
     gene            complement(<272425..>273027)
                     /locus_tag="CYME_CMJ088C"
                     /db_xref="GeneID:16994173"
     mRNA            complement(<272425..>273027)
                     /locus_tag="CYME_CMJ088C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534775.1"
                     /db_xref="GeneID:16994173"
     CDS             complement(272425..273027)
                     /locus_tag="CYME_CMJ088C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534832.1"
                     /db_xref="GeneID:16994173"
                     /translation="MPYYETLMLIDSRLGRGELHELLKRIVLRFMDAGGIVTRLRALP
                     SAFTPAGLYEAAARPLPQKLRGPTREKHVAASFVECGAFLFPQALPQVQHQLRLDEQI
                     LRITSVRRTAAESLTCSLATERGMAPPRSVRAPPPPPARHRIPRGVVGALAPVSGLEM
                     FIEEFESRHPAGIAVYDTYRKQENPFRGTLPETGPTERED"
     gene            <273335..>276088
                     /locus_tag="CYME_CMJ089C"
                     /db_xref="GeneID:16994177"
     mRNA            <273335..>276088
                     /locus_tag="CYME_CMJ089C"
                     /product="probable ATP-dependent DNA helicase"
                     /transcript_id="XM_005534776.1"
                     /db_xref="GeneID:16994177"
     CDS             273335..276088
                     /locus_tag="CYME_CMJ089C"
                     /codon_start=1
                     /product="probable ATP-dependent DNA helicase"
                     /protein_id="XP_005534833.1"
                     /db_xref="GeneID:16994177"
                     /translation="MDPLCSEWNGNNSMDFLKNLTKEQSVVVRAPLERSLLIAASPGA
                     GKTHTLLSRLAFLLLSGKLEPGEFVFFTFSRAGIEEARSRLEKHAAIEPLVRSARTTF
                     QQAFQTLHSFGRRLVESTAAPVLERTCQRRTFMNVISQTQKRAILREAIERYRQRLQT
                     NWDRLPSCTQPLFHQLELSALESDDAGAEMAKGAKSSDDRLVKEISVQIAERKARFIS
                     PPTLEQVDSAAFQWPLLDFVYALYECWLQHLNCIDFDDMIVMAVRILETQANPPHLFP
                     RGLRLILIDEFQDTSASQLRLVRALAKRYACTVCAAGDDDQCIYEWRQARPQFMTEFT
                     RFFPDAAVMFLRESIRCPVNIACCANALIQHNTRRLCKSIEPLPGYEQLRVRIILGRC
                     VEDEVAYLGQELVRLHTENGVAWKDMAVLCRVAQPLETLRKLLRERDIPYAGAEQSKT
                     VARNPQNEYGIRMPASNLDHAWRETLILASPLVSMITLLVNEYDLHSLDDACKAYAPS
                     MHALTRTCVIDEARKRRNMPLMRVVQYMVENAQEFFEGVPDRNTMPINVSQNAKANFV
                     QASVAPGRLAPGFKRVSEPAPDAYRPKLSQGQWKACRVLLAAYERLLVIARDLGPEIR
                     LERMLEVALELLPASAPQHGWSITNDTRRLLRHLAHHVDEEARTRWEWASGAAALPSP
                     SPSAGPDAGISNNYGTDEEQRCSLQPAADSSSKLLYGALARRRRCTPLARNELGIRSS
                     ASHHEKDSWRKPLRQLLLCLQDAWQEGTRAFAHARRKVPLDAVAVSTIHNAKGREWPF
                     VFILRAVQGSCPLLYPEVDLEEERRVFYVGLTRARQQCTILASEPQTGKQQDPQQQPS
                     IFLDELSAPHCERIQWRPVQQQQQQQQQQQRARKRATPAGHASAKRERIAGASIPSAP
                     KKP"
     gene            complement(<276344..>277735)
                     /locus_tag="CYME_CMJ090C"
                     /db_xref="GeneID:16994175"
     mRNA            complement(<276344..>277735)
                     /locus_tag="CYME_CMJ090C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534777.1"
                     /db_xref="GeneID:16994175"
     CDS             complement(276344..277735)
                     /locus_tag="CYME_CMJ090C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534834.1"
                     /db_xref="GeneID:16994175"
                     /translation="MEYLEAKRLGKWIDNLQGPACVRFYRRQIGRGACASGASNDTCL
                     QSLPQERVPPDPYRLSACIVKIGNWSECAVDSGKPPATSVVAFVPGVGASHTMWLSLV
                     ELLSERCNGNRTSVGRTLVCLIDNRGTGGSELYPPPAPICRCVRARERKANLSLWTAQ
                     ALADDARYVLEQVLGATKALDSTHANTSIRLFLVGHSLGSAILCHLLLTSPPLEVSGI
                     MFLSMHQGRFRDWFPPSARAVRASVRYWLWWIRAATISTTALQNERKRLRLLTQRAAI
                     DLSLHFSDAFLASPLEPAAQRSLLHAPRTDPSAGELHHIRRSAETATATASALPKKRY
                     SRPIRRHEWYLFNYTAESLERFRAWDEIADVRHSSGRNADPLNAYGSLGQLHAVQVYR
                     LTRADLERLRVRIPEKAMLLYGRDDPLTRPRACRAFAEALGIPAIELTGAHLITEESK
                     IPLAQFLLDLVRA"
     gene            <279441..>280109
                     /locus_tag="CYME_CMJ091C"
                     /db_xref="GeneID:16994180"
     mRNA            <279441..>280109
                     /locus_tag="CYME_CMJ091C"
                     /product="Small GTP-binding protein of Rho family"
                     /transcript_id="XM_005534778.1"
                     /db_xref="GeneID:16994180"
     CDS             279441..280109
                     /locus_tag="CYME_CMJ091C"
                     /codon_start=1
                     /product="Small GTP-binding protein of Rho family"
                     /protein_id="XP_005534835.1"
                     /db_xref="GeneID:16994180"
                     /translation="MKRVKCVLIGDGGVGKTSLATRFALGEFPDSYLPTTFDSHTAVR
                     RLGTGALVEINIWDCAGQKEFDEVRQYVYHPGLDVFILCFSLVDRRTFEHCAQRWLAE
                     MRDFDPEVPFVLIGTKADLRDQSVLQGSSAIARIVLTEEGVRFARRIGAAAYVEVSSR
                     TGTNVERAFRAAAKAALSTSHEESFGDSDEPLASANGKLQGKRERNEAAASDQGGCCG
                     CCVQ"
     gene            complement(279650..282011)
                     /locus_tag="CYME_CMJ092T"
                     /db_xref="GeneID:16994185"
     misc_RNA        complement(279650..282011)
                     /locus_tag="CYME_CMJ092T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461350.1"
                     /db_xref="GeneID:16994185"
     gene            <282172..>283935
                     /locus_tag="CYME_CMJ093C"
                     /db_xref="GeneID:16994188"
     mRNA            <282172..>283935
                     /locus_tag="CYME_CMJ093C"
                     /product="similar to Na+/H+ antiporter"
                     /transcript_id="XM_005534779.1"
                     /db_xref="GeneID:16994188"
     CDS             282172..283935
                     /locus_tag="CYME_CMJ093C"
                     /codon_start=1
                     /product="similar to Na+/H+ antiporter"
                     /protein_id="XP_005534836.1"
                     /db_xref="GeneID:16994188"
                     /translation="MFMFAGHTLLACRRRCTSFSAGCAVRLHRSSASSTLGLRAKNLQ
                     ASKATLLWCRQERVPANEQDASGQTVGPSLRNDDAPETNGPVGASPATLPEANTDASA
                     TDADVETTGSDGRANVRRDRSRLAALVTSFGIMAALIRVEWVEHNTIEALWIVFCTGY
                     AGIILEDILEFHKAGAALLMAVASWTALALAAPGDSARYVNSVEVTTAIRECMADVAP
                     LLFFLLGAMSIVEIVDGHRGFRTVTDSIRTRNPVTLLWIISLITFFMSAILDNLTTTI
                     VMVSILRQLVPPSARRLVGAAVVVAANCGGVATPLGDVTTTMLWIGGQITTVATIRDL
                     LVPSFASLLVSVLVFSPMVAQAAAKDAIDPVGGGSLAGAVAPRGRLIFFSGVASLLFV
                     PIFKAGTGLPPYMGMLLGLGFMWLLTDVLHAGEPGRLELRASRALARIDQSSILFFLG
                     ILMSVGALESGGALRMLAQWLDSHLAVRELIPTVIGLASSVIDNVPLVAATMGMYELS
                     QHPPDSELWQLIAYCAGTGGSILIIGSAAGVAYMGMEKVGFFWYLRNASLAALAGYFA
                     GILVYISLHGDVLQRLFHQVF"
     misc_feature    complement(284571..285911)
                     /note="possible transcribed region"
     gene            <286046..>287272
                     /locus_tag="CYME_CMJ095C"
                     /db_xref="GeneID:16994162"
     mRNA            <286046..>287272
                     /locus_tag="CYME_CMJ095C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534780.1"
                     /db_xref="GeneID:16994162"
     CDS             286046..287272
                     /locus_tag="CYME_CMJ095C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534837.1"
                     /db_xref="GeneID:16994162"
                     /translation="MNGFISGSFWQQHQSLYSDTKNTYHAEVLTCRQRKERRLPKAAS
                     RGLGRTPARHLGRAARNSAGPFTRSTTLYRRECFGLAMSGTVDAICSDTLTGRGAYRQ
                     EPRFTALETNASILEVGTARIFIDPHLVGPLVFFDPRFFAQYKTKLHISDTRQVSEMR
                     KRIREQFGPISLVVLSQALADHAHEPSLRYLDRELPVVAPNSARPLLTKLGFENVQYL
                     RPGNSFRMDCGSERSPSDEYVDIQAVKGSVVGPPWQEPENGYIFRLYRVLAPNEAHVC
                     VFRMFYEPHGNFDASALRTALASTQDPDGRLVDVVLTPPIRVLFAGVYELLRGAPSAV
                     ELVQLLRPQMVIPIRNWEGHQSGLLSGLLRGTGSLQEFRESVAQIARRLQLDTQLVRI
                     GEPGEAFTLPLRPLSS"
     gene            complement(<287730..>288047)
                     /locus_tag="CYME_CMJ096C"
                     /db_xref="GeneID:16994176"
     mRNA            complement(<287730..>288047)
                     /locus_tag="CYME_CMJ096C"
                     /product="similar to thioredoxin h"
                     /transcript_id="XM_005534781.1"
                     /db_xref="GeneID:16994176"
     CDS             complement(287730..288047)
                     /locus_tag="CYME_CMJ096C"
                     /codon_start=1
                     /product="similar to thioredoxin h"
                     /protein_id="XP_005534838.1"
                     /db_xref="GeneID:16994176"
                     /translation="MVKEVQSVEEFDQILAGTEKLVVVDFYAVWCGPCRFIAPVLERL
                     QEEYAGTVEFIKVDVDKLPDLAQRCGVAAMPTFIFYKGGKKIDDLTGANESVLREKVR
                     KHK"
     gene            <289146..>289808
                     /locus_tag="CYME_CMJ097C"
                     /db_xref="GeneID:16994179"
     mRNA            <289146..>289808
                     /locus_tag="CYME_CMJ097C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534782.1"
                     /db_xref="GeneID:16994179"
     CDS             289146..289808
                     /locus_tag="CYME_CMJ097C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534839.1"
                     /db_xref="GeneID:16994179"
                     /translation="MAFVPNLWVHRRSARTRAPKRALCLRASSVEERPAATPTLLLAL
                     LAGNRLGASYRASRRIAIQNIAGLLESTALEKREGIRFPRDLGRLEGVWRLCYTSGRL
                     PVGCVNSYQVIRGASRQLANIVDLALPLAPPRTVFRLCIEHTFDVVGEHRIRLRQTAV
                     RTGITGEDAAPDVHWLRFPPVPIPGVMAEPVGYLDTIYTDEDGLRISRGDGGELRIFV
                     KV"
     gene            complement(<290660..>292453)
                     /locus_tag="CYME_CMJ098C"
                     /db_xref="GeneID:16994178"
     mRNA            complement(<290660..>292453)
                     /locus_tag="CYME_CMJ098C"
                     /product="proline--tRNA ligase"
                     /transcript_id="XM_005534783.1"
                     /db_xref="GeneID:16994178"
     CDS             complement(290660..292453)
                     /locus_tag="CYME_CMJ098C"
                     /codon_start=1
                     /product="proline--tRNA ligase"
                     /protein_id="XP_005534840.1"
                     /db_xref="GeneID:16994178"
                     /translation="MLRLRLRMESVDRVAFTSPSVNWCLKRRFACSGGRAIHERRACG
                     RPAPSYRFRSAHAGRVYASASRRQPGVIAAGQPPARSSEQGSITPRAVSYAQWYLDVI
                     AAAQLADSSPVKGSLVFRPHGWAIWELIREELDRRIRQTGAQNVSFPLLIPQSFLCRE
                     AEHVQGFAKECAVVTHHRLRAAPDGAPGALEPDPQARLEEPLVVRPTSETIVWHMFGR
                     WIQSYRDLPLMVNQWCNVVRWELRTRPFLRTLEFFWQEGHTAHATSAEAEAKAREMLT
                     VYQKFLEEWLAIPVIVGTKSSSERFAGAEETFTLEAIMQNGWALQSGTSHFLGQNFAR
                     AFDVEYQSADSGVRELVWATSWGLSTRVIGALIMTHSDDHGLVLPPRVAPVQVVIVPI
                     QSKDATEQSLVRQRCQEMQDALERAGVRVHVDARDHIRPGAKYFEWERRGVPLRIEVG
                     MRDLQAEQIVLVDRCLRSKEKLAFDNHWTKSVIARLDAFQERLFNNAKGFLREHTRRV
                     ESYDEMKRFLTPSNQDAAAYGNESNDEQHITGFFLVPWHDDATNEAIIKQDCKMTIRC
                     YPLDSQDEARGKKCFYSGRPATHMAIFARSY"
     gene            <292602..>294533
                     /locus_tag="CYME_CMJ099C"
                     /db_xref="GeneID:16994183"
     mRNA            <292602..>294533
                     /locus_tag="CYME_CMJ099C"
                     /product="formate--tetrahydrofolate ligase"
                     /transcript_id="XM_005534784.1"
                     /db_xref="GeneID:16994183"
     CDS             292602..294533
                     /locus_tag="CYME_CMJ099C"
                     /codon_start=1
                     /product="formate--tetrahydrofolate ligase"
                     /protein_id="XP_005534841.1"
                     /db_xref="GeneID:16994183"
                     /translation="MQLVQGFSRQRDVSFVRVSLGYWRGMVQHGRPLKQVQSPPPPDY
                     VIAQSVEPQPILEVAKAAGLAPSELDLYGQFKAKVRLNVLERLRDAPTGRLVVVTGIT
                     PTSLGEGKSTTTVGLSQALGAHLNQRVFTCLRQPSQGPTFGIKGGAAGGGYAQVIPME
                     EFNLHLTGDLHAITAANNLLAAAIDARVFHESTQSDEALYRRLTAKGFSPIMLKRLQK
                     LGIEKTDPKSLTPEEQRRFARLDIDPETIAIRRVLDTNDRFLRSVRIGLAPTERGYER
                     LTGFDITVASEIMAILALATSLADMRERFGRIVVGHQRGTGLPITADDLGITGALTAL
                     MKDAIMPNLMQTLEATPVFVHAGPFANIAHGNSSVLADQIALKLVGADGYVITEAGFG
                     ADIGFEKFMHIKYRAAGTAPRVAVLVVTLRALAMHGAGAGVRAGAESNMVRHIENIRK
                     FGVRCVVALNRFKDDTDAELATVIDVARRAGACDAVVASHFEHGGKGAVALAEAVVRA
                     CTASTDAQHDVPRLLYSLDMPLEEKVRIIACEVYRAARVEWTAEARRKLEKLEQLGYE
                     KLPVCMAKTQYSFSDDPEKKGAPEGFVLPIRDIRLSAGAGFVYPLVGEIQTIPGLPTR
                     PAFYDIDVDVETGQILGLS"
     gene            complement(<295042..>295575)
                     /locus_tag="CYME_CMJ100C"
                     /db_xref="GeneID:16994187"
     mRNA            complement(<295042..>295575)
                     /locus_tag="CYME_CMJ100C"
                     /product="small heat shock protein, hsp20 family"
                     /transcript_id="XM_005534785.1"
                     /db_xref="GeneID:16994187"
     CDS             complement(295042..295575)
                     /locus_tag="CYME_CMJ100C"
                     /codon_start=1
                     /product="small heat shock protein, hsp20 family"
                     /protein_id="XP_005534842.1"
                     /db_xref="GeneID:16994187"
                     /translation="MSYYFFDPFEDLMDDWFFGFPRVSRRRQAALQQQQQQQQYDDQK
                     PAKANGVVARPQNVMAMITPRVDFKETPEAYEINAELAGVPRDQVKVELHGDLLTIRG
                     EKREENRAEEKDEGGRVVYLRTERAFGAFERSLKLPKNVDRNSIKATHKDGVLNIVIN
                     KLKKDEDEKMNIEVTEA"
     gene            <295921..>296640
                     /locus_tag="CYME_CMJ101C"
                     /db_xref="GeneID:16994181"
     mRNA            <295921..>296640
                     /locus_tag="CYME_CMJ101C"
                     /product="small heat shock protein, hsp20 family"
                     /transcript_id="XM_005534786.1"
                     /db_xref="GeneID:16994181"
     CDS             295921..296640
                     /locus_tag="CYME_CMJ101C"
                     /codon_start=1
                     /product="small heat shock protein, hsp20 family"
                     /protein_id="XP_005534843.1"
                     /db_xref="GeneID:16994181"
                     /translation="MQYVLRSLQGNLKMLGQASAKLNFVVPFTGSSVVLRRPLMTPVG
                     GRSPYAPALARSVAKRSLSSARTSLMQANANSRERDNERTLVRGRRDWGWPFSIMRRD
                     PFFMSPLMDLDRFWSDFDALAQRSNAYLPALDITETNDAFVVSCELAGVPRENVKIAL
                     DGDILTVQGEKKWEHEEKDAKMHRMERSYGSFSRSVRLPTDVVDAENIKAQHKDGVLR
                     ITIPKKVKQQENVKEIPIEVS"
     gene            complement(<297211..>298545)
                     /locus_tag="CYME_CMJ102C"
                     /db_xref="GeneID:16994203"
     mRNA            complement(<297211..>298545)
                     /locus_tag="CYME_CMJ102C"
                     /product="adaptor-related protein complex 1, mu subunit"
                     /transcript_id="XM_005534787.1"
                     /db_xref="GeneID:16994203"
     CDS             complement(297211..298545)
                     /locus_tag="CYME_CMJ102C"
                     /codon_start=1
                     /product="adaptor-related protein complex 1, mu subunit"
                     /protein_id="XP_005534844.1"
                     /db_xref="GeneID:16994203"
                     /translation="MPVTAVLILDSRGRLLIARDFRGEVDLQEAAEAFRLGLERNAWT
                     NGSGDAAGTPPLVPVKNGAYYFATVKHNDLYFIAVDVSPYSFSGTLVAFLTSMIRVFG
                     EYFGKVVEESIRDNFVIVYELLDEMADFGYPQTTEPKILQEYVVQDYHVMEQPKPPMA
                     LTNAVSWRSEGIHHNRNEVFLDVIETVNMVIGPQGNVLRAGIHGSIVVKCFLSGMPEL
                     NLGLNESIQIEQRGSGASGSAGTTPPNTGAIELEDVKFHQCVKLPRFETERVISFIPP
                     DGEFELMSYRVANPTLRPLFSADAAMDMASHRIDYLVRARSLFKAGLTANDVSIWVPV
                     PEDADSPKFQVSSGRVKYAPEKDALHWRMKQFPGQRENSLQGYFRLPSVANAASRNSV
                     VRRPIQIQFEIPYFTISGMQVRYLKVWSREGYTSYPWVRYITRASDYEIRLS"
     gene            298532..300505
                     /locus_tag="CYME_CMJ104T"
                     /db_xref="GeneID:16994202"
     misc_RNA        298532..300505
                     /locus_tag="CYME_CMJ104T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461351.1"
                     /db_xref="GeneID:16994202"
     gene            complement(<298620..>299948)
                     /locus_tag="CYME_CMJ103C"
                     /db_xref="GeneID:16994194"
     mRNA            complement(<298620..>299948)
                     /locus_tag="CYME_CMJ103C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534788.1"
                     /db_xref="GeneID:16994194"
     CDS             complement(298620..299948)
                     /locus_tag="CYME_CMJ103C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534845.1"
                     /db_xref="GeneID:16994194"
                     /translation="MRPALEASSRRPPKQNAVRAVVRRPPLAGLGQRQIVAPALRRRN
                     PRQRHDISASDWAPKPWHRFLANQRTLKIPPRRLSNHEWQQGVFASACLGARSSQSEA
                     RHLRLPETDPTNFRRPIRKNPRNSMAREPKLVPATRSTAQCMNNGTLSSARYVLHALH
                     RAKRLPYVAASICLARSTSYRTQTLLVHEQMLRPFTLTRSCASPCGKDQRPCSAIYSK
                     VAIQARIHRVARKDSGAAVVYDSMSCDSVAAGARSLNVLIPVHTESYKGFLWILTESE
                     KNERTPALQFVNTRVARSLERSAFQNKHLSPERMTCPYPPDFAGLQDSPRMSSLRTSL
                     FFLSSREQAIWNTSTAALRPVRVPAPAARFSRHERCAGNCAPDASRSQSVTLVCAIRD
                     RSCGRVSSKVTRVRQVTQVICFSTTYRISSVHAVARFGPREQHRNALALR"
     gene            <302710..>303240
                     /locus_tag="CYME_CMJ330C"
                     /db_xref="GeneID:16994197"
     mRNA            <302710..>303240
                     /locus_tag="CYME_CMJ330C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534789.1"
                     /db_xref="GeneID:16994197"
     CDS             302710..303240
                     /locus_tag="CYME_CMJ330C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534846.1"
                     /db_xref="GeneID:16994197"
                     /translation="MDNETFSDLDDDRPLDEVLKNSTRTESGTPPRKPIRKSKKNRSV
                     PASASIPLRPGSLKQDPSLAGTEALEQEPASVSKNAESGAGENGASDKAVRASNSPAK
                     KYALPGQRRDPPPENDPLRIFYTTMREEKLRKYGRSSVLADEWLMVHGLLDEETARSV
                     LDARRKRQMEVLRQTP"
     gene            complement(<304149..>305465)
                     /locus_tag="CYME_CMJ331C"
                     /db_xref="GeneID:16994046"
     mRNA            complement(<304149..>305465)
                     /locus_tag="CYME_CMJ331C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534790.1"
                     /db_xref="GeneID:16994046"
     CDS             complement(304149..305465)
                     /locus_tag="CYME_CMJ331C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534847.1"
                     /db_xref="GeneID:16994046"
                     /translation="MAFVVSSSWGCTNVWTGCRRALRRGATSLRSPPRVPVRAHRSVG
                     VPARRPLRSLVLSVDAGGTAHARITDLNTVPVNGGQSLEDETGYEARAGAPGTPSEPR
                     YEGSDFGGTGGKSGGGGGGGGGGGGGGGGGGDEGSFEPSRPLSAAGDLTRFMESRSFT
                     WNDIPNDVREAFQKGIISAAVIKNYIYAASNPVSRFLMNRTSRGMRERFLADNLFLTK
                     ILIEEGLGLCGKLSAEYEVRRDRFFDELDFVFANVLMALLADFALVYFPAPSVKLNPA
                     MATSSPFGSVGRIVSNYTNGMPSNIFQVDRPYTLQQRIACYLFKATQLFVTGTACAAI
                     GVSVTNVLLSVRQMLDPEFVPQNPKSNVLFTSIMYGLFLGLSSSTRYQLVNGIEIHIF
                     PKILGNSPRFVEGVATYLLRWGNTFWGSQQWALWARFTGAQKSGKH"
     gene            <307878..>308966
                     /locus_tag="CYME_CMJ105C"
                     /db_xref="GeneID:16994047"
     mRNA            <307878..>308966
                     /locus_tag="CYME_CMJ105C"
                     /product="similar to chloroplast inner membrane protein
                     Tic22"
                     /transcript_id="XM_005534791.1"
                     /db_xref="GeneID:16994047"
     CDS             307878..308966
                     /locus_tag="CYME_CMJ105C"
                     /codon_start=1
                     /product="similar to chloroplast inner membrane protein
                     Tic22"
                     /protein_id="XP_005534848.1"
                     /db_xref="GeneID:16994047"
                     /translation="MSAFAVPAAHPARRQRPALGLDRPLVPRWSSKRQVLFHRGRPLV
                     TFRKHLLSATERVCLSEQRTPGVVGQPAPETSWMQRAARALLLGLATVNIWTPLLRGF
                     SLGAGLQVLLGAPAVSAAKTPHARYSRKTLSEKLAQVPVFAVTNESGQPFLAAMERGL
                     QVGLIFFDPDDAIKMLEDLKRSSGKEAEDARIFIMGLDRAFEMVKSKPQPSGLRGPRG
                     DELKMVFRFYPNQQQLEYARTVAKKTKQPTVRGVPCFVAKGLTLRKGKEFVIPIFLDK
                     RDLDEAWNRLRQELAELPKQPEIEVGDLIEVILRLEEAAKNPKSLNETELQDLRRVAF
                     FPSSKSVEFMKRESAKQFKGTARMHSRP"
     gene            309800..309892
                     /locus_tag="CYME_CMJ326R"
                     /db_xref="GeneID:16994147"
     tRNA            join(309800..309845,309855..309892)
                     /locus_tag="CYME_CMJ326R"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:16994147"
     misc_feature    complement(311927..313510)
                     /note="possible transcribed region"
     gene            <313884..>314861
                     /locus_tag="CYME_CMJ107C"
                     /db_xref="GeneID:16994196"
     mRNA            <313884..>314861
                     /locus_tag="CYME_CMJ107C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534792.1"
                     /db_xref="GeneID:16994196"
     CDS             313884..314861
                     /locus_tag="CYME_CMJ107C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534849.1"
                     /db_xref="GeneID:16994196"
                     /translation="MSGRVRRHSLVVGERGPEGIDAATSASEGNTSATLHGSAATEEN
                     DALALKCIEVLLAREHLFTYPADYEPPLVDSEQYRRRCLQVQRSVSFVRRLRISEEVA
                     GLSVAFYDRIHSEVLPATLETSITDEVWGAASLALACEARELPAALVVILLAGDDRAK
                     SLRIWEAKQRLRAHLNWRIEMVTPYQYIRAIPRAPTHVRILASGIVTLALTDVQLIRQ
                     LPSRIAAAAVAVAFIIFDELHEAVERSMEEQLRVHALERFTPLRTSPRSPGQRETVAT
                     TPAGSCPLMNPQTLDLELMRRLLRIFFFSEAPDIAGGVFSLSSLSETST"
     gene            complement(<315919..>317214)
                     /locus_tag="CYME_CMJ108C"
                     /db_xref="GeneID:16994191"
     mRNA            complement(<315919..>317214)
                     /locus_tag="CYME_CMJ108C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534793.1"
                     /db_xref="GeneID:16994191"
     CDS             complement(315919..317214)
                     /locus_tag="CYME_CMJ108C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534850.1"
                     /db_xref="GeneID:16994191"
                     /translation="MKPACVTDSVKKPLSLCAKEERDIEGNQNAFEGAESALERPDSV
                     PYLLKVLRQLILYVETKPALMDGSASFIRDFLRTFLIQTQAASVQDSWTGGNNLREPL
                     WFASAGSASGNGMLSPAAASAAHLEIEAMDAAEDFMVEEGSSGLGSGSAVPEADGAEE
                     ASRGSARVTLVRAPLSLSALSSSAAASSRYQKASRETKSYVLGNRPTTISDLPDDTLR
                     RIFTYMNGPQLGRVRGVCKKWCKFASDENLWRKLCLENWRALETDAYLWRLLLDYHLS
                     QEAQASNREPLVSEDSRWRFMYPIVRYVPKWTCRLQKTGRFVCRLVAHQIGGPLTDEE
                     SIPPVVVVERRFNLNHLNEFVLPDAAVFYFEPEREEDRDGYQNFIEYLIQRHRAGLAL
                     DEERRIIFIPPCAYSQNVLHYNGEALLGVVQHSYPPLAG"
     misc_feature    complement(319573..321087)
                     /note="possible transcribed region"
     gene            complement(<322572..>323216)
                     /locus_tag="CYME_CMJ109C"
                     /db_xref="GeneID:16994066"
     mRNA            complement(<322572..>323216)
                     /locus_tag="CYME_CMJ109C"
                     /product="60S ribosomal protein L10"
                     /transcript_id="XM_005534794.1"
                     /db_xref="GeneID:16994066"
     CDS             complement(322572..323216)
                     /locus_tag="CYME_CMJ109C"
                     /codon_start=1
                     /product="60S ribosomal protein L10"
                     /protein_id="XP_005534851.1"
                     /db_xref="GeneID:16994066"
                     /translation="MGRRPARCYRYCKNKPYPKSRYCRGVPDPKIRIFDLGRKKAATD
                     ELPFCVNLVSDEREQLSSEALEAARVAANKYLTATAGKDGFHLRVRVHPFHVIRINKM
                     LSCAGADRLQTGMRGAFGKPQGTVARVDIGQILMSVRVKEQHVEAAKEALRRSKYKFP
                     GRQRIYVSRYWGFTRFTREEYEKLRAEGKLIEDGGNVKLIRPHGPLPTPPVTAQ"
     gene            <323715..>324332
                     /locus_tag="CYME_CMJ110C"
                     /db_xref="GeneID:16994186"
     mRNA            <323715..>324332
                     /locus_tag="CYME_CMJ110C"
                     /product="60S ribosomal protein L15"
                     /transcript_id="XM_005534795.1"
                     /db_xref="GeneID:16994186"
     CDS             323715..324332
                     /locus_tag="CYME_CMJ110C"
                     /codon_start=1
                     /product="60S ribosomal protein L15"
                     /protein_id="XP_005534852.1"
                     /db_xref="GeneID:16994186"
                     /translation="MGAYKYLQELWRKKQSEALRFLQRVRAWEYRQRPTVHRATRPSR
                     PDKARRLGYRAKQGYVIYRVRVRRGGRKRPVPKGIQYGKPKHQGITQLKFQRNKRSVA
                     EERVGRKICANLRVLNSYWINEDALYKYYEVILIDPNHNAIRRDPRINWICRPTMKHR
                     ELRGLTSAGRKGRGLHRKGHLVNKARPSVRSVWKRHNTLSLRRYR"
     gene            complement(<324351..>324764)
                     /locus_tag="CYME_CMJ111C"
                     /db_xref="GeneID:16994190"
     mRNA            complement(<324351..>324764)
                     /locus_tag="CYME_CMJ111C"
                     /product="similar to ethylene-responsive transcription
                     coactivator"
                     /transcript_id="XM_005534796.1"
                     /db_xref="GeneID:16994190"
     CDS             complement(324351..324764)
                     /locus_tag="CYME_CMJ111C"
                     /codon_start=1
                     /product="similar to ethylene-responsive transcription
                     coactivator"
                     /protein_id="XP_005534853.1"
                     /db_xref="GeneID:16994190"
                     /translation="METQDWKEVVINPRAKRNQVSSQSLTGPITGAAAEKKFGAGSNK
                     KNLVPNAKRLDEAHEPERLQSVPLSLAKRIQQARQQKGWTQTQLAQAIGERARVVNDY
                     ERAAVPPNPVIINKMEKALGVRLRGQGSTPAPSAK"
     gene            complement(<326151..>328430)
                     /locus_tag="CYME_CMJ112C"
                     /db_xref="GeneID:16994204"
     mRNA            complement(<326151..>328430)
                     /locus_tag="CYME_CMJ112C"
                     /product="vesicle coat complex COPII, subunit Sec13"
                     /transcript_id="XM_005534797.1"
                     /db_xref="GeneID:16994204"
     CDS             complement(326151..328430)
                     /locus_tag="CYME_CMJ112C"
                     /codon_start=1
                     /product="vesicle coat complex COPII, subunit Sec13"
                     /protein_id="XP_005534854.1"
                     /db_xref="GeneID:16994204"
                     /translation="MTEDSALEGALIVPKLFIETQHNDRILDLQFDFYGKRLATCAAD
                     GKIKVFDCSNAGLGSGALSSARLVSEVQASTSGPVWQVSWAHPCFGTVLASCGFDGRV
                     IVWAEQEPPPAAWPGGARSRPTPGPLLQPIYEHRAHEPASVNAVAFAPPEYGLTLACA
                     ASDGRVSVCRRDERDGSWRVEWVADPATGIAHKLGATCLSWAPAGNINSTLAEQAADA
                     AGTWSPMRLATGGCDHLVRIWIYDASSECWRIEGDGVSSPRSGELPGHTDWVRAVAWC
                     PSRSAGQVLASAGQDGRVLIWRRVPSGAHGEAAKHDGGQWSYVELPRFKAPCWGLSWS
                     TAGLFLAVSCGDQTVSLWRQLPSGEWKQIAEASEAGAQAIRDRERAQAQQELGSAATA
                     STASAGSVPASLRQRAPSGPVTPQLAHMSPAVSPGSHPGAGNLVRSGFDSSFAGAGAR
                     FPGMPPASVTSQVAATNQVPVAGARTSGSFVPAAGIMPPPPGTTSVYAMNAAASGARG
                     LPPGLASNASGMERSVPPAPAAFSPNSTQRAPPAYGAAQVGAFPQPPPSPAAPPVRPA
                     PPPPLPGIATPVQSNAGAFAGQAPQSSLTSPLMRPQPPPMSRSGSTALHAPQQAPAVP
                     RSQVPASPRVSAASMYSGGAPPLPPPMTTTTTMTSGAQSLPSASMPYPIGQAGHPWSS
                     SMAHAGTGAPIVPPPPLVAQQQQQQQQQQFSSGSQGVARQGMVQSGAQGPWSGALQGR
                     QPPPPPPPPPSSSSSSTYR"
     misc_feature    complement(328905..329371)
                     /note="possible transcribed region"
     gene            <329508..>330035
                     /locus_tag="CYME_CMJ114C"
                     /db_xref="GeneID:16994198"
     mRNA            <329508..>330035
                     /locus_tag="CYME_CMJ114C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534798.1"
                     /db_xref="GeneID:16994198"
     CDS             329508..330035
                     /locus_tag="CYME_CMJ114C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534855.1"
                     /db_xref="GeneID:16994198"
                     /translation="MTLPDAFGIFCISLIASLVSEYLLYLTVYRRQSFRNDRDELIAL
                     QRKLHQEEHRIVRADRKPLHERRIASLERTLQETYARASRRKMWMNLAISIFYFFVYR
                     AVHRTYSGRAVAALPFEPIPAVRRITHRDVPGDHPRETGLAFIYMLCSMTLRVFIGRV
                     SGHDLPPVVARRLSK"
     gene            complement(<330235..>330933)
                     /locus_tag="CYME_CMJ115C"
                     /db_xref="GeneID:16994199"
     mRNA            complement(<330235..>330933)
                     /locus_tag="CYME_CMJ115C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534799.1"
                     /db_xref="GeneID:16994199"
     CDS             complement(330235..330933)
                     /locus_tag="CYME_CMJ115C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534856.1"
                     /db_xref="GeneID:16994199"
                     /translation="MFVDRIVLSFRGAGLERANTCLRKGQRLRKACSHVFRPLCSSDL
                     PVNLPTDLETKRVMKPPLAERESIWSYPRPPRVEPNTRHLRVVHNQVTIAETRRGYRV
                     LEYSHPPSYYIPLDDIDLQYVMVSSKVRSTFCEFKGEATYYDVEVGWEVSEGAAWSYD
                     FPTRAYRMLKDHIAFYPAKVDACWVDEYRVRPEPRSFYGGWVTPLVKGVYPEEDVEDD
                     EDSSGGDGKDSATQ"
     gene            <331509..>332066
                     /locus_tag="CYME_CMJ116C"
                     /db_xref="GeneID:16994206"
     mRNA            <331509..>332066
                     /locus_tag="CYME_CMJ116C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534800.1"
                     /db_xref="GeneID:16994206"
     CDS             331509..332066
                     /locus_tag="CYME_CMJ116C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534857.1"
                     /db_xref="GeneID:16994206"
                     /translation="MLHLICCLGACKCAGLRQLHCSDTNLWKRSRSVSRIAAFPLGTL
                     VRYGDPVHVQYKLVQQLLDTIAKYSVVALVSGYPLELSRSREGPSCSMVRSFLSSLTV
                     TPELMCRVVPTLCLPLPCLLWDERFSSVSAQWYQYVEEPGRRGHVRPLPQWKKRGIDA
                     YAALIILRGVLECDWARYQAPPRTL"
     gene            <333921..>336116
                     /locus_tag="CYME_CMJ117C"
                     /db_xref="GeneID:16994205"
     mRNA            <333921..>336116
                     /locus_tag="CYME_CMJ117C"
                     /product="sulfite reductase, ferredoxin dependent"
                     /transcript_id="XM_005534801.1"
                     /db_xref="GeneID:16994205"
     CDS             333921..336116
                     /locus_tag="CYME_CMJ117C"
                     /codon_start=1
                     /product="sulfite reductase, ferredoxin dependent"
                     /protein_id="XP_005534858.1"
                     /db_xref="GeneID:16994205"
                     /translation="MWAAFVFLPTSRFLQRASPPCPSSNLCGRQRSAGRVSAGTASLR
                     AQEGTTNTPPRKLSPVEGIKERSNQLRYPLIDELRNDEIFVSGDAGQILKFHGTYQQD
                     DRDQRTKGEQKKYQFMLRLKMPAGELPASFYRVLDDLSEQYGNSTLRATTRSTFQIHG
                     VLKGNLKHVMATIMNAGGSTAGACGDINRNVITTPAPYQSPPYQHVRFIAKMLAEVFA
                     PQTGALCEAWLDGEKAASIEYWKRDIDMDEVKRIREHDNGRGQVFSGKEEPIYGETYL
                     PRKFKMAVTVPGDNSVDIFTNDIGIVVLMDDNYVLQGYNILVGGGMGRTHNKEATFPR
                     LADPLGFVPPDSLFDTIKAIVAAQRDHGDRQVRTNARMKYLVHRLGIDGFRDLVRSYM
                     TDNGAALQPWRPIPAWEHRDYLGWHEDGTGKLFYGLLIDNGRVRGPLKKALRQIVDEI
                     SPGMIMTPHQNLLLTNIMPEQRQVVEGILAQHQVYRDVRHIDQLVRKAMACPALPLCP
                     LAITEAERVMPQYLERIREILGKAGIAPSESFFTRMTGCPNGCSRPYMAELALVGSGP
                     NEVYQLWLGGSPNQTRLAWPFADRLSLNELDRVLEALFVFWRQERRPAEAFGDFCDRI
                     GKNGLEQFVSQYGEGHANGDTSKARASTSRLSKSTANNEEKVPLRPRVSLRPAVHARL
                     RTMAARAGVPLKVLVDEILTKFIASPESEKMFGGRISSAIKTDGNTAMD"
     misc_feature    complement(335536..337610)
                     /note="possible transcribed region"
     misc_feature    337536..339167
                     /note="possible transcribed region"
     gene            complement(<339892..>341421)
                     /locus_tag="CYME_CMJ120C"
                     /db_xref="GeneID:16994211"
     mRNA            complement(<339892..>341421)
                     /locus_tag="CYME_CMJ120C"
                     /product="putative nin one binding protein"
                     /transcript_id="XM_005534802.1"
                     /db_xref="GeneID:16994211"
     CDS             complement(339892..341421)
                     /locus_tag="CYME_CMJ120C"
                     /codon_start=1
                     /product="putative nin one binding protein"
                     /protein_id="XP_005534859.1"
                     /db_xref="GeneID:16994211"
                     /translation="MVENAATRRFLVLDASAWIHASESWLQRAALEKDLQLCTVPDVL
                     HEVRDEAARKRLEWLLGLKSGGADDARALTVSEPSPKAVACVERAARETGDLGFLSTA
                     DVNLIALAIDLGHPEKPSEPVTSGNGVEETCGAGSAPSTRTASDSFDIHGERIAQSAL
                     SWRRESTRNPDFFDPRTYVFGEGLKKVRRRLSELDASLPESLLRGVDELSMYPGSRPH
                     HRAECNRTACEKESQRSMKNDVQSCIPSEAEKDSSENGASSAYVDSSRGMSSHAEALC
                     ADTWLPPTHNPEAIASELRWDALKPGQVAIATTDFSMQNVMRCLDIPLVSVDSRKTIR
                     WARHFIRLCTACNRTIDAQELDEQTIRFCPECGNYGTLIRCIKEVTAGDTDTSGIGAK
                     HRERIRLPRFARSIDGAPRLSTRGSLSSIPKPVGGRDGLYRDFILRADEYSEKLRRHQ
                     RMSRRKAANCPSNAAHNSAQGTEELFGPRQTYLAPVLPVVHPSSRNALPTGRHQRRSK
                     R"
     gene            <343538..>344011
                     /locus_tag="CYME_CMJ121C"
                     /db_xref="GeneID:16994212"
     mRNA            <343538..>344011
                     /locus_tag="CYME_CMJ121C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534803.1"
                     /db_xref="GeneID:16994212"
     CDS             343538..344011
                     /locus_tag="CYME_CMJ121C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534860.1"
                     /db_xref="GeneID:16994212"
                     /translation="MLGFVTGLIPLTRNDSVVDSSLKRCRVRTSKVSLRMQLKRLRWS
                     EFEDRAAYAPLPRNWAGEFDSIGPLDPPKSQEEKLPEQIFGQKYEKPLPLNITPEEEA
                     AFKAFQSAEQRARQEAVARLAEKKQLETAAPGIMSNFDPAWVYKTPVLEYWRSRK"
     gene            complement(344035..345922)
                     /locus_tag="CYME_CMJ122T"
                     /db_xref="GeneID:16994213"
     misc_RNA        complement(344035..345922)
                     /locus_tag="CYME_CMJ122T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461352.1"
                     /db_xref="GeneID:16994213"
     gene            <346091..>350443
                     /locus_tag="CYME_CMJ123C"
                     /db_xref="GeneID:16994209"
     mRNA            <346091..>350443
                     /locus_tag="CYME_CMJ123C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534804.1"
                     /db_xref="GeneID:16994209"
     CDS             346091..350443
                     /locus_tag="CYME_CMJ123C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534861.1"
                     /db_xref="GeneID:16994209"
                     /translation="MQVRPLPDLARELHASQVRVVVRALQELWVEHGALGDCSATAED
                     LAAILVEEIGARDVDFDVETLESESAGSADVDSDELLEGLRALREAKRKVALAKQGEE
                     RSLENVDAEHFSERAEELVVFLLNEVSRERLGHSLAKRSALETQRAESGVPADAHQTH
                     RAGHAFFNLVLALYTAVMLRSERSKTRHLGCLLLARLPVRAAMTALALDRGKVVAILL
                     REHSFLRKAAARALSTLLLRFVDVVSGANAAKPSQFEDVDSIWLRRLRYDQHFLRTLA
                     TVFRGLVIALEDPDDEVFAESLLGLVRLCRGRPEGAESARSPLGLHCFEILDASGAAI
                     IARFYQTSDPELKSTILRELPGFIALSLDRHKQGSNAAGKTAPRAAPPQTKRKVSCAV
                     DPGAGPAPEADDLWALSFVREFCMPMLKLERNLVRLEDEAAAETNASHGSGSQPKSHR
                     HTKATERNESVWRAVVVFLLELACLTRNRDVQDLLASELPALQVALSQRELSSGLSAY
                     LFRSLLSASMELLPTPEGQYRFLLKELELWPRRPRSCQTRANLMLLVSLTMDCAYRFP
                     SGRVENGAPFGASASAFTDVPSICRALFPPLRRNLLDSHLVRESDWNRLRDTLFCAMT
                     VVCARLHTSLCGTGQQAFDTNRAHTNPSGQQVDLLSEARCHELTTTLHFLSNFREIVF
                     RYHGLSAQYGDFMAALICLALQAVFYQRGVPLALQQVAIGFMTETLRDCARHVASPTA
                     LKIFSRGICCALPLLPPFEAENELYDMLVIFLEQAVARASALPVQRRVWRSSTGVLRF
                     ETCAPVRAWQSAETVELSGSALSPDENKTGAGDPLLQMLLDAGQSPQMLLRKATSGAT
                     APNANPGERKVHAARHSIPSLLLDSDEETNLEEKNPADERQVPLRTLISEAAPMLYDT
                     QTGTEYAEFVRRTNLELIGSIFEMQKRFPGANSRALRTYVQLAVLQIELLAESPSRAY
                     RDDVFLDVAAAADSQLRFLRIGEYATPESRDALLRRVATKDDTQLQAFLIVNGGQARP
                     LVAAHITDAVVDVVRALLLHEHLLMQCVPDALRKATVSEVNGLERSWVTRQPSVAAFI
                     ERFLAFVWPRVSTGPAPGTPAPAVQLCGDHGPLRIQAHYTLDHRAGLVRLVLDVEYQE
                     DACGFADIRIGFCGDGDSSDSSDTASSASADAVKSPADAGWLQVPEQYQYRFFLRQSA
                     TLQVPLPLRRGVYYVEPIRVRVWWRPCDSLANMFVTESSNGTDAAVPVVGVDDYQTRA
                     AAAVAVWQCRTAMPMALGEVPVTPSRLLLFSPLDTGTGASSLEFCYGLWDRCPAGRAA
                     AMAPAETSLPAVSRSYLWVHYLLRFLETTFSFRTMAKAPDSEPQYAVLYARSRVHGYS
                     VLMRLEAPLDTALQGTGSPRDLEPGMRPWILMHLRSEDALFLDVFYGHLVNALRHWEL
                     PLDVREHDERSIMS"
     misc_feature    complement(347149..350594)
                     /note="possible transcribed region"
     gene            <350966..>351547
                     /locus_tag="CYME_CMJ125C"
                     /db_xref="GeneID:16994215"
     mRNA            <350966..>351547
                     /locus_tag="CYME_CMJ125C"
                     /product="40S ribosomal protein S9"
                     /transcript_id="XM_005534805.1"
                     /db_xref="GeneID:16994215"
     CDS             350966..351547
                     /locus_tag="CYME_CMJ125C"
                     /codon_start=1
                     /product="40S ribosomal protein S9"
                     /protein_id="XP_005534862.1"
                     /db_xref="GeneID:16994215"
                     /translation="MGKSYRNFSKVYKIPRRPFEKERLDAELKLCGEYGLRNKREVWR
                     VQYALSKIRAAARELLTKDEKDERRIVEGAALLRRLTRYGLLDQTQQDLNYVLSLKVQ
                     DFLERRLQTQVFKLGLAKSIHHARVLILQRHIRVGKQLVTVPSFMVRVDSQKHIDFAP
                     TSPFGGGRPGRVKRRRLRRESSGDAGDAADDDE"
     gene            complement(<352519..>353193)
                     /locus_tag="CYME_CMJ126C"
                     /db_xref="GeneID:16994216"
     mRNA            complement(<352519..>353193)
                     /locus_tag="CYME_CMJ126C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534806.1"
                     /db_xref="GeneID:16994216"
     CDS             complement(352519..353193)
                     /locus_tag="CYME_CMJ126C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534863.1"
                     /db_xref="GeneID:16994216"
                     /translation="MFIQGAGFSGTRWKPSLNRNGQAVSLTTAHTHGVFCPRSRVQSA
                     PASAAGVHRSTALPHRGVIGLQAKKGKPNAPLAPPSELEVPEDGTPVFAILARSPVSG
                     LWYPLGTMRGDGRAKMLVNAMRTSWGRKFYGDTLNKGVARSVFSEQGRRMIHAALRKY
                     SALRKYTADDLEYGYRVIAKDFDYPTQMIRPEQAMSLIQWLKMKLGRGKPPSIAMKDE
                     STEWRK"
     misc_feature    354165..356334
                     /note="repetitive element"
     gene            <356981..>358870
                     /locus_tag="CYME_CMJ128C"
                     /db_xref="GeneID:16994214"
     mRNA            <356981..>358870
                     /locus_tag="CYME_CMJ128C"
                     /product="phenylalanine--tRNA ligase beta-subunit"
                     /transcript_id="XM_005534807.1"
                     /db_xref="GeneID:16994214"
     CDS             356981..358870
                     /locus_tag="CYME_CMJ128C"
                     /codon_start=1
                     /product="phenylalanine--tRNA ligase beta-subunit"
                     /protein_id="XP_005534864.1"
                     /db_xref="GeneID:16994214"
                     /translation="MPTVTVIRDRFLKALDSDLDEAALEQLCFSYGLEVETVEDEPLS
                     DLLGGQRARSGWSDSIDDVENYAGPLDQHVACLKIEVPANRPDLLCFEGLVQALRVFR
                     GLDKPAAFLLQRTEPRERILVRTNALRPYIVAAVLRGIDLSDPLRYQSLMDLQEHLHQ
                     NLGRRRALVAIGTHDLDTVKGPCTYTVKDPREIRFRPLAAERELSGLEIIEHYRLDKH
                     LKRYLPLVEGAQAYPLLHDSEDQVLSLPPIINGDRTKIRPSTRNMLIECTGTDLVKLT
                     TALTVIVASFSRYCLPAFYVEPVTIHYDQPLPEDRLAAIKANVLDSQTLCTPWVEDAQ
                     MQVSARYVQSLLGVSLSVSELERHLQRMQLHLVSVVENEAFDQVLNVQVPVFRSDILH
                     PCDVAEDVGVSYGFDHVPERTAPCVPVGQWRPLERLTDHLRRELAQQGYFEVLTWVTV
                     SHAENTEMLQRSDAQSPAVRLHNPKTLEFEECRTSLLVGLLKTLREHREAPLPLRLFE
                     TGDVVLLDSKSETGARNERHLAAVYSDVRAGFEIVKHLLDRIILALNLKSLGYNAGYR
                     LDPKACHDDLFFPGRRATILVERPNGARFALGSMGWLHPQVLKNFGLAAPASAFELNV
                     QPFAA"
     gene            complement(<361470..>362998)
                     /locus_tag="CYME_CMJ129C"
                     /db_xref="GeneID:16994193"
     mRNA            complement(join(<361470..362443,362686..>362998))
                     /locus_tag="CYME_CMJ129C"
                     /product="histone deacetylase"
                     /transcript_id="XM_005534808.1"
                     /db_xref="GeneID:16994193"
     CDS             complement(join(361470..362443,362686..362998))
                     /locus_tag="CYME_CMJ129C"
                     /codon_start=1
                     /product="histone deacetylase"
                     /protein_id="XP_005534865.1"
                     /db_xref="GeneID:16994193"
                     /translation="MKAEAGTSESRVGTLEAFPSRVAYFYDHDVGNYYYALGHPMKPH
                     RMRMVHELLIAYGVHEKLQVLQPPRATERDLTRFHSDEYIEFLRRITPETAQKQLDQL
                     QRFGLFEDSPCFDDIYRFCQISAGGSLAGAARLNRGFCDVAINWSGGLHHAKKSEASG
                     FCYVNDCVLAILELLKHHARVLYCDIDVHHGDGVEEAFYTTNRVMTCSFHKFGNFFPG
                     TGDVRDIGYGPGRHYALNFPLQDGIDDVCYREIFAPIMSRVMEWYQPTAVVLQCGADS
                     LSGDRLGCFNLSLDGHAQCVRFFQRYGVQLMLLGGGGYTIRNVARCWAYETALAAGVV
                     LDDMIPYNPYYEYYGPDFRLRIRPSNMENLNTPSYLHRMMVQLLESLRSLPHTPSVPF
                     HSVPADVISDPLLRKFSAPVPLSDDEHSVCSSDWDD"
     gene            <363276..>365285
                     /locus_tag="CYME_CMJ130C"
                     /db_xref="GeneID:16994017"
     mRNA            <363276..>365285
                     /locus_tag="CYME_CMJ130C"
                     /product="probable cryptochrome DASH"
                     /transcript_id="XM_005534809.1"
                     /db_xref="GeneID:16994017"
     CDS             363276..365285
                     /locus_tag="CYME_CMJ130C"
                     /codon_start=1
                     /product="probable cryptochrome DASH"
                     /protein_id="XP_005534866.1"
                     /db_xref="GeneID:16994017"
                     /translation="MYVVLPAHSGTRQLQRGLRPALHPISDGVGVRATRQRASRRHRT
                     PLVAVQWEWFGWDLDGRFEPDLTDITPKPEKVLPNTGTTYADSLVFPTDSKRWPDSLP
                     GTALLWFRNDLRLHDNEALRLANRAESLLCVYVFDERYFFGKSRFGGFLRIGEHRAYF
                     LRECIVDLRQALRSRGQELIVEIGSPVDVIPRLVQKFGVQHLIFSKEVTEEEIATENA
                     LVRTLAQVAAQGQISAPVQCHAVWNATLVHIEDLPYPFPGKAKDISRRAESPVPKTRG
                     TPAVDRVFPDTFTTFRRLVERSWTVRETWQCPEVLTLLPDDASNFNTIDWSGALPIEY
                     PAEATRIGAEPPKLLLMRPYPDPRACYDFHGGETVALSRLEDWIWETQSLASYKETRN
                     GLEGPDYSSKFSCFLAHGCISPRLIYNAVRDFERRVESNESTYWLLFELLWRDFFRFT
                     AVHHGNAIFKRRGLRGVRGASKTSQSGARSAVVRQREDVSPDARLTAWCQGRTGVPFI
                     DAAMRELRLTGFMSNRARQVVASFLINDLGLDWRLGAEWFESQLLDYDPCSNWGNWCY
                     LAGVGNDPRSGSRYFHPLKQAYEFDPRATFTKRWCPELFWVDNALIQTPWKWNRKMQE
                     AFRVTLGDQYPEPIVTLREPGRARTPPKVSPSTPVDTDAAVHHES"
     gene            complement(<366419..>367351)
                     /locus_tag="CYME_CMJ131C"
                     /db_xref="GeneID:16994079"
     mRNA            complement(<366419..>367351)
                     /locus_tag="CYME_CMJ131C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534810.1"
                     /db_xref="GeneID:16994079"
     CDS             complement(366419..367351)
                     /locus_tag="CYME_CMJ131C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534867.1"
                     /db_xref="GeneID:16994079"
                     /translation="MAVEHTTSTNLSNWDNFLNLESCSQDEQNGEWEVRSGIIPTSGR
                     FETDSSTDFGGCTVAAESLPQSPRAASFCLEDTAWSSRDMGIGDYLLLSRALSDLAVE
                     NQRLRERVRELEALVCAQSTRTVEARSSPDNPNEAASQASCETNGKPPTNGQRMIVGF
                     ACVTKSVLRELASFLTISNGQLGWTGASQVGTPPPSEKEDAKGYLFSSPCTESESIAK
                     GSTSEPGSRWRSKRSPSADDRHAPDVPGAKRARHEAKSRVSYCAAARFAASGAIYSIF
                     FFFSLALLPPLFDMLGFAFEPWLAASRTLALPAT"
     gene            complement(<372019..>374262)
                     /locus_tag="CYME_CMJ132C"
                     /db_xref="GeneID:16994094"
     mRNA            complement(<372019..>374262)
                     /locus_tag="CYME_CMJ132C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534811.1"
                     /db_xref="GeneID:16994094"
     CDS             complement(372019..374262)
                     /locus_tag="CYME_CMJ132C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534868.1"
                     /db_xref="GeneID:16994094"
                     /translation="MLPAIRAPWSRVHRSKNVDGKVAVQAKLSPQRDLSQEATTQPID
                     EHEDDHLNQSRGLDAASLEAQRPDSLQLDRLKSAISSVEQAGPSRQSSEHLSQAMMES
                     LEDAARHARRQLSRSDRERVDKYLQRLRLLQELSRDFARYDASCRVPMREALQRLTAI
                     AFCGGGVLGTAYVGALSVLEQHGLDYTRIKRFAGTSAGAIMASTLAVGYRAAGCMRQL
                     QALNFDDLMSPDLSALTRGRGLSSGRALERWMGQVLAEQTGDPNITMGQVLERYGKEL
                     VIVTTELDTGRERKLTPHSDPDLPVKAAVRMSAGIPIVFDVYAYQGHQYCDGGLVNNW
                     PVDALPQDGTGLGMVTFSFNDFIHYELYHLLWDPIPPETRGFDYERIGQAFAQALYSH
                     SEKTTSIFGVATRSMRIIYDRLTREQIYRYAERWPGGLSMPRAVFLCVGEYGALDTDI
                     STTGQLELFEMGRLSMYVEIQRFMHELEYASTHSGSSLREAFSANPDLYGERVHAAQA
                     LYRDRRLSSQLSESADAENGDASSQQNPQHLLERTEQRGRSSRSVQAATDAGTESVQG
                     SSAVAAAAAATAASLEAPVEERARPDDAHVRFADDAIGTESTASMEVPESSSDHDSMA
                     HGRRPWQAPEELFWRHIFLLSLREGRKLGPNVHARLFPSRLRRKYRMRGLRAEAVLIQ
                     QDISRQVRSIWQSIRLCGIGCLALTIQCVTCWQVARCVRDDDGVDDLADLADAATPAE
                     HVPTAEA"
     gene            <376695..>378209
                     /locus_tag="CYME_CMJ133C"
                     /db_xref="GeneID:16994131"
     mRNA            <376695..>378209
                     /locus_tag="CYME_CMJ133C"
                     /product="similar to epsin"
                     /transcript_id="XM_005534812.1"
                     /db_xref="GeneID:16994131"
     CDS             376695..378209
                     /locus_tag="CYME_CMJ133C"
                     /codon_start=1
                     /product="similar to epsin"
                     /protein_id="XP_005534869.1"
                     /db_xref="GeneID:16994131"
                     /translation="MLDKVNWSDVKRKGVRQRGKLVSWLKDAVMTDVENSVRAATSVE
                     PYGPTQRELAEIASATHNAEEYPLVMSIIWSRLNDKGRYWRRVYKALDLLRYLLLHGS
                     PRVLEEARAALPHLEVLQEFRYFDQTERRDCGLSVRQKAKVVVEIIRDPRRYEEELQR
                     SLTMMQKLGASVGSTPLHSGSTGAAPGDLPFYASRSGGSLARGPDMYTGAARSALRSG
                     DAYAPAPSAGFRGFGSEEVDFDRAATIASTSASTTAAFCATNSAPVRADTGPSATRVD
                     DLLGFDDGDASEAATSKASKAELESKDDALGGMNATNDWSDFVAASSGTGASGLASKP
                     STAAMPSASGTVPSAAYASDGDDFFQMIQSSVVVSRSKASDALHSTEAPSVSVLHTEN
                     RVEAQGMYPPSLSTNAHSSKKLSESPGNNLLSDLLSGATPATPATANSASSRTPNAMQ
                     RAGVAASTGPRVQPTARGALRPNSSGLEAGPSDDPFSNLLAEMALKDADTVKNK"
     gene            complement(<380383..>381252)
                     /locus_tag="CYME_CMJ134C"
                     /db_xref="GeneID:16994184"
     mRNA            complement(<380383..>381252)
                     /locus_tag="CYME_CMJ134C"
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /transcript_id="XM_005534813.1"
                     /db_xref="GeneID:16994184"
     CDS             complement(380383..381252)
                     /locus_tag="CYME_CMJ134C"
                     /codon_start=1
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /protein_id="XP_005534870.1"
                     /db_xref="GeneID:16994184"
                     /translation="MGFWCTPCSILYGAHLSQLVAFVAPVGRLAPERAPQRHGAFASL
                     RRCGLCVHAKRPTLLRGCIEDVPSQIRRKKPLESEKRYRLDLGPDAHEAKPVPVQSMS
                     FWNLPNALTLARLILLPPIVVFFYISQRWAALVCTTLFGMVSLTDWLDGYIARRLNVS
                     SVWGAFLDPVADKLSVATMLILLVERYARFWVTLPAVVILVREIAITALREWMASRGL
                     RDVVAVNQHGKLKTVFQMGSIMLLLLAQPSIGLPPPVLYLGVSFLHAAAVLSLVSGYR
                     YFRAALEAHATYY"
     gene            <382026..>383648
                     /locus_tag="CYME_CMJ135C"
                     /db_xref="GeneID:16994182"
     mRNA            <382026..>383648
                     /locus_tag="CYME_CMJ135C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534814.1"
                     /db_xref="GeneID:16994182"
     CDS             382026..383648
                     /locus_tag="CYME_CMJ135C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534871.1"
                     /db_xref="GeneID:16994182"
                     /translation="MEPLYALQKLGEFGSAMTGSRMDEDKQLLFVGTTAYPLDQLTPA
                     RRTAGARKGEPYTLRDIYVALLYTDASLREYVAYCQQNGVSRLMEAERKELVKFMLGE
                     ISVEESSLLGASVDSAGSTLRHAASALPPTTAPATGEDADQLPRGSAPARESPVPRES
                     SAPPAIDGDKVKHERSDFNGEAPLASAADSTFLAQCREMERIQRTCDAFFELDKRKQI
                     NFLSFPVIEALRKSLIAPAPTDEQPRESAATAQSLQANGSSGVDIARGDRYRTDPLRA
                     YREAGLTEIERLEIDPAVSLASVAASLGDVGTSTAARSKATVAPQQAASAATTLTSAS
                     EVHMPGIPAGQGQNYARKDARAAGSEKPQTGTGGLRAPATPGRGPDRGSAPIIILPSG
                     QQPLVTMLNIRDFVEKGTFRSQEELRKQGIVQKPASPVEIYHRGQCYLFTDQPGQLQP
                     NEWKRVVMVVCQGALWQFKGWPLPGDPAQLFARVQGVYFYYEDEEIPPTVRQWAVKCI
                     PIRRHRRYTDEGVVREFWSLVEFACRRAQYVS"
     gene            <386036..>389578
                     /locus_tag="CYME_CMJ136C"
                     /db_xref="GeneID:16994201"
     mRNA            <386036..>389578
                     /locus_tag="CYME_CMJ136C"
                     /product="similar to poly(A)-binding protein dependent
                     poly(A)-ribonuclease subunit"
                     /transcript_id="XM_005534815.1"
                     /db_xref="GeneID:16994201"
     CDS             386036..389578
                     /locus_tag="CYME_CMJ136C"
                     /codon_start=1
                     /product="similar to poly(A)-binding protein dependent
                     poly(A)-ribonuclease subunit"
                     /protein_id="XP_005534872.1"
                     /db_xref="GeneID:16994201"
                     /translation="MQPLHTPVEAPVFPGLGDPIRRTRWVSVPLTDPDTDALNGGSRP
                     APTPGTHGTRLVLVGTQHGQVRTSVYPSGCLFTSWVGSVAGALSDGVRDVAAIQGAST
                     ESLLVSVSANGTLIRTTLGLPLHTLTSSDWTQSRLCRPMPLQGHALLLVTTDLGRMHL
                     LQAERGTALRSFVDPPHIRRALAADWLYNQAIVLGYDDGSIALKDPSSLRVLHEEPRH
                     PAGNAARFPVVDLVALSEHGLVAAVYGVVPLIRLYDIRKGLGNGGRVGKISPAIVQEL
                     AVPSSDSVIALKWLPGKQRLWTLGVGGHCERFSVDGAASVLCYEAGLCLPVGNGLYSC
                     FDITAEGGTLVTGDLGGCVQYLHLEESEKLEALANAQCPDPALSEPALIEALCSRAAR
                     NARPRRDLTDSTHTEQRCWLADTPWPLVQQQRGNATKRLKFRFPLLASPIAIRSARFV
                     GPVGYLPVTGSASDQLYLQPDEGWQQTSISTASMQPKLDTLEERVRFRRIDLVKAESL
                     EGFDYALYNRTRFCGLENSLPTMYMNPILQMFFFIRPFREAMFGLCHRFACTGEELPT
                     SIAAELGYLYDMMERGGSLACDTVRLMYAFQQSHQAVALGLVDRLSGGPTLMQSGIPL
                     ERLVDKFCRFLLENLSREEMHDAYGAPPDQRVIERLFAFRTRTCIRSVASGLETTRED
                     VQYVLSLSSDNAEPVEAAHFPSLVNAALRQTQPPIRALHPASQKVELVEQRREVLSLA
                     PYLLCSSAGITVRSLQPELELELPLDAACYRYRLIGEVVGVRPANVPASTNQQKAPAA
                     TSTVAFLRIQGLEPHQASLSAQEGSWYCFNDFTITAVRDAAQVERFDSCFMQPLLLLY
                     RRETGVAAVALDDKPPVSFEARLWPDSETEWARVFALRPMSTTHKRLLQAGDRNALRA
                     RLSFVPLQPGERLTRGTLVAIDTEFVLVSREKAEICCSRRSTGHTPRWCRWSSPSLGQ
                     APEEEEPLLRRVILEPSRKHVARVTVIRENGQVLLDDYVMPPPGCTIVDYLTRYSGIT
                     APDLQPNRTRHYLTLSKYVYAKLHALQRTGCVFVGHGLRSDFRQLNFLLRSEQYRDTA
                     LLFRLPANERTRGRSRLLSLRFLAGCLLKRRVQNGSQGHDSVEDARAALDLYRLYLEL
                     EQRQLLKTTVERLYEYGSRKHWQPDFADPFELAL"
     gene            complement(<390563..>391081)
                     /locus_tag="CYME_CMJ137C"
                     /db_xref="GeneID:16994210"
     mRNA            complement(<390563..>391081)
                     /locus_tag="CYME_CMJ137C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534816.1"
                     /db_xref="GeneID:16994210"
     CDS             complement(390563..391081)
                     /locus_tag="CYME_CMJ137C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534873.1"
                     /db_xref="GeneID:16994210"
                     /translation="MTTNLSDCLLPTTRSFLDEDDLSCGTDREVEDLIEKYSGGRSEA
                     TGEPDEESVPTPETQALLAKEVALLQLRKHWDPKRFYKSMGHEEKLDPRRFQLGTVIE
                     APHEYYTGERLPRRARKSRIIEEVLADPRARGYVKRRFRAVQQRAQRIAEASKLRRRR
                     SSKTVQRRRRRS"
     gene            <392891..>395047
                     /locus_tag="CYME_CMJ138C"
                     /db_xref="GeneID:16993908"
     mRNA            <392891..>395047
                     /locus_tag="CYME_CMJ138C"
                     /product="similar to metal ion transporter"
                     /transcript_id="XM_005534817.1"
                     /db_xref="GeneID:16993908"
     CDS             392891..395047
                     /locus_tag="CYME_CMJ138C"
                     /codon_start=1
                     /product="similar to metal ion transporter"
                     /protein_id="XP_005534874.1"
                     /db_xref="GeneID:16993908"
                     /translation="MDTTSTGTCGALPDVEGAGAPSRRQQQQQQQRRRRRLAVLFRRL
                     WRYAGPGWLVCVAYLDPGNLFSDILSGSQYAYSQLWVVWWSQWFALFVGWLCARLVLR
                     SSPLEDFASAERKRYRKPPAARYFLWLFAELVVIIADIPEVIGFAFGIHILTGLPVWA
                     GVLLSFLATSLVLLLELGDFRLVEMVVALCVFALGLVLLVSLAKSGLDGKAFMVGWLL
                     PRFQGGQSVYDALSIIGSVVMPHNLYLQTGSLIAHHTAAFVALDIIDKVHVNETGGEL
                     DAQLVDPSFTKDTDDNGDGDADSSEQDVEAAAATSATLWESDMADKSRGAGSVQDIAE
                     DSVSVVVHAAHNAHAHWSVDDAQTQYAEPGPDAGITCSRSDLEDTNASSGINACTGER
                     ASERGLNEPLCDASNTELDEIHSAVVPQTQQQQVEEARCIGPLGADGSSDITVERTPV
                     HVLGKGDFETSVRRLSGKTLEQENTTERQGLDVSSQYQDGLCAPAPLPAVGAVVLELV
                     LPTCFAFFVNASAIAIAAEHVFSQGSSTSDSLGLYNFCNFLPFDGACILWGIILILSG
                     TASTVTATLTGSYVMSGFLHLRIPMLVRAALARGLALTPALIIAATSGPATVNAIIGV
                     VNATLSIALPIVLVPLLRCSHERRKLHWFPHAAGWLFTAFIFGLNLYGLCAPQGGMFG
                     LYTGSSDNFTWSVQSNILQDLVVLSYTAIVVWLAVS"
     gene            complement(<396068..>397330)
                     /locus_tag="CYME_CMJ139C"
                     /db_xref="GeneID:16993916"
     mRNA            complement(<396068..>397330)
                     /locus_tag="CYME_CMJ139C"
                     /product="tyrosine--tRNA ligase"
                     /transcript_id="XM_005534818.1"
                     /db_xref="GeneID:16993916"
     CDS             complement(396068..397330)
                     /locus_tag="CYME_CMJ139C"
                     /codon_start=1
                     /product="tyrosine--tRNA ligase"
                     /protein_id="XP_005534875.1"
                     /db_xref="GeneID:16993916"
                     /translation="MGEGAPESLVQEQEHHAKIEQQTKGENEALPVTEGALAVPAQDQ
                     DTSGCIDLVTISKLRELPRPSWWTGSLTLEERHALCRSVAEECLQEEELWRLLAQKQS
                     APVCYDGFEPSGRMHIAQGVQKALNVNKLTAAGCVFKFWIADYFAQLNNKLGGDLEKI
                     RTVGRYFIEVWRACGMDMERVEFLWASEEIAKRSTEYWTLVMDIARRNSLARIIRCCQ
                     IMGRNESDELSAAQILYPCMQCADIFFLRADICQLGMDQRKVNVLAREYCDMRKLPHK
                     PVILSHRMMPGLKQGQEKMSKSDPDSAIFMEDTEIEVNTKIKKAFCPPGVVEGNPCIE
                     YLQYMVMPKLGGFSVDRRPEHGGSVHYAAFDDLARDYASGALHPSDLKPALARALNLI
                     LQPVRDHFERNPEARQLLEKVRRYRSKA"
     gene            397612..399151
                     /locus_tag="CYME_CMJ140T"
                     /db_xref="GeneID:16994092"
     misc_RNA        397612..399151
                     /locus_tag="CYME_CMJ140T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461353.1"
                     /db_xref="GeneID:16994092"
     gene            complement(<402220..>403092)
                     /locus_tag="CYME_CMJ141C"
                     /db_xref="GeneID:16993927"
     mRNA            complement(<402220..>403092)
                     /locus_tag="CYME_CMJ141C"
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /transcript_id="XM_005534819.1"
                     /db_xref="GeneID:16993927"
     CDS             complement(402220..403092)
                     /locus_tag="CYME_CMJ141C"
                     /codon_start=1
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="XP_005534876.1"
                     /db_xref="GeneID:16993927"
                     /translation="MFVSSLASSSPGAAQTRRTLVRRVAGIDSGAGRGVRSRGARAGE
                     GFLHKLVYLRGQGVYRAGNTCSGRRRCQRNACQLVQMSRTMPRVPYRGPGMQEYVFID
                     LMQRLNKDRIIFLGEEIDEEVANQTVALLLQMKEEDSVSPVRLYCQIPGGIYTAGMMI
                     YDCVKNLPFDVITLNMGMAAGMGAFLVAGGTKGKRFALPNARFLFQQPSLLDDVEGSA
                     EDIKTEVLNVLRQRDQWLHHLSEFTGHPVEKIKEDFRRDRYFTAAEAREYGLIDRVLE
                     PTMKGITKDMEAQL"
     gene            <403329..>404021
                     /locus_tag="CYME_CMJ333C"
                     /db_xref="GeneID:16993939"
     mRNA            <403329..>404021
                     /locus_tag="CYME_CMJ333C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534820.1"
                     /db_xref="GeneID:16993939"
     CDS             403329..404021
                     /locus_tag="CYME_CMJ333C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534877.1"
                     /db_xref="GeneID:16993939"
                     /translation="MHDHRPGHTDSLERDDKLSAEDLLTFAVKAVFERWTALRLAIAG
                     CWAGSDTTERVDDLIDDVIELCLGQRQRADGNILPYSQRILSSWLEDFFVEDCSADVE
                     DGSIGQVAVVIDGLRTEILRAAPCPVAMWREVCPELAKLADRVRSERAQGRSLLASTE
                     ESSTSEGSLSAEQRAEDSVADNAMEILPRPTADNPSDANEENDTTELPLVDEDGFQLV
                     VSRRHRRAFKST"
     gene            complement(<404935..>406626)
                     /locus_tag="CYME_CMJ142C"
                     /db_xref="GeneID:16994057"
     mRNA            complement(<404935..>406626)
                     /locus_tag="CYME_CMJ142C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534821.1"
                     /db_xref="GeneID:16994057"
     CDS             complement(404935..406626)
                     /locus_tag="CYME_CMJ142C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534878.1"
                     /db_xref="GeneID:16994057"
                     /translation="MPRSRQRRRSCRTYILLHESLSERNGETSEVTSSDVHRRVLVLQ
                     APRLDPHTEEAVLPSERMQQLETHTIYARPVSEAEEAFFAEAERAYQQEKSLFIPEDT
                     FPDDGYDYEQHFRERGDGVFIPAPIIATDLNTRACDACGSAGARDPADPELASDLNRV
                     LDLLASDEEASEAGSESEETACSAADVASADELTDDFVLQANALVGTCSLSKNAVDVR
                     FRDVDATQKQRPVQRRPRDFLDEQFDSFLQTVYADHGDPGEPDACTASPTARHPHSPD
                     VFDRMLADFEEDLRRLRVDPTKDFQRVQLRSRDAAHCEPSNGMTEGIQSGSAKGCREL
                     HGPAEIAAGLDARQVVPRIAHPDQVAPRCTAIAPRAPPHERLSDDNNACYSTESDASD
                     WSDHWSSSDDVCSADRITAESGSVARAAAGRYVPQLIRCVRGSSAGRQTARELDLPES
                     EKAVPHLGSNAAHGAIIEQRQPADAFPPLPSGVRISAESPNQEQMVAGNSRVLRHGGA
                     NDSREEKRLLKAQRRERRAVKKALKEAYSRERHRQNIHRHLLGAAKVSVEYRTAL"
     gene            <407432..>408265
                     /locus_tag="CYME_CMJ143C"
                     /db_xref="GeneID:16993958"
     mRNA            <407432..>408265
                     /locus_tag="CYME_CMJ143C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534822.1"
                     /db_xref="GeneID:16993958"
     CDS             407432..408265
                     /locus_tag="CYME_CMJ143C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534879.1"
                     /db_xref="GeneID:16993958"
                     /translation="MVYWDTRNCNENIQVQAGSVENTSWASGYRVRLRCGFLPMIPTL
                     GPSRERHSVLHTREQHSKLVRRPDARKVRLVCSRETRTVSVRLPRPPLNTTELTLVAR
                     GSKRKTPEKDRKLEQKPEQSTSPMLNLNGFKLPGTPISSFWFLGGVVVLSLGILRRLL
                     GSKEVAHIPAGSVRYRASNDAELHVYRCGKCGYTLYPARGRELKFFPRTFKCPQCSAP
                     KSEFWDLNDPNDPRNQETESDETDQASLEQTQSEDAPDTPQDTGGSTPPIDSSPGENK
                     P"
     gene            complement(<409493..>410140)
                     /locus_tag="CYME_CMJ144C"
                     /db_xref="GeneID:16993922"
     mRNA            complement(<409493..>410140)
                     /locus_tag="CYME_CMJ144C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534823.1"
                     /db_xref="GeneID:16993922"
     CDS             complement(409493..410140)
                     /locus_tag="CYME_CMJ144C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534880.1"
                     /db_xref="GeneID:16993922"
                     /translation="MRALESTPLTGDVDWKSPLGSRSTWARLREQTRHCTFYRTYCFK
                     ASLKQLEEVTEEHVTYVGDCAALPPSPFLCVLLAYDCCSPSREEVAAHLDCSKNVYWR
                     AIVATWIRWKESRAEQVYQLLDPLYRDYRPIKVRQKDNSYHNSYLDVFIDQLLRYRCA
                     LVSLEEPFVLDVIPFPHLPPRYELEARGVLPQREYAAPADDDDDDDAVSRPRLQQ"
     gene            <410481..>411434
                     /locus_tag="CYME_CMJ145C"
                     /db_xref="GeneID:16993935"
     mRNA            <410481..>411434
                     /locus_tag="CYME_CMJ145C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534824.1"
                     /db_xref="GeneID:16993935"
     CDS             410481..411434
                     /locus_tag="CYME_CMJ145C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534881.1"
                     /db_xref="GeneID:16993935"
                     /translation="MSQQRALGLQPQAIAAALPENVWDPLRHEDADPFWREIEPFFSP
                     ITVESLSYMRESDTMNDGPDTDLLVPTADAENVVPNGEPGESAPETRQPERRRRRPEA
                     TSSGGSAVDHSEKWTVERLLRARLNSYPFFQRVAAAFVELPSTGDAPASAMRNKGSGP
                     EDLFWSGPADSQLLDEYHRILEIRVTNELQSIGLIDDTDADELQSEMRLLQWQLRNAK
                     ARNRSIRSWSYSDWNRVLKAQGKARELEQGNQNLQILYLERAIRKCRRNRRMRQRFER
                     VLKLLFPSHRIGNLNLQRRTEPAAGAHTEQKTLPAGAENSP"
     gene            complement(<413710..>414447)
                     /locus_tag="CYME_CMJ146C"
                     /db_xref="GeneID:16993936"
     mRNA            complement(<413710..>414447)
                     /locus_tag="CYME_CMJ146C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534825.1"
                     /db_xref="GeneID:16993936"
     CDS             complement(413710..414447)
                     /locus_tag="CYME_CMJ146C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534882.1"
                     /db_xref="GeneID:16993936"
                     /translation="MFVPAGVFPKCGTAASETPRSTLRIRRQGRKFARCQRTARALFV
                     YANDFGYNVYLDPEDRAKRELSENDIYAVVQKPLGLTLAERDDGMVYIAAVQPGGNAA
                     KTGVLRPGQIVTAVSATFGDEIWSVRGVGLDRVLKSIKVRSGDFVTLVVEDEQTVEQK
                     KTDAYEIAQRRAVEAREKYGEREVLDPVTWTSRSVPKNSSSDLNDPELERTLTDAVDE
                     PFRQTWLLWALGGAVAIVAVLAFTFFT"
     misc_feature    complement(417464..420526)
                     /note="repetitive element"
     gene            <420843..>421196
                     /locus_tag="CYME_CMJ148C"
                     /db_xref="GeneID:16993943"
     mRNA            <420843..>421196
                     /locus_tag="CYME_CMJ148C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534826.1"
                     /db_xref="GeneID:16993943"
     CDS             420843..421196
                     /locus_tag="CYME_CMJ148C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534883.1"
                     /db_xref="GeneID:16993943"
                     /translation="MVWDYKLLDSVSVSPLDCIYQFFCLPCAWGELYAVDQGERCLQP
                     QCLIGTLIAFVPVLNCFCFANRRAEQMERMGMYVDYLEVCAVICGFPSACCFVHQERL
                     QYNGTGAEPKLILME"
     gene            complement(<421290..>422957)
                     /locus_tag="CYME_CMJ149C"
                     /db_xref="GeneID:16993949"
     mRNA            complement(<421290..>422957)
                     /locus_tag="CYME_CMJ149C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534827.1"
                     /db_xref="GeneID:16993949"
     CDS             complement(421290..422957)
                     /locus_tag="CYME_CMJ149C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534884.1"
                     /db_xref="GeneID:16993949"
                     /translation="MRELQKTGFGGRLAFAGGAWCCSTQHTADLAGYRFRAGAQLRIL
                     RSESLQLRHVLLSPPALPRKQARLRTEHVRHVLAGGRISGTQSSRWLPEVRRKPFSFE
                     KGNTTILRSCENSELLGNKGRELQITGSNPPTESSSTAIDPEEGDDFEANAEEAELLA
                     AAAAAPPEVAAATLRRKVRARARTARLQRDIEGTDHARRYRITTYCTAKEYDMVRALR
                     RMRVWSNNQAGLVDDSLVIHARPRRAAMVSEDDAAEEPGDVFIFRYGVVVMWHLDPEE
                     ERHLLTIIRSFCERDGLDEPESDDFAYEISGDQPRFVSDILMMPDASVLAKLAASHGM
                     AQSIKLSSFEESVQRSVEATRDLAAELAATGAIVSRSRRDIAMTLGSLVMDRHILYLF
                     ADVLDPPDIIWNHPEYDSLYRLVERYLELPQRVEMLNKRVDVVRELLNLLSSELQFRH
                     SSRLEVIIIVLIMLELIIALGKEVVPLIAGTARHNRFWILVFLAIFVAGLLVTLAALM
                     AENLFTFPHKKRDHDRFLAKPFRPLAEIENYRALRFQSTTPPPRPGR"
     gene            423163..424412
                     /locus_tag="CYME_CMJ150T"
                     /db_xref="GeneID:16993959"
     misc_RNA        423163..424412
                     /locus_tag="CYME_CMJ150T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461354.1"
                     /db_xref="GeneID:16993959"
     gene            complement(<426182..>427048)
                     /locus_tag="CYME_CMJ151C"
                     /db_xref="GeneID:16993930"
     mRNA            complement(<426182..>427048)
                     /locus_tag="CYME_CMJ151C"
                     /product="similar to thylakoid lumenal 17.4 kD protein,
                     chloroplast precursor"
                     /transcript_id="XM_005534828.1"
                     /db_xref="GeneID:16993930"
     CDS             complement(426182..427048)
                     /locus_tag="CYME_CMJ151C"
                     /codon_start=1
                     /product="similar to thylakoid lumenal 17.4 kD protein,
                     chloroplast precursor"
                     /protein_id="XP_005534885.1"
                     /db_xref="GeneID:16993930"
                     /translation="MTKFAPALDDLGVVAPAPRQRYVTVAFIGTGVQLGTRSAISNTG
                     RFLWERAFAGSDAKRLRVRHQCREGRLRLGSPVAPRASWGTPGQRLSNLTQSLAVGLY
                     MVPLLFCFVDPMGLFAAPSPAFKLPPVDMTDPNRCNLTSSTIGQANAARDKFLDGRFC
                     DLRGRDFSGYDLSGVLLEGATADEARFRSTQLSKAYAPGFKCRRCDFEDAVVDRVNFE
                     NADLSGSVFRNAVLSDSMFSDGTNVRDVDFTDVYIGEYGLRRLCRNPTLDGENPLTGA
                     PTRASLGCRAER"
     gene            <427543..>428934
                     /locus_tag="CYME_CMJ152C"
                     /db_xref="GeneID:16993931"
     mRNA            <427543..>428934
                     /locus_tag="CYME_CMJ152C"
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /transcript_id="XM_005534829.1"
                     /db_xref="GeneID:16993931"
     CDS             427543..428934
                     /locus_tag="CYME_CMJ152C"
                     /codon_start=1
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="XP_005534886.1"
                     /db_xref="GeneID:16993931"
                     /translation="MFCFPSLSRPHIGTNFADFDASKVTLAHRRRSHGASSRTVYAVA
                     ERPLDKKQRRREIMQSEKFNRRGFASTKEEAQGLMVGEFSSELLKALRESAYTLERDG
                     LTVLLAKAYGFCWGVERAVALAFEARRQFADKRIWITNEIIHNPKVNTRLKEMGIFFV
                     PEHVDERGMRHKDLSGIEPSDVVILPAFGATLDEMTYLDRLGCQIVDTTCPWVSKVWN
                     ALDKHQRARCTSIIHGKWNHEETIATASFAETYLIVKDLEEAEYVCNYILHGGDKEAF
                     LNRFQNAMSAGFDPERDLNAVGIANQTTMMKNETAAIGKLFEKTMMRKFGPTELSKHF
                     VAFNTICDATQERQDAMLELVEQDLDLILVVGGFNSSNTSHLVEIAHQRGIPVYHVDT
                     AERIGPGNRIEYRDVHGQIQRAEYWLPKTGKHGGHVRLGVTSGASTPDRYVEECLDRI
                     FLIHALAKSEVAV"
     gene            <429887..>430948
                     /locus_tag="CYME_CMJ153C"
                     /db_xref="GeneID:16993937"
     mRNA            <429887..>430948
                     /locus_tag="CYME_CMJ153C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534830.1"
                     /db_xref="GeneID:16993937"
     CDS             429887..430948
                     /locus_tag="CYME_CMJ153C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534887.1"
                     /db_xref="GeneID:16993937"
                     /translation="MTGKPPRKRNPQSEVRALSIAATATAAAGAADAGKNAASSVSAA
                     DLPPSCRLYEAITGIGGGALTPVGTRGEGAGGAPSSSSSLSPLFLQPYLFARPSPCLE
                     HEFERIGAEAPRWLAAPPVVDDELEWDILGDLFRPLYIDTEETQQWETVLNQAGTTRC
                     LPGAPQATCASTICQHYLKALSQEMSRATTEYATLDGGDDAQTRLSPTDTLHLRRNAF
                     ATLVYASPIVFEPMDYVVLLEWVMQGVSETGATPNASIPESVELGLVTLEIAVPCILY
                     RWLRRQPCVSTAARVSCRERLLPDGLVELARVACRCAQIRERFLFPDWVAWLREHLRL
                     APRAGLAGRWLEFELMRMY"
     gene            complement(<431197..>432561)
                     /locus_tag="CYME_CMJ154C"
                     /db_xref="GeneID:16993944"
     mRNA            complement(<431197..>432561)
                     /locus_tag="CYME_CMJ154C"
                     /product="geranylgeranyl hydrogenase"
                     /transcript_id="XM_005534831.1"
                     /db_xref="GeneID:16993944"
     CDS             complement(431197..432561)
                     /locus_tag="CYME_CMJ154C"
                     /codon_start=1
                     /product="geranylgeranyl hydrogenase"
                     /protein_id="XP_005534888.1"
                     /db_xref="GeneID:16993944"
                     /translation="MATSKPSVTFVSAPAQFWGASSARPLAPRRVHRPCIRRVPFLQA
                     KFRVAVVGGGPAGACAAEALARCPEIETFLIERKMDNCKPCGGAIPLCMVDEFGLPPD
                     IIDRKVRRMLMVSPSGREIPVGRTLKPHEYIGMTRREILDSYLRERAYELGAIRVHGL
                     VQEVELPDPRDPRGKYRIKYADYDKIDGGRATTSSLEVDMVVGADGANSRVAKAIDAG
                     DYSYAIAFQERIKIPDDKMAFYEDLAEMYVGDDVSPDFYAWVFPKYDHVGVGTGTVID
                     KPNIKRYKEGIRQRAAPKIAGGKVIKVEAHPIPEHPRPRRVVGRVALVGDAAGYVTKC
                     SGEGIYFAAKSGRMCGEAIVRASLNGSRIPTEQDLRNGYLRPYDRQYGPTYTVLDILQ
                     KVFYTNNAAREAFCELCGDDYVQQVTFDSYLYKKVTRTSPVEDVKLLFRTIGSLMRGH
                     ALAP"
     misc_feature    434482..436229
                     /note="possible transcribed region"
     gene            complement(<435308..>436408)
                     /locus_tag="CYME_CMJ156C"
                     /db_xref="GeneID:16993979"
     mRNA            complement(<435308..>436408)
                     /locus_tag="CYME_CMJ156C"
                     /product="similar to microtubule-associated protein, RP/EB
                     family"
                     /transcript_id="XM_005534832.1"
                     /db_xref="GeneID:16993979"
     CDS             complement(435308..436408)
                     /locus_tag="CYME_CMJ156C"
                     /codon_start=1
                     /product="similar to microtubule-associated protein, RP/EB
                     family"
                     /protein_id="XP_005534889.1"
                     /db_xref="GeneID:16993979"
                     /translation="MAEAVGIMSGAFFVSRGELLSWLNDFLKLSYTKVEQVADGAAHC
                     QVFDALFPGKVPLHKVNFSARHEYEYVQNYKVLQAVLDKVGIEKHIEVERLIKARAQD
                     NLEFLQWVKAVFDRFYAGQPYNAVERREAAVRKYNEQKPGVSRETVGAAMKRRPVSGP
                     KTAAGLHAPAARTLRCTGAVNSNIRAQREEAYRAASATTHPRGGTPAQESTTCSSPAQ
                     PRTASPGTKTEPPAVNAADGLAREQESKLIQKITEMQLAIDNLERERTYYFEKLRDIE
                     MLCQTHPEPELPLIKAIQAVLYDEPLQIERDEPAPVSRGTGAHSTSDSLLPPASASDV
                     EDTPASFDSIFSKTVITSCSEQQMGATLASLL"
     gene            <436794..>438137
                     /locus_tag="CYME_CMJ157C"
                     /db_xref="GeneID:16994023"
     mRNA            <436794..>438137
                     /locus_tag="CYME_CMJ157C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534833.1"
                     /db_xref="GeneID:16994023"
     CDS             436794..438137
                     /locus_tag="CYME_CMJ157C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534890.1"
                     /db_xref="GeneID:16994023"
                     /translation="MPRRCRHTTAKDRRAGEKCCCRCGALCEPGSAAETVSVRDAPWQ
                     HVDASAAAVWTSAVYDAVSRRFHDDDDSDNELSSPLLALMQLGSDMDSDFEADGLPSG
                     AWALTPLDLDADSDSDSDSLQEKTRSTHTGESRTVTAERGAPLDKSGRSETSPSESLS
                     EDWHRKEFDTENLQSLAETSWYRKTGNGLHAKLSWLEREAEFNQLLIGHGRRKRRQRR
                     KSAVKEKRFLETKMKLEATMDEAIRTMMRFCEDTGPNAVDYVDMPAICSTGREFLHRL
                     AQACRTRVVSKPNAHVVAVARTRNTRWCGLEEAQRLASECSEKALLKQSGLYRTRRET
                     RTNDASRSNASATSAKRSPEDTEKQQKQFTKGTVHTERGRAQLQQTALAVQPVAAENR
                     GHELMRRLGWQPGQALGAQTGGERALLEPLKATLRPPRRGLGAAHATASSGTPPK"
     misc_feature    complement(438335..441255)
                     /note="repetitive element"
     gene            <441010..>442236
                     /locus_tag="CYME_CMJ159C"
                     /db_xref="GeneID:16994024"
     mRNA            <441010..>442236
                     /locus_tag="CYME_CMJ159C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534834.1"
                     /db_xref="GeneID:16994024"
     CDS             441010..442236
                     /locus_tag="CYME_CMJ159C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534891.1"
                     /db_xref="GeneID:16994024"
                     /translation="MDAEPQLTAGSAETASACTACNSYEAQIREKRLRNQRLLESLGI
                     AQSRAVLLGKAAGKRSESLTIGEDADRPQKRGRRARSIAANAVALQLSVQTRSLRRRC
                     SQTETNAAVDPLTTVSVNASSERDADSNLLHGFLSMRASEKSPPSLGRYAFWEPIYDP
                     RNDDASSIAETENHSAVKDHSGRLFVLSKKRVVSVRPNEAGKTAPKQTPADLRAEKRR
                     AFESRFCADLPREPAPYALRRLLNHHSIAAFCCGTVAVPFTLRSIGVTVRSLGQLVIR
                     PDDPLVERKWFSSRLAMYAHPFPTGYHATKTHWNRLWHMHIESDPNGGGPFFIVKSDD
                     GRETYRRHTPSHAWMDACLHSHAPGTRISGPLFFGFSDPWLQTVIQTQLVADAEKSGM
                     FRDSSTASECILGMKR"
     gene            <444418..>444915
                     /locus_tag="CYME_CMJ160C"
                     /db_xref="GeneID:16994021"
     mRNA            <444418..>444915
                     /locus_tag="CYME_CMJ160C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534835.1"
                     /db_xref="GeneID:16994021"
     CDS             444418..444915
                     /locus_tag="CYME_CMJ160C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534892.1"
                     /db_xref="GeneID:16994021"
                     /translation="MRPLRFMTRVAVGLTGALALGAAASVLQDPLYPTRVLYTHTTSL
                     SGPRSTAALIGRLYATWLLTSGSVRIVAAVRYGSVACRLLAALTYVIALAHFYTEVFW
                     FGTLSLHPAGRLPIIVASCCLGLLFLDAVSTVILQMRGGKHHPEKSGPGRGTARSQRP
                     RRLDD"
     gene            complement(<446013..>446459)
                     /locus_tag="CYME_CMJ161C"
                     /db_xref="GeneID:16994016"
     mRNA            complement(<446013..>446459)
                     /locus_tag="CYME_CMJ161C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534836.1"
                     /db_xref="GeneID:16994016"
     CDS             complement(446013..446459)
                     /locus_tag="CYME_CMJ161C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534893.1"
                     /db_xref="GeneID:16994016"
                     /translation="MRLLTHNLLICPVHKKPLAIRNVSAVDIIPVEYQPRFLLRMIPR
                     LDWSLLRAAAVSVESDCVDALPEAAPSPSELPALEKAVESGDRLPLLDALQRLLLETH
                     VVGGQLHCEHGEFYVIADGIPNLLADAAVNPSETASEQAACTTEGS"
     gene            complement(<449169..>450101)
                     /locus_tag="CYME_CMJ162C"
                     /db_xref="GeneID:16994003"
     mRNA            complement(<449169..>450101)
                     /locus_tag="CYME_CMJ162C"
                     /product="similar to diacylglycerol acyltransferase type
                     2B"
                     /transcript_id="XM_005534837.1"
                     /db_xref="GeneID:16994003"
     CDS             complement(449169..450101)
                     /locus_tag="CYME_CMJ162C"
                     /codon_start=1
                     /product="similar to diacylglycerol acyltransferase type
                     2B"
                     /protein_id="XP_005534894.1"
                     /db_xref="GeneID:16994003"
                     /translation="MPLRTYIFPTRVARLLSVTSFIVTVFLCHWNFIKAALLAYAFIF
                     FDDGPLHGERYWPAFARLPLWKWYVQRVLNVHLHAECGILDSSQKYIFAAHPHGILAW
                     QHYATFTDGCDFLSKVAPGLERRDLVASALLWCPFIRDFALWLGCVDASPSVAERQLR
                     LGRSLLIFTGGEHEQVLAEPYCQRIVLRKRKGFLRLALRHGAHILPVYAFGENELYVT
                     WPRFAQRFRLWLVRRTRVPLLLFRGRWFTLWPDTRVPVHVVIGKPVRVPGPINEPSDE
                     QILALQKRVLDAFVQLFERHKGRFGYGKQDLLIV"
     gene            complement(<452703..>453176)
                     /locus_tag="CYME_CMJ163C"
                     /db_xref="GeneID:16994076"
     mRNA            complement(<452703..>453176)
                     /locus_tag="CYME_CMJ163C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534838.1"
                     /db_xref="GeneID:16994076"
     CDS             complement(452703..453176)
                     /locus_tag="CYME_CMJ163C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534895.1"
                     /db_xref="GeneID:16994076"
                     /translation="MKWRLFWVSMLQELSGKAASRRGLVERRLNLVERTQLCSLRAQT
                     VERYLGACTLTQRRWLRGVSTATDANALETRKRRCLYRANQRGLRELDILLGEWTQRH
                     LATFTEQDVSELEQVLDHESPLLYLYITEQRQPPAELAGLALFQRLVRETRQARS"
     gene            <453504..>454334
                     /locus_tag="CYME_CMJ164C"
                     /db_xref="GeneID:16994071"
     mRNA            <453504..>454334
                     /locus_tag="CYME_CMJ164C"
                     /product="cell differentiation protein rcd1"
                     /transcript_id="XM_005534839.1"
                     /db_xref="GeneID:16994071"
     CDS             453504..454334
                     /locus_tag="CYME_CMJ164C"
                     /codon_start=1
                     /product="cell differentiation protein rcd1"
                     /protein_id="XP_005534896.1"
                     /db_xref="GeneID:16994071"
                     /translation="MDDTEARILQLVHNLKEVDHRDAALLELSKKRESVSNLALILWH
                     TPGTVAVLLQEIIAIYPLLSPPALTGHASNRVCNALALLQCVASHPETRGPFLAAHLP
                     LYLYPFLNTVSKTRPFEYLRLTSLGVIGALAKVDDPEVTSFLLSTEIIPLCLRIMETG
                     SELSKTVATFIVQKILLDDSGLNYVCQTAERFYAVSTVLANMVNSLIEQPSGRLLKHI
                     IRCYLRLSDNPRAREALRQCLPQSLRDTTFAQLLNEDQSTRRWLASLIYALGGDAALV
                     "
     gene            complement(<454915..>455637)
                     /locus_tag="CYME_CMJ165C"
                     /db_xref="GeneID:16994074"
     mRNA            complement(<454915..>455637)
                     /locus_tag="CYME_CMJ165C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534840.1"
                     /db_xref="GeneID:16994074"
     CDS             complement(454915..455637)
                     /locus_tag="CYME_CMJ165C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534897.1"
                     /db_xref="GeneID:16994074"
                     /translation="MAKQVVSEDEQERVFRILLAEQENGRCAECFCPGPRWASVNLGV
                     FLCIQCSGFHRKLGVHVSQVRSINLDRWTSEQLENMKRIGNRRAAAIWEAQLPTDFER
                     PSPGDIGRMQEFIWNKYVEKLYYREPSQYFENEGHSVSRDASAATASTVSPAVTLQNS
                     RQSSMGACERSKHVPVENNWFNALFAPSSERGNSHEHAHGPVAGAENHEHLQRKRHIL
                     AMYAQRNNSEASSDRLDTSPKT"
     misc_feature    455779..457681
                     /note="possible transcribed region"
     gene            <457817..>458494
                     /locus_tag="CYME_CMJ167C"
                     /db_xref="GeneID:16994042"
     mRNA            <457817..>458494
                     /locus_tag="CYME_CMJ167C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534841.1"
                     /db_xref="GeneID:16994042"
     CDS             457817..458494
                     /locus_tag="CYME_CMJ167C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534898.1"
                     /db_xref="GeneID:16994042"
                     /translation="MPYVYDCDELQGYILFLGRDKYENDALLEYSLPLDWWFHVDKHS
                     SAHVYVRPKRRLFELSETSGGTAYELSAAPLEPPTEVVRAAAAVAKENSIEGAKQSFV
                     HVVYTPASNLLKSGDMGPGQVGFRDPKLVQRIRVARSDAVRLKQIKSSRKECTIDELR
                     KSHEDFQHEQQRWSKAASRRRQAEERAHQEQAARERDARNYAHLHKQEAMTSNKELAE
                     NYEDEFL"
     gene            <462136..>463707
                     /locus_tag="CYME_CMJ168C"
                     /db_xref="GeneID:16994043"
     mRNA            <462136..>463707
                     /locus_tag="CYME_CMJ168C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534842.1"
                     /db_xref="GeneID:16994043"
     CDS             462136..463707
                     /locus_tag="CYME_CMJ168C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534899.1"
                     /db_xref="GeneID:16994043"
                     /translation="MSGKLAVKTAEALRNITRVRSLREPLWSPRTTAALQGVNASLNW
                     SLARHDAAPVGVEYVYRNLRAKNLVSHCIERYGSAYTSALVAHGNAERPAGTLQLLPP
                     AASRRTHQALVADYLCRGGDAFTSSSWKSKLYVLDGAFGSDLETCLASRVVCDDPVVA
                     LALTHWMERLPAGALDLNVFSPDIVVYIGAGYHGRFEENSGKNGISSSPPRDKASATR
                     APDGNASPGLAHVTTDGQRVYIGASVQLNHMRSAIGAAASLAMLSTRRGIDPERYGLI
                     LNGQLHSNGRAVLGVDGQHVMWTHRGLARGWRDVLRLEDWRSSVPPPKVTQRQWQQRV
                     AFPSGDASGDTAMKSSSASAIAPLRVPSTPNLVLESPLFLIALDHGGVRRSSSDTSKR
                     KRKTVQNAEQQQQAQSEPDENRVQVVPLKNPQTAALYALAVATFPVPENLLEISVRDF
                     VAAYERANARALLVCGTGATSHVLQLAADSATPSITGEAVPGVLQEYARQCILDRYRQ
                     VGQQLLAQDGPLAAA"
     gene            <467418..>468344
                     /locus_tag="CYME_CMJ169C"
                     /db_xref="GeneID:16994056"
     mRNA            <467418..>468344
                     /locus_tag="CYME_CMJ169C"
                     /product="probable heat shock protein hslV,
                     proteasome-related peptidase subunit"
                     /transcript_id="XM_005534843.1"
                     /db_xref="GeneID:16994056"
     CDS             467418..468344
                     /locus_tag="CYME_CMJ169C"
                     /codon_start=1
                     /product="probable heat shock protein hslV,
                     proteasome-related peptidase subunit"
                     /protein_id="XP_005534900.1"
                     /db_xref="GeneID:16994056"
                     /translation="MLATIGRWRTVSGSIRAARALSVALRAPAAVVAREQASSVSVKR
                     TSLPGGSTLLRNTSAQSLLASSALNVSSTREERLARHVGSGRVQRAVTLAAACAPRPR
                     AVLPSAGSNQNFCTALRKLGTACLYQQPQPWHHTTILAVRKSGQVCLVGDGQVSMGET
                     ILKANARKVRRLGDSVIAGFSGATADALTLFERLEQKLEAYPDQLLRASVELAKEWRQ
                     DKALRRLDALLLVADRSITLTLTGTGDVLEPSDGVMAIGSGGMYALAAARALLELEDW
                     TAERIARRAMQIASEICVFTNEQLTCEVLSGA"
     gene            complement(<468399..>468644)
                     /locus_tag="CYME_CMJ170C"
                     /db_xref="GeneID:16994050"
     mRNA            complement(<468399..>468644)
                     /locus_tag="CYME_CMJ170C"
                     /product="60S ribosomal protein L38"
                     /transcript_id="XM_005534844.1"
                     /db_xref="GeneID:16994050"
     CDS             complement(468399..468644)
                     /locus_tag="CYME_CMJ170C"
                     /codon_start=1
                     /product="60S ribosomal protein L38"
                     /protein_id="XP_005534901.1"
                     /db_xref="GeneID:16994050"
                     /translation="MPKEIKDLKTFLSLCKRADATRVTVKRNRANTKFKIRCSRFLYT
                     LVVQDSRKATKLEQSLPPKLQVQKVERGSRAKAAKKR"
     gene            <469092..>470867
                     /locus_tag="CYME_CMJ171C"
                     /db_xref="GeneID:16994001"
     mRNA            <469092..>470867
                     /locus_tag="CYME_CMJ171C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534845.1"
                     /db_xref="GeneID:16994001"
     CDS             469092..470867
                     /locus_tag="CYME_CMJ171C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534902.1"
                     /db_xref="GeneID:16994001"
                     /translation="MPNAVDSENENASEYTLAAEHVNRTSLSEPGHKSQASTSLAALA
                     DDTENGDSVCALCQQLDLAQLRVELERNGTERRKLEAKIDRTFLVSVDRLLEQDALLC
                     RLEGAIESQEQALRRLVQEFHHVAVKRANQLPALRTKLRRLRESVKSSARSRSWQSLA
                     EVRDRLEQAIRHREYDEALSLYANLRTMSANLGKASLEKEYLETQMSSLETMLAVSIL
                     EELSEATSLSKCIEMSGFLRTFDFFDNAELRRLFLHCRGRYIWRFISDAMRALDALPT
                     ETRERTEAIVVLQLSRLTDALRQRVLKLFTEYRTLFSNANADDDASDSVEGDALLVDE
                     AWCAWHREWLTAYLLVVEKTIARVSDVVLIQTLFTQTMAFAAALGRLELDFRPLLVPL
                     YERAVLRVWQRKLHDALLHYSRLLRSLDLDSINPEVHMISSALVGSVDASPETTASGD
                     GAVEPAPAPASAPKEGVALSVAPIVQLQNEIESAILQLGVLVPSRHLGVFANELCQAL
                     KDAGAVIAELLVFPRLNTGAGHVGDTLIRALRSELVPRVMQRFREATEIPAEELAPFE
                     EKLERFYCELDHLPPINENHHQYNS"
     gene            <472995..>475013
                     /locus_tag="CYME_CMJ172C"
                     /db_xref="GeneID:16994039"
     mRNA            <472995..>475013
                     /locus_tag="CYME_CMJ172C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534846.1"
                     /db_xref="GeneID:16994039"
     CDS             472995..475013
                     /locus_tag="CYME_CMJ172C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534903.1"
                     /db_xref="GeneID:16994039"
                     /translation="MGAFRGWALSVSSRRSACVLAEPLAFGVALQGRRFGAHCVPRFG
                     RRGGTVRNRQHTQPRRRCRRNERLPKVCCLLTRNRKRCGDLPVKSAATCRTRALRLEL
                     LLRMFQRALAAAAAMATLVFLRDLGLVLAPVWAAVSTSTLPLVASNNLVLEFPARSAL
                     AASQLPYHELRKKALAWVLLFASSSALAAAETAITALYPWKVRDLAESEGSNSPFGRL
                     NQDITRYLTTILVASTICGVYSTALATEMATRIFGSVGVGYATGVMTVVFLFFGEILP
                     KTLAVHNSEKVARFMLRPLHLLSLLLYPVGKAFSFLVNLTLTASGLEHSSEPLVSENE
                     LRLITAGARRSGGINIHEQDMIESVLDLEETEVREIMKPRVEMTCISCESTLEEFLAL
                     EKTTHYSRYPVFKENVDDIIGILYVKRLLEFLGSEDGHLRNTRIGRLAEPAMFVPESL
                     PVWRVLEEMRRKRIHMAIVVDEYGGTAGLVTLEDIMEEIVGEIYDEDDSDYEEEGQEI
                     VRIDENTWVMDGQARLERVAETIGMEVSEDDLHEYGTIGGFLCDRMDGIPDPGDSAVI
                     DAFQFSVDDADDRRILRVRARRFTAAPTQTDAPDVEDPVQTDIASKSDRAHRMSTEQD
                     GSASSNRSDGLSADAAGLDPGTKTNLQGNSLRKLLPSTSTRTEAQANS"
     gene            <476473..>478179
                     /locus_tag="CYME_CMJ173C"
                     /db_xref="GeneID:16994054"
     mRNA            <476473..>478179
                     /locus_tag="CYME_CMJ173C"
                     /product="glycerol kinase"
                     /transcript_id="XM_005534847.1"
                     /db_xref="GeneID:16994054"
     CDS             476473..478179
                     /locus_tag="CYME_CMJ173C"
                     /codon_start=1
                     /product="glycerol kinase"
                     /protein_id="XP_005534904.1"
                     /db_xref="GeneID:16994054"
                     /translation="MKEKRFALALDQGTTSTRAILFDLEESVVIASHQLGHRQYFPRA
                     GWVEHDPFEILGNARRCLVAVCQQAEQKGIKPADIACLGLTNQRETVVAWDRRTGEPL
                     HPAIVWQDTRTREHCAALAAANDTAASVSGGVGSISASTSTSGSGKSRQLHQSRSVGR
                     SKRHRRELGTEPQQAFDRFRELTGLPISTYFSGTKYRWLIENVPAVQKGVEDGTVLLG
                     TIDSWLAYHLTEERVHVTDVTNASRSLLMELRTQHWSNELLDIFGVPREALPVIRSSA
                     ERYGTLTSTESALDGQVPLAGILGDQHAAMLGQACLRADDVKCTYGTGCFVMLHTGER
                     PIPSRHGLLTVPAYQLGRDQPVQYALEGSVAIAGAGLQWLQEQLGVIRDIQEAEKLAS
                     SVSDTGDVYLVPAFNGLFAPRWRPDARGVLVGMTQFTNRAHIARAMLEQVCFQTTEVL
                     EAALADLGQSTAAIQMLRVDGGMTANQLLLQLQADLLGVPVVRPQIAEATALGAAAAA
                     ALATGLLDRVDQVRKLWREELVLTPGIDDAERARRHRRWNDAVERSLGWVSVDTQPSL
                     LG"
     gene            complement(<479715..>480371)
                     /locus_tag="CYME_CMJ174C"
                     /db_xref="GeneID:16994049"
     mRNA            complement(<479715..>480371)
                     /locus_tag="CYME_CMJ174C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534848.1"
                     /db_xref="GeneID:16994049"
     CDS             complement(479715..480371)
                     /locus_tag="CYME_CMJ174C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534905.1"
                     /db_xref="GeneID:16994049"
                     /translation="MPFLEPPLRVASAHLSLLGLEQPTRLFPGRQALRLPLWTFGKHG
                     LAEHWRGSLIARTDSRPEPGSAPPEALRLVPTTGDGRCLFRAIAKCLAFYGKRPLPEH
                     LERADADALREAAFQEICLLRRQEFQKKHVVEGDMGAYCAQLRSPEFYAGEPEMFALA
                     DVLERPIEVYLVHPQNRTLLKIVEYGSVYRKRQQDLEPVRVAYNGTNHYSALLPRTQR
                     "
     gene            complement(<480371..>482776)
                     /locus_tag="CYME_CMJ175C"
                     /db_xref="GeneID:16994048"
     mRNA            complement(<480371..>482776)
                     /locus_tag="CYME_CMJ175C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534849.1"
                     /db_xref="GeneID:16994048"
     CDS             complement(480371..482776)
                     /locus_tag="CYME_CMJ175C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534906.1"
                     /db_xref="GeneID:16994048"
                     /translation="MRFTVRIAAEKGGSTRRRYSLPHTVRGGAKHEVDDAPPKRRSST
                     GAALSAPETLLAVRTSDPDHGASSKADAAGNRRQMQALDCNATERGSAKDASPVFGDS
                     LSSRQYAGTYSEENALQRDRTTGSVSNNVTDDAGIRPGIRPVDHADDPRTLIPSSWCK
                     TPARLSQRIAVFGQSPGAASARTKRSEERMHHLPPISVQSVRKRIRIPSAEPMSQQTP
                     RCDEEPASNGARSEHREARETSDDAAFRSPFAETFFGNPDGTPWSSARKRKIASRLCW
                     GTGSGTRSPSSLVATQQQSPPPLELDGQHLACSPQGEAHLSRTGTGGAPWALRLHYRC
                     AMSRFAKMLREWESRRLLFLQQSQEDPALSLFSRLERAEMQSASVTPTVTVQKVLWRP
                     RRTGAASERPVPLRIALVAVEDIAESVSMTQHQLAARPSLNTGAAVASARDNSNDCRW
                     AVTDAAQQHPDVATLCELVRDNGAILATRTRRGLDQAIVQEETPATAVAPAPLTSVDT
                     RRASAISSRQYCRSSSSDHRMSAVLFLPERAASGIVEPGRRLQLYGAHWTSWLRGSPA
                     APAAPAASSALAPAIVAALAVPLEQPLASPSRTGQPSPETFANVRTADGPGEQREASQ
                     LRVLAPGASAVAPLERFWYTQLRQCILQQIAHCLPPSTLQCRYLSCLAQVFHEPYLVQ
                     TRIGFWGRLCGPGEQHENTGWFTVADLDGGTTAIVTYTGNRTPFVDFEQPGQCPGLFF
                     FEQLRVSMLCPAAALCRRQQAPAETFALQPALQLAWLPQRSRLVPLPPSLVSNYEGLH
                     LHS"
     gene            480554..482866
                     /locus_tag="CYME_CMJ176T"
                     /db_xref="GeneID:16994061"
     misc_RNA        480554..482866
                     /locus_tag="CYME_CMJ176T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461355.1"
                     /db_xref="GeneID:16994061"
     gene            <485545..>485835
                     /locus_tag="CYME_CMJ177C"
                     /db_xref="GeneID:16994053"
     mRNA            <485545..>485835
                     /locus_tag="CYME_CMJ177C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534850.1"
                     /db_xref="GeneID:16994053"
     CDS             485545..485835
                     /locus_tag="CYME_CMJ177C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534907.1"
                     /db_xref="GeneID:16994053"
                     /translation="MVLITLEFGGGLDAITSAKAKTVACDVPAKTVGELIRWIRRHQV
                     RERHEFFASGDGVLRPGVLVLVNEVDWELEGKMEYVLREGDTIAFISTLHGG"
     gene            complement(<489359..>490906)
                     /locus_tag="CYME_CMJ178C"
                     /db_xref="GeneID:16994070"
     mRNA            complement(<489359..>490906)
                     /locus_tag="CYME_CMJ178C"
                     /product="similar to ribulose-1,5 bisphosphate
                     carboxylase/oxygenase large subunit N-methyltransferase"
                     /transcript_id="XM_005534851.1"
                     /db_xref="GeneID:16994070"
     CDS             complement(489359..490906)
                     /locus_tag="CYME_CMJ178C"
                     /codon_start=1
                     /product="similar to ribulose-1,5 bisphosphate
                     carboxylase/oxygenase large subunit N-methyltransferase"
                     /protein_id="XP_005534908.1"
                     /db_xref="GeneID:16994070"
                     /translation="MQCFIVPLSANQGRGACVLRRSAGSCHLGTRAGLRQRTGRLQRV
                     AQPLCSAAKVPGQYLQVELGSTPHQGRLGLHAAQKLETGQVVASVEVAAALVSERHGT
                     AVTTPDAASDDARWEAAAELALRLVLETVQNESSPWIDYVENVCRKREFYVNHPLLWD
                     ASRSRLFRGTALETRRETLRRELVSWLEERRRSSVLPVDTFSASAFLRAVALVLDRGT
                     WFADVGRWVLAPPLDECRPTGREDATVRFQWVRKRLLGGREEIHLICTKDVLTGAELR
                     YHARVADAIDFFLQYGYFEEHSNPDSARKLRECVGLVTLAFEISRLDRFYDDKVDILQ
                     QQQQQQQRIDATSEDELAGQTFVVAASDLTSEALQAAENPLSAMVQFLRLLCLSGSDA
                     FLLEGLFRDEVWEFLALPVSEGNERMVCELVLASCEERMQALDEAQALCEENFSPELK
                     QAAQLVQEAERTTLRAIMTYFRNELTSLREKEYYHERRLRALDLYRPLDPDEIHDADA
                     TGFDQYM"
     gene            complement(<491770..>492747)
                     /locus_tag="CYME_CMJ179C"
                     /db_xref="GeneID:16994055"
     mRNA            complement(<491770..>492747)
                     /locus_tag="CYME_CMJ179C"
                     /product="similar to Nedd4 binding protein 1"
                     /transcript_id="XM_005534852.1"
                     /db_xref="GeneID:16994055"
     CDS             complement(491770..492747)
                     /locus_tag="CYME_CMJ179C"
                     /codon_start=1
                     /product="similar to Nedd4 binding protein 1"
                     /protein_id="XP_005534909.1"
                     /db_xref="GeneID:16994055"
                     /translation="MLVEDSGHHLPESADIENALDLLLKAQLERAFGPELAEHFWAAR
                     QPRTLDERLAFIRKCWIGVFKDSPLSTFGLERLEQLERLCRSKRRGRELSAAEHHQFA
                     EELARLWEQVQRLLPRAAPETSYASSASAGGVHSGDAHTPATLSDAESAHAAPEAMRI
                     EAPATSARSASGCMARVSSDVAAAATNVSLVVLDGENIAWAHGQNAVFSPKGIAIAVD
                     FFRKRGYRCVVFLPDYRRKRADLPTVSASDALVFVPAGEYDDTFALGYAVGHDAILVT
                     NDLLQDHLDQFYPDEGEAREALRKWLGSHRCSFTFVGDEFLPNPHFFLP"
     gene            <493279..>494538
                     /locus_tag="CYME_CMJ180C"
                     /db_xref="GeneID:16994088"
     mRNA            <493279..>494538
                     /locus_tag="CYME_CMJ180C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534853.1"
                     /db_xref="GeneID:16994088"
     CDS             493279..494538
                     /locus_tag="CYME_CMJ180C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534910.1"
                     /db_xref="GeneID:16994088"
                     /translation="MDLEQEILWVRRLWAERYRHRLQPPRDQLQGVTESRLEQRERSR
                     AVHHVNGERALAAPSLGKRQSREHDGRLENVRKSTSAVSGALRHYREQSAKRYQRERT
                     ERAALAPAARFPLLRLFAGSADARATAPWSAYPETRPIAITQSLNDGLWNQRCRSPRT
                     QQLAQGASRGTTKQLGLGLRTALMMLQFRSKRFHLPAALSTDPFTLRATRYVQSLGNE
                     ATCQALVTSRPAWSMEESAEVLAAHEASQVLENHPSDLCRMLHQEKQARGHVWCARTS
                     SLRDARGYHMLTIPAPRHVSYDFAPAGQYTSQGLFQRRTALVKNAFAELSAEAYLVCK
                     RYQDLPDAAYRCRSAAQFAAWRQRRQEQRDRAETAMRLAQAQTPAIHSNENQYLWDTR
                     LTLFMHGTRISQADRHAQILIDRYASS"
     gene            complement(<495147..>496019)
                     /locus_tag="CYME_CMJ181C"
                     /db_xref="GeneID:16994089"
     mRNA            complement(<495147..>496019)
                     /locus_tag="CYME_CMJ181C"
                     /product="probable diphthine synthase"
                     /transcript_id="XM_005534854.1"
                     /db_xref="GeneID:16994089"
     CDS             complement(495147..496019)
                     /locus_tag="CYME_CMJ181C"
                     /codon_start=1
                     /product="probable diphthine synthase"
                     /protein_id="XP_005534911.1"
                     /db_xref="GeneID:16994089"
                     /translation="MPLYFIGLGLGDERDITLRGLETVRSCDRVFLDGYTSLLRTDLG
                     QLEDLYGKKVTIADREMIEENVSSLLEPARTGNVAFLVVGDVFGATTHHDLVLRARQL
                     GVECRFIFNASILTAVGVCGLQLYRFGETISLVFWTNAWRPTSWYEKLEANRRRGLHT
                     LFLLDIRVHEPSEESLARGVKVFEPPRFMTIADAAQQLLTLWRERAQLLGRETDETGA
                     GAFAYDSDTLCIGLARVGQVDELMAVGTLKEFSGKDFGPPLHSLVMPGDLHAVEAEYL
                     ASLPRASSLQTLLV"
     gene            <497469..>498494
                     /locus_tag="CYME_CMJ182C"
                     /db_xref="GeneID:16994090"
     mRNA            <497469..>498494
                     /locus_tag="CYME_CMJ182C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534855.1"
                     /db_xref="GeneID:16994090"
     CDS             497469..498494
                     /locus_tag="CYME_CMJ182C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534912.1"
                     /db_xref="GeneID:16994090"
                     /translation="MTSSTSSTGPRVASVQATWRRARVFLFCVPPRFDCVYSAGCSQK
                     NTTTLRASAFNPRTLRNQHPNRVLRYKRRPQSCGYVWHSASVTNMAAWCRHCHQHTSQ
                     CRLDRSEEGATDRSRSPVTEWRVMYARWTQGSSWMPQLHIMLPLLLALFMIDLQFIFL
                     ADVSYALELPPGSMSVTREESEESGTKQTQTQRVRSILATLQQTKSCILCDLSSVDLS
                     TAALAGADLHGAALSHANLFQVQLSGANLRGAKFDASILDEAALDGADLSGADLRQAL
                     VRRTLLLGARLDANISIDGADFSGALIDRTNQRLLCELAQGVNSRTGVATATSLACPE
                     PKTNQSP"
     gene            complement(<498701..>498874)
                     /locus_tag="CYME_CMJ183C"
                     /db_xref="GeneID:16994087"
     mRNA            complement(<498701..>498874)
                     /locus_tag="CYME_CMJ183C"
                     /product="mitochondrial ribosomal protein L33, precursor"
                     /transcript_id="XM_005534856.1"
                     /db_xref="GeneID:16994087"
     CDS             complement(498701..498874)
                     /locus_tag="CYME_CMJ183C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L33, precursor"
                     /protein_id="XP_005534913.1"
                     /db_xref="GeneID:16994087"
                     /translation="MAGAKGKSVLIKLVSAAGTGYFYVTRKNPRNVPYKLSVIKYDPR
                     VGRHVVFKEGKMK"
     gene            <499655..>502069
                     /locus_tag="CYME_CMJ184C"
                     /db_xref="GeneID:16994077"
     mRNA            <499655..>502069
                     /locus_tag="CYME_CMJ184C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534857.1"
                     /db_xref="GeneID:16994077"
     CDS             499655..502069
                     /locus_tag="CYME_CMJ184C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534914.1"
                     /db_xref="GeneID:16994077"
                     /translation="MTQAGTLTRNKPKVRRWLPVTVCLLLVLLLLLGATQPAAAVNAC
                     DYCDAVGKACNATLGKCYRCTSSKDCPSRKICNVDIGQCIVGGVFSNFDWQEGVLILL
                     VFLAAGVSNAGGVGGGLLFVPLLVLLASFPIPQASANSQSLILGASIANSVYNFRKRH
                     VIRDAPRIDWNLVISTMPFFLCGTTPGYFLNISLPGYFTGFVLAAMLGALTIQSFLSG
                     TRMTRRQWRMRREFLRQEAAGSAPLDGPAASKPTAPTASDGTSVVQPGMQPTSTAVGE
                     ERLDIDSITSRLPGHQDGSARDGASTASLAGGTQPGNVEAGAVNIQHDVAGSGSSSGQ
                     QHDPQLGEPSHRAASQTTLTESTGANVVLASSQGDVHPSVLASNATVAAAAEARGPVH
                     APEELLPAAGALPEQRRDLDPLPRSVLQERLGHAAVDGHLTHRSDRNERTAIWVGMKR
                     SVSCQEEELVGRQHRSRDDSTTSCLPMRVRGRHSCSGVLRTASLYEDLAGLYTVHVDE
                     PSPRSRSKLASAERSGSFVDQQAGSFESTSKLYRVWRFVDPVLASRNLEEMLAAERPW
                     FPWRHILFVVILIAILFAGQFLSGAPYARSPVGVPLCGAVYWVIFMLQELSLFVIGLL
                     TVFRNIRLRRLRAAYGYPWFEHDGLTDMRWDGMNLYVYPAFVLVIGAIDSWTGLSSSA
                     LIIPYLYLIARTDLVTVQSSMAIVNLVASLAAAMVFLVDGRLNISYSLFYGLWAMLGS
                     YSGVFFVYYLVDRFQIRAFIILAISIAFFAAFAIVLYEAVHNVLAARAANAGWKMVNI
                     CVPTYL"
     gene            complement(<507851..>509338)
                     /locus_tag="CYME_CMJ185C"
                     /db_xref="GeneID:16994075"
     mRNA            complement(<507851..>509338)
                     /locus_tag="CYME_CMJ185C"
                     /product="NADH dehydrogenase I flavoprotein 51kDa subunit"
                     /transcript_id="XM_005534858.1"
                     /db_xref="GeneID:16994075"
     CDS             complement(507851..509338)
                     /locus_tag="CYME_CMJ185C"
                     /codon_start=1
                     /product="NADH dehydrogenase I flavoprotein 51kDa subunit"
                     /protein_id="XP_005534915.1"
                     /db_xref="GeneID:16994075"
                     /translation="MQGAVRGSLQRVVHKRTRWLVGVFTTLRSSSSVATGAPAPKPET
                     WRASNAERSYGLLKDQDRIFTNLYGERDAFLDGALKRGDWYRTKDLVLKGRDWIINEI
                     KASGLRGRGGAGFPTGLKYSFMPRQNPDGRPNYLVVNCDESEPGTAKDREIMRHDPHK
                     LVEGMLLVGVSMGARAAYAYIRGEYVYERKQLERAVQEAYQKGLIGRNACGSGYDFDV
                     YVHHGAGAYICGEETALLESLEGKQGKPRLKPPFPANIGLYGCPTTVTNTETVAVVPT
                     ILRRGSSWFASLGRKNNCGTKLFIISGHVNNPCVVEEEMSIPLRTLIERHAGGVRGGW
                     ENLLAVIPGGSSVPLLPKDICDDVMMDFDALKEVGSGLGTAAVIVMDRSTDIVAAIRR
                     ISYFYQHESCGQCTPCREGTGWLHRMLCRMEKGDARIEEIDMLYEVTKNIEGHTICAL
                     GDAAAWPVQGLIRHFRPELERRIREAERIRQEAQQNGAGASVATA"
     gene            complement(<510760..>512097)
                     /locus_tag="CYME_CMJ186C"
                     /db_xref="GeneID:16994086"
     mRNA            complement(<510760..>512097)
                     /locus_tag="CYME_CMJ186C"
                     /product="26S proteasome ATP-dependent regulatory subunit"
                     /transcript_id="XM_005534859.1"
                     /db_xref="GeneID:16994086"
     CDS             complement(510760..512097)
                     /locus_tag="CYME_CMJ186C"
                     /codon_start=1
                     /product="26S proteasome ATP-dependent regulatory subunit"
                     /protein_id="XP_005534916.1"
                     /db_xref="GeneID:16994086"
                     /translation="MGNGQSLPPGGGPSGKRGDQASKGEKKKRFDAAPGSTRFGRRRK
                     RRGPAALQRLPAVTPAVKCKLRVLRLERLKDCLLLEEEYISNALLSKPQVERVEEDRA
                     KVETLRGSPLGVGTLEEIIDDNHAIVSSAMGPEYYVNMCSFVDREQLEPGCSVLLHNK
                     VLSVVGVLADDTDPSVSVMKVEKAPPETYADVGGLDQQIQEIKEAVELPLTHPELYED
                     IGIQPPKGVILYGEPGTGKTLLAKAVANSTSATFLRLTGSELIQKHLGDGPKLVRELF
                     RLADENAPSIVFIDEIDAIGTKRYDATSSGEREIQRTMLELLNQLDGFEARHDVKVIL
                     ATNKIETLDPALLRPGRVDRKIEFPLPDEKTRRRIFAIHTGRMSLAPDVNTEEFVMTK
                     DPLSGADIKAICTEAGMMALRERRMKVTQEDFRKAKESVLYKKQQGAPDSLYL"
     gene            512198..514593
                     /locus_tag="CYME_CMJ187T"
                     /db_xref="GeneID:16994067"
     misc_RNA        512198..514593
                     /locus_tag="CYME_CMJ187T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461356.1"
                     /db_xref="GeneID:16994067"
     gene            complement(<514280..>515212)
                     /locus_tag="CYME_CMJ188C"
                     /db_xref="GeneID:16994072"
     mRNA            complement(<514280..>515212)
                     /locus_tag="CYME_CMJ188C"
                     /product="unknown hydrolase, cbbY homolog"
                     /transcript_id="XM_005534860.1"
                     /db_xref="GeneID:16994072"
     CDS             complement(514280..515212)
                     /locus_tag="CYME_CMJ188C"
                     /codon_start=1
                     /product="unknown hydrolase, cbbY homolog"
                     /protein_id="XP_005534917.1"
                     /db_xref="GeneID:16994072"
                     /translation="MVLSNTAFLALPSTPVRHRGHRSCCSRRPQAVNWLQRTRACAAS
                     SGRNPAFSAGTSQTAVLPLTRAILFDCDGVLADTERDGHRVAFNRAFREFRIDEEKAT
                     WDVNLYGQLLEVGGGKERMTAHFNEVGWPDVARTPDDQRELVQRLHKRKTEIFMKMVD
                     AGEIPLRVGVASLIQRAFERSDMRVAVCSTSNEEAVQAIVNLLGPDIAPRIRVFAGDV
                     VPRKKPAPDIYLLAIEQMRLDPNHTVVIEDSAIGVKAAKAAGLCCLVTKSAYTRFESF
                     EGADAVIDALPKDGTEALRLLDQVLVARRAAKRF"
     gene            <515788..>518952
                     /locus_tag="CYME_CMJ189C"
                     /db_xref="GeneID:16994073"
     mRNA            <515788..>518952
                     /locus_tag="CYME_CMJ189C"
                     /product="probable mRNA cap binding protein 80"
                     /transcript_id="XM_005534861.1"
                     /db_xref="GeneID:16994073"
     CDS             515788..518952
                     /locus_tag="CYME_CMJ189C"
                     /codon_start=1
                     /product="probable mRNA cap binding protein 80"
                     /protein_id="XP_005534918.1"
                     /db_xref="GeneID:16994073"
                     /translation="MSTSNAGNSDIMCGTVDWQLVTARIARLGDQFLLQLPNEPEAVA
                     DLYGDRPNKRRERIQGFDSWKAAELVPALPTPDEVQDAVKDHMDLITSRKGVADPLTD
                     LDADETSLHREKRARYTTDAPSVASVSELVRYLEPTSAEAWIGAVALQVALWANRLRE
                     ASSPVLPAAIAHEEDFQRRAQMGVFATGEAPLVAPNPLLPTLVRCGTELGHKCDVFAL
                     FLACLVYPDRAKQRETMKEPEALSRTDAFCQHLARQVAETVFGLFNSALRHITTGAPI
                     AEQSLMISITPNASATAKTAGFMKLPPVLQARRALHFLAELANTHILDSEWFVRRILH
                     DLLVEAALFGAEQDQAPLSRSQFLVELALDGLMHCGREAERVAADCVDAILQAAERFA
                     GTIRSPSTIIEECARMERLFSPVKDVELNSPALDEAHRASLQVSRRFHELLLVCRKLR
                     ARSWHCNLLPQYHLLFWETRIRDSGLRMQLPVPPLSRHSIDARYPVPSIRLHITKMDT
                     TVEEHTSASETPTSPPVANEQNDSKAQSWWPAMSFTDRFLAVERLSDMLDAFLADRRI
                     CVQMLRRPRAGFSMKDHQMMLVETILSAMLQIPRSRNPLLFYATVLVELCRGGDPQTA
                     IHLLQAVETLIREAQRLDPEVTERVAQWLAFHLSHFQWEWNWDAWLPLQGNVHSAALI
                     ASMLEYAVRLSYRERIAEKTPSALHNLLVPPAEPVWETESPLIGSPAASLLASIPEPV
                     KVELAQRLVASAYDAVPYLNEHVPKELRPAVFLQALLRGGYGAPSFFANLVERWGGVL
                     RELCRDPGAAAAGLQLVSVVLQVWESSHQHALLSLNCLSSAGILDPSTVVTGVYRQLL
                     NRYPTSDDLSFAALNDLRFPFETVRFFLNQYRDRLRRIQTDIEMLLLAISRAPERDLD
                     TMEAALTRARQMLQQHRQGLKRFLAATLDSLAQILRHYHGSSGGDRGDRDHHETDDHE
                     DHGGTASATSASTGDTAPAALVRGWLLERSLGLVQELLRTQLDQTPRLLGTLKALLGN
                     FTNASLKRMLHDLDQLARWSLATV"
     misc_feature    complement(518447..519943)
                     /note="possible transcribed region"
     gene            complement(<520282..>521814)
                     /locus_tag="CYME_CMJ191C"
                     /db_xref="GeneID:16994082"
     mRNA            complement(<520282..>521814)
                     /locus_tag="CYME_CMJ191C"
                     /product="tryptophan synthase beta chain"
                     /transcript_id="XM_005534862.1"
                     /db_xref="GeneID:16994082"
     CDS             complement(520282..521814)
                     /locus_tag="CYME_CMJ191C"
                     /codon_start=1
                     /product="tryptophan synthase beta chain"
                     /protein_id="XP_005534919.1"
                     /db_xref="GeneID:16994082"
                     /translation="MLNCTAFVAPLSNTTSFFLAKERFTRNSGRSVDNRRTLGRRARS
                     QNPAARTVFLPSMLMTPERSVAADNATENVVPEEIEHGERVTDLRGRIGRYRSSVPDA
                     RGKFGPFGGKFVPETLISCLEELEEAYKKVSKDPTFQQELAQQLRDFAGRPTPLYFAE
                     RLTAHFARPDGSGMQIYLKREDLLHTGAHKINNALGQVLLARRMGRTRIIAETGAGQH
                     GVATATVCARFGLPCVVYMGARDMERQKLNVFRMRLLGAEVRPVHTGTATLKDALSDA
                     IRDWVTNPSTTHYVVGSVAGPHPYPAMVRDFHYVIGEEVYQQVQERHGPGRLPDILVA
                     CVGGGSNAIGLFRRFVDEPSVRFIGVEAAGRGLDTHEHAATLTKGSVGVLHGSMSYLL
                     QDDDGQIVEAHSISAGLDYPGVGPEHAFMRDTGRAEYLSVTDEEALDAFQLVSGLEGI
                     LPALETSHAFAALKRINDTIPAGARPIVVVNCSGRGDKDVNTVITALKERNSPLVSGL
                     DI"
     misc_feature    complement(521920..524668)
                     /note="repetitive element"
     gene            complement(524286..526711)
                     /locus_tag="CYME_CMJ194T"
                     /db_xref="GeneID:16994083"
     misc_RNA        complement(524286..526711)
                     /locus_tag="CYME_CMJ194T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461357.1"
                     /db_xref="GeneID:16994083"
     misc_feature    524409..525802
                     /note="possible transcribed region"
     gene            <526920..>528740
                     /locus_tag="CYME_CMJ195C"
                     /db_xref="GeneID:16994084"
     mRNA            <526920..>528740
                     /locus_tag="CYME_CMJ195C"
                     /product="similar to outward rectifying potassium channel
                     KCO"
                     /transcript_id="XM_005534863.1"
                     /db_xref="GeneID:16994084"
     CDS             526920..528740
                     /locus_tag="CYME_CMJ195C"
                     /codon_start=1
                     /product="similar to outward rectifying potassium channel
                     KCO"
                     /protein_id="XP_005534920.1"
                     /db_xref="GeneID:16994084"
                     /translation="MRQASRKTSTGTTVPRLERDAQPGISASFLVLMNKQVRKSLTFN
                     DEHVSRRADVLWGRLSLFFSGSGQKPAASCRVVAFQTTLSGITSVFQAPRHTTQALRE
                     PSCRRQGLLKRARPARRSTLPGRERTLAASRRTLFVPLYASANDNDLRAQQESSSRAT
                     IRNRSATTRSGNDSSVKEGTEPQRPRSVSEVAVEQFEEQPGPSTTVIAATFVAMYLTI
                     GTLFYSTVESWSPLDALYFVVQAGLNVGYGDIQPTKEISRLFTAAFVLAGNLLLGGAL
                     ALFVQGALMKQERLIQQFADESNKLRVTMDDENNDGAWETNAGSGVAGWAVSLFSDAV
                     SFTRGIHKVLSSYAKRAGRRLSNAAENALSSFSDDAMDAPRGIDLLVRELSAVGAAFL
                     NTPLGNVISSYSILWLWIGSGTAFGMIHEHLPFADALLFSVSSLSTLGISPPPSSDPV
                     SRLFCTVFLLSGVAVYALTLGRVANFFVDRYEREQVRRLVTTRLRLRKKLQQIARRCD
                     IHDNAAALAWKAQMRKQHAELLETPLWRPLSEAGLASATTPDPSQRTGEDGDKAEPLP
                     DEETLTWAEFLEWKLLTEGRISVERLSAIRREFEQCFEKM"
     gene            complement(<529061..>531331)
                     /locus_tag="CYME_CMJ196C"
                     /db_xref="GeneID:16994080"
     mRNA            complement(<529061..>531331)
                     /locus_tag="CYME_CMJ196C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534864.1"
                     /db_xref="GeneID:16994080"
     CDS             complement(529061..531331)
                     /locus_tag="CYME_CMJ196C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534921.1"
                     /db_xref="GeneID:16994080"
                     /translation="MVPAAVGSRLLQPHSTEDVVVAEVRREDTSFFAVVSEDGSNHSS
                     NSIDDTVLANGSGTSRALEPIPGQSVAQRGSPVTSQQFRCSAGQHTPCSPVLSTQLTL
                     KNGYVIALQSNRDPSGGIKLCLLVKDPSEQLEAALDTPEPSSQESGYSAELGALEPLD
                     TSLWSVPLSEETFTGKYMMNTWGIACVILWNNSILQLLQFEYHSDKRKLYLRRQRNAA
                     LRPAKPNTSQTPSGAQRPAERNRAGKRRQSDCAPAANTGGTDTVLEHENRKSASWIGL
                     FAVGIANTPFCVVVVAEAPAPVIVPGQQKVGLRRKLRSNQCTVGDLEATAKHWKRHLQ
                     LWDVEFGQRHQLLRIETDESEQHGTFSTHSPVLAKQYPAWVSYEADTAKLSIGWGEEV
                     PSTGVHCWLVSLHATLPSTLRMADMLRLLRDHDSGALPSGPAVSLQAGQARLPAQSKA
                     NRVAAGKLDTQRVHQSSEAPSVEALCQQEEALLAAIQIGSWELWVKALQNFPTYRDAT
                     GSGALADSPQGIVLRSATHAATEPPDHSGSAFSLREHLLHLNARLREKYIENAMAVAS
                     SHGILQEQRACLRVQYKDLRAAFPEASSMPALSDLIPFIPLGCHCTNMPVGEQIGLLL
                     HHLRHKQSADSNAKHPGATGRLVNSLYAYPRPSSSDTRNVLRQLPLRDVCCILTDVSE
                     RLERVHAGLEGAASAALDGALDLSVCLIDLHWRELVLGETGALFRFANAVCRLKAGLD
                     HAERLCGLLDQWLQAA"
     gene            <531837..>532847
                     /locus_tag="CYME_CMJ197C"
                     /db_xref="GeneID:16994078"
     mRNA            <531837..>532847
                     /locus_tag="CYME_CMJ197C"
                     /product="similar to smooth muscle caldesmon"
                     /transcript_id="XM_005534865.1"
                     /db_xref="GeneID:16994078"
     CDS             531837..532847
                     /locus_tag="CYME_CMJ197C"
                     /codon_start=1
                     /product="similar to smooth muscle caldesmon"
                     /protein_id="XP_005534922.1"
                     /db_xref="GeneID:16994078"
                     /translation="MEQDTAAASNRRVLPSRSTRGQRLHQLIGEELEADDLFWKQAAS
                     IDSSTEEDDDFAVSEASELSSADDAISSTEEAAEVNPLPTDSNTKGTTEEIDEEQEAI
                     LKERERLERLKVRKKRYRFGKYEDPALKERESSKRPRSSRSRSTTQSDLDALYSSPKA
                     TPDSSEWSVSRESLRRTTKAASEETARLLEERAATKAQRQQERQRRRAEQTPHSGALS
                     QEERLAEALQVTEPANRLELEHLLALADEKDSALKRQARAQRQHPALKTSVMRWFRGY
                     RPQSTGGYCGGSAPDKASSADTVYVEWVAFRQEEDMPMFLRKSQHAPQQMSMPSSSTT
                     ER"
     gene            <535378..>536859
                     /locus_tag="CYME_CMJ198C"
                     /db_xref="GeneID:16994045"
     mRNA            <535378..>536859
                     /locus_tag="CYME_CMJ198C"
                     /product="similar to protoporphyrinogen oxidase HemK"
                     /transcript_id="XM_005534866.1"
                     /db_xref="GeneID:16994045"
     CDS             535378..536859
                     /locus_tag="CYME_CMJ198C"
                     /codon_start=1
                     /product="similar to protoporphyrinogen oxidase HemK"
                     /protein_id="XP_005534923.1"
                     /db_xref="GeneID:16994045"
                     /translation="MPLAAFSGVLRVPGCLRCCARWTRTIDECVFVRRCRSSRTPLTP
                     LRPLGCVRQQESHQRLQASQDVPELVQTSAEAAGAGLVAAGASRLAPPLVQWPQDTPR
                     ALLQYVKREVLAVVPEPDLSAEYLFMEALRRAQSSVQMQHQLKQLRQLRYQHQRYAAL
                     GLDASQRDWLDVLLIPPPLTLPAFRAAVNASGKFSPARQTVREEQHPAMHWVETLRDA
                     IRAEYRELCIRRLSREPVQYICGSWAFHCIELLLQPPVLIPRPETEELVEHVLRSDWA
                     QRARAGESLRLLDIGCGSGAIVLALLASLRNTNVAAVAIDPNETAVWITAENARRLGV
                     ALYAERGDAETLHPFLRILRCDIQTFKSDLLTQARAMRDSGEHEFTYDLIVSNPPYVL
                     PGDMATLAPEIRDFEDPAALSGLDEDGMRIIRAILKACAEAPSLLAPGGELWMEVDPS
                     QPPKIASLLAATASAASSVTLELVDVKRDLSGHERFVHIRRPR"
     gene            complement(<537545..>538459)
                     /locus_tag="CYME_CMJ199C"
                     /db_xref="GeneID:16994044"
     mRNA            complement(<537545..>538459)
                     /locus_tag="CYME_CMJ199C"
                     /product="similar to UMP/CMP kinase"
                     /transcript_id="XM_005534867.1"
                     /db_xref="GeneID:16994044"
     CDS             complement(537545..538459)
                     /locus_tag="CYME_CMJ199C"
                     /codon_start=1
                     /product="similar to UMP/CMP kinase"
                     /protein_id="XP_005534924.1"
                     /db_xref="GeneID:16994044"
                     /translation="MQSRQCECAPLHARIAFVPLNGAFHGMLRRKPVPGGQQNLPITR
                     FGVDHPLPPANYLSRPATRLSQSESRRALGAVAVPGQELPFGAFPMTCAQSLRLLFLL
                     GAPGAGKSTLAKKLSELHNWRHLNVGDLLREAASGTSPLVTADQSRELENLLLVGDRI
                     APSEITATLLNSALERCWSTSTSSDQRTVIVDGFPRNHENWQAFETSVQRTLTAYPCF
                     VLLWLDLPFSVALRRAQQRHRNDDLTPTLKRRFKVYVQETLPLRQRLPADRQYCVSAD
                     QPVDHIVTSVQRLLREAGFLASNWSSCP"
     gene            <539475..>542024
                     /locus_tag="CYME_CMJ200C"
                     /db_xref="GeneID:16993928"
     mRNA            <539475..>542024
                     /locus_tag="CYME_CMJ200C"
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily a"
                     /transcript_id="XM_005534868.1"
                     /db_xref="GeneID:16993928"
     CDS             539475..542024
                     /locus_tag="CYME_CMJ200C"
                     /codon_start=1
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily a"
                     /protein_id="XP_005534925.1"
                     /db_xref="GeneID:16993928"
                     /translation="MVDVEKTARTGDSVDSGRDESRKEDDVLVKRSEQDQVSLTEDGL
                     VASYPVGECSERDNGGGDTGDCSVTDQGDLEAGTNSATQAVKRRRYEHLERLLKAATL
                     YTSVLSEQIRQQQEQYRRRAHQQTSTPHNERSSKPGSTAGEKKLKTLVETADREQVDV
                     RRTEARDAGALQLQEFTGGVLRDYQLAGLEWLVSLYENGINGILADEMGLGKTIQCIA
                     LICHLREMGVQGPFLIVGPLTVLPNWISEFQRFAPSVYALLYHGTKSERQLLRKRHLS
                     TRNGASNMPVVITSYEIVMRDRVYLSKYHWAYIIIDEGHRIKNMDCQLLRELQSYTSA
                     NRLLITGTPLQNNLDELWSLLHFLMPDIFDSVELFREWFDFGNDIAAGALERQQEDAI
                     VSKLHMILRPFMLRRLKSDVEKKMPKKREIYLFAPLSALQREYYMAIMQDRIHELLNA
                     RYGREYTRPLTLRNKFMQLRKVCCHPYLIAEPEENFTDGAYPITDERLVHAAGKLALA
                     DRLLPRLRARGHKVLLYSQFTSMLNILEDYLQLRGHKYARIDGSVKFEDRIRQMEAFN
                     SPDSEIFIFLMSTRAGGLGLNLQAADTVIFYDSDPNPQMDLQAMDRCHRIGQRKPVHV
                     YRLVTPNSVEERMLNRAVEKRKLERLVVTRGHFYCDATHASLQAPSAPSASNAGPSTT
                     PDENRNPSQTVSSFDEALVQKLSALEENLLDLDTIASKEQVERILEELVNFVPAEAEY
                     GNGGQITDADLDALMDREEMIDQEAESHADAESLPLQESASTQASQTSRSCRRKRAAM
                     DANEAAPLNLSETTDADGIQTKTDAVVFRRQIAQGRGYQIFESGGESKLFQ"
     gene            complement(<544946..>546184)
                     /locus_tag="CYME_CMJ201C"
                     /db_xref="GeneID:16993923"
     mRNA            complement(<544946..>546184)
                     /locus_tag="CYME_CMJ201C"
                     /product="delta 9 acyl-lipid fatty acid desaturase"
                     /transcript_id="XM_005534869.1"
                     /db_xref="GeneID:16993923"
     CDS             complement(544946..546184)
                     /locus_tag="CYME_CMJ201C"
                     /codon_start=1
                     /product="delta 9 acyl-lipid fatty acid desaturase"
                     /protein_id="XP_005534926.1"
                     /db_xref="GeneID:16993923"
                     /translation="MIDARDGTINCSLLGAEQRSDGNESARVEPPRAATAADALAQHR
                     MRAVRNRSPCSIGRLASSPALWAFALVHVFALKGVVQIGFGVQSRALLLCLATYLVRM
                     LGITVGYHRYFSHRSFKTSRPFQFVLAWLGASSCQKGVLWWASWHRHHHQHADSEEDA
                     HSPVHLGFWWSHFGWFLLSDAHTEVLASLVPDLMQYPELVWLEKWHLVPGAVLALACY
                     WLFGGYQAFVYGFLVSTVALWHATFTINSLSHIYGSRRFICEFRGDCNARNNLWLALI
                     TLGEGWHNNHHSFMGSARQGFYWYEFDPSYWLIRLLALLRVVKKVREPPLEQLERKRL
                     PAECRRWDICSCVLRQFCTETPPGSAHLPRVGRNACQGSESDTLADALHVLKAATEWK
                     APVAPELPQIIGMSWPEHAH"
     gene            complement(<547204..>549726)
                     /locus_tag="CYME_CMJ202C"
                     /db_xref="GeneID:16993924"
     mRNA            complement(<547204..>549726)
                     /locus_tag="CYME_CMJ202C"
                     /product="similar to chloroplast import-associated channel
                     Toc75"
                     /transcript_id="XM_005534870.1"
                     /db_xref="GeneID:16993924"
     CDS             complement(547204..549726)
                     /locus_tag="CYME_CMJ202C"
                     /codon_start=1
                     /product="similar to chloroplast import-associated channel
                     Toc75"
                     /protein_id="XP_005534927.1"
                     /db_xref="GeneID:16993924"
                     /translation="MCVLGFLAGDPLRVGAHALKICTRSIASRERRRNAPRKQFPADR
                     TGQRWHRSTTWLSKRGEPLTCSWQSQMLDSMARSRRKRHRNTTKPGVKRSWCGSIGDR
                     TLRGGGGRGGNSYVDGVAGGFPDLPNRGSFLLWLTLCWHTVQVWLRAPTALALSVPTA
                     ATEEEAAEIYAEHPNDQTKGPLRQVVLRGPVDRLLLPRDRLEQAVNRILQANQNADAS
                     IDYTAIRRSIDSLNAFYGEHGYPLALVRRAPDTPIKDGILVLEAYEPLVARVLVEYVD
                     ANQEPCSGRTHASVIARALGYDGLGVEKEMPDHQRHSRKSRSAQKACPRKVPFRWTEQ
                     HFQRLQQLGLFESVTADVRVIDAVTPHDSPAAEGQVAQAERCAEIGDVELTLRVRERP
                     FHRFEPGITLSRGKLYGDLTLEDANVAGRGIRFQADIRSKPDRSDDAAHIVLQNPRLG
                     SKAGGYQVRLFESRSTAVGSRRGVEVTLMAPQLWSAPTDEARRSSRTWLRPAAWRSVM
                     ERTLQLWNIQTGVLCEQVRMFPSGMNPGQTASSSLPASADGASARRNRDESTTEASTA
                     RERSFTHLVLNSSAIRDTRSDPLHPQAGYRLALHAAYAVPVTTSNPEYSRFGFTGSVY
                     KKIPPIRGLLRRRRRKQTEQPETSHQNQEQDEEQPARACVALLAEARVSSASLPESER
                     YPFGGLATVRGMREGSLGQVGSFARTCAEFRYPLDKRLVFVAFTDWGSEIQPPSHLVR
                     FPKLFRRGAHGHRLGTVVDSASAESTSSGVDAPASAGSIQRSSTASGVISVGLGLRVL
                     GALRMECGWILDRAPGGSGGGFPNWRLSRDGYWHIGLVDVSY"
     gene            complement(<551128..>551439)
                     /locus_tag="CYME_CMJ203C"
                     /db_xref="GeneID:16993925"
     mRNA            complement(<551128..>551439)
                     /locus_tag="CYME_CMJ203C"
                     /product="similar to transposase"
                     /transcript_id="XM_005534871.1"
                     /db_xref="GeneID:16993925"
     CDS             complement(551128..551439)
                     /locus_tag="CYME_CMJ203C"
                     /codon_start=1
                     /product="similar to transposase"
                     /protein_id="XP_005534928.1"
                     /db_xref="GeneID:16993925"
                     /translation="MAIRQEETNDRSEHTTPSSDSVVRSLGNRRSDRVLQHLILRRST
                     LWRLHPARFCPGVRQRRCPSLGSGRGARNCEWRCAALLAELFSLAESSRKRHLCWQTQ
                     V"
     gene            551913..553728
                     /locus_tag="CYME_CMJ204T"
                     /db_xref="GeneID:16993926"
     misc_RNA        551913..553728
                     /locus_tag="CYME_CMJ204T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461358.1"
                     /db_xref="GeneID:16993926"
     gene            <554594..>555511
                     /locus_tag="CYME_CMJ205C"
                     /db_xref="GeneID:16993938"
     mRNA            <554594..>555511
                     /locus_tag="CYME_CMJ205C"
                     /product="probable iron-sulfur cluster scaffold protein"
                     /transcript_id="XM_005534872.1"
                     /db_xref="GeneID:16993938"
     CDS             554594..555511
                     /locus_tag="CYME_CMJ205C"
                     /codon_start=1
                     /product="probable iron-sulfur cluster scaffold protein"
                     /protein_id="XP_005534929.1"
                     /db_xref="GeneID:16993938"
                     /translation="MQRVRLLWPLVRRVHQREAQLASLRALHRMQPEALRQVRSLTSL
                     GQLGHQKMKGSARRDSIAGLWKGPLRSVLQRRTLFIQTAATPNPNSVKFLPGSVVIEN
                     EGTYDFPTPQAARASPLADKLFQIDGVVGVMFGPDFITVTKREDIEWNVLRPEIFSVI
                     MDFYMSGQPLFMDASTGSADAPGLNEDTRILDADPEHVAMIKELIETRIRPAVAEDGG
                     SVLYRGFEEATGTVLLELQGACSSCASSSVTLKNGVENMLRHYVPEVKAVREVKNAER
                     EMMEAESNRMLHELERRFAQQHDATPAKR"
     gene            <558192..>559970
                     /locus_tag="CYME_CMJ206C"
                     /db_xref="GeneID:16993946"
     mRNA            <558192..>559970
                     /locus_tag="CYME_CMJ206C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534873.1"
                     /db_xref="GeneID:16993946"
     CDS             558192..559970
                     /locus_tag="CYME_CMJ206C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534930.1"
                     /db_xref="GeneID:16993946"
                     /translation="MPMNDDSRGFYEDYGYKEYAAETGANSERGKRASRFNVTESLFQ
                     SESTLERVVFGGRRQRRGAPLSNHLSSKDQYVQESELETAPSSEGSNSREHELDHWSG
                     SAATPAPSSIRARPESATDSESEYVSLEERDRRRKLRHFVDENVVSRRTFEQRLREQF
                     VALHGIPRWAARHDNTARADNGTAAVSLVSDTGNDALDPEGPVAASAASSRGASATRP
                     PLHWKALPIRRLTDANAAAPAASVLTSVRFHPASAHLCFTAGFDKRLRLFHLTEEPAD
                     NLRWKCVRENECLHTVCFADMPIYTAEFVRGSHGAITNSVLLTGRRRFFYEYDLAAQK
                     GIKIRTLESLRKERSFERFTVSPDGKLLAFTGDDSQVILVDAVTKQYLGCVRIACGPQ
                     SGAALPRVVTFAPDGLMIAVAGETSGYVSLYDLRMCFTDSGMNASQPLARFLDEGTVR
                     CTALKWSPTGQYLATGSDAGIVNIYDGRAIRGQASTKASGESVTPRERNMHPLASVSN
                     LVTQIDTFAFLPDDQALFYASQAKRNAARVYHLASRKTFPNWPTSQTPLHRVWSASFS
                     PGGGFLALGNDRGRALLYRLRCYAPT"
     gene            complement(<560160..>561473)
                     /locus_tag="CYME_CMJ207C"
                     /db_xref="GeneID:16993947"
     mRNA            complement(<560160..>561473)
                     /locus_tag="CYME_CMJ207C"
                     /product="similar to calcium-binding protein MO25"
                     /transcript_id="XM_005534874.1"
                     /db_xref="GeneID:16993947"
     CDS             complement(560160..561473)
                     /locus_tag="CYME_CMJ207C"
                     /codon_start=1
                     /product="similar to calcium-binding protein MO25"
                     /protein_id="XP_005534931.1"
                     /db_xref="GeneID:16993947"
                     /translation="MGTETFSLPEGPAELSRAVVDALLALRRISEAVATTTTPPTTTA
                     TTTGSGSATKLPVPAAGSDQYVPGAAGAPDDRTEQPVDSTQPGSSLSRVVEAQERVAF
                     TLAALRSLLYGEDWLDRSATRSAVIADTCNREKRNDLAATTTTPANQAKGGQDASERL
                     STEALQSVVYDTELLELLASSLPLMEFESRKDAVAVFHNILRRQAENQRMQVPTSVLE
                     SLLVDYGRPEVALSCGMMLREALRHEDCVRMLFSLDTFWIFFSLLQMSNFDVASDAFT
                     TLRVALTRHKKLAAEFMLQHFDRFFLTEYNNLLRCDNYVSKRQGLKLLSELLLDRSNF
                     YIMIRYVGMVENLKLVMTLMLDPGKSIQLEAFHVFKLIVANPSKPVDVKRILFRNRDK
                     LIRYLNALGSEAPTGNPAFASEAFREDLQLVISEIQKLQPETKSP"
     gene            complement(<565196..>565864)
                     /locus_tag="CYME_CMJ208C"
                     /db_xref="GeneID:16993951"
     mRNA            complement(<565196..>565864)
                     /locus_tag="CYME_CMJ208C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534875.1"
                     /db_xref="GeneID:16993951"
     CDS             complement(565196..565864)
                     /locus_tag="CYME_CMJ208C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534932.1"
                     /db_xref="GeneID:16993951"
                     /translation="MRRKPSSCWLVPVECSLHSTSFEARGSYSRTEDRHRLADRRVGA
                     WCRAVRINPCTWRQQREAALAAGSGRAHLRKSGNAGVRSLVGQQKRRGPLFDWDSALI
                     RASRWLSSAQGQLVVWAILVWLVFSGRIGVIFDSFLILFALLSIAPVVGALVLRWWIA
                     ANVREGTCPNCRFPVTGLVGKEFRCPSCTQRILVEKNGNFVLSEDARSAVINVEAREV
                     DTKD"
     misc_feature    complement(565993..567590)
                     /note="possible transcribed region"
     gene            <567099..>568187
                     /locus_tag="CYME_CMJ210C"
                     /db_xref="GeneID:16993933"
     mRNA            <567099..>568187
                     /locus_tag="CYME_CMJ210C"
                     /product="similar to tRNA dihydrouridine synthase Dus1p"
                     /transcript_id="XM_005534876.1"
                     /db_xref="GeneID:16993933"
     CDS             567099..568187
                     /locus_tag="CYME_CMJ210C"
                     /codon_start=1
                     /product="similar to tRNA dihydrouridine synthase Dus1p"
                     /protein_id="XP_005534933.1"
                     /db_xref="GeneID:16993933"
                     /translation="MFHVVGPGTSNMGHVQRAWDHFRAVGSPRFLCAPMVDASELAFR
                     LLVRRYGVQLAYTPMLHSLNFLQSPKYRDEHFTTCALDRPVVAQFCGNDPTTLVAAAK
                     LVESQVDAVDLNLGCPQNIARRGRYGAFLQDDWDLVQRLVSALSTHCSVPVWCKIRVF
                     PDEHKTLAYAKLIQDAGCSVLAVHGRTRDQKGNDPGPANWTMIRRIKEHLEIPVLMNG
                     NIQSWADVQRGLAETRCDGVLAADRLLAYPALFSGREDNCIYALAREYLGIVEQYDPQ
                     TPARMIRGHLFRMLNADIRRDEDLRERLLGAHSVQGFAEAVLIAQRRAAEMPVVAAPL
                     ERVHGLGGSSRVDVSRGASQPQTYARPV"
     gene            complement(<569762..>571228)
                     /locus_tag="CYME_CMJ211C"
                     /db_xref="GeneID:16993934"
     mRNA            complement(<569762..>571228)
                     /locus_tag="CYME_CMJ211C"
                     /product="NADH dehydrogenase I iron-sulfur protein 49kDa
                     subunit"
                     /transcript_id="XM_005534877.1"
                     /db_xref="GeneID:16993934"
     CDS             complement(569762..571228)
                     /locus_tag="CYME_CMJ211C"
                     /codon_start=1
                     /product="NADH dehydrogenase I iron-sulfur protein 49kDa
                     subunit"
                     /protein_id="XP_005534934.1"
                     /db_xref="GeneID:16993934"
                     /translation="MWCRGFCSGLGLARNLLLHQLGRRYADPAPHNGFLVRRLLGTGV
                     RALCVDATRTRPEPGALQPKDYVDLESYNAFSGEVDVQQLEPHEKERMRANLENAKEI
                     RNFTLNFGPQHPAAHGVLRLVLQLDGEVVESTDPHVGLLHRGTEKLMEYKTYLQALPY
                     MDRLDYCSMLCNEQVFCLAVEKLLKIEVPLRAKYIRTMFAEITRISNHLLAVTTHAMD
                     VGALTPFLWAFEEREKTFEFFERVSGARMHANYFRPGGVHQDLPLGLCDDIYAWCRQF
                     ASRVDEIEEMLTNNRIWKQRLVGIGVLSAEDALNWGFTGPMLRASGVPWDIRKVQPYD
                     AYAYVDFKIPVGVYGDSYDRYLVRVEEMRQSLDIIQQCLNQMPSGEIRVDDRKVSPPS
                     RHDMKSSMESLIHHFKLYSEGFVVPAGETYVAVEAPKGEEGIYMISDGTNRPYRVHIR
                     APGFAHLSGLNMLARGHMIADVVTLVGTLDLVFGEVDR"
     gene            complement(<573973..>574305)
                     /locus_tag="CYME_CMJ212C"
                     /db_xref="GeneID:16994093"
     mRNA            complement(<573973..>574305)
                     /locus_tag="CYME_CMJ212C"
                     /product="similar to cytochrome c"
                     /transcript_id="XM_005534878.1"
                     /db_xref="GeneID:16994093"
     CDS             complement(573973..574305)
                     /locus_tag="CYME_CMJ212C"
                     /codon_start=1
                     /product="similar to cytochrome c"
                     /protein_id="XP_005534935.1"
                     /db_xref="GeneID:16994093"
                     /translation="MGDIPEGDASRGEKIFKTKCSQCHTYEKGGPTKQGPNLHGLFGR
                     PAGSVPGFAYTAANKNSGVVWKDETLFEYLENPKKYIPGTKMVFAGLKKPQERADLIA
                     FLKKATSE"
     misc_feature    complement(575820..577046)
                     /note="possible transcribed region"
     gene            <577244..>578131
                     /locus_tag="CYME_CMJ214C"
                     /db_xref="GeneID:16994036"
     mRNA            <577244..>578131
                     /locus_tag="CYME_CMJ214C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534879.1"
                     /db_xref="GeneID:16994036"
     CDS             577244..578131
                     /locus_tag="CYME_CMJ214C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534936.1"
                     /db_xref="GeneID:16994036"
                     /translation="MGTHSGHERNGESARGGALQRLERRLAAAWAEQDAYQIEQLAGM
                     IYDRLVRSDPSAAATVLEQNAHRLAVAGKPAEAAELATRLIRHWRELEQRPFYLARLQ
                     QMVLEPLQALSGVEAARARTMVLEAVLAWKRASATVDTEEAAPAELAPVQDALVDAYV
                     LCGEWARAQYQVVCRGGPAERDLAFIDEQLGPHLANDVERMLARTRLVLFYVLAGNLK
                     AGRALVEEIQRKHPTAPMTNFVVILMQVLERARNVDSSKRRLLRNFCDDLKRVYHWAF
                     SLDPELDAMLDDVLKAQGL"
     gene            complement(<581859..>584315)
                     /locus_tag="CYME_CMJ215C"
                     /db_xref="GeneID:16993953"
     mRNA            complement(<581859..>584315)
                     /locus_tag="CYME_CMJ215C"
                     /product="unknown homeobox protein"
                     /transcript_id="XM_005534880.1"
                     /db_xref="GeneID:16993953"
     CDS             complement(581859..584315)
                     /locus_tag="CYME_CMJ215C"
                     /codon_start=1
                     /product="unknown homeobox protein"
                     /protein_id="XP_005534937.1"
                     /db_xref="GeneID:16993953"
                     /translation="MDVAGHSLVHSPLPTWAPAEHEFRTADAVDALARGTEGSHSDGR
                     AATQSERSSEEASRMKRHRFTPEQMQMLKTVFEQNPMPSTAELQALSSASGVPVRSCR
                     LWFKNRRARTPGKRTASESRGLRAAGPSGTTDAVSSNASLPRSTSAWNAQAPSGDSQL
                     EARMYNPVSIAQDLGPMQSSASQQDSTVDAAPRRRPKRPHERGRAAKPGAGGQSQSSP
                     LISPRPDSVLRISPAYGALGQDWSNTGSFADNGQKEPAAIPDSNWRCVPVRSEPPAIL
                     QSPHRSTAMGIPPTPRLQCQRVYKPGEVVELLDSAGAARAWCPARIISADVSWPSSTE
                     SLLSAVEIAQDDGINRVCEYDDVSPLTKTAYEIAFLSADEVLRIRADACANSETAGAC
                     PANVQGAAAGGTGAMPEGPHRVVLGARLRPYPPPPMPEWRPGVGEAVEALLSLSHGRA
                     GTSATPSASTSTAEQAAVDQIQGKSTSSTDMPSRTASTSGHGCCWTVGQVRNFLARKG
                     FLVAFADGSDEWFHLDQLRPYAIWRGADHWQVKSKAPPAVTRRALGAAPPAESSRAED
                     SNAADSNFRALEAAQRLATLNASRSTARAPHAVSESLPRALPRSTIAAPAAQMYPHRA
                     WYTHELSDGDDSEEAWSDEAEEPARDAEQGLRRPRRSSREEALALRNRNASAMRSSST
                     SPLTSPASAAARLSKPAHRFPRSSLPVIKKDSDRALARKRKRHRTGHRVNEETRRMLD
                     QTEIVAGQNGLVVGAGATDRRHRGGRKPSLTLTLPPGWRLEEQIRKGGSLAGRIDRVY
                     VSPDGRKFRSLKEVARFLDR"
     gene            <587353..>589368
                     /locus_tag="CYME_CMJ216C"
                     /db_xref="GeneID:16993945"
     mRNA            <587353..>589368
                     /locus_tag="CYME_CMJ216C"
                     /product="ATP-binding subunit of unknown ABC transporter"
                     /transcript_id="XM_005534881.1"
                     /db_xref="GeneID:16993945"
     CDS             587353..589368
                     /locus_tag="CYME_CMJ216C"
                     /codon_start=1
                     /product="ATP-binding subunit of unknown ABC transporter"
                     /protein_id="XP_005534938.1"
                     /db_xref="GeneID:16993945"
                     /translation="MFVATTPLKLPLVGSHATVASRGRRCAFLGDAVVSVAAASLRGE
                     RCRGLPIAGRLHVRMGLNASKLKKQQQQQQGKKKNKVSTKQEEASDAPSQIDTNRRDY
                     MFQMLRVSKILPNGKQILKDISLAFFPGAKIGVVGPNGAGKSTLLRIMAGVDKEFEGE
                     ARPMRTASIGYLAQEPQLDDGETVMDNIMAGVKEIRDNLHRLETLSQRLADPACSAAE
                     KQEIAQEIDQVQAQIEAADGYNLESILERAMEALRVPAPETPVKILSGGERRRVALVR
                     LLIRRPDLLLLDEPTNHLDAESVLWLEQYLSKYYTGTVVAVTHSRSFLENTCEWILEL
                     ENGRGIPHQGNYSSWLAAKQLRLEQDKKEADARRRLIDAELEWIRATPAARMTKNKAR
                     IDRFEELYQTQQETAESRSQSLSMNQIRIPVGPYLGEQVIEAEGLFKWYGDRCLISDA
                     TFSIPRGSVVGIIGGNGAGKSTLFRLITGREQPSAGTLRLGETVKLMYADQDRETLDP
                     NKTVFEEICGDAHVDTVTLGNRTLNARAYCAWFNFRGADQQKKVGVLSGGERNRLNLA
                     KAILNREHGGAGNVLLLDEPGNDLDTATLANLEQAILDFPGVVLAISHDPWFLSRVTT
                     HILAFEGDSQVRFFVGGFDAYQEYRRARFGDEFINPTRLKFRPLPKM"
     gene            complement(<590166..>591449)
                     /locus_tag="CYME_CMJ217C"
                     /db_xref="GeneID:16993956"
     mRNA            complement(<590166..>591449)
                     /locus_tag="CYME_CMJ217C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534882.1"
                     /db_xref="GeneID:16993956"
     CDS             complement(590166..591449)
                     /locus_tag="CYME_CMJ217C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534939.1"
                     /db_xref="GeneID:16993956"
                     /translation="MTRLCWSPAQQLVGGFVPPFCAKQSGHYWTDRDVEPRTRRWTKP
                     FPANSASWLQRPSVGTDGCAKCLVEPRKRASASALQLIASDGSSEARSLPWTGRCLLC
                     IELGAMVPFGDTPGGANNHDEERPSPDPSLADFFERLRVHVSVTKQQIVLVYFFEGTL
                     KEARELLERFPIMAEPDVLCTLCGTEIYQRGYVAPDPYWEQRMAAVGLGFDPKPIAWM
                     MRESFEKWLTPEFDEKLLSKRKLLTDPSAREVAYLEYSWRSDPDEAIDRAHLIESVQG
                     KMKEMGFEATRCIVSPLAGNLVLIPDEARMSKCLQFIMLMMRLTTADLVLVGSESSAL
                     LQDAVQVFESSDPVASLEALAPDVRKSQWTDLKPGATGSANAERANRGTLVLLPSASG
                     DVAVNFNAPDRCQVVKASQKGAAGIIEALLALGKL"
     gene            <593476..>595167
                     /locus_tag="CYME_CMJ218C"
                     /db_xref="GeneID:16993957"
     mRNA            <593476..>595167
                     /locus_tag="CYME_CMJ218C"
                     /product="aspartate--tRNA ligase, cytoplasmic"
                     /transcript_id="XM_005534883.1"
                     /db_xref="GeneID:16993957"
     CDS             593476..595167
                     /locus_tag="CYME_CMJ218C"
                     /codon_start=1
                     /product="aspartate--tRNA ligase, cytoplasmic"
                     /protein_id="XP_005534940.1"
                     /db_xref="GeneID:16993957"
                     /translation="MDVSAIAESVRRKLDERIPRTEWTEEERTWYKEDKKRRKEAEAA
                     LKKHVDLEGNVPSPSEEAVLSAQLESLKMDADAPAFGRYTLKALTTSSCGDDSVRRTW
                     VEAGTLGVAHPACATNQEVWLRGRVQTVRAQGSKVAFLVLRHQYATVQVVLVADSVPS
                     VTRDMVRWLARSGEVTPESVVDICGILVPAQVKSCTQNDVEVHARRIYLVSRARVPLP
                     FEIADASRRADEDGPHVHRDTRLDHRFMDLRVPAHQAILRLQSGVSTLFREWLVAHGF
                     TEIHTPKIIGGSSEGGAEVFRLRYFDENACLSQSPQLYKQMAICGDMRRVFEVGPVFR
                     AENSNTYRHLTEFVGLDIEMEIQESYHEILDVLEQLFQHIFEGLEQRFGAELSSIQRQ
                     YPFQPLRYKRGRGLRLTHRQAVDLLREHGEQVDDLVDFTSEQEKALGEIVSKEFQTDF
                     YVIDRFPAKCRPFYTMPSPDDSRYSNAFDVFMRGEEIVSGAQRIHDVDLLRQRITEKG
                     LDPATLQSYVEAFQYGVFPHGGAGIGLERVVMLYLGIGNIRECSMFPRDPKRLYP"
     gene            <596721..>599363
                     /locus_tag="CYME_CMJ219C"
                     /db_xref="GeneID:16993917"
     mRNA            <596721..>599363
                     /locus_tag="CYME_CMJ219C"
                     /product="similar to component of oligomeric golgi complex
                     4"
                     /transcript_id="XM_005534884.1"
                     /db_xref="GeneID:16993917"
     CDS             596721..599363
                     /locus_tag="CYME_CMJ219C"
                     /codon_start=1
                     /product="similar to component of oligomeric golgi complex
                     4"
                     /protein_id="XP_005534941.1"
                     /db_xref="GeneID:16993917"
                     /translation="MTMSDFLRIVWFLRNKNPAADHMIDALSFCGSLVSTRNTRKPGY
                     VHRCSVSPWRPKVEPTTSSIRYCVSIARSGSVMTSEKSATGAADRARASLPQLLHQAK
                     SLRAATGEAERVSEQQLQEQLAIFYEQVPKDFARVQEALRLLLQSRSEFFALLTLAKT
                     QAERLFSDTTELRRFDGHLRKVETALKLVEDLLALRQTAQTLQKLLQAPDVDTERAAA
                     LIAEFHVRLQQSAFHSQMDLFGSAEVAALQQQVEEARHQLRALVVYQAEQVLSSAASA
                     PEVPATSEHPMQAHIMRLHALGYVDDARRLLVQHTKAQALSRMSQRTASALEPETAHL
                     EELTALYEAIAETIAYTERSAQRFDSDDGKVILALEELANERGAEILQRFCDATKLAE
                     RCRQLNRRREANVKAATESVYRSHAGPVFDIEYAPLSNMAAIGDSRTGATAHDFDMTR
                     EQSETNELEALLEQIVVMSRRTAMFRHFMMTRLGLGNDFEQERRREGALYLKMQEVMG
                     MYVLLERALLDSEWKLAQRLEALPASGSAGEPPAASSETVSRAIDYTFYAIKRIIGRS
                     LQAFDPDALCASLNHVQALLAGPLLEHLRRSLPTHAALPSVFPSAQMVFGSSFRAEAL
                     EGLIKVANDARTSGSYLRHLVTVSVSRGLAEQQLPRSAALTAIISDLETTIEELRCVA
                     SQGVRRIFQTLVSNVLEQAATHAERLLLGASPTSGASNGSPYLVSESSFQPGPSAFVT
                     ELFEQMYRGGLDRILAQLEPENTAELVCLVSEWTRDRLDQAIRSRSLSMNALGGLIFD
                     ADVRYLVNRFAGLVLETQRANIRAIFRPLFHMALVLTVDRPAEVLDLWEQIRETQIPD
                     RVRQLLRMRVEFRAETIASLELPT"
     misc_feature    complement(598231..599685)
                     /note="possible transcribed region"
     gene            complement(<602338..>603018)
                     /locus_tag="CYME_CMJ221C"
                     /db_xref="GeneID:16993919"
     mRNA            complement(<602338..>603018)
                     /locus_tag="CYME_CMJ221C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534885.1"
                     /db_xref="GeneID:16993919"
     CDS             complement(602338..603018)
                     /locus_tag="CYME_CMJ221C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534942.1"
                     /db_xref="GeneID:16993919"
                     /translation="MNVTLGTGDGADFWVFGFGSLIWKPDIPFEECRDAFITGWRRRF
                     WQHSTDHRGTESYPGRVATLVLAEQPGERCYGRAYRVDNEAAADVLAYLDEREKQGYS
                     RLALPVYDARSAEQITKHALVYIAREDNPHFVRAADERQIPVLCRIIARARGPSGDNA
                     TYLFRLKESLDEIGVRDEHVDELVFGVRAELEALASACSESTPHGVAVAPTAASFDAV
                     PASSDDLR"
     gene            <603343..>604185
                     /locus_tag="CYME_CMJ222C"
                     /db_xref="GeneID:16993921"
     mRNA            <603343..>604185
                     /locus_tag="CYME_CMJ222C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534886.1"
                     /db_xref="GeneID:16993921"
     CDS             603343..604185
                     /locus_tag="CYME_CMJ222C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534943.1"
                     /db_xref="GeneID:16993921"
                     /translation="MITGETEPACVEDASQLAEQRNGAPVMEAGCAAVPVEANATKRG
                     YWRQRTLHSWFIGRKPQRTCIAVDIDEVLAFFVPELCAFHNKRYGTRLQATDFHSYRF
                     AEVWGGTDTDAIRKVHEFFRTPAFQELQPIPGAKQVLQSRLARFRFVVVTSRQLVIEQ
                     ETRAWLDKHFSGIFEAIYLGNQWALHPNGEHGTGVGSAAQEPQRLFANRRRKSQVCKA
                     CGAAVLIDDLPHNLLDCSENGVFGVLFDFQGQYGWSKSPAFESKDIAVVHSWEAVGEL
                     LDRL"
     gene            complement(<606237..>607151)
                     /locus_tag="CYME_CMJ223C"
                     /db_xref="GeneID:16993920"
     mRNA            complement(<606237..>607151)
                     /locus_tag="CYME_CMJ223C"
                     /product="similar to actin-related protein"
                     /transcript_id="XM_005534887.1"
                     /db_xref="GeneID:16993920"
     CDS             complement(606237..607151)
                     /locus_tag="CYME_CMJ223C"
                     /codon_start=1
                     /product="similar to actin-related protein"
                     /protein_id="XP_005534944.1"
                     /db_xref="GeneID:16993920"
                     /translation="MTAVDDVSAVVLETTSDRVRAGFAGSACPSCVRLLPELTTGPES
                     LASIQDAWRGSLVSIFGAGEAMSEDNRPAESESLGSERTPLLLVEPAQPWEQETRQEL
                     VRFAFETLHVPAVYLMRSAVATTFAWARKTALVLHIDRVGAVAAPVLEGYLLLNCLRS
                     DPLVGLPWPQRDSSTAEETRLPLKKVEAKLFPRLTRLVFDAIMAADIDVRRELFYNVI
                     VTGDGLSQLEEQALVQRLDETLGEVCPHLFRPRVVNASNEQLFHPGVSAAWVGASLCG
                     TLGVFHQLWVSRSDWEASPPSILEDRCP"
     gene            complement(607417..607983)
                     /locus_tag="CYME_CMJ224T"
                     /db_xref="GeneID:16993914"
     misc_RNA        complement(607417..607983)
                     /locus_tag="CYME_CMJ224T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461359.1"
                     /db_xref="GeneID:16993914"
     gene            <608137..>611250
                     /locus_tag="CYME_CMJ225C"
                     /db_xref="GeneID:16993915"
     mRNA            <608137..>611250
                     /locus_tag="CYME_CMJ225C"
                     /product="probable dipeptidyl aminopeptidase"
                     /transcript_id="XM_005534888.1"
                     /db_xref="GeneID:16993915"
     CDS             608137..611250
                     /locus_tag="CYME_CMJ225C"
                     /codon_start=1
                     /product="probable dipeptidyl aminopeptidase"
                     /protein_id="XP_005534945.1"
                     /db_xref="GeneID:16993915"
                     /translation="MNGLCAALMKPPMVWFVPPAGRLRRAPGWTRVAASATSHHRSEQ
                     LQRWRRHRHDALGLKALRASADETAPMPWDASKSGVIPYQKPPKEIQALVDADLDPVL
                     ALSPGEEIRYILELKRPPRSPIRNFALEELRLAGIRFYPATYTPARMTFFCGIGVREL
                     DAPDRTAWSFTGLASGQLDIGYVKWSPDGAQVAFCTFDRERGLDLWLADIATRSARCL
                     LQSGISLARELGIERQQTTDITQPALPERLRLNGIVSDPFAWCGNTGYLLVNLAVYDE
                     AQDQTADPLKTQRWQQAKRPTVPLGPTVQVYEAGRAAPARTIPDLLRDEFDMEIFELY
                     TTTQLALLDTRTGRMHSIGGAGVFRYASPSPDGKYLLVERIERPYSTSVPASRFPRTV
                     EIYDLVHRALTRTVAHIPAQEHVPLAFDATVSGPRAFGWRQDDVQRATLVWVEAQDQG
                     DPEQQVSVRDVVYCLRAPFSDTEERPRPLIALAKRFGGITWGDNTTAVVSETWYKSRS
                     IRTYLFEPAASLGGESAPSISEPTQLQCLFDIPDWEDAYRNPGNLVVKATPSGKLVLH
                     LVGPRRRQVLLTGSGASDQGNRPFLDLLDLDTRARWRLWQSAPPYLEYFLKVLEPRSS
                     ERVPRRLLISRESPTEPSNCYIIECMDPVPLPSGVSMDAWTAHTDQALSSDNGQQESP
                     VDQAQGNGDVAHDHHHAVRRRWRQLRQVTWFPHPAPSLASVQRQLVRYERSTDQVRLS
                     ASLYLPPGYDKTRDGPLPFFVWAYPREFLSADSAGQLRDSPYGFTHLARVPLYWLTQG
                     FGILEGPSMPIIGPSGEDANDTFIEQLVASARAAVAFLVSNGYADPQRIAIGGHSYGA
                     FMAANLLCHAPDLFRCGIARSGAYNRTLTPFGFQNEQRTLWQARDVYVRMSPYLYANQ
                     IQAPLLLIHGEDDDNPGTYPLQSERFFQALKGQGKIARLVLLPLESHSYQARESVLHV
                     LAEMDAWLKRWCAPAASSYTSMSPASIPTEMNTHNTAAADAGLGLSRTPTVPTHHEGD
                     TQGPGTL"
     gene            <613453..>614562
                     /locus_tag="CYME_CMJ226C"
                     /db_xref="GeneID:16993912"
     mRNA            <613453..>614562
                     /locus_tag="CYME_CMJ226C"
                     /product="mRNA-decapping enzyme complex component DCP2"
                     /transcript_id="XM_005534889.1"
                     /db_xref="GeneID:16993912"
     CDS             613453..614562
                     /locus_tag="CYME_CMJ226C"
                     /codon_start=1
                     /product="mRNA-decapping enzyme complex component DCP2"
                     /protein_id="XP_005534946.1"
                     /db_xref="GeneID:16993912"
                     /translation="MIDDKLQTVLVDLAARFLLNLPASEFESFERLFFTVEEAHWFYL
                     DFYRDHDKKLPALSLPEFASELFQQVDFLRPYVQYLEKHFADFQAYKREVPTAGVIAL
                     NQRISKVLLVRSWQRQHWSFPKGKIAKDETHLQCAIREFTEETGFDVSHYVLADTYID
                     AQLHGRPCRLFIAVGVPESAKFEPLARKEVSEVRWFPLLKLIRHVHARSEQDLQADWP
                     APARFHAVRPFLAWIREQCKRLRCTYGVKQGAGSSDLATRAACIHPGSVRDPVPAPVS
                     LPVQSRISGTEHGHSGYAADAQTHVRISGASAPFFTAMTTTTVGSSDTRWTSSAPDTE
                     VAWDPLEHFQLDQQQLLAIVDEAFGTVPRITADTR"
     misc_feature    complement(615157..616332)
                     /note="possible transcribed region"
     gene            <616349..>617470
                     /locus_tag="CYME_CMJ228C"
                     /db_xref="GeneID:16993909"
     mRNA            <616349..>617470
                     /locus_tag="CYME_CMJ228C"
                     /product="similar to mitochondrial carrier protein"
                     /transcript_id="XM_005534890.1"
                     /db_xref="GeneID:16993909"
     CDS             616349..617470
                     /locus_tag="CYME_CMJ228C"
                     /codon_start=1
                     /product="similar to mitochondrial carrier protein"
                     /protein_id="XP_005534947.1"
                     /db_xref="GeneID:16993909"
                     /translation="MSVVFTSTRPSKGAAAPVIDSSLGLRAPVPTVVPFRKLPRAALA
                     GGLAGAIVNSVLHPIDTIKSVRQADTWRRSQSTWSVFWQLVRESGPGALYRGVVPAVL
                     GAATSSAVYFGTYESVRALLVWYEQQRHCRAKTGSQATHSARDAHLVARSLSKRGLIH
                     MIAAASGNVVSSFIFVPKEVIKQRLQTGRESTVREVFAHQHLRGLYWGYRATLLRNVP
                     NAMLNFVLYEELKLRIGQLRTAVQQCMGGSRTQTTQTTEAFPTLDLLMAGSLAGALSS
                     TLTTPFDVLKTRFGTASSSAVASRSLMSLAAEILRQEGLGGLFRGVGTRAVWAGMFSA
                     IGFTTYERCKDLLVSHASSSKRNAHLQLSTGRRRRQRQQ"
     gene            complement(<617538..>618137)
                     /locus_tag="CYME_CMJ229C"
                     /db_xref="GeneID:16993910"
     mRNA            complement(<617538..>618137)
                     /locus_tag="CYME_CMJ229C"
                     /product="riboflavin kinase"
                     /transcript_id="XM_005534891.1"
                     /db_xref="GeneID:16993910"
     CDS             complement(617538..618137)
                     /locus_tag="CYME_CMJ229C"
                     /codon_start=1
                     /product="riboflavin kinase"
                     /protein_id="XP_005534948.1"
                     /db_xref="GeneID:16993910"
                     /translation="MFLRIPQPRAGANERAPERQVNRYRPSRKRPLLQLTEEPPQWNL
                     LSRPRHLAGPVIRGFGRGARKLGFPTANLDTRAPQVAEVLATLTPGVYAGYAAVLRPE
                     GAPWPGESVTDWYRAAVNVGYVPSFDNRELSIEAHLLHEFSEDFYGAQMHLVLLAYLR
                     PERKFVAIDALVAQIKHDIASTKRVLEELPFVPSACMFE"
     gene            complement(<623223..>624791)
                     /locus_tag="CYME_CMJ230C"
                     /db_xref="GeneID:16993911"
     mRNA            complement(<623223..>624791)
                     /locus_tag="CYME_CMJ230C"
                     /product="similar to GTPase activating protein"
                     /transcript_id="XM_005534892.1"
                     /db_xref="GeneID:16993911"
     CDS             complement(623223..624791)
                     /locus_tag="CYME_CMJ230C"
                     /codon_start=1
                     /product="similar to GTPase activating protein"
                     /protein_id="XP_005534949.1"
                     /db_xref="GeneID:16993911"
                     /translation="MESAQPLPLAESRALLTRLRARPENRFCFDCEAHHPTWASTSYG
                     IFLCIDCAGLHRNLGTHLSFVRSTLMDSWTPEQLWRMTAGGNERARSFFKAHQAPMSG
                     SLSQKYSSRAAYLYRERLSREAEQVRLAHQDTLGCVGVAPEPAPSTPSAPEQPLQSKR
                     SGQREAAVARQVVPETVDATQTELRTATTNGAGSGDRDAVPLQPSSSTSVGARTEERF
                     SQSTASTLSDDATRFVTASVAGNLSQTRTGASMNGAPNWTSRSAAPRRTGSHGLGARR
                     LGPSFSAGCKNTSTNMSNAVQIERPSGGSVSAGTAMACSASGSAALPQGSSRDASTPV
                     FEAQRTGTTPPRASLLTGTVVTETAVSGFVTATRQGAGIGDPPQRQLDIEAKGPPLAV
                     QPTRDSAQIAKQSVERAACESPQTSMASSADWRDKLRHAKAVSAADVRGQSDRMMVLQ
                     LADDTSASAAGAGPARISGNNAAWAVSSQARATPSRSPRTPTLETVGSVVRNVSKRLS
                     STVTELFEDLDRSA"
     gene            <625154..>626398
                     /locus_tag="CYME_CMJ231C"
                     /db_xref="GeneID:16993948"
     mRNA            <625154..>626398
                     /locus_tag="CYME_CMJ231C"
                     /product="similar to 2-hydroxy-6-oxohepta-2,4-dienoate
                     hydrolase"
                     /transcript_id="XM_005534893.1"
                     /db_xref="GeneID:16993948"
     CDS             625154..626398
                     /locus_tag="CYME_CMJ231C"
                     /codon_start=1
                     /product="similar to 2-hydroxy-6-oxohepta-2,4-dienoate
                     hydrolase"
                     /protein_id="XP_005534950.1"
                     /db_xref="GeneID:16993948"
                     /translation="MWISLAGPAKTLPALNGQARVHTRTFTQQRRDGQRRLAPVPPRG
                     VSAARCPLSMDERRLHASDRHDAKASASFRPKLECVPSQCFLPAAEVAAIRDERAQRL
                     IQRLQRVAADETICFYTNEPANLEDTKKPALVLIHGFDSSCLEFRALLPELERLLAPW
                     VRLFAVDVFGWGFGARPSGLDYGPAGKRAHLKRFLLHVVDGGVENLQTPLVLAGASLG
                     GAVLTDYVLHADAAERERIRAAIFIDAQLFVDGKGFRFLVPPLDYVGLWVLRSAALRQ
                     YANKLAFYRPSEHATEDALRISRLPCLMAGWMEASRSFLRANGYTISEEVAQLACFRL
                     PVLAIWGAEDRIVPLSTVERLRGFYRDQSCADLVQVDVIPECGHLPHLERPEQVASIM
                     DRYVREKLLAGDSATVHRSQLS"
     gene            <627185..>628336
                     /locus_tag="CYME_CMJ232C"
                     /db_xref="GeneID:16993941"
     mRNA            <627185..>628336
                     /locus_tag="CYME_CMJ232C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534894.1"
                     /db_xref="GeneID:16993941"
     CDS             627185..628336
                     /locus_tag="CYME_CMJ232C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534951.1"
                     /db_xref="GeneID:16993941"
                     /translation="MRRSVTRTKRGVVSTSGATSPLRTALEAAGTSPRVTPAPGDKPE
                     AFQGPRNRRTICHRLQESTKEASAGMLPVSTGATRPPTAADPRGQLPSATVASVCLDR
                     KPQPRRRLKRAVDELDSAQTQSERTDTLSMDRSRQSEEISPKRSNRDTRQTDDILSHV
                     TTDDGMHVPGTRGVTRVDLHPQRLPSGPGLQWNMPSLEKAAPTTSPDAASAANAASSG
                     ATSQELVRKLLEHESGWIRLTLGPTLPLSCQYLPLHGTAKLGRVEKLASGRYRLVFGP
                     DDKVNDDDENDHDRTSGGGDATSSAFYWLELGKLIAHPQRWWKLVRERNKKPAEDGNS
                     EGQAPQQHLIEAGEVDTEHAGRLEANVEVTGPYTLIGVPDLAHLYTTSR"
     gene            complement(<629789..>630895)
                     /locus_tag="CYME_CMJ233C"
                     /db_xref="GeneID:16993942"
     mRNA            complement(<629789..>630895)
                     /locus_tag="CYME_CMJ233C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534895.1"
                     /db_xref="GeneID:16993942"
     CDS             complement(629789..630895)
                     /locus_tag="CYME_CMJ233C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534952.1"
                     /db_xref="GeneID:16993942"
                     /translation="MTATAEGSVVPLNYGARINLRNYPNQDWIVFLGTATSEGVPRVS
                     CLTEQPVPQCHVCVDASERLHSPNRRRNTSLAIHRRRRTQAGRELLAGRTHETVVIDV
                     GKFFYQSAIDVFPATGLRQIDAVVLTHEHADATNGLDDLRDWTLNIGRRHGDGPLSIP
                     VWGDAATLERVHGAFPYLVEPSRATGSGLVPKLSFHQIEAYQRFYPTHPRSVNAANSL
                     QSDRLTPAPALAPAPDCISLLPVPVEHGRDQGCLGFRFGEVVYLSDVSYIPPKAMDAI
                     RGCRILIVDALHPGTGSHVSHFCEQQALALVTQLRPIYTFFTGMTHMWDHERDNARLA
                     AWSAAESRRMDGRPVHVALAYDGLCVPVDLEADR"
     gene            <631567..>633870
                     /locus_tag="CYME_CMJ234C"
                     /db_xref="GeneID:16993929"
     mRNA            <631567..>633870
                     /locus_tag="CYME_CMJ234C"
                     /product="vitamine B12-independent methionine synthase"
                     /transcript_id="XM_005534896.1"
                     /db_xref="GeneID:16993929"
     CDS             631567..633870
                     /locus_tag="CYME_CMJ234C"
                     /codon_start=1
                     /product="vitamine B12-independent methionine synthase"
                     /protein_id="XP_005534953.1"
                     /db_xref="GeneID:16993929"
                     /translation="MSIAHTLGFPRFGAHRELKQALERFWSGKSSLAELLEAGKAIRA
                     AQWSAESHAGLDFVTVNDFSFYDHVLDASAMLGVVPARFRDAKAADADLDVYFRMARG
                     RSQAGSSKADVPACEMTKWFDTNYHYIVPELEENQHFAISSRKLFDESAEALAAGYRP
                     KPVILGPLTFLWLSKSAGKEFDRLSLLSRLVPVYEEVLRSLDARIEWIQLDEPILALD
                     LPQAWRTAFPQTYQALARATQNRKLLVATYFGGILENLEIATALPVHGLHIDAVRAPD
                     QLDQVHQQWPRERVLSVGMIDGRNIWRTNLNEALKKLQPIYKERGDQLWIAPSCSLLH
                     TPVDLNNETRLDEELKSWLAFAVQKLEETHILKQALASGPDTVRAALDANAHAIESRR
                     RSPRTRNPLVRNRIANITDAMKRRSQAYAMRAQAQREKLKLPLLPTTTIGSFPQTAEI
                     RSIRRQYKSGKISEQDYVKAMRHEIEQVVQKQTELDLDVLVHGEPERNDMVEYFGELL
                     EGFAFTQNGWVQSYGSRGVKPPIIYGDVSRPAPMTVEWIRFAQSLTSRPMKGMLTGPV
                     TILQWSFVRDDQPRSDTAFQIALALRNEVSDLEAAGINVIQIDEPALREGLPLKASQR
                     DAYLKWAVDAFRLSSGGAAPSTQIHTHMCYAEFNEIIESIAALDADVISIESSRSRME
                     LLEVFQRFEYPNEIGPGVYDIHSPRVPSKEEISELLHAAARYIPVSRLWVNPDCGLKT
                     RGWPEVMESLANMVAVAKAMRAEYGKE"
     gene            complement(<635105..>635917)
                     /locus_tag="CYME_CMJ235C"
                     /db_xref="GeneID:16993940"
     mRNA            complement(<635105..>635917)
                     /locus_tag="CYME_CMJ235C"
                     /product="mitochondrial ribosomal protein L1 precursor"
                     /transcript_id="XM_005534897.1"
                     /db_xref="GeneID:16993940"
     CDS             complement(635105..635917)
                     /locus_tag="CYME_CMJ235C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L1 precursor"
                     /protein_id="XP_005534954.1"
                     /db_xref="GeneID:16993940"
                     /translation="MGILYRTLLRSQLRGVFAQHRTSFHPECRELKCPHPGLRTLSSA
                     HAHRTALADTYEEPRNLRDAIDACLVNARKRFDETVDLCVQLNLDVRKPEHNLRGLVR
                     LPAGVPKVPRVAVFTTLPSEAEEARAHGAALVGAAELVSHIQTNGITFERCLATPEAL
                     SYVARVARQLGPRGLVPSEKLGTVGVEIGDLVDMALSSVQFRTDAYGQVHVPVGKVSF
                     GPERIQDNVMAVVQHLLRVKPDTVRRRYLLGATLSRTQGPGIEVAVASMMDR"
     gene            636073..636195
                     /locus_tag="CYME_CMJ236R"
                     /db_xref="GeneID:16994195"
     tRNA            join(636073..636086,636110..636123,636151..636195)
                     /locus_tag="CYME_CMJ236R"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:16994195"
     gene            complement(<640662..>642605)
                     /locus_tag="CYME_CMJ237C"
                     /db_xref="GeneID:16993983"
     mRNA            complement(<640662..>642605)
                     /locus_tag="CYME_CMJ237C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534898.1"
                     /db_xref="GeneID:16993983"
     CDS             complement(640662..642605)
                     /locus_tag="CYME_CMJ237C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534955.1"
                     /db_xref="GeneID:16993983"
                     /translation="MSGTGNYYNVGARAVKPQRASRGSGAMRAFNEMGDQAPRQVPGA
                     VYVEEDFPALTRSNGSSVRGKSNINANAGGKPDATMTPEQSDSTGGATSASPEKERRR
                     ADAPSTDATSVSTGNSQEASTSGHARLRSTFSQSAPHMNAFYAPGSYMTMMSDMTAGM
                     GSHHESAALPYGVRMGEQFSQTMNAMPLLNGMGPGAHRTRQMRNGPRSGMNAVAHHVG
                     EELATCTLQIELKRFYFDLRANERGAFLKIAEAEAKGSRSKIIIPAYGLGQFKTILDN
                     MVAESRKEYQSEQRAEAPSTPATAAPESSEPPALPSSDAPSEADGDGQRGSEGSSDEV
                     DGQTSTPQKEREAVLAALGAEAVASGTPQSAVIEGQLVEIPATGLPTTLASATMRVET
                     KKYYFDLLSNAKGKYLKISQSAGSNKRSSIVVPATGLAAFRDSVHEMCRYAEMTLHLA
                     ANPNIMAFAPGAAPAIAYPMFPPGAGPPGMPSALYTSMGPPPPPPAAPGTAGAAPSVP
                     AAPVATSVPAASLAEAAACRRQHRRRNWPPVPPPPTPAPPTAAPTSGLAPVDMNLALG
                     NTSASLVHGPVQIPVDETSSVKVELVANQVGDTQQSTGTRAPTHLEITDPKNQRIRVP
                     LGSLAALHSVLGEWLQVAAAHPL"
     gene            <643373..>643723
                     /locus_tag="CYME_CMJ238C"
                     /db_xref="GeneID:16993984"
     mRNA            <643373..>643723
                     /locus_tag="CYME_CMJ238C"
                     /product="mitochondrial ribosomal protein L28 precursor"
                     /transcript_id="XM_005534899.1"
                     /db_xref="GeneID:16993984"
     CDS             643373..643723
                     /locus_tag="CYME_CMJ238C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L28 precursor"
                     /protein_id="XP_005534956.1"
                     /db_xref="GeneID:16993984"
                     /translation="MTKPSAALTMLRRFRGLYQGRHIRFGNQISHAENKTRRAWRPNV
                     HRKEFYSRVLQEPLRFTVTTRALRTIEKVGGIDEYLILTHERDMLGPDLVRLRARIVE
                     RVRELRLSENAAST"
     gene            <645416..>646273
                     /locus_tag="CYME_CMJ239C"
                     /db_xref="GeneID:16993978"
     mRNA            <645416..>646273
                     /locus_tag="CYME_CMJ239C"
                     /product="glucose-1-phosphate adenylyltransferase"
                     /transcript_id="XM_005534900.1"
                     /db_xref="GeneID:16993978"
     CDS             645416..646273
                     /locus_tag="CYME_CMJ239C"
                     /codon_start=1
                     /product="glucose-1-phosphate adenylyltransferase"
                     /protein_id="XP_005534957.1"
                     /db_xref="GeneID:16993978"
                     /translation="MTRSRLLQTARVFARRFAGHSQFANIKHKKAREDARRCKAFQRV
                     FNAIGAAVRAQGGDANPESNPRLATALEMARGVRMPKEKIAAALESAKGSGVRATGPV
                     SDLELVVYEAYLGTEPLLIECLTDNRRRTAPRLRHLLNEHGGTLAPDGAVLWQFNRVG
                     RVLIRCCPRFEQAWLDAIIDTGLVENLEHYRADAQPNGDKTNENEEYVELETAPELLS
                     ALEEHVRQLADQIRHESTFSMEIVSAELAWKRKSEAGTSEGSERPPELDELIQALEAE
                     DDVQRVISG"
     gene            <649255..>651429
                     /locus_tag="CYME_CMJ240C"
                     /db_xref="GeneID:16993976"
     mRNA            <649255..>651429
                     /locus_tag="CYME_CMJ240C"
                     /product="serine palmitoyltransferase"
                     /transcript_id="XM_005534901.1"
                     /db_xref="GeneID:16993976"
     CDS             649255..651429
                     /locus_tag="CYME_CMJ240C"
                     /codon_start=1
                     /product="serine palmitoyltransferase"
                     /protein_id="XP_005534958.1"
                     /db_xref="GeneID:16993976"
                     /translation="MATKTSLGERQLPEAGTVSGREPIEAEVAAAEELQLFVSNRGDG
                     FVSYLSQRSPTPVDLSSLQARDRSSEEDENEDEDLCNDDDELDSDDADVFSGVTASSA
                     GRLSSSPGSDALDVTSGATPVQKLSWRASSGSLRTPKTGSIETPKHRVTGVGSNASDR
                     WESERSATRKTPMSPARMKLATSARRIPQRYSMAAQYVSEVPDEMYAEVPLVAALITY
                     AMYAVVIVLGYLRDALSKILKRRRYAMIKPQGCAPLLSDFEDFYTRRLYRRIEDCWSR
                     PICSAPGAYIDVIERRFRTPKERELLLQKGILERWATKPPQLKPVELIREGTNEVIGW
                     IPQAPFTAALTYTGRVKRCLNLSSYNYLGYGEVPGGVDASVLETLDRYGVATGAARES
                     GCTAVLRELEQTVARFVGKPDAIVIGMGFATNSMIIPAIIGKGGLIISDELNHASIVA
                     GARSSGARIRVFRHNDAKDLERVLRSAIAEGQPRSHRQWRRILVVVEGIYSMEGAICN
                     LREIARVTRKYKAFLFVDEAHSIGALGERGRGVCEFTGVDPRDVDILMGTFTKSFGAV
                     GGYVAASRELVAHLRRTAPGALYASTMSPACAKHILFAMRQISGEDGTDIGRRKLTQL
                     RENSLYFRRRLLEMGLQTIGSTGSPVIPIMLYVPSVIAEFSRECLKRGLAVVVVGFPA
                     TPLILSRSRICISAAHSREDLDFALNVIEQVADLLKIRYLRK"
     gene            complement(<652223..>653767)
                     /locus_tag="CYME_CMJ241C"
                     /db_xref="GeneID:16993974"
     mRNA            complement(<652223..>653767)
                     /locus_tag="CYME_CMJ241C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534902.1"
                     /db_xref="GeneID:16993974"
     CDS             complement(652223..653767)
                     /locus_tag="CYME_CMJ241C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534959.1"
                     /db_xref="GeneID:16993974"
                     /translation="MSLSLVESVWLGTSAAQLSALVNFFHSEYLRVDSRNTFALSKSY
                     AVAVALNALPYAIVGVVLFLAALLVLTIRSCCCKQWWYKRSLRPGLRRHFVALGLVGL
                     ALIVITYGSLAIMFQAARGIDRSVSGTFKALISAGGELDNGATFIAQTVSNFSQAVSE
                     YVAAHGSTNGLECKSALSSLNQKAQTLESDAQLVAGADYRASNEGIYVVQYIFLAIVI
                     LLAVQVGVTYLALVLCQGHVRNCCAVFSRILALIFAGLVMGIAWVVVGLAVAAALALS
                     DACVSQNQLFQYMESQVKSFQQGQPAPPPPSGNAFIEVGLQCPVLNTLGKSYSQAISE
                     LKSIISDCRYIIESATGLSDSDYTQVTDQLVTQVEDLTNCTTMLRAVHRIGALSCGSQ
                     RDSDISSAFIVFVVGLVLAAIYIILYFLLVLDADLLVWAKMAPGRTVQPVMYQIYPLD
                     ASATPENQAASAPYSRFGGGADTLATIPDTSWAGAGKSTVTSLGGSENGGSEGVPRPS
                     APPPSW"
     gene            complement(654519..656207)
                     /locus_tag="CYME_CMJ243T"
                     /db_xref="GeneID:16993975"
     misc_RNA        complement(654519..656207)
                     /locus_tag="CYME_CMJ243T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461360.1"
                     /db_xref="GeneID:16993975"
     gene            <654668..>655447
                     /locus_tag="CYME_CMJ242C"
                     /db_xref="GeneID:16993972"
     mRNA            <654668..>655447
                     /locus_tag="CYME_CMJ242C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534903.1"
                     /db_xref="GeneID:16993972"
     CDS             654668..655447
                     /locus_tag="CYME_CMJ242C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534960.1"
                     /db_xref="GeneID:16993972"
                     /translation="MGHKSQGNGNRQIESDEYSLATKRDSSALGHKSRTVAERSYTHK
                     IQRERLLSGFLLAQVLFGCFLIVWSCWYLTSGSSFPATRYYYLDASKIYTLSYFEPLT
                     HRPFLIAAINGGYPLVNNIIRLVTGCMIVLAALLWIVLFYHFRHGHAFFWLTQLGITG
                     AAAASAGLDFHSTVEAYRICSRSSAQARCDGSPSSIGSFSLSEMYCECGTQGYYWALS
                     AVDAIVFFSALLSLVAAISAMVALRRRERGNRPPTPASVGW"
     gene            <657123..>660134
                     /locus_tag="CYME_CMJ244C"
                     /db_xref="GeneID:16993971"
     mRNA            <657123..>660134
                     /locus_tag="CYME_CMJ244C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534904.1"
                     /db_xref="GeneID:16993971"
     CDS             657123..660134
                     /locus_tag="CYME_CMJ244C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534961.1"
                     /db_xref="GeneID:16993971"
                     /translation="MPLLHRSEFRPQQPSSDLSPADLVFYYPDTGEVFREYADYLDHY
                     WLYASRIWSCSTTGKGGLTFREALLSERAAAERLEQRFRSSLYLEPLCRLVHHFAGRL
                     DDLVDAVAEIFQKSYVPGETYVDGGGKQASVRRVFIAHADTSDLEPVRYSPELARAVL
                     EKRFEFARIRYELEDGRILPAPLAVLNRKAPPVPKTLLKQKIREISSRDPWHGAPLVV
                     QNPVLVQQFQLPEALPTPEMQRAKAEYEERRMRLEEPAAESSAQAADVEKPREEPEPG
                     VTTEANKKRPGKQTEPELVDDLLVDHSADPPRPEPEQDFIVDRVSFGDVLMIWNFLNQ
                     FGKQVLMLSPFSLDDFEGALAYPPGHSPLIDAVFYALLRLLLSVSSDPACSRDLRDFV
                     ASSSKSGTLGLLRRTLSPASWPQVLVEMVRNMKLPPETRRLFTEQRQRIGTEQVGIAS
                     DGAGPTSKDAEVTEQAVVSTAPHRLPGSDGSIEPRDLEDDNSYNENDDGNNHDAADDQ
                     MLLWNEPRSPLVSNRVVEVVLTIMQHGYGQVPLSGRLVVLRALCEEAMATERVRRVLD
                     AILVERAEVARSTRQQLMEKRRVIREQIGEAEEALFAFEEAHGIRRDRGEHRAATQSD
                     AQCVSASMAEQQEEHSERKPHSNGKKSRPRSIGDALRTERAASLQSGEEGSYADDASQ
                     SGSEQDDDDGDDMDLGTHEESTSVYNDDDDGNDLEPGQRGSESQTGAVRSHPQRNRSR
                     LSGSISTTSVWNGSLVCAADDRPDLSSGDDASQYTPSTERGALQRVAQQSQAKLDEDR
                     KRHTDANGYLSTPDVKRLVRLSRQEALAAERERRAQERRQFEIEREHARLIARRRTLQ
                     KELRRERETYGEQMAAALSEYSVRTTPLGLDRDLNRYWFFHGEGRLFIEKQPNADEPP
                     VWSYYASKSQVDAFLLHLNTRGRRESALHRRILRSYNWIISAMRKRNQTMPTKRLWAS
                     ERPSRTRQAPESRLAWFRYENKLATETPTRT"
     misc_feature    complement(660313..661473)
                     /note="possible transcribed region"
     gene            <662260..>662598
                     /locus_tag="CYME_CMJ245C"
                     /db_xref="GeneID:16994058"
     mRNA            <662260..>662598
                     /locus_tag="CYME_CMJ245C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534905.1"
                     /db_xref="GeneID:16994058"
     CDS             662260..662598
                     /locus_tag="CYME_CMJ245C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534962.1"
                     /db_xref="GeneID:16994058"
                     /translation="MASGYSVHGGESRCYSFWLAFKRCMLESSDKSVCSSYRQDYEEC
                     LHHRKAIKRFNEVVREYQRRQANGEELPLPGQMPTAPVDAHETGSAGSAPKGSDGSTA
                     PEIPPEVMTP"
     gene            complement(<662595..>664079)
                     /locus_tag="CYME_CMJ246C"
                     /db_xref="GeneID:16993954"
     mRNA            complement(<662595..>664079)
                     /locus_tag="CYME_CMJ246C"
                     /product="trans-prenyltransferase"
                     /transcript_id="XM_005534906.1"
                     /db_xref="GeneID:16993954"
     CDS             complement(662595..664079)
                     /locus_tag="CYME_CMJ246C"
                     /codon_start=1
                     /product="trans-prenyltransferase"
                     /protein_id="XP_005534963.1"
                     /db_xref="GeneID:16993954"
                     /translation="MWCGLSRFFGHHHRSLYRSRLLRVCGLPVSAWHPAGCTTRSTHA
                     ETHQAFLSTLTPAGTELPGSALPDSAAGGLAFLKDEENRKHRALNRVAEAISGSASQN
                     VDSRQRRWANAARVPTQANGLPWSLASLASLLETRVSGVASSMDPFRLVEQHLQRLAA
                     EVLQAVAVDHPVLQRAAQYFFELPGKRLRPAVVLLMAQATCLQSLGTVSHAQLQLAMI
                     TEMIHTASLLHDDVIDESNMRRSASTVNALFGNQLAVLAGDFLLARASVCLAQLRDCD
                     VVELLSRVIEHLVQGEVLQLNDPGPEHARNGRSPNTPDDWPTFHAYMRKTWYKTASLI
                     ANSCRAVTLLNPVSRNQPQIVHAAAHYGDHLGLAFQLVDDAMDYSISSSNMGKPANKD
                     LMQGTITAPVLLAAEGPANVDALELHRAWQRRDKERVAELVRKGLGVEKTLALAAEHA
                     REAQNALVAPSTAADGISSAGALPPSPARDALCHLCECILARQR"
     gene            <666815..>669961
                     /locus_tag="CYME_CMJ247C"
                     /db_xref="GeneID:16993969"
     mRNA            <666815..>669961
                     /locus_tag="CYME_CMJ247C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534907.1"
                     /db_xref="GeneID:16993969"
     CDS             666815..669961
                     /locus_tag="CYME_CMJ247C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534964.1"
                     /db_xref="GeneID:16993969"
                     /translation="MALASNTLPTLPIEAALLTVLDVGIHGKRAAVPGKLLGLRTSAD
                     IESVVRRGELPFRERFLLVTAVSRDGRSIRISDGKNSILATCSERLSQEADVHGTVPF
                     PVSLRDRCVFMNGCVRLSAARDLESTITEPDAWDLAVREHAARLYGQWFRKTMLAGGG
                     TRPWTAFLQQVTIESFIRVEVELVNTQTTAWAFPNRMMTGDVVDVNQSLRVKRKLTQC
                     LIHLLAPIEYRDNVPAYAGSASAKTGVRGADALHELPCSDAVPSNETSGGYPRNACPV
                     EDAGSTTGAVPQAQHAPIPRPLALRMRLAAKQRPVEGSDDPMPQSEAADSCAPINSSK
                     CDGDVRAQAPPLRKNAKIGQSHEPLPDAMATESSGGTDQGSGASAKHAVHIENQIAAM
                     ALPKVDLAPTGSTWANVGDAEKSNTEAPESTVGGTSENALLRGKELRVLYNALEAMRL
                     PPSSLSALEDEHARGPVTEIGALGLAPAPISGPVSEQCASTEDDQIAPAVGSQQSQHT
                     ALTPGTPTACPTNDAVENAQRNLHSDLVCVTESVESDAVRRGAPPGANTIPSDGDDKN
                     DDAAQACQDHSDGRKPSSDDRIRSQKRMRISHLSCDRRSPEKPQESESVCTSTSRETF
                     QQDNNITNSVSTFEANLMNMSPVPRKRCKAIVPSSATRTPSDGPAHASNERQISPQDR
                     ADEATVRDSNGTAAVAIAPAFQDTANGTLPHRQSQRSRQTRNAAVTDGENTSGSLNAT
                     ALPPKNRRGKKPRRRAPQPIEETGHSSPGQGTRNSTFVGPSKACDSSQQALQRTQLEC
                     QLETAGKHSNQHESVPFDCARDQTSDSSTTTMTTQPPPTSPPSFSSTVPPDAQRIAVE
                     SPQLADSAASPAGQEHRGRKTRSERRPLPVHAQDRGDGACRNATCPAGDSTIDAHASP
                     LMTGERDRTHPVRGSARAADATACADGPKNAMQASGELHERRDAPSVPSDDLQSLVAN
                     GTPRMALLTAGTVQSKRSEEERSMSAAVTPVRSGHASPDTTCAQSALPPWARYLRNLG
                     RWRFFKGQKWRNDPRDPS"
     gene            complement(<670542..>671084)
                     /locus_tag="CYME_CMJ248C"
                     /db_xref="GeneID:16993970"
     mRNA            complement(<670542..>671084)
                     /locus_tag="CYME_CMJ248C"
                     /product="similar to cytochrome c-type biogenesis protein
                     ccmH"
                     /transcript_id="XM_005534908.1"
                     /db_xref="GeneID:16993970"
     CDS             complement(670542..671084)
                     /locus_tag="CYME_CMJ248C"
                     /codon_start=1
                     /product="similar to cytochrome c-type biogenesis protein
                     ccmH"
                     /protein_id="XP_005534965.1"
                     /db_xref="GeneID:16993970"
                     /translation="MSDPRNPAGTADQVDEKEILLNEKAKALFRAIRCLECGSGQNIE
                     FSNAPTAVALRDRVRKLLRDGLDSETIRDYLTQEYGQSVWFQESDIFWTDPVLRGLWL
                     GGALLGGLVGVTVLRRRGTLSLTSKTLASPRLLTKTQIRQLTQQIVGQRWRWSAAEER
                     TLQTILSPPAQQSGVTRKSP"
     gene            complement(672646..674344)
                     /locus_tag="CYME_CMJ249T"
                     /db_xref="GeneID:16993968"
     misc_RNA        complement(672646..674344)
                     /locus_tag="CYME_CMJ249T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461361.1"
                     /db_xref="GeneID:16993968"
     gene            <675037..>676059
                     /locus_tag="CYME_CMJ250C"
                     /db_xref="GeneID:16993960"
     mRNA            <675037..>676059
                     /locus_tag="CYME_CMJ250C"
                     /product="glyceraldehyde 3-phosphate dehydrogenase"
                     /transcript_id="XM_005534909.1"
                     /db_xref="GeneID:16993960"
     CDS             675037..676059
                     /locus_tag="CYME_CMJ250C"
                     /codon_start=1
                     /product="glyceraldehyde 3-phosphate dehydrogenase"
                     /protein_id="XP_005534966.1"
                     /db_xref="GeneID:16993960"
                     /translation="MAVPKVGINGLGRIGRLVLRAAVEKGTVEIVAVNDPFIFSDVSY
                     AAYSLKYDSTHGAFPGEIGTDGEHLVINGKKITCFAIRDPADIPWASTGAEYVVESSG
                     AFTTAEKASLHLKGGAKKVVVSAPAKDVPMFVMGVNHDSYTKDLQVVSNASCTTNCLA
                     PLVKILDEAFGIENGLMSTIHAVTATQRTVDGPSNKDWRRGRSAMLSIIPSSTGAAKA
                     VGKVYPKLDGKLTGMAFRIPVALVSVVDLTANLKTPTTYEEIKHVMKAAAENPEFKGI
                     FGYTEDPIVSADLAHSSYSSVFDAQAGIMLSPTFVKLVSWYDNEWGYSNRVVDLITHM
                     AKVDAA"
     gene            complement(675307..678313)
                     /locus_tag="CYME_CMJ251T"
                     /db_xref="GeneID:16993966"
     misc_RNA        complement(675307..678313)
                     /locus_tag="CYME_CMJ251T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461362.1"
                     /db_xref="GeneID:16993966"
     gene            <678537..>681083
                     /locus_tag="CYME_CMJ252C"
                     /db_xref="GeneID:16993967"
     mRNA            <678537..>681083
                     /locus_tag="CYME_CMJ252C"
                     /product="probable rRNA methyltransferase pmt2"
                     /transcript_id="XM_005534910.1"
                     /db_xref="GeneID:16993967"
     CDS             678537..681083
                     /locus_tag="CYME_CMJ252C"
                     /codon_start=1
                     /product="probable rRNA methyltransferase pmt2"
                     /protein_id="XP_005534967.1"
                     /db_xref="GeneID:16993967"
                     /translation="MARKHKVGKHRLDRYYHLAKEHGYRSRAAFKLLQLNRRHGFLGR
                     ASRGVVDLCAAPGGWMQVCRQHMPVAAPCIGVDLVPIAPIRNCTTIVADITSEKCVRL
                     IRNALTSFGEVLDPSGRVATGDLGVDVVLSDASPNMGTAWLQDAYNQVELTLHALRIA
                     STLLQRGGWFVSKLFRSADSEAFLLVARRLFQRVYVTKPPASRQQSAEIYVVCKSYLA
                     PARLEANLFDPRQVFRESTSHANAVADVASPDDARQRQQLQSKDRKFRRQLLSGRRSA
                     VPDDVEAINGTTKYRTCSLRTFLESSFPGIVLSTHNSIEIIEEDALPEPVRLLVNAEI
                     RALCKDLGVCGPKDFRRLFKFWETSRRVLFCAEKSQKQAGSTVPESGVSEEPMVDRSA
                     ASSTMASTTGREKRLEAKAARERARKLERQRQRGAHLDANANVDEDTGFSNLFSLREA
                     RAAMQTGYFEEVETSALESSALDSEQDGADASEESGSDAAGAHSESFVDDQTMSSDDD
                     GHGQDASVNLNMSADEPIQSDSDVDLDNEIQNAQQLVLEDDPNIPTQLKAGAQRWLHR
                     LGIRSLDALQIPDAADLLQASVLEAENASMLTDAHLSDSSTSSSSSTSSSEPAEGHGY
                     LGNTPAATHDQHQSTVTREDAISADAGTNTNKIRQLLGTMDERTRAELRTIARHYMLR
                     RSGREALIDSTYHRHAFDDPESLPQWFLADEQRARKAPQIVDPAEVDAAIAQLGAPFE
                     HLPKRVREARQRRQARLQRRLEAARERAEAIARAPEMNTASKIQQVARVMRRARAQRR
                     QRPVLAVLQGNRAVPLAGGHQKPKSRGRVRYKLVDRRLKADLRGRRKARR"
     gene            complement(682312..683922)
                     /locus_tag="CYME_CMJ254T"
                     /db_xref="GeneID:16993961"
     misc_RNA        complement(682312..683922)
                     /locus_tag="CYME_CMJ254T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461363.1"
                     /db_xref="GeneID:16993961"
     gene            <682350..>683633
                     /locus_tag="CYME_CMJ253C"
                     /db_xref="GeneID:16993962"
     mRNA            <682350..>683633
                     /locus_tag="CYME_CMJ253C"
                     /product="similar to mitochondrial presequence translocase
                     subunit Tim44"
                     /transcript_id="XM_005534911.1"
                     /db_xref="GeneID:16993962"
     CDS             682350..683633
                     /locus_tag="CYME_CMJ253C"
                     /codon_start=1
                     /product="similar to mitochondrial presequence translocase
                     subunit Tim44"
                     /protein_id="XP_005534968.1"
                     /db_xref="GeneID:16993962"
                     /translation="MWRPITSRQLSVLCWRLGSTALTRTSAARVNAGRRRPNELRPLL
                     RRPCTSETSTSAKPVSATARTSAAPEPRTTESASTAEVDQHTSSSSVAEAAPEAVQAY
                     RPGDRRPGWAGFFRGLFGGTQAAIEDTLAAEARRRGQLNDAEPVRASVQRAHRSRSAA
                     TSHATSTASAANREAGTALVPQGRVRSHDDDAQGDASTTTGYASVLNRIFSRFAGSPF
                     MRSVLEAKERVSERLDESDHPVVNVFRTIHDRFFAENEMAQVIGAIRTLDPKFTISRF
                     LVDIESRLIPTVLGAYLAGDLETLQEHCTEEAFAMMAASIHERRLSGIVMDTRILDLD
                     HVELVTGRFLDEEPVLIVQFTTQQIHCLRDLHGEVIEGAPDNIRAVYYVWALCPAFAG
                     EPAASAAAAAAAEDTTFTPTWRLMEMVVRGAHATI"
     gene            complement(<684077..>686755)
                     /locus_tag="CYME_CMJ255C"
                     /db_xref="GeneID:16993964"
     mRNA            complement(<684077..>686755)
                     /locus_tag="CYME_CMJ255C"
                     /product="similar to gamma-tubulin complex protein 2"
                     /transcript_id="XM_005534912.1"
                     /db_xref="GeneID:16993964"
     CDS             complement(684077..686755)
                     /locus_tag="CYME_CMJ255C"
                     /codon_start=1
                     /product="similar to gamma-tubulin complex protein 2"
                     /protein_id="XP_005534969.1"
                     /db_xref="GeneID:16993964"
                     /translation="MTCAETRQSTAALPLVSDELCFKIQKVLRSGNEIRGEKLAGSAA
                     DARSTVRFKVNATQQSLRPAGAVPASQTIPRKSATAHSETDTKGYARPVCGGRQAPAA
                     QDDAELGRFLALTGRGPQLRTWQRWRRFRQQLISLEPSWRIDRPYVDGSFRMLLADPA
                     SVLQPDTHHSANPCWMQVERQLLRDLQFALLGYPPSTKEVATVSLVGHGQSCGVRFHL
                     RRVVYGVPLPTATHALVQSILDIAGALCIVRDFAETCSFYNQGMVRQALGAALKRLLR
                     RYDALFLDHWGWTGSTSPSAEVPEQLKQEPPLTIQRLWIQLQPIQGAVLAISSMCLAE
                     RVRKQGGGALLCALYDLIDPAQVRWGVHNAVEASLDDPKALKEELFWAAFQPFWAMLE
                     QWLDHGVLSDPFDEFCVQRDTTQIGERLADDFNAAFWESGYTLRASHLPNMLQQVGTP
                     ILLAGKYQFASQSLEVMQQAVPGERPPVAIPMQVAPEAGSCRDASGTTGPQSLQCMTL
                     RITNALATASKSLVRALILDGNLMATLTQFKNCFLLGRVDFLDDVLSGVPGEILAGQG
                     AVAEVLASTPSAESVRTAFDRALGAGFRLQNTEPKSLVGHFSISFLPYSLSSQLLRVL
                     AVSSAAAPWSSAEAAELASLAHPTRTRDAQLCIIDAVSLDYHANWPYSVILNRRVITK
                     FQLLFRQLSSLHLCLRRLGSIRLQLQRARTVCHKFTGETRHAAILSPLYCSLLQQTIH
                     ALLYAMTWTTIETQWMRWQQTLDELGNSFRHAAKNSHEQSPRENRTSSVDELIRALNE
                     FLDASLYGCFLMKARSFRCVRQIVLHVHHYIAAVERCAGRLDPAFVVAEIRTLRAVVR
                     TLVGSVAPTHPLRAWYDSVAWPWCEPVMNCYVHQYP"
     gene            complement(<688969..>690039)
                     /locus_tag="CYME_CMJ256C"
                     /db_xref="GeneID:16993963"
     mRNA            complement(<688969..>690039)
                     /locus_tag="CYME_CMJ256C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534913.1"
                     /db_xref="GeneID:16993963"
     CDS             complement(688969..690039)
                     /locus_tag="CYME_CMJ256C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534970.1"
                     /db_xref="GeneID:16993963"
                     /translation="MVCDRCRGGKAQIQRLRDRHRLCKACFFAEFEREVHETIVHHDL
                     FQVGERIAIAISGGKDSVVLAHVLKELNERHQYGLELVLLAIDEGIHGYRDASLAAVK
                     RNSSALGLPLVSLSYDELYDGWTMDRVVSQIGRTNNCTFCGVFRRQALERGARHIRAN
                     KLATGHNADDMAETVFLNLVRGDSARLRHSADVMTGALANGGTSPDETVHWLPRVKPL
                     LYMYEKEIVMYAYWKRLDYFATECVYAPNAFRAFARDLVKELEALRPRAIIDTLTAAQ
                     ALSRHADGVSAVGTVTAVKQCARCGYVSSQVICKACILLEHLRRGTGKEATHRHATRS
                     VFSASDQTSCTESCAADQCKCP"
     gene            <691915..>695673
                     /locus_tag="CYME_CMJ257C"
                     /db_xref="GeneID:16993965"
     mRNA            <691915..>695673
                     /locus_tag="CYME_CMJ257C"
                     /product="single subunit mitochondrial RNA polymerase"
                     /transcript_id="XM_005534914.1"
                     /db_xref="GeneID:16993965"
     CDS             691915..695673
                     /locus_tag="CYME_CMJ257C"
                     /codon_start=1
                     /product="single subunit mitochondrial RNA polymerase"
                     /protein_id="XP_005534971.1"
                     /db_xref="GeneID:16993965"
                     /translation="MSERLRLLGRRVTLMDVLVQFTSRGRVPPAAINTVRRKVAHLGT
                     LALEYIGDQVARTKRWLRLSESLRDPAQPSCAGSRVWPSQGSTSTTETIYAEHARLRL
                     IQDSKFAASGTTANRGTALTGSRLARLERTPTSQVRVASTYVARNRRNAQVGGRCSPL
                     ARQAESTGLLYLNPTVARCRVLSVDGGAASLVSEAGSAAEETLPGTGRQVSQADDSSC
                     DLRCPETPACAEEAQQRGPGREAKHLASPTSAAPLAPQGERLSSENVREASAWSRAPE
                     RISEPASPELGLRGHNEAHGPAVCSLGGNASKRSTPSKPIAQESLFPVADGRPMRSSR
                     EPALIKTTGEPLSTQSAKEVANDEKLDWVELQQRIASDSGLYGNRHALGLERYLNAAE
                     LAEATRLGLPGTMRSSDGYLHDEMDYLREFNLEERAVEAAVARYRSFTQSALERGDIN
                     SLQPSQRLLLSWFFPVTMAIHQEQERIRRGELSYDGNVCGPHLLRLKPEVLAVIALHE
                     TLGRVLQDRAGVAFIRVASAVGRSVQAEINLQRLRELHSEQRHRQLPQDRALRRTLAL
                     ASTGSGGSRAVAAINLAAKRMELDTATWDDSVTIKVGSVLISFVMKHALIHIDTPTGK
                     QAVQAFRHGYRPLQREPRKVGVIELHKSVLNLLLANESDLRETILPRFQPMLVPPRPW
                     TAYNSGGYLRPRGLVMRVRGSRLQLEALKKGDLSEVFAGLNALGATPWRINRPVLDVV
                     EKLWRAGGDIAGLVARADLQLPALAESVVDPAPDGKESAASTESLSREQRRAIWRIRK
                     TNRERHALRCELHYRLETAREFADVSRFYLPHNLDFRGRAYPMPSHLHHMSSDVCRGL
                     LTFAGPGLRVGERGLFWMKVHLANLCGMDKLPFDERVAFAESVMPKVLAVAAAPTADS
                     NLEWWAQQEDPFQLLAACFELAAAKGGLDPDYHSTLPIQQDGSCNGLQHYAALGRDER
                     GGYQVNLLPSERPQDVYSGVAELVRERVAHDAREGVPIAQLLQGRISRKIVKQTVMTS
                     VYGVTLIGAREQIQNRLRELPDFPEEKTWEASFYLAKQTLGSLGDIFRGATDTMEWLA
                     ECALRVATSKERTNAVRWITPLGLPVIQPYRRREARLVNTVVQHVLLEAQNDHLPVSR
                     ARQRSAFPPNYIHSLDSTHMLMTALACRRAGLQFAAVHDSFWTHAATVDEMNRLLREC
                     FVRLHARDLLQELREQFQLRFPDVELPPVPPKGTLDLNQVLLSPYFFD"
     misc_feature    complement(695024..696358)
                     /note="possible transcribed region"
     gene            <696477..>697211
                     /locus_tag="CYME_CMJ259C"
                     /db_xref="GeneID:16993986"
     mRNA            <696477..>697211
                     /locus_tag="CYME_CMJ259C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534915.1"
                     /db_xref="GeneID:16993986"
     CDS             696477..697211
                     /locus_tag="CYME_CMJ259C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534972.1"
                     /db_xref="GeneID:16993986"
                     /translation="MRAGACRVLSVSLWDYKQAAGLLSNVMSAGWSSRNSLAFDPIRI
                     GDILRWDVKEPERLGLNLVVFKTFRTDVLSDLTGADLATELRLGAQFGTVQLLPSRAR
                     EDFYDDSEGEPRVRWYRPPVGSLTIRTRLSDIGGGEMRSRGALWFRARIDTDKCVWHY
                     GVEADRRIALSNWHDTRGFVNVKYMKKASEPEFTVTSQLGIEQYLRLGRVWALTRTGV
                     NPEGTLHVSLRDYGLRSKRAPARAKR"
     gene            complement(<698291..>698983)
                     /locus_tag="CYME_CMJ260C"
                     /db_xref="GeneID:16993987"
     mRNA            complement(<698291..>698983)
                     /locus_tag="CYME_CMJ260C"
                     /product="similar to prenylated rab acceptor PRA1"
                     /transcript_id="XM_005534916.1"
                     /db_xref="GeneID:16993987"
     CDS             complement(698291..698983)
                     /locus_tag="CYME_CMJ260C"
                     /codon_start=1
                     /product="similar to prenylated rab acceptor PRA1"
                     /protein_id="XP_005534973.1"
                     /db_xref="GeneID:16993987"
                     /translation="MGVPQITSNTVAPVERKVERGSYGATAPAAPAAAFASTESELIR
                     DSDPSLSTMWLPVDLSVQLTPKERLQLAWSAARPWREWAALHALAPPPPSSWLDWSAR
                     VRTNLELYAWNYLFVALVMFIVTGLFYPWSALLLISWLLLALYMGVRTADAVGGEDAS
                     LGARMFQNWPGYIRYILLGGLLTLMLFLTDVVALALTSASLAAAVTLAHAALHDPVAV
                     LSARNAEYTVAP"
     gene            complement(<700267..>702915)
                     /locus_tag="CYME_CMJ261C"
                     /db_xref="GeneID:16994014"
     mRNA            complement(<700267..>702915)
                     /locus_tag="CYME_CMJ261C"
                     /product="DNA replication licensing factor MCM6"
                     /transcript_id="XM_005534917.1"
                     /db_xref="GeneID:16994014"
     CDS             complement(700267..702915)
                     /locus_tag="CYME_CMJ261C"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM6"
                     /protein_id="XP_005534974.1"
                     /db_xref="GeneID:16994014"
                     /translation="MTEVLYSEGNAIYTQPRQPTLPAGADLEIRGLAGARGSAVAPEG
                     DQVAEELARLLLEFLEEFRLPDASGSWGSSPAQLPPVRTESPNRGRVVYVEALERLRQ
                     TEETTFVIDYRHLLSYNAELADALVDSFYRFEPYVRRALFEFVRKYAPGLEVDQAGRP
                     RMFWVSVCGLPHVRRLRELRSDRIGSLVAFSATVTRTSEIRPELLVGTFQCGECGHVV
                     VGIEQQNRYAEPPVCPSADCGNRTNWKLIVERSKFVDWQRIRVQEHSTEIPPGAMPRT
                     LDVIVRHENVERAKAGDRCIFTGTLVVVPEATMLAVPGERVEASLTRTSAARSRPDGA
                     PYGARQFGQRELNYRLCFVACHVLPQNDLFSSRNQSEWEALLERDPFGVGGVEADSAT
                     LLERMTPEERNEMMRMKHQPRLYQRLANSIAPTVFGHDDVKRAVLLMLFGGVHKKTNE
                     QIRLRGDINVCIVGDPSTAKSQFLKFVCNLMPRALYTSGRASSAAGLTASVVKDPETN
                     EFCIEAGALMLADNGICCIDEFDKMDLRDQVAIHEAMEQQTISIAKAGIQATLNARAA
                     VLAAANPVGGRYDRTRPLRSNIQMSPAIMSRFDLFFVILDECDEASDYNVTRYIVGLH
                     QHQQHAIRPEFTPEQLQRYIRFARTVHPQIPEESRALLVESYKQLRANDVFGGGAGGA
                     YRITVRQLESLIRLSEALARMHLDPIVRPKYVREATRLLRKSIIHIETEDVVLDDPVA
                     ETMTEAPASPERLPSTSASHGAPTTPAASSALRLPFQMYRLLANRVVLFLRSREAAEQ
                     IGVPENEIIQHMLRFRDETDEIQSEDELRLEAQRMRAVLHHMLNRDHILIQIQDQGSV
                     ALSQESQASSGMNRLLTVHPNYVLDD"
     gene            <705116..>707218
                     /locus_tag="CYME_CMJ262C"
                     /db_xref="GeneID:16994012"
     mRNA            <705116..>707218
                     /locus_tag="CYME_CMJ262C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534918.1"
                     /db_xref="GeneID:16994012"
     CDS             705116..707218
                     /locus_tag="CYME_CMJ262C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534975.1"
                     /db_xref="GeneID:16994012"
                     /translation="MRCGRRLIFVLLSVLLSFLGGLPVQVLVSSTDLDPFQYATRGEE
                     PANILSLISSQTIPREDEDIAAQEFHSGAFLESFDNEGVDAAVLSHEPARGTATKAYV
                     TRILNWRHELPAACALAYSIASVVYGIEDISRISAGDVELVALVESQRLPRSARFYLE
                     KCGYRVVPVQPQLGIPDFLRLPLASWSLTEYKAVIFIEPISLVLSPSVQELFHCGCFC
                     AAVQTGEYFSAGVFGLRPSLKVHSRMLEFLRRDVIGLDWPPAHYAEKHRHLFTEASRS
                     LGAFLNTYFRDFLRAPYFPQKIPAEHIDEDDMEYGELMRSCCDDPILLVSSLRLASDP
                     NSVCVRRLPIGYNGDPVFHGVFSNTRVIRFTVPLTPYAWWSAWVIGNKAAWRASRRAL
                     GSVRARFWAAGPPFLGPLMLGSGLMGLAAAIVVLLVSWREARHPFLGHWLATVLGTLA
                     NVQRNALIERGGQKRDRPFRFWSRLRTARRPSAKSTVDAGSCDPESSCRLERAPSSRR
                     SMWIRCMNLLVGNLCGLVGGLVLPATAWLMVPTYLPAPVGAALFASLCVALQHCTLSV
                     LRFYFQRRCFSQTIPPPPPQGAAFEGARHHASERDSSDTINAIEEKQSRGYPRLGASS
                     RHSAGLQRNAARPLLLPRYVHIAHFIWWIVAPQIPILFTRNIPRVITIWVSSLFIYDM
                     ICCLGFAFVLQSDAQESC"
     gene            complement(<707578..>709128)
                     /locus_tag="CYME_CMJ263C"
                     /db_xref="GeneID:16994009"
     mRNA            complement(<707578..>709128)
                     /locus_tag="CYME_CMJ263C"
                     /product="acyl-Coenzyme A thioesterase, mitochondrial
                     precursor"
                     /transcript_id="XM_005534919.1"
                     /db_xref="GeneID:16994009"
     CDS             complement(707578..709128)
                     /locus_tag="CYME_CMJ263C"
                     /codon_start=1
                     /product="acyl-Coenzyme A thioesterase, mitochondrial
                     precursor"
                     /protein_id="XP_005534976.1"
                     /db_xref="GeneID:16994009"
                     /translation="MLSVKRLQTVARISCVLCVDCRSDAARTVLTSAGAHVLRSCARS
                     TLYQQRCAYHPRMQDAITARAVAFPLYNAGSVSEFLDNERILGLGSDDAHPVQTATQP
                     SSPVGALGRAQRHPQRLHTRLQLSTSPALRSFYTNAWGSLRIGRVLEDLDALAGSIAL
                     RHVALPDINTVTACVDKIRILQHHQSEPTGISTESVKPARSAPPWSAIHFDLLYNGHL
                     FHVGNTSMTISCEVARADRDSTPFLEAVFVFVARDASGNKSIPVPGLLLATAADREAF
                     ARGEKLATERRKSRLQQHRHAGLAASTSHQSSRESLSEHASASGQSEKARLDSSTVAP
                     KSSANSVSIDETTMRTMHIVQPDVRNLFGFMFGGTVLLWSFELAYLTVLQHASMSLTV
                     SKESARQDAGLSIVPRLVAIGDIDFHRPIPVGSILEMRSSIAGVRGDRVAVRLSVRLW
                     SAGASPARIAFIEDANLITNTMTFLFQVPCMVSTSGISHTLRSVYPTTPEQAEESARA
                     LAMLESDT"
     gene            complement(709154..709225)
                     /locus_tag="CYME_CMJ264R"
                     /db_xref="GeneID:16994010"
     tRNA            complement(709154..709225)
                     /locus_tag="CYME_CMJ264R"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:16994010"
     gene            complement(<709646..>710320)
                     /locus_tag="CYME_CMJ265C"
                     /db_xref="GeneID:16994002"
     mRNA            complement(<709646..>710320)
                     /locus_tag="CYME_CMJ265C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534920.1"
                     /db_xref="GeneID:16994002"
     CDS             complement(709646..710320)
                     /locus_tag="CYME_CMJ265C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534977.1"
                     /db_xref="GeneID:16994002"
                     /translation="MRRSRLVLVCCAFQLLFLIAAGCRAYLVELSEASPECFYEDVLE
                     GDSLVGSFLVTTSDKKPVSVRVISHRGVPLFETSEPEGRFDIRVAEAGTYAFCLSRIE
                     ESSASVVLLRFEWQSVFSGLGERTNSERSLKELEAAAKQEHLEHMMNEIQSLYRAVLH
                     IRSKQSLSWWLRQQDLSIQRRAARHLLYAALLKLLVLVITTLEATRSMRHRLDAGGSR
                     LQIRGV"
     gene            complement(<712357..>713025)
                     /locus_tag="CYME_CMJ266C"
                     /db_xref="GeneID:16994004"
     mRNA            complement(<712357..>713025)
                     /locus_tag="CYME_CMJ266C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534921.1"
                     /db_xref="GeneID:16994004"
     CDS             complement(712357..713025)
                     /locus_tag="CYME_CMJ266C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534978.1"
                     /db_xref="GeneID:16994004"
                     /translation="MFTHCLRLNLTQRGLRNIPQFRTSCARNTFSTLKATVPGGDVTR
                     RALLTWLTVAVAGSLAPRACNAAAGTALTKKLYPKPGYNVEEQFEAPPLSEQDVARVQ
                     KQLAALREYRQAVSDISAKFEAAPDTYDVLGELERVFRYDTLRNVLNVVADTNFDEEV
                     QKRTDRLVRNILQDLSELETAARIRGNQGRRTPRKTDAVRKWLRTFSTDMDRLLAYYP
                     KAKA"
     gene            713201..715474
                     /locus_tag="CYME_CMJ268T"
                     /db_xref="GeneID:16994005"
     misc_RNA        713201..715474
                     /locus_tag="CYME_CMJ268T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461364.1"
                     /db_xref="GeneID:16994005"
     misc_feature    complement(713426..715184)
                     /note="possible transcribed region"
     gene            <715741..>716313
                     /locus_tag="CYME_CMJ269C"
                     /db_xref="GeneID:16994006"
     mRNA            <715741..>716313
                     /locus_tag="CYME_CMJ269C"
                     /product="similar to calcineurin B subunit"
                     /transcript_id="XM_005534922.1"
                     /db_xref="GeneID:16994006"
     CDS             715741..716313
                     /locus_tag="CYME_CMJ269C"
                     /codon_start=1
                     /product="similar to calcineurin B subunit"
                     /protein_id="XP_005534979.1"
                     /db_xref="GeneID:16994006"
                     /translation="MGANASTLLDDDITEIVASSSFSKDEIEQLYSRFQKLDRNGSGT
                     IDASEFLMIPELAMNPLVPRIVQLFDGVNFKEFVRLLSAFGKNAPREARIDFLFRFYD
                     VDGDGVVSEADVNSIFRLLVGENLDDATLRRIVRQAMLDFGAGLEALDGGDESEELNG
                     CSVQCRPLTREDFCRKLQNVELDRILQISV"
     gene            complement(<717145..>718821)
                     /locus_tag="CYME_CMJ270C"
                     /db_xref="GeneID:16994008"
     mRNA            complement(<717145..>718821)
                     /locus_tag="CYME_CMJ270C"
                     /product="cytochrome P450, family 710"
                     /transcript_id="XM_005534923.1"
                     /db_xref="GeneID:16994008"
     CDS             complement(717145..718821)
                     /locus_tag="CYME_CMJ270C"
                     /codon_start=1
                     /product="cytochrome P450, family 710"
                     /protein_id="XP_005534980.1"
                     /db_xref="GeneID:16994008"
                     /translation="MIETASLTRSTPVAAAEWVVSVARHCLRRADAALGIAGWGTASR
                     ALAYVALLVLGLAIAEQVRLRRWAGYGRIPGPRFVIPLIGSIVEMVLSPYGFWERQRR
                     LNPCGLSWNALAGFFVLFVTDTDLSRYVLSENGPHAFEMILHPNGWRILGRNNIAFKS
                     GEEHKLLRQSFLRLFTPKALGMYVSIHERLIGEHLAAWLSGRGTDGTAAAFEVRPRIR
                     DLNLRTSQTVFVGPYLRDRERFCADYLLITQGFLSFPLALPGTGLWRAIRARERVLRD
                     LTACVRASKERFRKDAEAEPQCLLDFWTVSVLEEVAAAKRENRAPPKYSADHEMADAM
                     LDFLFASQDASTASLVWTTVLVAERPDVLQRVREEQQRLRPHDEPITYELLEQMVYTR
                     AVVLEVLRFRPPPVMVPQVASKRVQLPNGYEVPRGALVVPSLWTACMQGFPSPERFDP
                     ERMLPPRQEEQKYRKHFLTFGCGPHMCVGRNYAINHLMCYLAVLATTVDWTRVRTVHS
                     DEIIYLPTIYPADSVIRARWRVADASTGAGTGAGTDTACTSEAVPVVVAS"
     misc_feature    complement(720205..721458)
                     /note="possible transcribed region"
     gene            complement(<723587..>725761)
                     /locus_tag="CYME_CMJ272C"
                     /db_xref="GeneID:16993999"
     mRNA            complement(<723587..>725761)
                     /locus_tag="CYME_CMJ272C"
                     /product="phosphoglucomutase"
                     /transcript_id="XM_005534924.1"
                     /db_xref="GeneID:16993999"
     CDS             complement(723587..725761)
                     /locus_tag="CYME_CMJ272C"
                     /codon_start=1
                     /product="phosphoglucomutase"
                     /protein_id="XP_005534981.1"
                     /db_xref="GeneID:16993999"
                     /translation="MVSIEDASTGMDCVTYGRLAPRCECGWFPCLAFTVNYTPKRATL
                     ARGTYWNPTRASSYLCQSAWRRRKFAGKREPNQTSRLERSKIRCSAIDWSDLFHQETV
                     VYEESTPLCVVQVPTSPIPGQKTGTSGIRKRTREVTQTPNFFENWFQSLFDVLVERYG
                     RTCLNRATLVVGGDGREGNQAALRTLLRIAAANSLQRLIVLGPDAIATTPAISAAIRA
                     AGALGGIALTASHNPGGVDGDWGVKYNMENGGPAPDSFTSLIYERTLTISRYLEVEAS
                     DPEALCGRDGFDGVNFKRIQTVHRFRILPEGARDALQSPNPDRLPHSDGGRTFEIHLV
                     DATATYVELMEGIFHFERLRALLRLPNFNMVYDAMYGSTGPFAFMIFGEKLGYWEYPW
                     FRRGQYLPDFGGVHPEPNLENLADLVAEFFSDEDSPDFGAASDADGDRYLILGRKFVV
                     QPSDSLAIMLDYALRPDFAAYCRFDGGLIRGVARSMPTSSAVDVVASRHNIRCYETPT
                     GWKYFCNLLDAGLVSLCGEESCGAGGAHIREKDGLWAILFWLSILAYHNLQVAPGSKS
                     TSVEDIVRAHWAHYGRNYYERWDFHGIERTTAERWMRNLERSVEGGEILSLRIDGPQL
                     YAADVFHYQDPVDGSWARNQGVRLFFSSDRRMRAVLRLSGTSSADATLRVYLEKYVAP
                     NDGDVQAVGELASSFVADIGRAALLYCGIVSELGRERPDLRA"
     misc_feature    724958..726608
                     /note="possible transcribed region"
     misc_feature    complement(725929..729164)
                     /note="repetitive element"
     gene            <730554..>731072
                     /locus_tag="CYME_CMJ275C"
                     /db_xref="GeneID:16993998"
     mRNA            <730554..>731072
                     /locus_tag="CYME_CMJ275C"
                     /product="retroelement"
                     /transcript_id="XM_005534925.1"
                     /db_xref="GeneID:16993998"
     CDS             730554..731072
                     /locus_tag="CYME_CMJ275C"
                     /codon_start=1
                     /product="retroelement"
                     /protein_id="XP_005534982.1"
                     /db_xref="GeneID:16993998"
                     /translation="MNNYRTIRLIPSIMKLLCAIPTNRTQRGLVERKFFAPEQAGFRS
                     HEECMSHALTLTEVVQRRSISGQQPAYVCFTDFQKAFDTVPHEAPFLKMERAQVSGKC
                     LAFFRALYADSWMRIRLGDRSRTPSRRIRRGLRQGERASPLLFNIFINDLLNNCRQYG
                     LEVPWIDCGDTR"
     gene            <733222..>733818
                     /locus_tag="CYME_CMJ276C"
                     /db_xref="GeneID:16993995"
     mRNA            <733222..>733818
                     /locus_tag="CYME_CMJ276C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534926.1"
                     /db_xref="GeneID:16993995"
     CDS             733222..733818
                     /locus_tag="CYME_CMJ276C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534983.1"
                     /db_xref="GeneID:16993995"
                     /translation="MELFRKMKACNGLLGFCSWYTDIGKLDSTLRQRRERLRCRVRRA
                     VVAGAAASSLDGSRTHARGTPGHRLVRGQMPAPKIGRPKTEVKRETFRMPEPVKEVEA
                     EAGAVRGRPKTKRVTDTEFVPMWKVILLGDKEYEEKHVIESLVKTIPKMDKEEARRIF
                     KEAQAVGESVVTVVAQEHAEFYATMLRRCSLYVRIEPE"
     gene            complement(<735395..>736477)
                     /locus_tag="CYME_CMJ277C"
                     /db_xref="GeneID:16993985"
     mRNA            complement(<735395..>736477)
                     /locus_tag="CYME_CMJ277C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534927.1"
                     /db_xref="GeneID:16993985"
     CDS             complement(735395..736477)
                     /locus_tag="CYME_CMJ277C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534984.1"
                     /db_xref="GeneID:16993985"
                     /translation="MEPGVVDLVRRAEKEGRYELLVFCTPGLQRSCLSRAVAGASVDL
                     VLEVDMEGDHFARRPHPSEHVEASIEARWVEQQKVLGDNLWNASKFRLNAIRVSCRHE
                     QGVVHRKFHLEVGATDYRAHQGTTLAPNALKAFRSAERGAPWCHLANAIGNAAILETA
                     DGKIVCQRRSSRLGEASGRWVLPGGHPEPSNVATSIDVTQGVWQEFLDAVKSELCDEL
                     NLPTCRVSDPVFLGLVRRKVDWRPTYACWCTTSLTSTEVEYLWMQGGKDTGESTMLYF
                     LKIPAHDDDLLFPTDSYAMFFEACGLRGQRAEHETDQRSPLFPNEMVEDHRGALCLYW
                     IQRLFVAELLPMSHDVCEYFLRPIPK"
     misc_feature    complement(736559..739319)
                     /note="repetitive element"
     gene            <741497..>742786
                     /locus_tag="CYME_CMJ279C"
                     /db_xref="GeneID:16993980"
     mRNA            <741497..>742786
                     /locus_tag="CYME_CMJ279C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534928.1"
                     /db_xref="GeneID:16993980"
     CDS             741497..742786
                     /locus_tag="CYME_CMJ279C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534985.1"
                     /db_xref="GeneID:16993980"
                     /translation="MRSLPPSGSRCSEDAMTWVQIVGTRADQVHFAPRPERCGRGAPV
                     SFTRPLLSRRRQQALMVRWCPARLCAGNSNGNQPKKTRAKQTFSPPPSTFYQALNQAV
                     EAVLAAVEAGERLLEIDFPPLPASVLNSTRSSSDDVIDANTRLAFDFAKMLQETTRER
                     RNGRSTYQRVALIYPDMIERNRAFAGDAAPKKPGSGYANRFGDTVGTADSRIRLAALR
                     AGYEAGNFIQRILQANIRDGDAGDRIEPILDDDDIFIVLGASAQELVDVEKFVQRLEE
                     TDKTRGDQRPVILFNMQLDTSRGDLGLPAFPSRMLHHRFLCRFLPVYYLRTRSYSRSI
                     SRPPFVVNYQGAIFRVYPEPYQVLLETQENRYRQVAQYATRPRLTEAKDALTKAVFPQ
                     QNEKDGGSFGFLRRGMQTATWWERASDDSSVSNKWRQ"
     gene            complement(742237..745270)
                     /locus_tag="CYME_CMJ280T"
                     /db_xref="GeneID:16993981"
     misc_RNA        complement(742237..745270)
                     /locus_tag="CYME_CMJ280T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461365.1"
                     /db_xref="GeneID:16993981"
     gene            <745403..>746476
                     /locus_tag="CYME_CMJ281C"
                     /db_xref="GeneID:16993993"
     mRNA            <745403..>746476
                     /locus_tag="CYME_CMJ281C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534929.1"
                     /db_xref="GeneID:16993993"
     CDS             745403..746476
                     /locus_tag="CYME_CMJ281C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534986.1"
                     /db_xref="GeneID:16993993"
                     /translation="MQTPSHGARPFGTLSYSQQRIHALKAELLRYRTAYRRLRSYVSR
                     INDLLEQRERALACSSRTRLFQAIEEKVVYGQYPDKENRDFSYLNTLEPVAPVQVEKE
                     SLLLEGTPATAFSVSPVCARAPRDGRAIMGGTLGGDVLDSCNRAYSEHASCTTVAKPE
                     SVDENSGQTAGSVRADDLVSPPRTGASPHTVHNPITVAASIENPGLQEEVHDCAQANA
                     VAKAPDSTQAPSEPPSKSGKPPTERAPARTQRRRQQQQERRRRRLPAICVEEVPNIWA
                     VNPEHPPGDRRSQSNALISCLKRVSRMLAGALGPSRRICHPSYSKIFALCGVSFGAGF
                     LSAVLTIQHVECSSGSARRSPRA"
     gene            complement(<747120..>748691)
                     /locus_tag="CYME_CMJ282C"
                     /db_xref="GeneID:16993994"
     mRNA            complement(<747120..>748691)
                     /locus_tag="CYME_CMJ282C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005534930.1"
                     /db_xref="GeneID:16993994"
     CDS             complement(747120..748691)
                     /locus_tag="CYME_CMJ282C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005534987.1"
                     /db_xref="GeneID:16993994"
                     /translation="MDDVEPFTLDEETTFRYLLLELPSKAFESAGLATPSTPSNESAK
                     LSESPLAPSPEVCLTPAPEASSSSVSYSSLKGGSWLLSDNLDLVAGKSQSPSVAHVKG
                     PWTPAEDALLLSLVAQFGIQAWTAVAACMPGRSGKQCRERWLNQLDPSVRRGAWTFEE
                     DEALVLLHARFGNCWAKMSKYLPGRTDNAIKNRWNSSMHRRWRAERSATLAAGRPWNA
                     ETAARLNLPRTSGDHASQVPRSLSLERLSASTATELHEIVSGPRKRIQRNSEPIPVGN
                     GKTCFCKTNEEYANTTQSSSQTIHSLCLDPSRQLSCSEAPQFPETYSSVQVSSSLETK
                     IGEMLPSSYSPVNRCMLTVAHSPLSRCSSSGSLTSLKDGVGKLRVREQLRARCASSRR
                     RTLSASGSDRYRQRPAEKTKTCPFMRMSEEDIAKEICTDMGRAHNFAAQETPCCDEVF
                     LKLTTCSADASELVSPLEFAPNEGLELANHTEIADVASALGTFDWNLSPAAEKGDIPK
                     DKEILDLDGWLLSGV"
     misc_feature    748991..749628
                     /note="possible transcribed region"
     gene            complement(<750743..>752413)
                     /locus_tag="CYME_CMJ284C"
                     /db_xref="GeneID:16993988"
     mRNA            complement(<750743..>752413)
                     /locus_tag="CYME_CMJ284C"
                     /product="cytochrome P450, family 710"
                     /transcript_id="XM_005534931.1"
                     /db_xref="GeneID:16993988"
     CDS             complement(750743..752413)
                     /locus_tag="CYME_CMJ284C"
                     /codon_start=1
                     /product="cytochrome P450, family 710"
                     /protein_id="XP_005534988.1"
                     /db_xref="GeneID:16993988"
                     /translation="MIRRPRYALDASGSSRVGGSVARHCLRRATLRWDRRLGYRQPCA
                     GVRCAAGARPRDRRQVRLRRWAGYGRIPGPRFVIPLIGSIVEMVLSPYGFWERQRRLN
                     PCGLSWNALAGFFVLFVTDTDLSRYVLSENGPHAFEMILHPNGWRILGRNNIAFKSGE
                     EHKLLRQSFLRLFTPKALGVYVSIQERLIREHLAAWLSGRGTDGTTAAFEVRPRIRDL
                     NLRTSQTVFVGPYLRDRERFCADYLLITQGFLSFPLALPGTGLWRAIRARERVLRDLT
                     ACVRASKERFRKDAEAEPQCLLDFWTVSVLEEVAAAKRENRAPPKYSADHEMADAMLD
                     FLFASQDASTASLVWTTVLVAERPDVLQRVREEQQRLRPHDEPITYELLEQMVYTRAV
                     VLEVLRFRPPPVMVPQVASKRVQLPNGYEVPRGALVVPSLWTACMQGFPSPERFDPER
                     MLPPRQEEQKYRKHFLTFGCGPHMCVGRNYAINHLMCYLAVLATTVDWTRVRTVHSDE
                     IIYLPTIYPADSVIRARWRVADASTGAGTGAGTDTACTSEAVPVVVAS"
     gene            complement(<755123..>755665)
                     /locus_tag="CYME_CMJ285C"
                     /db_xref="GeneID:16993989"
     mRNA            complement(<755123..>755665)
                     /locus_tag="CYME_CMJ285C"
                     /product="40S ribosomal protein S10"
                     /transcript_id="XM_005534932.1"
                     /db_xref="GeneID:16993989"
     CDS             complement(755123..755665)
                     /locus_tag="CYME_CMJ285C"
                     /codon_start=1
                     /product="40S ribosomal protein S10"
                     /protein_id="XP_005534989.1"
                     /db_xref="GeneID:16993989"
                     /translation="MLVSTPNRRDIYARLFSDGVLVARKDFASPEHMELKHIKNIEVI
                     KTCQSLRSRGFVREQFSWQHYYFFLTDEGIEYLRKWLNVPSDVVPKTLQAKAEPPRVI
                     GGFRGDRAGGYRRPGAPGERGFGERRGPGTFQSEYRSRGGPGGFRSFGRGGGNAPGAG
                     GRDVYRPPRAEPPVRGMEAP"
     gene            <756677..>759676
                     /locus_tag="CYME_CMJ286C"
                     /db_xref="GeneID:16993990"
     mRNA            <756677..>759676
                     /locus_tag="CYME_CMJ286C"
                     /product="polyadenylate-binding protein"
                     /transcript_id="XM_005534933.1"
                     /db_xref="GeneID:16993990"
     CDS             756677..759676
                     /locus_tag="CYME_CMJ286C"
                     /codon_start=1
                     /product="polyadenylate-binding protein"
                     /protein_id="XP_005534990.1"
                     /db_xref="GeneID:16993990"
                     /translation="MEDSRGSSADATGLSTMIRDLSLNSGSGSKQNSTSTGVGVAGAT
                     GAPASGETSSRKTSPMSYASAAQQSGAESGVLGGTAGGPYAASAAAQTARAPSASSTS
                     SISSGGGSKGPGGALQAAGESIPPAQSVSGAGAAGFGDGSVAGFALNGMSSLPASGAT
                     AVPAASASGTGELPNVSLYVGDLQPDVVEQNLFELFSSVGPVVSVRVCRDVVTRRSLG
                     YAYVNFQNPEDAERAIDVLQFYEGPLTKNKPIRIMWKRSDPSQRRNPEGNIFIKNLDK
                     SIDNKALYDTFSTFGKVLSCKLATDDKGNSLGYAFVHYQDANVAKYVISKMNGMLLNG
                     QKVYVGEFRPRREREATGELSTKFTNVYVKNLDESLCTTEEVTKLFAPYGNITSIFIP
                     TETVQEQQPHHEDEHRAPSEEASSEAGRQGGSSQEVKSAGADQSNAAPDLETSERNDG
                     AKAPENRAHAQSVVRVRPRGFAFVNFETPEQAAAAVEALNGMELNGKTLYVGRAQKKA
                     EREAMLRAQMEQLRNDRMQKLQDVNLFVKNLSDDVDENRLREEFSRFGTITSLRIMRD
                     EKGVSKGFGFVAFSHPDEAIKAVTEMNQRIVGQKPIYVALAQRKDQRRAQIEAQRAAM
                     MRAQMSFLPPGLAASMYVPGTGMPTPSGYPYPYAVHPMQMQMSMGMSRAMSAMPGGAA
                     SGAMTYGGFAMQPNMAVGASGIPRMNMTSPNMTNAAPASAGSIPMGGPNAAMLMQGRI
                     PYATVGSQQPMTSTLGSGQVLQNSGAPGAVVGVPGSANAEAGATAAASGHPNPNFAAS
                     GVAGRAGPRQARMAARMGPASGPMPGVSMPAMASGLPTGLGAPGMGYKMGGAMRAPPG
                     GTMAGMVAMSPMTAGAGNTVPSGAMGNMMIGSAASQPLTVQMLANADPKQQKQILGER
                     LYPLVYQQLVREGKRELAPKITGMLLEMDNSEVLHLVESPEALQEKVEEALEVLQQHL
                     ASLQAKAAQHTSAQQGLSSTAPSNSSA"
     misc_feature    complement(759623..761339)
                     /note="possible transcribed region"
     gene            <761637..>763709
                     /locus_tag="CYME_CMJ288C"
                     /db_xref="GeneID:16993991"
     mRNA            <761637..>763709
                     /locus_tag="CYME_CMJ288C"
                     /product="similar to DNA photolyase"
                     /transcript_id="XM_005534934.1"
                     /db_xref="GeneID:16993991"
     CDS             761637..763709
                     /locus_tag="CYME_CMJ288C"
                     /codon_start=1
                     /product="similar to DNA photolyase"
                     /protein_id="XP_005534991.1"
                     /db_xref="GeneID:16993991"
                     /translation="MALKHEVFQRAVLESHVEPERVRLLNQCTPNTATGTYVLYWCTR
                     SPRAVHNEALEVAKSLARLVRLPLVCLNVIDLEEALEGSLRHVLFQLEGLVDFKRGLV
                     KRHGLSPDAIHTRLDPALSVVTRLDPTGASSATSRTGEESVPYTPESPPASTTIVGGL
                     SVLGGAAPALVGGREAPVTPQICSFEGFASRAYAIVTDRGHLRYQRARAARVAALAGR
                     PLLEVETSLIVPVETASVREEVVASTFLDRMGSGLGERYLHELRPSPPLEPAPANVLA
                     DLHTLGYWPFPQVDQGWSAETWLSSVNRTHLLEVLRYHGVDCDAPIISASAYRGGETA
                     ARRLLSVFVARKLYGYAVKAEHQNEALRAEYGSLLSPYLTFGHISPVYVAIKVHRAAA
                     ERELDEHGGRMRACDSAERVVASLEKHHGEDTGDSGESFPSQAGTASPGCTSEEAFLL
                     GSASSMLSIGSSAKRTLTTADTLTLRAAVEIASQQPDVRKFMENMYRRELAYNFVMYN
                     KRYDSFDGAVPVWARRSLYDRASRRTSHYQYSETDWYNARTHNMRWNAVQRELLTRGR
                     NICRDRNYWCQKILEYENDPAHAFELAIRINNHLMLDANDPVGYATCAQCFGRWQQPV
                     TRASTFPGRDRDPAPEAAFGEQLGLVPELYTLRTDEQWRAAETLAEMIDQRLEIVPIP
                     ENDTVDAY"
     gene            complement(<764404..>764802)
                     /locus_tag="CYME_CMJ289C"
                     /db_xref="GeneID:16993992"
     mRNA            complement(<764404..>764802)
                     /locus_tag="CYME_CMJ289C"
                     /product="60S ribosomal protein L32"
                     /transcript_id="XM_005534935.1"
                     /db_xref="GeneID:16993992"
     CDS             complement(764404..764802)
                     /locus_tag="CYME_CMJ289C"
                     /codon_start=1
                     /product="60S ribosomal protein L32"
                     /protein_id="XP_005534992.1"
                     /db_xref="GeneID:16993992"
                     /translation="MPEPLEHVRVVKKRTKRFRRHQSDRFKRVKESWRRPKGIDSAVR
                     RRFNGKTLMPNIGYGSARKTRHMLPSGFFPFLVHNSKDLECLLMHNRRYCAVIAHSVS
                     ARKRAAIVKRAAALDIRVANALGRLEPVES"
     gene            complement(<767779..>768021)
                     /locus_tag="CYME_CMJ290C"
                     /db_xref="GeneID:16994013"
     mRNA            complement(<767779..>768021)
                     /locus_tag="CYME_CMJ290C"
                     /product="retroelement, dead"
                     /transcript_id="XM_005534936.1"
                     /db_xref="GeneID:16994013"
     CDS             complement(767779..768021)
                     /locus_tag="CYME_CMJ290C"
                     /codon_start=1
                     /product="retroelement, dead"
                     /protein_id="XP_005534993.1"
                     /db_xref="GeneID:16994013"
                     /translation="MERAGVSGKCLAFFRALYADSWMRIRLGDRSRTPSRRIRRGLRQ
                     GDPASPLLFNIFINDLLNNCRQYGLEVPWIDCGDAR"
     misc_feature    769716..773062
                     /note="repetitive element"
     gene            773039..774389
                     /locus_tag="CYME_CMJ292T"
                     /db_xref="GeneID:16994029"
     misc_RNA        773039..774389
                     /locus_tag="CYME_CMJ292T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461366.1"
                     /db_xref="GeneID:16994029"
     gene            complement(<774042..>775511)
                     /locus_tag="CYME_CMJ293C"
                     /db_xref="GeneID:16994031"
     mRNA            complement(<774042..>775511)
                     /locus_tag="CYME_CMJ293C"
                     /product="citrate synthase"
                     /transcript_id="XM_005534937.1"
                     /db_xref="GeneID:16994031"
     CDS             complement(774042..775511)
                     /locus_tag="CYME_CMJ293C"
                     /codon_start=1
                     /product="citrate synthase"
                     /protein_id="XP_005534994.1"
                     /db_xref="GeneID:16994031"
                     /translation="MGDERSASLTVRVSVKNGTQSPDEARECEVLESATEPTIAIAAR
                     DVALTVQEATGTHTVCYDSGYLNTVMARSSITYIDGEQGIMRYRGIPIEQLAEQSSFL
                     EVAFLLIFGDLPSKGQLDQFSKLVADHSFLHTDICDYMRSFRYDAHPMGIFISSMAAL
                     ATTIPAGDLQQLDKHIYRILGQASTIAANAYRHRIGRAFNEPRMDLGYTENFLYMLDR
                     LSERDYRPHPAIVRALDILWIVHADHELNCSTACMRHLTSARVDPYTAISGAASALFG
                     PSHGGAAEAVVRQLERIQTIENIEPFLERVKAKEERLFGFGHRVYKSFDPRARILKEQ
                     VEKILELVKVEEPLFLVAKELEQRALQDEYFRARRLYPNVDFYSGVIYRALGFPTDFY
                     PLLFAIPRIAGWLAHSREAQLAEAQLDVREHTHVVRPAQVYTGSAPRPFVSLEAGDRP
                     PYQGRDIECYRTRLSTRRRLGLLSDSSASEHTQHTHARV"
     gene            <776010..>776516
                     /locus_tag="CYME_CMJ294C"
                     /db_xref="GeneID:16994032"
     mRNA            <776010..>776516
                     /locus_tag="CYME_CMJ294C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534938.1"
                     /db_xref="GeneID:16994032"
     CDS             776010..776516
                     /locus_tag="CYME_CMJ294C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005534995.1"
                     /db_xref="GeneID:16994032"
                     /translation="MQPDKEVRGTEAVDAASSSPSRDNRSKEQMIEDALNCPCVESLK
                     EGSCGGAFIAAYRCFLESEAEPRGSDCYEVFQRMQDCMLAHPDEYHFDDREEEEAELE
                     RRSSSVENGRSVVVNPEPLPAPASAPPSTGRDPSESLEGARTRAVVAAASSTEDGQSK
                     PEQGARSR"
     gene            <780246..>781088
                     /locus_tag="CYME_CMJ295C"
                     /db_xref="GeneID:16994038"
     mRNA            <780246..>781088
                     /locus_tag="CYME_CMJ295C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534939.1"
                     /db_xref="GeneID:16994038"
     CDS             780246..781088
                     /locus_tag="CYME_CMJ295C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534996.1"
                     /db_xref="GeneID:16994038"
                     /translation="MNVWLLGRGELRRRHDDVLQLERAFLTDRTGLHFVNARSSEDLL
                     ALAESRRAEQQWPVLDAEWISPVGTDTCDDLVWQNLESTLDGRPDTFYSTAGFEAGNT
                     LSGTGELAPGEAFLAYRFWRPVRVYAVQLRAFQADFHPGRPVYPFQVARVGVGCSLQA
                     GMSLSYGADASAPGTSCNYRCFCTTEQQTLVFDDPMVGVYLVICLKGFPQQQLTDRLH
                     YAAVSGIRVFGEPISSPALENELSCLISRGFILDGRDAARWLDLRSAQEHAAPMHIPE
                     DEVI"
     gene            complement(<781985..>782614)
                     /locus_tag="CYME_CMJ296C"
                     /db_xref="GeneID:16994028"
     mRNA            complement(<781985..>782614)
                     /locus_tag="CYME_CMJ296C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534940.1"
                     /db_xref="GeneID:16994028"
     CDS             complement(781985..782614)
                     /locus_tag="CYME_CMJ296C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534997.1"
                     /db_xref="GeneID:16994028"
                     /translation="MTARSKKIASSCLFILFLLAFEGLALIFDPKSSSSTTETCVLES
                     LYTGQRVRAAFYPLQWERTRVRAWVSTLDGRKRLETAKGPAAELVFQAPDDGDYCFCW
                     VAEPPAASVRFGISAPHFPELEALLKKGQLKRFERSVLTLAQTLEDLKYRAQHALHED
                     LRTKGKLRQSMRRLRVMTLVEMMVLFSTLGWRVWRVKSMFRERYRGTAR"
     misc_feature    complement(782709..785764)
                     /note="repetitive element"
     gene            <786073..>787134
                     /locus_tag="CYME_CMJ298C"
                     /db_xref="GeneID:16994026"
     mRNA            <786073..>787134
                     /locus_tag="CYME_CMJ298C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534941.1"
                     /db_xref="GeneID:16994026"
     CDS             786073..787134
                     /locus_tag="CYME_CMJ298C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534998.1"
                     /db_xref="GeneID:16994026"
                     /translation="MRPTEKTFHFRRRSESPAGGAAKLPARSDSEQRSCGVQNENRAV
                     VVAGEAAATSVCAEPCAGDKSSVGIQKRHGEQQSTGVVRGLEAVVSANGLLCERIPRD
                     IAQEVRLLRLCEWFALASLDGFRQRLVASQDLYQKTAGLECVSENELCCCIALFEGAV
                     STFLKDIEERFVTPNRLLTSAPPDTPESEERPRLEELTFADVNRLLQRPMRPNKHNQR
                     MRKSLSALTALEALYDREIAGWEDVQNFLHDENQEAMESDEACALSPVDSTQTDQALH
                     DIRDHQKRLEENILLHLDQLERHLQRLFLRYQAADEFCLSTARRINSDAFAGLVDIGE
                     TRKLLANAPSAVWLEQAEA"
     gene            complement(786631..788140)
                     /locus_tag="CYME_CMJ299T"
                     /db_xref="GeneID:16994027"
     misc_RNA        complement(786631..788140)
                     /locus_tag="CYME_CMJ299T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461367.1"
                     /db_xref="GeneID:16994027"
     gene            <788336..>789697
                     /locus_tag="CYME_CMJ300C"
                     /db_xref="GeneID:16994015"
     mRNA            <788336..>789697
                     /locus_tag="CYME_CMJ300C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534942.1"
                     /db_xref="GeneID:16994015"
     CDS             788336..789697
                     /locus_tag="CYME_CMJ300C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005534999.1"
                     /db_xref="GeneID:16994015"
                     /translation="MEPQTVQELELSYGARELIHKTAEFVRKHAGTDVEQRLLAREPS
                     KFAFLQEQHPWHNEYLRALLGEAADVVTPPQADACAAKATGNGDVITTVTSDAISFEQ
                     YLPYKDFFPALRSANLVLALGGTLEEWRTRRRELLCAPTASELQVMRLVASHMALRVF
                     CSALPPQQRETEAPASASPIADDLRCCSDICSGEKRGLSSELQRELLSLLEKQPRLLA
                     FLLPQHVYHPIFHRFLEASADLLHTAVNGAAFESMLGKLESFKDDEWAVFAAARQWVP
                     RDRYAAPDSGEQLTFHERVSRAFALGAVRRPRKLGTLAISERIPELQRLSQGVPPVAA
                     RTSYPKSIPAPGKRKPNMASGPAATGQPPFKRSMVTPRTSTTSRVDARASATSVPQRP
                     HHRAETQAISDPRAAPLRPEHPRTQQTRGWQNQSPREMQRGGSAQRRPMNPSPPFNGH
                     HTR"
     gene            complement(<790679..>791662)
                     /locus_tag="CYME_CMJ301C"
                     /db_xref="GeneID:16994022"
     mRNA            complement(<790679..>791662)
                     /locus_tag="CYME_CMJ301C"
                     /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
                     /transcript_id="XM_005534943.1"
                     /db_xref="GeneID:16994022"
     CDS             complement(790679..791662)
                     /locus_tag="CYME_CMJ301C"
                     /codon_start=1
                     /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
                     /protein_id="XP_005535000.1"
                     /db_xref="GeneID:16994022"
                     /translation="MKASRTSRHATPNKPPDSVLLCSMLVTQLACQHRVPAVLLTDGI
                     DFSVYPTNVPLPQETAHDSMHIRQGALHCIGANTVAAAALERCENSAQAWQVLMASRA
                     RRALGDALVSKISKKCLAVGRNYVEHAKEMGHEVPSVSQEPFFFMKPTTCYLREGRPI
                     LLPIGSEPEHEVELGLVIARRCKRVPRDAAFSFIAGYLVCIDVTARRWQREAKAKGLP
                     WTLAKSADSFLPMSRFIRREEVHDPQRLWLWLKVNGQLRQRGCTVDMVHDIASLVHYA
                     SRWMTLEEGDIILTGTPAGVGPLLHGDIVEAGIEELVSMKFVCETDTGSPI"
     gene            <791703..>793094
                     /locus_tag="CYME_CMJ302C"
                     /db_xref="GeneID:16994011"
     mRNA            <791703..>793094
                     /locus_tag="CYME_CMJ302C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534944.1"
                     /db_xref="GeneID:16994011"
     CDS             791703..793094
                     /locus_tag="CYME_CMJ302C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535001.1"
                     /db_xref="GeneID:16994011"
                     /translation="MTRRLRTSRNSREQKPQASRSQAARHGESTTSDALACLGPDADD
                     AFFAARSRGAGTPASALNPPSDCGEPEHHAEDLDAENRAPSGDRLPPEGGPGAMQSTG
                     EHGVCAAHSPETPAVTAPTSAGSWDALDEDQQRHLVSTVTRFLLVREQSRIPVLKRDI
                     TSLVAETLGVPAGPRGRFPTWLTTLRNAALERAAQMLLFDLGFRVLQVGRLPLGEHAR
                     GRTRQAARGLTLTVAPYHFYQERCLVEGAPPSLDEAPPGNDGMPSDLLLLVSDLPPKL
                     RPQPRSIAFSGLLMVLACLFGLSDTGMIQEKELFNSFARIGLMTVHNNSQATREAALP
                     AHTHNGDYVPETNPLRGVPANDADPDATGAVSGDNVWFHGYQRKADIHKLLTLYLPKM
                     LYLQRFRLNIADSEWTYAAGPRLRAELPPESLFELLCEFFGEDADEGAATNLRRRLLP
                     DQPVMLNASRAES"
     gene            complement(<793196..>794404)
                     /locus_tag="CYME_CMJ303C"
                     /db_xref="GeneID:16994018"
     mRNA            complement(<793196..>794404)
                     /locus_tag="CYME_CMJ303C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534945.1"
                     /db_xref="GeneID:16994018"
     CDS             complement(793196..794404)
                     /locus_tag="CYME_CMJ303C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535002.1"
                     /db_xref="GeneID:16994018"
                     /translation="MFVVGVGGASGTGFPRRLLSGCVLLLTLLVLLHSRSGDALERTL
                     SILEACRFTQETTGITSYAKLRVLDRFRSRDGLETLVLSARGPLDRRTVEQAAATWCA
                     PGGVLPPRLDPQNEVLILQCKPDADAFEGTAPNEQLHLAAWTMLRLRPESQENRRPNN
                     VERSVSQSLLLSWIIHHTRVGIRNFFIYLNEPDACGSRIMELRDELTERLADVPANVS
                     IIAWPFRPPKGVHWNHVQIAAMNDCLWRNRGIFKWILFADVDEYIVPSENALRSNPES
                     PVLHVLDDIERQLPINLCSVRVPCWWRYDVIEPALNWSEASQTSLRRPWLGAAAPVDR
                     VCKPHLNREKCFVRTDQVYYTAVHAVAEAYGPNCVQVWPDVHQHLRLEHRRSPRAFDD
                     YSPAEVLYAT"
     misc_feature    complement(794392..797660)
                     /note="repetitive element"
     gene            <798463..>799896
                     /locus_tag="CYME_CMJ305C"
                     /db_xref="GeneID:16994019"
     mRNA            <798463..>799896
                     /locus_tag="CYME_CMJ305C"
                     /product="phosphoglycerate kinase"
                     /transcript_id="XM_005534946.1"
                     /db_xref="GeneID:16994019"
     CDS             798463..799896
                     /locus_tag="CYME_CMJ305C"
                     /codon_start=1
                     /product="phosphoglycerate kinase"
                     /protein_id="XP_005535003.1"
                     /db_xref="GeneID:16994019"
                     /translation="MIAFVINSATKAAVSPLKGQICRGLPKNPSFAASTWLGQAALST
                     RPRSSQGRGRSGVRESAATRARAPVCVQTSDVAMRVRSIRDLQDAEIRGKRVFVRSDL
                     NVPLDGKRITDDTRIRASVPTIKYLADKGAKVIVVSHLGRPKGGFEDKYSLAPVAERL
                     SELLGKKVRMAKDCIGDAVATEVAAMSPGDVVLLENVRFYPEEEKNDPDFARKLAANA
                     DLYVNDAFGTAHRAHASTEGVTAFLKPAVAGFLLEKELDYLSNAIESPKRPFAAIVGG
                     SKVSTKIAVLEKLLQKCDTIIIGGGMVFTFLRARGLKTGSSLVEEDKIELARVIEEEA
                     RKRGIELLLPLDVVVADKFANDANTKVVPVEEIPDGWMGLDNGPETTRMIQEKLRTMK
                     TVLWNGPLGVFEMPNFAKGTFAIAETLAEITQNGCITIVGGGDSVAAMEQSGKADKVS
                     HISTGGGAALELIEGRVLPGVAALQRA"
     gene            complement(<803079..>804527)
                     /locus_tag="CYME_CMJ306C"
                     /db_xref="GeneID:16994035"
     mRNA            complement(<803079..>804527)
                     /locus_tag="CYME_CMJ306C"
                     /product="similar to ribonuclease PH"
                     /transcript_id="XM_005534947.1"
                     /db_xref="GeneID:16994035"
     CDS             complement(803079..804527)
                     /locus_tag="CYME_CMJ306C"
                     /codon_start=1
                     /product="similar to ribonuclease PH"
                     /protein_id="XP_005535004.1"
                     /db_xref="GeneID:16994035"
                     /translation="MKPQDLLSLDGLRVDGRKPDEVRSISAQLGVVPGADGSVLVEQG
                     QTRVLVAVYGPYETKKGALSIPSTRALINDALRTAVSEYQAPVVPETHAARPAQAVAG
                     AVFAESDDSSIDSDMETALNIDTVESDHSDSAISNAPGNESPATALKLLPPATAHGRV
                     HCEYSTASFAGAASSVRTLRAYRRRQQNRYAGTAIMRTSTMDSHDEKNGALRIGRTEA
                     APHEAQTERSFRLPGIVASSKFRQKSREAAEHIREVFEPAILVGSDANSAGSSRYMPS
                     HAQVDIFVQVLQSDGSEFAVAVNAVSLALLHAAVPLRDLIVACSAVALPTEELGSGAR
                     RFVAAADPSNWELQQARIWQAAFGAVVPEVTVAVLAGESFQPVPQRIVDFRDPHAGSS
                     LEHGVQLLWVDYRNMALDDGSTKGLDCRAYSVEQVKQLLDLACGTGCAETYRWIREAA
                     LHQTYDQVLRYEWSSARLQLPVREAQNPRSDC"
     misc_feature    complement(804749..806922)
                     /note="repetitive element"
     gene            complement(<808919..>809965)
                     /locus_tag="CYME_CMJ308C"
                     /db_xref="GeneID:16994025"
     mRNA            complement(<808919..>809965)
                     /locus_tag="CYME_CMJ308C"
                     /product="retroelement, alive"
                     /transcript_id="XM_005534948.1"
                     /db_xref="GeneID:16994025"
     CDS             complement(808919..809965)
                     /locus_tag="CYME_CMJ308C"
                     /codon_start=1
                     /product="retroelement, alive"
                     /protein_id="XP_005535005.1"
                     /db_xref="GeneID:16994025"
                     /translation="MLESTNEDETWRYIRPRLDPPKKCLGLTPIVYEEALRTERASVN
                     EAWTDHGTELHEEATGHCQDPIYWHQYAAELPRLESVPEWNDPIFWPESVRTLLRSCN
                     RKTPGIDGIPAEWMKLVTPKDGTTGTPSIPDESDTSLGKRLVELIQRMFEEAYIPDVW
                     RTAEVVPILKKDSHTDMNNYRSMRLIPSIMKLLCAIPTNRIQRGLQERKFFAPEQAGF
                     RSHEECMSHVLTLTEVVQRRSISGQQPTYVCFIDFQKAFDTVPHEAPFLKMERAGVSG
                     KCLAFFRALYADSWMRIRLGDSSRTPSRRIRRGLRQGERASPLLFNIFINDLLNNCRQ
                     YGLEVPWIDCGDAR"
     gene            <812087..>812848
                     /locus_tag="CYME_CMJ309C"
                     /db_xref="GeneID:16994030"
     mRNA            <812087..>812848
                     /locus_tag="CYME_CMJ309C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534949.1"
                     /db_xref="GeneID:16994030"
     CDS             812087..812848
                     /locus_tag="CYME_CMJ309C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535006.1"
                     /db_xref="GeneID:16994030"
                     /translation="MRPNMQRLWNIFALGLVLFLLARLSQTLLITTVRDGEAEAIKRS
                     AARHELWDDCSPFRRIEGSWARRWRSVVFHRETCARFRVTDRELVSVDGESDSCGISG
                     VCVSPSTELERWSQLPGKRVAGHGEVLRFSNVPTHWKRMDCVHGSLKGNSIPVNVENG
                     KYCILPDGQGFNVLSPAAEIERSESPAETAADELGSHEGTYSCQPARQVVEPCSPERR
                     RLVKEASGVSKTLGSCFSTWRSWRSWWSWQFRYPW"
     gene            814569..818789
                     /locus_tag="CYME_CMJ310T"
                     /db_xref="GeneID:16994020"
     misc_RNA        814569..818789
                     /locus_tag="CYME_CMJ310T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461368.1"
                     /db_xref="GeneID:16994020"
     gene            <820561..>821694
                     /locus_tag="CYME_CMJ311C"
                     /db_xref="GeneID:16994068"
     mRNA            <820561..>821694
                     /locus_tag="CYME_CMJ311C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534950.1"
                     /db_xref="GeneID:16994068"
     CDS             820561..821694
                     /locus_tag="CYME_CMJ311C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535007.1"
                     /db_xref="GeneID:16994068"
                     /translation="MYDTPRDQHMRATGALHVTLRRLGCMALGRSPLGLLGWCDVCAL
                     DEPVHSKRASSSRVSTQCPAYRHAHRLKRVLTLPGAFVHQLLETAAAAVTTQNPAAEP
                     ALTQTRSTLEPFWHLLKRNLRAAAWNDEQLLAFIDDVLVIYTCQAAMARHWRTQLAEV
                     IGIAADRVSTDAAIACWCRCVRDDVPRCRLCGHDHLTRCWLPALVALIWVIPPRGRSR
                     WLQKCLCARLLESWVSRRTELQVEAQESAVARIDDGASEADAGHASVMLLARVAGALC
                     LPRYEAGRTSGRASDASDLEWMVDAMHLLLLDWNVVPDIAAAIHSMRRHVLQQLRTVL
                     AAWTQVARTVPEPRGYRLRTQLHLLRRQLCDEPVDVFGSGTVP"
     gene            821483..823861
                     /locus_tag="CYME_CMJ312T"
                     /db_xref="GeneID:16994069"
     misc_RNA        821483..823861
                     /locus_tag="CYME_CMJ312T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461369.1"
                     /db_xref="GeneID:16994069"
     gene            complement(<822851..>823981)
                     /locus_tag="CYME_CMJ313C"
                     /db_xref="GeneID:16994059"
     mRNA            complement(<822851..>823981)
                     /locus_tag="CYME_CMJ313C"
                     /product="dTDP-glucose 4,6-dehydratase"
                     /transcript_id="XM_005534951.1"
                     /db_xref="GeneID:16994059"
     CDS             complement(822851..823981)
                     /locus_tag="CYME_CMJ313C"
                     /codon_start=1
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="XP_005535008.1"
                     /db_xref="GeneID:16994059"
                     /translation="MSSQSTALSNGAKSVTGGQPDGNSDARVVYGDRLRFVPRNILVT
                     GGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIRGDIRSHD
                     LVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGKVRRFI
                     HVSTDEVYGGESNMETESSILAPTNPYACSKAAAEFICRGYVKSFGLPVIITRGNNVY
                     GPHQFPDKLIPKSICLLAQRRPCFVHGSGEHARNFLYVEDAASAFDTILHCGETDEVY
                     NVGSEIEKRNIDVVHDIIDLFGLSAEANRHIEFVKDRTLNDMRYRIDSSKLHALGWRP
                     QVSWEEGLRRTKTWYCDPNNLKRWPNYLSGLVPHPSLTEEKH"
     gene            complement(<825193..>826107)
                     /locus_tag="CYME_CMJ314C"
                     /db_xref="GeneID:16994040"
     mRNA            complement(<825193..>826107)
                     /locus_tag="CYME_CMJ314C"
                     /product="similar to dTDP-4-dehydrorhamnose reductase"
                     /transcript_id="XM_005534952.1"
                     /db_xref="GeneID:16994040"
     CDS             complement(825193..826107)
                     /locus_tag="CYME_CMJ314C"
                     /codon_start=1
                     /product="similar to dTDP-4-dehydrorhamnose reductase"
                     /protein_id="XP_005535009.1"
                     /db_xref="GeneID:16994040"
                     /translation="MPDEIAQVRFLIVGRTGWIANMVAELLEQRGERYAFASFRLEQR
                     EACERELDALRPQRVLNCAGVTGRPNVDWCEDHRRETVRSNVLGVLNLADCCASRGIH
                     LTNFATGCLYHYDDGEHRPTAEGGRPFTEDDPPNFFGSYYSRTKAMVEELLRSAFDNV
                     LILRLRMPVSDDLSPRSFVTKIARYEKVVNIPNSMTVLTELLPVALDMSERGLTGVYN
                     FTNPGSISHNEVLELYRKYIDPKFQWKNFTLEEQAKILKAGRSNCELDVRKLLRDNPG
                     AQIREVHAAMEEVFRRMQAKGVKPLVAP"
     gene            complement(<826773..>828353)
                     /locus_tag="CYME_CMJ315C"
                     /db_xref="GeneID:16994041"
     mRNA            complement(<826773..>828353)
                     /locus_tag="CYME_CMJ315C"
                     /product="similar to high-affinity iron permease"
                     /transcript_id="XM_005534953.1"
                     /db_xref="GeneID:16994041"
     CDS             complement(826773..828353)
                     /locus_tag="CYME_CMJ315C"
                     /codon_start=1
                     /product="similar to high-affinity iron permease"
                     /protein_id="XP_005535010.1"
                     /db_xref="GeneID:16994041"
                     /translation="MVQLFSLAGFIITFREILEACIVVSICLAYLRRTKNERYLRDVW
                     LGVAAGVGVLIVIGIAFGIVFWTRGQKLYTGLTELLFEAIVRLVAVVLITWMIFWMLS
                     TAAHMRRDLEGGIARALSRRGRWGVALLVFTSVLREGVELIVFLFGITGGVSWSSIPI
                     AAAVGVAVALVVAWAIYRGALAFDLRLFFALSSLLLIAFAAGFLSTAFLDLQKANLFG
                     SFTRNGNEDESIPSTQRPWWNAALWSTEACCADDGNEFFNLLHELFGYVDAPTFVSTV
                     VYFGYWTLAGVLWIIVERRTLERKLCQMHTGYLVSTAFLAVAAVVGLVVAARSPTWNG
                     ILVTCLTLVLAIIGVGAASASHAALPPRARFALQGSCWIGLVLVACLALALQVAQAIC
                     SPQIGASQYCSIPDFYYWFVIFSPDWIAKTRDDNSFHALAVLTVSICFTMLFCLGQGL
                     VGFYEWKRSALAMQRAGQAPAAFAKQANTSSDLEGGKSTPLDDSSIDELTWEALDSTQ
                     PPQHASQIEISARRMLAD"
     gene            <829767..>830771
                     /locus_tag="CYME_CMJ316C"
                     /db_xref="GeneID:16994064"
     mRNA            <829767..>830771
                     /locus_tag="CYME_CMJ316C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005534954.1"
                     /db_xref="GeneID:16994064"
     CDS             829767..830771
                     /locus_tag="CYME_CMJ316C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005535011.1"
                     /db_xref="GeneID:16994064"
                     /translation="MDELPEQVLVEFRAGRAYLDSGLVHSDGRKGCVRVVRAADGLVH
                     FQWLDRATRAIEEDLIVLPRRRDRGIPSRSRPCRPCKTMHWRRVHACRTGRMFVLGFA
                     SSDLQLFFWLQEPRCDADVRLAQRLRNALECRPLDDPAGLDHADEVRLSDAESRPGPG
                     LSSQVPDGATRPSSAALGQSLVDALQRLGASAASDAVHAADDASRQPQARADDTPDLG
                     ALLRWGPALERLLREPGLGPASAALCREYLPSSIDLESVLQSAAFRQQLEALSTALRR
                     SRGDAGPLFAAFGIEPPPAGDWRHDLEALLEALRLRAEESARSRSEGPAPESRHGCGR
                     "
     gene            <832137..>832652
                     /locus_tag="CYME_CMJ318C"
                     /db_xref="GeneID:16994063"
     mRNA            <832137..>832652
                     /locus_tag="CYME_CMJ318C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005534955.1"
                     /db_xref="GeneID:16994063"
     CDS             832137..832652
                     /locus_tag="CYME_CMJ318C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005535012.1"
                     /db_xref="GeneID:16994063"
                     /translation="MAAPTSCSAGKGWETSASCCLGVLPVDVAFVQLHAFSVVGERLA
                     SGAERTPLSQVLPRRWTPLHPASLQDRKRAWVLGQVLQRHRSSSALQGSRVGRPQAAI
                     VQLRASLDRSALAGMSLAQAGFLVIGAREPVLLDVGPLHQVDVTMLLTGVATVGGVLV
                     GLLIAFIISRQ"
     gene            complement(<834149..>835846)
                     /locus_tag="CYME_CMJ319C"
                     /db_xref="GeneID:16994051"
     mRNA            complement(<834149..>835846)
                     /locus_tag="CYME_CMJ319C"
                     /product="similar to dolichyl-phosphate-mannose:protein
                     mannosyltransferase"
                     /transcript_id="XM_005534956.1"
                     /db_xref="GeneID:16994051"
     CDS             complement(834149..835846)
                     /locus_tag="CYME_CMJ319C"
                     /codon_start=1
                     /product="similar to dolichyl-phosphate-mannose:protein
                     mannosyltransferase"
                     /protein_id="XP_005535013.1"
                     /db_xref="GeneID:16994051"
                     /translation="MAPAVKRRAADATAASLPASSPSTERVQAADLDVMHQGRTKEDT
                     PQHEHPGADPQKQQASPLERLVLRSTAHVRANPDAWLTGALVLLGLWTRLYRIRWPPE
                     CVFDEVHFASFAHHYLNRTYFFDIHPPLAKLTLAAVAKLAGDVPNRDWYVDKVYPPDS
                     RYYAMRACAGVFGALLPPLGFRIARGMGMSRIAATSVGVFLLFDMLNLIEARHILTDS
                     QLIFYAALCIDAFVRLWRTPPASRARRWAAVRAGLASGAALSVKWTTLVVPGLFGLES
                     VAGAALAAEPLEWSTCAIVAATALLLYVALWYPHFRILIYNGPGGDFMSAEFQRTLIG
                     RDGYDPQARKPPFLKLVWQLNKEMLLANARILDEHQWQARWHTWPYVGRGLLYWNRWQ
                     EGTLDADGRPLRPHHAMQIYLIGNPLLFWMCLAAVLGTVAAMPFLLRLIRQRKKRGTS
                     TDAWERYLRLATFLLLGYALGILPYMPIQRSTFIYHYLPSLLFAELLFAHAVLDLPAL
                     PSVLQLPLAGIVWIVVFWCFWYFRAWVYGHIALTADDHEAMRWIKYTSSVGDNKGWH"
     misc_feature    835682..836872
                     /note="possible transcribed region"
     misc_feature    complement(836314..838599)
                     /note="repetitive element"
CONTIG      join(AP006492.2:1..839707)
//
DBGET integrated database retrieval system