GenomeNet

Database: RefSeq
Entry: NC_010137
LinkDB: NC_010137
Original site: NC_010137 
LOCUS       NC_010137             852849 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 11, complete
            genome.
ACCESSION   NC_010137
VERSION     NC_010137.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 852849)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 852849)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006493.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..852849
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="11"
     gene            complement(<3328..>5502)
                     /locus_tag="CYME_CMK001C"
                     /db_xref="GeneID:16994308"
     mRNA            complement(<3328..>5502)
                     /locus_tag="CYME_CMK001C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005536386.1"
                     /db_xref="GeneID:16994308"
     CDS             complement(3328..5502)
                     /locus_tag="CYME_CMK001C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005536443.1"
                     /db_xref="GeneID:16994308"
                     /translation="MRKRYFSIVRLLVVVLVVSSTHTVRGVLSSEDTFLWTWIGGSNS
                     TGSSGSYGVQGVPNTSNVPPARYGAVFWTGADGVLWLFGGGSDLRDVFGDLWNYNLST
                     FSWTWVGGSASLNSAGVYGSRGVPNKSNHPPSRTQSAGWSDSYGNLWLYGGWNFNSGY
                     SDMWMYNVSSGEWTWVQGSNKTNVSPTYGPRGNSSSSNTPGARYKTAAWVGLDDQFYL
                     FGGSGANGSSYGDLWQYNPANNEWSWVGGSQEPDPSGSYGTFRQASPSNYPAGRYGAT
                     SWRDLDGNFWLFGGDGEIVRPGGLLNDLWLYNVSSKEWTWMSGDEKIGLNGAVYGEKG
                     VPSSSNTPGYRSFSSGFVDSSNTLYLFGGSSPGACNDLWTFNITSLEWTWVDGDNTTN
                     GAYSYGELNKTSNTTLPPPRYGAVLWDTDQNDPVLFGGLGKPGIYNDLFTLYIATPTP
                     TPTASPTPSVTAEPSATTNVTQTAVGEGSAVCFPADASVLIDGLGNHLQISELRSGMA
                     VMGVNGRGQLVEDSVLGWLHNEAGATAEILAIKTRSGKQLRLTRQHLVYRMIEHSRDF
                     YGMTTAFSCISQKQQQQHQQEHIRQSLELDTSAVEAVFAEEIRVGDALLDVAAHLPDP
                     VVAIETLVTHNGLYAPLTRSGRLVVDGVLVSCYGTYASHAVAHAVLWPARVDALRKVW
                     GSGLGTEGIVGIMPYAERLYHIWTSAARVLTEARVSVVVAAC"
     misc_feature    complement(6203..7374)
                     /note="pseudo-gene of trefoil factor"
     misc_feature    complement(7952..9214)
                     /note="pseudo-gene of NADPH:protochlorophyllide
                     oxidoreductase"
     misc_feature    11791..12680
                     /note="repetitive element"
     misc_feature    13428..13973
                     /note="possible transcribed region"
     gene            complement(<14006..>15070)
                     /locus_tag="CYME_CMK006C"
                     /db_xref="GeneID:16994358"
     mRNA            complement(<14006..>15070)
                     /locus_tag="CYME_CMK006C"
                     /product="L-lactate dehydrogenase"
                     /transcript_id="XM_005536387.1"
                     /db_xref="GeneID:16994358"
     CDS             complement(14006..15070)
                     /locus_tag="CYME_CMK006C"
                     /codon_start=1
                     /product="L-lactate dehydrogenase"
                     /protein_id="XP_005536444.1"
                     /db_xref="GeneID:16994358"
                     /translation="MTSGIDEAAAELQGSLFGEVSPAIDTPGAALARSYPVRITVVGA
                     GDVGVACAYNILTRDICSELVLVDVLKDKLKGQVMDLQHGGAFYSTRIRAAESYEDTA
                     HSAVCIITAGVRQRPGESRLELMDRNAALFKGIIPPLVQYSPNTILLVVSNPVDLLTH
                     LAWQMSGLPRERVIGSGTYLDSSRFRTLLAQRLGIDTASVQAMVLGEHGDSSFVYRSG
                     ITVGGVPLRTCFERMTDAASASTAFYDLVKGVHQQVVAAAYEVIKLKGYTNWAIGSAV
                     GSIVTTIVHDRRKVLPITTHAGSLRGLESADVFLSLPCVLGRNGVVEVLQILPFMESD
                     EKEDLQSSIEALQSTPKKAS"
     misc_feature    15562..18559
                     /note="repetitive element"
     gene            <18697..>19707
                     /locus_tag="CYME_CMK008C"
                     /db_xref="GeneID:16994359"
     mRNA            <18697..>19707
                     /locus_tag="CYME_CMK008C"
                     /product="similar to ubiquitin fusion-degradation protein
                     1"
                     /transcript_id="XM_005536388.1"
                     /db_xref="GeneID:16994359"
     CDS             18697..19707
                     /locus_tag="CYME_CMK008C"
                     /codon_start=1
                     /product="similar to ubiquitin fusion-degradation protein
                     1"
                     /protein_id="XP_005536445.1"
                     /db_xref="GeneID:16994359"
                     /translation="MDDNMLPDDVVGPLRPARPVRRQLESFSLAFSNAARPEYELGDK
                     ILLPQSLLAELIQWNTEDPMIFRVQAQRSERVTHVGVIEFTAEEGKCYLPHWLMQNLA
                     LQEGDVVQLETASLPKARYVKLQPHLTEFTQMTNPRAVLETRLRHYTALTEGDEIAIE
                     YNGKMFWLTVIACEPASAVCVTDTDVSVEFAPPRDMPPEMPAVRTNAGMSSTSQCAGR
                     IEFGDATAATAGEPAAATTSRSLWRRKNEKAASGDEGMTTGSRDGVPNAPANAQPQHD
                     DYWSKLSGGRTLSGRPVFASDSPRTVETSTGTPSRPKAQPTSTDGPKKFVPFSGTGRT
                     LR"
     gene            <21492..>24242
                     /locus_tag="CYME_CMK009C"
                     /db_xref="GeneID:16994360"
     mRNA            <21492..>24242
                     /locus_tag="CYME_CMK009C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536389.1"
                     /db_xref="GeneID:16994360"
     CDS             21492..24242
                     /locus_tag="CYME_CMK009C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536446.1"
                     /db_xref="GeneID:16994360"
                     /translation="MGFICVSLFQGFSIGAERVGSYSGFYRRRHPGWRFRPRQPGTLP
                     VLPLPPDRLTPRWDAPAIRVSNGSSVTRSIPRMSARTGSRGFEEQQGGDASVSAASEV
                     VGGTPGTSTEGAATGTLGSGRPWNKGVAHSPEVRARIGAARRGKAPWNKGKALSEEHR
                     RKIGAAHEGRPLSSEHRQRIAKGMRRRPDDVLTGKKGGDTPAGAASTEAHELDEFGRL
                     QKLLLSAELETGIVPNTESASTGRHAMQDASETQENVLSQSDDVEENRIESMEPAGRA
                     SPEDEVEASSLDSVALDVQRFTRLRAELRAWSQLFARFHGGRRPSLADVRRTGSLEII
                     NKFEMYLKLRERLRNLADEVLGDTLMIPGVSRKVLAAPGGSEDVSKDYRSTEVIDTWM
                     RYLRMQREIERSGESTTQTPSVGVPKTRRRTRRSPVEVMKENARKPISVWPNQVKVDS
                     GKDGAPDHSVPGEPNETSWTRAVSKEMTHADESVLSPSRSLVSDVAPKADPDSGGIIA
                     GAPPISFPRIPATAESSAAEGATLLPTKTLNKANALQKQYNRGSSTRKSSRTRRSASK
                     DSKTADPALDSGTLPNTMQNDSNETLYREASAATRTTCEHNENPAPNGADTGHASSTG
                     PTFFNSTESTTDDRSRSRESSTNAPLATHDLYHSASSTLGNESNATAPSTIMSVTPSA
                     AAVHEMATECASCATETAQHAGASMPNPGAASATSNEGVFLDEDQRNEQGQKPVPVVP
                     PQDPASSHALETRKTLDPGRTDNDSAEPRPGVVNAVQPELGLSEEFVFPSVIEHELEP
                     LDYSLLGRIRLLGVNDVREILSLRKTLRRWIEQFKLKYGRRPTVQDADLYLSADDHVE
                     LRKVQCRKYVQLRDTLELKSRKIYDDSFVELLEQHHARIERLVERLAREPAQLTPPEA
                     TP"
     gene            complement(<24882..>26285)
                     /locus_tag="CYME_CMK010C"
                     /db_xref="GeneID:16994379"
     mRNA            complement(<24882..>26285)
                     /locus_tag="CYME_CMK010C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536390.1"
                     /db_xref="GeneID:16994379"
     CDS             complement(24882..26285)
                     /locus_tag="CYME_CMK010C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536447.1"
                     /db_xref="GeneID:16994379"
                     /translation="MGTRKMTVDEQASPRGTNGFEGSDGEAGSAHPPRSPLGRLVASF
                     ASYVGAGSRSAVVDAWDSANRARPVITYGDIVPSEPEADSLDQDAWFSEATGSKSAEP
                     ERDTYVQGSDVGRASRSLGQRRGTTDPTVPGSRGTVSQTRGASAMGNTAVRTLAAGGP
                     ASEDGCPALHGTSGERPRPSVDSGHAMIDLEELGIIPSGSVPYQGLQRRLSGSNDINR
                     RSRTFAHGPERNEVDSDGSIVLSQSAPAAPSEGLRNALAETNTSRTSGDRDSGQRGRT
                     QAPVVSPSLVWRKLEQYLGQRSPRSSPSHDPGTGSELSHASIRGNVAEGSLSEPTAAA
                     GHVYCADSGLEEHQTDQDFARWSTDVQPDAGRSPDRRAVLPITPVTPPIDIALSKHPQ
                     TYAEAVGSEIAAELAASHARLHSGAQIPSNRAPKTAPEAPKSMKETESVSRRSHMQRA
                     AKATEQYRDLWLYSTGI"
     gene            <27677..>29017
                     /locus_tag="CYME_CMK011C"
                     /db_xref="GeneID:16994380"
     mRNA            <27677..>29017
                     /locus_tag="CYME_CMK011C"
                     /product="3-dehydroquinate synthase"
                     /transcript_id="XM_005536391.1"
                     /db_xref="GeneID:16994380"
     CDS             27677..29017
                     /locus_tag="CYME_CMK011C"
                     /codon_start=1
                     /product="3-dehydroquinate synthase"
                     /protein_id="XP_005536448.1"
                     /db_xref="GeneID:16994380"
                     /translation="MYLVAGTSKLTCKGREAAAICRPQGSDAVVAHCWYRRKREATPG
                     AERRRSTVKAEVPVTTTDERVLWVDAPSRKYPIIFRNKPSLHDSELFAPHISGNSVLI
                     VTNETVAPLYLHRLREGLSRCPQVDRVEECILPDGEEYKTMDSLRAIIDVCMQKRLDR
                     KSTLFALGGGVIGDLTGFAASVFLRGIPFIQVPTTLLAVVDSAVGGKTGINHPLGKNM
                     IGSFYQPHAVIVDASTLKTLDPRQISAGIAEIIKYGLICDEEFFNWCERNVSKMVSLS
                     PGAIQYAMERSCQCKAAVVAADERESSGYRAILNLGHTFGHAIEAATGYGTWLHGEAV
                     AAGMVMAAEMSRRLGFIDEQVVRRIEAILTEAALPVRPPPSMNVETFLTYMAMDKKVE
                     RGVLRLVLLERLGKAIVTANYERQVLVDTIEYFRRLYQEQPENYERRLAHLRPK"
     gene            complement(<30482..>30820)
                     /locus_tag="CYME_CMK012C"
                     /db_xref="GeneID:16994373"
     mRNA            complement(<30482..>30820)
                     /locus_tag="CYME_CMK012C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536392.1"
                     /db_xref="GeneID:16994373"
     CDS             complement(30482..30820)
                     /locus_tag="CYME_CMK012C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536449.1"
                     /db_xref="GeneID:16994373"
                     /translation="MGRVYQKYLSGSTIYSCATCNAHLALHEDIMSKQFQGRHGRAYL
                     FANVVNVTAGPKENRMLITGLHAVADLHCTVCNTVLGWKYLEAFEQSQKYKENKFVLE
                     KNMMTKLESG"
     gene            complement(<31958..>32920)
                     /locus_tag="CYME_CMK013C"
                     /db_xref="GeneID:16994374"
     mRNA            complement(<31958..>32920)
                     /locus_tag="CYME_CMK013C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536393.1"
                     /db_xref="GeneID:16994374"
     CDS             complement(31958..32920)
                     /locus_tag="CYME_CMK013C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536450.1"
                     /db_xref="GeneID:16994374"
                     /translation="MVADTETRPPFDSVGPRPLPSSRIRTEALPRWASPFDKSACQSD
                     VARVHRQLNAEGWALGSLLGTREIPKESGVHLPSDRKRWLNVVTPGTSARSDAHSGDA
                     ATDPKVPVVLESEHAANVAVQGDVDTVTKHLAVLGSELVEDVPDGTVVHVDQPAPLDE
                     AGASKVPAEASPIRDQITTEPRLSVVDATAPEQTESPRADASASSPDTESSGQHPSRE
                     EPCLGSASSARATQIPESVLVDEAKRSQGGTCEPMFQNHSRFVDQPPADAWERCQARD
                     ALCRSVADDLKRELSCPYSPIGVDMQDLTWGFFTRMNRFQPARS"
     misc_feature    32711..34469
                     /note="possible transcribed region"
     gene            <34820..>37654
                     /locus_tag="CYME_CMK015C"
                     /db_xref="GeneID:16994371"
     mRNA            <34820..>37654
                     /locus_tag="CYME_CMK015C"
                     /product="similar to protein disulfide isomerase"
                     /transcript_id="XM_005536394.1"
                     /db_xref="GeneID:16994371"
     CDS             34820..37654
                     /locus_tag="CYME_CMK015C"
                     /codon_start=1
                     /product="similar to protein disulfide isomerase"
                     /protein_id="XP_005536451.1"
                     /db_xref="GeneID:16994371"
                     /translation="MSRGGHWRQPAIGLCLWLVIGVVLSGQTTRALFLPDLSPTGFRN
                     YIENRGNDTIAAVKVYAPWCHHCQDMEDDWNILGNIFADLSNVVIASINGDKHVKLRE
                     SLGVTGYPTIFLYDKGAEKPRDWKYARNWGLLAMEMKRMAQEAGGSTASEVESVAIPQ
                     SPTLLTEYRARYARVTKQSPIIKLDEKSLTAVAFDRSRDVVLAVTKQGAPQMSSFMKA
                     FAEAGTSFVVAGHSPNEIVFAEVDAATYNQIQEKEKLPPLKSAPAVLFLPQGPDKRTK
                     IDTLVSDAGAASKMTAAALIDLVNAKAGTEITVGGALHPQAGRIPQLDSIIAACFNDA
                     AFRAKYPSYDEARRANFSGVSDLIKQTDQKLEDKVYELSGDGTLSAVQGNFYLKTFEK
                     FVDPTSEGLKEIVQMIGRYEHTLEEAPLKKSMQASHLREFARMRNLMRIFEEHSEELR
                     QEVEKLTRRVKSLVADSVTIDILDDKFRGDDETRERFAERVRTLSEARAEALAAASRG
                     QPYRAREAVVAQAVAGIRDKHVWVVPKGSIIPNEVVFKVAEQKLPDLVVVLGPAAQEQ
                     APQKPAFYSKHDKMSSGPNAAPAEPLEYTENATDLATVTRYLERAMLPPPPSSVVELT
                     DKTFAKVALDKGKTVMVAFVASWCGHCKRLKPEYEKAAAIIGRRGLDPDRVVMAMIDA
                     DKYDRIRDEYAIQGFPTIKLFHASDNLVEDYQGGRSAAELLSYLESKAQEDASGKRLQ
                     TVDDESKGGRKFVQELTPETLDALLEQPDKAVLLMLYAPWCGACQRLKASYEKLAEYF
                     ASRREDVVIARLDADKHASEVEQRIKIEHYPTFRFWRKGGPEKRAMDESLDELRYDVD
                     LVALRHFVEEHAGTPKPVPLGRRIFRRLLTSASDLLGYLSHRMPFQVTTPWYLAMLSL
                     STVFLVYGLIRVLPTRARKRALHTSTKKTE"
     gene            complement(<38118..>39341)
                     /locus_tag="CYME_CMK016C"
                     /db_xref="GeneID:16994372"
     mRNA            complement(<38118..>39341)
                     /locus_tag="CYME_CMK016C"
                     /product="probable adenosine kinase"
                     /transcript_id="XM_005536395.1"
                     /db_xref="GeneID:16994372"
     CDS             complement(38118..39341)
                     /locus_tag="CYME_CMK016C"
                     /codon_start=1
                     /product="probable adenosine kinase"
                     /protein_id="XP_005536452.1"
                     /db_xref="GeneID:16994372"
                     /translation="MLALAMWRWFGGCGGLDYSAAAFIRPWQLVRRRLASLMGIRDTV
                     RILGMGNPLLDVSASVPDTLLTKYGLEPNNAILAEQRHRPLVRELRDAYAADYVAGGA
                     TQNAIRVAQWMLQRPGSTAYFGAVGNDDFAERMRQAARRDGVHVQYRVDEHEPTGTCA
                     VLVTSNGQCRSLVADLGAANTYKIEHLRHPDQWQLVEAAKLFYIAGFFLTVSVESALA
                     IGEHVAQNADKTFCMNLSAPFLLQVPEYWNHFCAVQPFVDVYFGNETEACALAKRMGL
                     IDDAACEALTRAQLFEVATALATKTPKRTSRPRTVVFTCGADPIVLVIGDGERLWSTS
                     EYGVIPCPDNDVVDTNGAGDAFVGGFLAMMALGRPIVECVAAGNYAANVVIRQPGCTF
                     PPKPHFRYRGVQVLV"
     gene            complement(<40046..>46555)
                     /locus_tag="CYME_CMK017C"
                     /db_xref="GeneID:16994369"
     mRNA            complement(<40046..>46555)
                     /locus_tag="CYME_CMK017C"
                     /product="similar to tuberin"
                     /transcript_id="XM_005536396.1"
                     /db_xref="GeneID:16994369"
     CDS             complement(40046..46555)
                     /locus_tag="CYME_CMK017C"
                     /codon_start=1
                     /product="similar to tuberin"
                     /protein_id="XP_005536453.1"
                     /db_xref="GeneID:16994369"
                     /translation="MDGKEHASVGSSLALWRAFQRTLGLEPSSSEFSGSQLDGSAMNA
                     ATRAPFSHAEPRNGTQTDSKLESAVDATTSRSAGVDASRSEQRAFATREVHVLDTESS
                     PVLTSSPHHGTSTQLNLPAASPSPELEQIARESLRSDKSLVQVLGTLAVVLSGATRAR
                     SFETMKQQWILLRHVAQTESGSDRNDDAERVSPVSGSSTSAEASHGKPGIRLESLTAC
                     LHAQATLSPALWLVSINSGATRILTAKNATNVLPPALVGEPRRDSDDKNACEVHRKFC
                     ALASVLIADLSGTARAHNEQKLEYADDVESALQTDLELLEYLWDRWTTDDGATAKYPE
                     ESQRRRADSSPMGHLLTNRIQQTWSDAAARALRGADLDKMLDLLEMLDWAWLCSVDID
                     AACTVVHLAHSIGICSTERRREARRDAPGEVDARAMECLGQWLVSVLELHAAFAGGFD
                     ALLTCLGRAYVSLLWTTVKGTALVNGRTKKSLTSADWTLLTRPVVIHVFGACWRALTT
                     RGARIHSVCLYTQCCEVLGALCILVCASGTVQHVIWREFGRCVHAESVSVLVHALATG
                     ACLCVLRAPSAAHAATALFLQLLETPWVYRVLESASRLLAGEMFPVPASTLLASGEAE
                     RLPALSSLPESLSGESYRQPFSFASGGTAAPATEALGRQHANIEASCGTRPSVVANSP
                     ETDEMLIEAAALGAMHCLLMTLAQGSIFEKADGFAFASALIIRVSESAAQWAEKSPFF
                     TMELVAALHRLVRVSHCVSQFDDGALTLLVEVATRALLQRFGDVSSTGISTGAGNELM
                     LCGTGSRAIPTSSVRATIARFVPSNDSTGTLAHRIQSDDYRASANASLAAETGAMTVR
                     SLDAAPDVRAQSTPEAGSIADMAAFWEQVAHRFIESVLDYVERTSPQSFGDGPEILSF
                     LERVGPLTRVPERLRMLALRERLAQPFFGLETWVDRLQYVLTVYLRDEPRQAVRLRAV
                     RFFRDTFTVWKGLYADLFVTEVVQPVLLGAWKELRQSAQSRPSTPSEYGLDAELTEEL
                     VHTVAVALSAPTSLAVFERFARELLDLGDEVLTTLLAALETYLREHEAPRASVLFALL
                     TDHCLEWRTAHAGSLGENDAPGGHAQSRRHLLAFCGFICRLSKDLPHSPFLQLDGKTL
                     PCPVRLGDVPDARAVSGDGERSAYSLPPGIAVDTASSGVWCRTERTRGASVSARTGEA
                     LERHADGSDAPAPATGESSAPADQPSVKPTIPAHTDVFGAGVLVPVAAWYHHLLGRLL
                     HSTMDDAAYATAAPPAVDGTTEAFQPPELESIMACLVHLVTDPGFGPIALVPALQTYD
                     LLGQWLERSRKLATDKSGSYLSLAARHLALEVLAAITLRELARSAPMSWAQHIEHLLD
                     MVIAELYWLVAEAERLPLYPPMLDFTLRLLVQGWCMAKDREPTVALQSITAAYLVALQ
                     VFAGRLVAVSGERPRTCVEHARHLADCVNEAAAILESLHGVALCFRELVPSAQATAPE
                     TGSFVCSDVAMQAALSPRVRYADGVQSAGADPESGSGPADVGLLAAFETASIGVDGGV
                     VAGLATRRNATYAHIAFSIVITLVPLFAPTGASLQGASPAVAQSQGAQLRRLAMSAWC
                     NWASLVHDVTVLRPYLEALEERCRKHGCTLFAAVAAEFTYCFGGVRLVDRGPSTLLDK
                     ALQQAPLVASWALAGTDALPVVINAYRNGYELTLAIRRVTGSSRMQLRLHEPPWTWYP
                     ERRYATESSSARAATFAEAPRRVQVEGTAAASTDRSSVRLPFAAEQPAPSSSSSLSSS
                     VVVGGGGVAVVDNAIPTEKSPNGPELVDSAVEKKLDAHLRGVLAQFMHRQPLEAWRRL
                     VLDRQVWQVLDRMPPEDIHRIGLMYVGTGQQTESEILANVAGDSQYDDFCTNLGVFLR
                     LTDHWMFGYTGGLDYSERQADGAFALYYRDAATQLIFHTTTLMPAELGTEGARLATDP
                     GNSVPEPAGTPTNPAVRFAAATRGSSSERKSLIRKKRHVGNDHVKIFWCARRTEARIA
                     ATPDVLPGAFNSVHFTIAPLSTRDGNTNEAADGTESSLFLAEAHWHRSGMPRSGPWRV
                     PGPCMVCGTGAAAFLLRLAAIHADTLCGCRAIAGYRSSMATSSVSSAPAHGSTIPLAS
                     AAGLAIGSEEEPWLRRLSYMQHQIERLSGESLPPGTG"
     gene            46789..48508
                     /locus_tag="CYME_CMK018T"
                     /db_xref="GeneID:16994365"
     misc_RNA        46789..48508
                     /locus_tag="CYME_CMK018T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461370.1"
                     /db_xref="GeneID:16994365"
     gene            complement(<49222..>51681)
                     /locus_tag="CYME_CMK019C"
                     /db_xref="GeneID:16994366"
     mRNA            complement(<49222..>51681)
                     /locus_tag="CYME_CMK019C"
                     /product="similar to low affinity potassium transport;
                     Trk2p"
                     /transcript_id="XM_005536397.1"
                     /db_xref="GeneID:16994366"
     CDS             complement(49222..51681)
                     /locus_tag="CYME_CMK019C"
                     /codon_start=1
                     /product="similar to low affinity potassium transport;
                     Trk2p"
                     /protein_id="XP_005536454.1"
                     /db_xref="GeneID:16994366"
                     /translation="MAPTEDFPGSLSTEAEADVSTSPRLGNGSLASHTIAQPGRSSDD
                     TELAVYTIPVAATPGPGGGSYEGLFEDPQGGYRLDAASPSLRARARLSRTEGVAYDWY
                     PDQPDRESIGYEATYQSGPAETVQSSGRPYSRTVVIPWYRRFMRWLLHNLNYRYIFVA
                     YVVLIPIIAAGVGAAILHGQIAFIDTYYMVVSAFTETGLNSVNMSAMNNGFLALLFIM
                     IIIGSQIFTVFLPPLIKRRLYWHWYGALIRRERHLRSELSRHAAQGEDDLGADDEESI
                     YGLDESIHDRPVSIYASLSQLHVPEPPKPVQKANTYGDPERSLSSGQVNVYGAKHSGN
                     GAASPDMVTNRFRDGSRFLARESTIHSLEREARANSIGRSMSRELAGRSVVYQRRSIC
                     LEGNEFARNAVLEFEAMGKLILLNAIFYVGLLAIFLPLVFAAVVTPPGPSPAIAQSGA
                     TTGWFSVFTSVSALHNCGLTLLNASLAPLANQPGALFLLGVLIIIGNTGLPVALYLLV
                     LLGRRLARDKAPWEYLLLHGRKFSIFLFNGAQTFVLGIILVILLLVQFIAFLALNLDR
                     TELLASYSAGSLVYLGAFQSVCTRNAGFQVVSFRAISPALLVLYAVLMYLSPVPYVLT
                     LRTSMPSTASQRKRVEPAQLNDAAYASLSSKSAAANAAAGAAPVLRELGKTFENLLVF
                     DIAWLFLALFVVCIAENYLLRNSIREVQTLGTVTVFDILFEIASAYGNVGYSIGVNNA
                     DYSLSGKFSVFSKLVIIATMYGGRIRSIPQSSDEAARFRFDRNMMDITQSSLLRPTLH
                     LQALERRRSRSIQTDRSAFRR"
     gene            complement(<54200..>56125)
                     /locus_tag="CYME_CMK020C"
                     /db_xref="GeneID:16994367"
     mRNA            complement(<54200..>56125)
                     /locus_tag="CYME_CMK020C"
                     /product="similar to glycogenin"
                     /transcript_id="XM_005536398.1"
                     /db_xref="GeneID:16994367"
     CDS             complement(54200..56125)
                     /locus_tag="CYME_CMK020C"
                     /codon_start=1
                     /product="similar to glycogenin"
                     /protein_id="XP_005536455.1"
                     /db_xref="GeneID:16994367"
                     /translation="MRLKFFALIIVISAYVFLDASQTSLRSSSLENPPGWPAFRRAAG
                     ASLPSTENQTLAGGEHVRTQELPGGKQANVVRPRPLAYVTFLYGDTYVLPARVMFHSL
                     RVHQQRGVLFEPAGGTAGELDERTLEAASAARAGHDLQQPQAILLSMVTADVSAKARA
                     QLHRDGVYTLEVRRVRNPYTGGEHYNHRFDDVLAKLQVFALEQFEKVVYVDADTLVLG
                     DVQDMFECGDFCAAFINPCHFNSGVMVIRPSQALFQSMLEKLAVTESYDGGDQGFLNV
                     YFSELFYAPGFGPDDAHRGGPLRRLPFGYHLDHIVYYPRLQWEVPARCGGLRIMEFMG
                     VPLFKPWQWWTYPVMDLSWAWHAMRSQLSDPYPPDYSLNWKWVALRFLGVYLGMYVLW
                     WSMSNPLGFAPPNRRRRAPFLWLGNWFAQTRVMRYFFGLDDRLYLYVMVIVGMTGWLC
                     TTLAAALCIPMLATPYLAVAIYIHFKVLFTFFWMICFGTMCMRRHRLSDGKHARGGVL
                     FRLLCYALADASAPPIVFGIAWHIPWSSFFAKIFGLLACLPFYLIGLNATYAHLVLLW
                     ARQGALIAERERARSRSLNAAPDDSELAAFFSELSRENPTAVLLTDSPTHTPRLPVTN
                     TPGSAAAPSTRHQLRSP"
     gene            complement(56512..58189)
                     /locus_tag="CYME_CMK021T"
                     /db_xref="GeneID:16994368"
     misc_RNA        complement(56512..58189)
                     /locus_tag="CYME_CMK021T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461371.1"
                     /db_xref="GeneID:16994368"
     gene            <62097..>62339
                     /locus_tag="CYME_CMK022C"
                     /db_xref="GeneID:16994363"
     mRNA            <62097..>62339
                     /locus_tag="CYME_CMK022C"
                     /product="similar to Sm protein B"
                     /transcript_id="XM_005536399.1"
                     /db_xref="GeneID:16994363"
     CDS             62097..62339
                     /locus_tag="CYME_CMK022C"
                     /codon_start=1
                     /product="similar to Sm protein B"
                     /protein_id="XP_005536456.1"
                     /db_xref="GeneID:16994363"
                     /translation="MDLLPVLRSQVHVQTTDGRLLAGKLLAFDAHSNLLLSHCTERRG
                     ESAKRYLGMVLVRGEHVLAVITPRITETEQKTAASE"
     gene            complement(<63411..>64949)
                     /locus_tag="CYME_CMK023C"
                     /db_xref="GeneID:16994364"
     mRNA            complement(<63411..>64949)
                     /locus_tag="CYME_CMK023C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536400.1"
                     /db_xref="GeneID:16994364"
     CDS             complement(63411..64949)
                     /locus_tag="CYME_CMK023C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536457.1"
                     /db_xref="GeneID:16994364"
                     /translation="MIGRRAATADADGACVPRRRRPMCAPWHLSTGAIVLVCVVQYMT
                     KCTGVKAVFCARPRTNLTTHSLRGERACILGCMWTQPCVWRYSTTSRRARARQYLGFV
                     DQRAPRLRQLAHRGCGCLVALASAEEPRSQDERAREPPPFSEQEVEERVYLADLPLLS
                     VQELSRKPERWERTGAYAVFDEERTLRYVGYTKNVLAKLQVHRKLQPSLCRYFKTYFP
                     TRGSQEATPDVLESVLCDWIRENGRVPSGNYQLDRWESMPSPRSLSDTENDSPEYAPM
                     GRDVPNERIGAQRAAPRGDEGGAADRERRFGRYRTVRRAVFDEEGEADAFDEYEPASV
                     ANGDDWWHRLVRVFIGQSVPLPTGVLADESLRVRVRDKHGGVRSDRPLISGIPAMPNE
                     YDGPRGRRRGAEDRETAQNRDPYLEQLLRFEEEEAYRKASQGTRWRAGSSSGRRSAFR
                     SKEAQAFPDEEDMVDDWNDALMDNGMQDWIPFLALGGLALFLYLVSALSSTGNALPPE
                     SLGF"
     gene            complement(<65473..>65991)
                     /locus_tag="CYME_CMK024C"
                     /db_xref="GeneID:16994378"
     mRNA            complement(<65473..>65991)
                     /locus_tag="CYME_CMK024C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536401.1"
                     /db_xref="GeneID:16994378"
     CDS             complement(65473..65991)
                     /locus_tag="CYME_CMK024C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536458.1"
                     /db_xref="GeneID:16994378"
                     /translation="MALDIARGFRLFCYFVVIALSIASFALIVHDLKPIINGKRYCFP
                     HFYTTGTVGTSVSICNFGIADNVIMFVFALFTFMFVLIGSFVSSLEPHIFIFEVAVNG
                     FNTIWAMIWAIVVSARIGGSRSKKENAVLGFSWIDFALLLFALIVTLAVERGQKGSSD
                     DVGEADTERAEA"
     misc_feature    complement(66125..68749)
                     /note="possible transcribed region"
     gene            66419..71452
                     /locus_tag="CYME_CMK025T"
                     /db_xref="GeneID:16994409"
     misc_RNA        66419..71452
                     /locus_tag="CYME_CMK025T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461372.1"
                     /db_xref="GeneID:16994409"
     gene            complement(<73052..>74305)
                     /locus_tag="CYME_CMK028C"
                     /db_xref="GeneID:16994377"
     mRNA            complement(<73052..>74305)
                     /locus_tag="CYME_CMK028C"
                     /product="eukaryotic translation initiation factor eIF-4A"
                     /transcript_id="XM_005536402.1"
                     /db_xref="GeneID:16994377"
     CDS             complement(73052..74305)
                     /locus_tag="CYME_CMK028C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-4A"
                     /protein_id="XP_005536459.1"
                     /db_xref="GeneID:16994377"
                     /translation="MAEANGTSSVAVSRDTGYSNDAEHVENVESAGEIDSNVTEVYES
                     FDDMGLRDELLRGIYAYGFEKPSAIQQRGIVPMVKGRDMLAQSQSGTGKTGCFVIGML
                     QNVDTSVRKVQGLILAPTRELAQQIQKVALALGDYMGVKVHACIGGTRVVDDLRTLEQ
                     DTPHVIVGTPGRVYDMIQRRALDTTTIKCFVMDEADEMLSRGFKEQIYMVFQYMPANC
                     QVALFSATIPAEIVEMAEKFLRDPARILVRKDELTLQGIRQFYIMVEKEEWKLETLID
                     LYETISASQTVIFVNSRRKAEWLSERMRERDFTVSVIHADMSQEERNLIMREFRSGSS
                     RVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRVGRSGRFGRKGVAINFLANEDV
                     RTLREIEAYYNCEIQEMPVDISDML"
     gene            <74895..>77051
                     /locus_tag="CYME_CMK029C"
                     /db_xref="GeneID:16994410"
     mRNA            <74895..>77051
                     /locus_tag="CYME_CMK029C"
                     /product="similar to GTPase activating protein"
                     /transcript_id="XM_005536403.1"
                     /db_xref="GeneID:16994410"
     CDS             74895..77051
                     /locus_tag="CYME_CMK029C"
                     /codon_start=1
                     /product="similar to GTPase activating protein"
                     /protein_id="XP_005536460.1"
                     /db_xref="GeneID:16994410"
                     /translation="MSVSRDVCEPAPPRTGVSESSLWDCALYLYKRENVLLVLTANDR
                     RPGALGLERRQRSQGAGAPAADTGGHAESSTASVWVFWAPYEPSTKHRELCQTDTARV
                     SPEDKATFSRRHGASQPLDRGDPHAFSVCVGDLLALRRHLPAIGSPRVCFTKKGGEML
                     PELAFQEGGLRDFLSALRRHIELEPDSTDPDLFYVRAAIADDCPRSRKASNVQISNKG
                     FRVQPRTNRRFSASPAAIAMLVQEQPSHIQSGPVVIPQAPSANPRLCEQQHRHASEAS
                     SPSAVSGSSREDSIFGTTLAAEEELTFHLLERFAQITRLARTATSSLSAAYRQRRTRG
                     RRTASSTVTDDANPNAASKDNEYPAVSEDATSDEPLASVTVQYENGEIIPPLRTLDRD
                     FARYRPLRAAAGVSREAFQRGRRLDPLAMRRAIFAGGLEEDARADAWPYLLGVFDWTI
                     SPEEEQEQRSRLEKEYVVLREQWRSISEKQERRFTKYRDRRAQIEKDVVRTDRNVDLF
                     RNDDSVALSQLFNILLTHAFFNFDLGYCQGMSDLAAPIVYVLGAKDEALAFWCFAALM
                     DVLERNFRKDQSGMNEELARLAIITKHIDGGLYEYLKQQQADNFYFCYRWLLVRFKRE
                     FPFEQVLYLWDVMWAAPGSVGGGLFHLYVAAALLELHRDVILQYRLSADELFSYASRM
                     AMRNDAELVIAKAETLFKEFGLPAEIELQLTQKRLI"
     gene            complement(<77029..>78339)
                     /locus_tag="CYME_CMK030C"
                     /db_xref="GeneID:16994395"
     mRNA            complement(<77029..>78339)
                     /locus_tag="CYME_CMK030C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536404.1"
                     /db_xref="GeneID:16994395"
     CDS             complement(77029..78339)
                     /locus_tag="CYME_CMK030C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536461.1"
                     /db_xref="GeneID:16994395"
                     /translation="MPAANHIQHLLYVATCSAFVCLGVSVAFLGPSLPALHELVSERG
                     GVTKDGWLFSLGGIAYFIGAGLNGTLDRSFEAMLLESLLLTVSLVVSGVSQAMLPFCR
                     KRWQLGGLLFITRLGAGSLDVSGNSIIAASGSVATSWMQCLHACFSVGAYLAPLILAF
                     WLRTSAYGLYLGFATYAVFVVFSLVLLFMYTAMLRRYAERNISSCPTGNRAVDDKTQL
                     GPVVASEAKAVISTTRQRLVRMARITLVVVVFASYAGYEVSLGAWLAVYAHEADGASK
                     ELAQADMVSALFWAAIMCSRLLAIVVSVWFSATTILTCCVIESLIAWLCTLWRLRSLR
                     VLAACLGLAMGPAYAAQMSIAVEIFGDRERCASEVATWGTIGSTLGEALLPWIVGIFM
                     SRFGLVWFHRTIMSYAFLWSAFAVALIWRRQRPQTMDPKSGASG"
     gene            <78692..>79045
                     /locus_tag="CYME_CMK031C"
                     /db_xref="GeneID:16994396"
     mRNA            <78692..>79045
                     /locus_tag="CYME_CMK031C"
                     /product="cytochrome c reductase subunit 7(VI)"
                     /transcript_id="XM_005536405.1"
                     /db_xref="GeneID:16994396"
     CDS             78692..79045
                     /locus_tag="CYME_CMK031C"
                     /codon_start=1
                     /product="cytochrome c reductase subunit 7(VI)"
                     /protein_id="XP_005536462.1"
                     /db_xref="GeneID:16994396"
                     /translation="MGRLADLVLSVPGTRPLVTALARWYRREVEQELRKFGLRYDDLL
                     LETDPEVSAALEQLPPAEQELRWKRIKRALDLSMKKTYLAENIAQQEDVWNPYLRERV
                     SLIKQKRQELIESGE"
     gene            <81665..>83809
                     /locus_tag="CYME_CMK032C"
                     /db_xref="GeneID:16994404"
     mRNA            <81665..>83809
                     /locus_tag="CYME_CMK032C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536406.1"
                     /db_xref="GeneID:16994404"
     CDS             81665..83809
                     /locus_tag="CYME_CMK032C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536463.1"
                     /db_xref="GeneID:16994404"
                     /translation="MDAPPAAHLTRDARGDLNQRLAIRAGHPASYARCSSGAQRRRRH
                     RQTVRHLGFGLSGMSGIRGTAERRVEKRNLRKQGSFSYHALQNRRASELGFWLPSSAA
                     KTLFGSPLSRRCSLDTHQAPVRYNDRFRNDAWQPELIQARGAGGAGLPTCSEAQRAAT
                     RELQPSDTGRSGGDAGASSAKAGDKHRTIDEKESKKLSRKAADDALAARNVSDAAYAR
                     ICVAELRSALDAIQKRCFFARKPESALGTGATEFCARLAARIGICVSQPDCRCLDVGA
                     VSAERPAQHEHHSSRNENGGRTECENWALLVRRFHRLIREWLARRVETAPLSAHTEDG
                     ACGPTDSMHPSRGLMRFQSDALTDASDPDNGDEQENATTPGLHPIFHASSLSSKAALS
                     QRSMPAEPEIIRHTLAVEADIQDRRKRILQDVYRERERSAAFPNDVLPASRSSLRKGS
                     QQGAYATAEHEDELIHALEFLRSSISEREAELEMLTNEQSQLEAMLQELLASCAPVTA
                     ARVRANIDSNGVSNSTSESRPRRPVSSPQTSVLDPADTIESNDRRRATCSAAAELERQ
                     ACVPTSNTRQDDSDCPESADRNRLHPRCFSEPGPEELVSQHLEREKAEQRAAMMLQLL
                     FASSTSPSKTVHRRRHVEMVAIELVTSMLALKPSGAIQLSGDDDEMIAIEFLEMHGLV
                     RSQRSNRCLASPTATPDGTAKEYFFTEPASNA"
     gene            complement(<83908..>84465)
                     /locus_tag="CYME_CMK033C"
                     /db_xref="GeneID:16994399"
     mRNA            complement(<83908..>84465)
                     /locus_tag="CYME_CMK033C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536407.1"
                     /db_xref="GeneID:16994399"
     CDS             complement(83908..84465)
                     /locus_tag="CYME_CMK033C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536464.1"
                     /db_xref="GeneID:16994399"
                     /translation="MYNDGGFTQLFVLALGIGLVLKPQDLPRAAHFVGRLCGRTVALV
                     RELRQGATQLARLVEEEEGGVSAKASRQGASPEKHVNAFQLHRELQESAAELRQLRIL
                     LRREWNAATPMAQVRLPTAMVQSYRPRRRLPAAQKTTESGTAEDGGADLVLRALEERA
                     FADKVQHVLDAATVSSSASSETNRH"
     gene            complement(<87080..>88228)
                     /locus_tag="CYME_CMK034C"
                     /db_xref="GeneID:16994400"
     mRNA            complement(<87080..>88228)
                     /locus_tag="CYME_CMK034C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536408.1"
                     /db_xref="GeneID:16994400"
     CDS             complement(87080..88228)
                     /locus_tag="CYME_CMK034C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536465.1"
                     /db_xref="GeneID:16994400"
                     /translation="MTSHVMGGKQASVLVSCLTKPLEPDGRPAWRSYSSVPQPKSSPS
                     TGATHVAATCVHCQAGLGGFPGRWRPIVSDSSVPDIEVEPCSLSLGETRSSLQLLLDA
                     SALAMKEPKLIYRTENGPQRSAKARLLEAEGVMNQPSNEDVVQEHGRETNGGISKRDA
                     LSTWPEQLHTGERQSAANLWRVPNETNEVCQASGAASATQRAGIAAPDCVSETGTRGS
                     FAASGSSACDGDALSDRPFPSCANHVTTKQVSTSCADESRGESGSSSKALLVNDRERL
                     RDSARQTHRMHEQKRRRMISSRVDALMCLVPAVRGYATRFGRKPDRATILEGAAEYIR
                     SLEANVAALKTRLQELEVANFVAKKYGVSSPDITQYKPEHIVLRHHCR"
     gene            complement(<91068..>92522)
                     /locus_tag="CYME_CMK035C"
                     /db_xref="GeneID:16994401"
     mRNA            complement(<91068..>92522)
                     /locus_tag="CYME_CMK035C"
                     /product="ribonucleoside-diphosphate reductase beta chain"
                     /transcript_id="XM_005536409.1"
                     /db_xref="GeneID:16994401"
     CDS             complement(91068..92522)
                     /locus_tag="CYME_CMK035C"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase beta chain"
                     /protein_id="XP_005536466.1"
                     /db_xref="GeneID:16994401"
                     /translation="MVLFESASTSDCESGTSSASESPLMATSLRYDAALGSRTAAALT
                     KEHFSLGQNAHVHAASEAQLKGASKWNLSSEANSAAAGAAAGSSGRSLPAESSAEAPV
                     SPRNATEEVLESFVDAEMHSDLIKSETHFRGEEGEARSFLVSRKELLKIREWLRTCEK
                     SEPLLMASTNRFVLFPIRYPETWSFYKRAVASFWTVEEVDLQQDLRDWSRLTSGEKHF
                     ITYVLAFFAASDGIVNENLALRFSTEVQLSEARSFYMFQMAMENIHSEMYSLLIDTFI
                     KETTEKDRLFRAIDTLPCVRRKAEWALRWVGSDASFAERLIAFAAVEGIFFSGSFCAI
                     FWLKKRGLMPGLTFSNELISRDEGLHCDFACHVFHMLRYKPPDVLIRAIICDAVEQER
                     AFVREALPVNLIGMNSTLMQQYIEFCADRLLVALHVDPVYRVENPFDWMELISLNGKT
                     NFFERRVGEYQKAGVMTFQPSGVGENDFRLDLDF"
     gene            <95086..>97125
                     /locus_tag="CYME_CMK036C"
                     /db_xref="GeneID:16994406"
     mRNA            <95086..>97125
                     /locus_tag="CYME_CMK036C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536410.1"
                     /db_xref="GeneID:16994406"
     CDS             95086..97125
                     /locus_tag="CYME_CMK036C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536467.1"
                     /db_xref="GeneID:16994406"
                     /translation="MSATKVEPNPAADSSRSLVVMGRLPSDADAGSRSTQSLRSAEGR
                     RKVLRWLQASGWWHPVDKRWDSTASTLDDVDERYLSPCCSSRKVARVENEKLTQPGSG
                     AEDNPLQRHLCKDGALSPNSRPSNWETLDFPQLPAHILSILSRAEEELMKSSHKNKSV
                     EIGDTVSLDPDDADCRCRDQSAQSTTESQTPEKAKCTALIPLDHNSEAFDPEGDLGHT
                     SKAVENEACPAYLPDASSRVSTPAQPRRRLTGAQRRRFDRACEAAQQLLFRHDWKSVS
                     QQTKETAMISRTEVSPQTPNLSPLSADRLSPTKRRRRAHAAAVVTPEPKSSVRAKWPA
                     VVPAQRRLCFESSSESNSSEFLESEEETVTEESSTTSSADVAGSMTSPLVRARHTPVS
                     LRAAQPSSALSRSTATQRARQRRSKSEDASGATLQGEHDKIQRISRQRPKSSGRNRGS
                     SANRGNREPAERATRSTNTREASPNKRNARANTTNEMIADESSAVTSTAKSMRRGSAQ
                     KSEAAKKSPQRTRGASLSAMPKADSKATVSSHEEHAPDYWQAQRERASARQAVFYNAR
                     YWSQANMAAYVARLHTIQARTYPHLSVSPLLLTGATPLSACSAYPQHPLVQHLPAEAC
                     RFDPRASGRTVPCAASVPVSSLYAGPMANQTLAQSVSTTESESAGSIPSAGMRTP"
     gene            complement(<101384..>106207)
                     /locus_tag="CYME_CMK037C"
                     /db_xref="GeneID:16994407"
     mRNA            complement(<101384..>106207)
                     /locus_tag="CYME_CMK037C"
                     /product="RNA polymerase I largest subunit"
                     /transcript_id="XM_005536411.1"
                     /db_xref="GeneID:16994407"
     CDS             complement(101384..106207)
                     /locus_tag="CYME_CMK037C"
                     /codon_start=1
                     /product="RNA polymerase I largest subunit"
                     /protein_id="XP_005536468.1"
                     /db_xref="GeneID:16994407"
                     /translation="MDERVVSLKSGDVHYRIGGVGFGFYTAEEVLQLSVQQIQSAVAF
                     DDLGRPVRGGLYDPRLGVYDKFGICATCRLGFFSCPGHCGHIELAEPVVNPLLFSLLV
                     RLLRGVCLGCANFRLPRIREKLWLECLRHLERGTWQNFESLADLLQLDKQSTSPDLAG
                     FLDQTSDVSSESSDGSRSSTKKPRLESARGGHSGVHTDRFDAATEKLTTVQRSSRRVQ
                     LMQRFIGDCTSSNAACTRCGCKAVHIRTDGCRIFARLPPTRKRSKAAATTLATAQASP
                     DTEAQCQTQLLEALCLVAGKEQLLLPSMVVRILLAVEQNSPELCGYLFGHHLLDTFLL
                     RVLLVPPSRFRLPSTRDDDVNSIPREHAQNFHYTYVLKANESVADARKARNPLALGKA
                     VAELQQAVQELVDSEPTASMRRAPGIRQQLEHKEGIFRMHLMGKRVNYAARSVISPDP
                     FLDVNEVGVPLQFAMKLSFPELVASWNLTRLQQNVYRGPQRYPGANIIERGDGTRIQI
                     PAGDSKRSGVLAETLFEAEELPDGCVVPTRVFRHLQNGDRVLFNRQPTLHRVGLMAHR
                     VRVLGPTENTLRLHYANCGAYNADFDGDEMNMHVPQDWIAAAEAEYLLRIDFHYLSPT
                     AGAPVRGLIQDHVLAAVLLTQRDRFFSWEEYSELIYAATARLWERKRGTEGTAPGSAL
                     GPFTVCADVPPAILYPQQYWTGKQVLSTVLGIVAHLADPENRHRKLRMQSRAKVSSAF
                     WGQSASEESIVIIRDGELLQGVVDKAQIGAAPFGLVHCVHALYGPEAACDLLSCLGRL
                     LTIFLRRHGHSTGVEDLLLLPSTERIRWEMLKDTQITVGSRVLRRVLGLPADGTVDLE
                     HALAEALRTERGRELELLLDMEMKKELASIASNVSEHCIPAGLRKPFPNNGFALMTAS
                     GAKGSQVNAAQISCLLGSTVLDGRRVPRSVAGWTLPCFRPYESTALAGGFIASRFLTG
                     LSPPEYFFHCMAGREGLTDTAVKTARSGYLQRCLVKALEGVTIAYDGTVRESDGSIIQ
                     FCYGEDGLDPCQALWLQHRAEFMAILLADGTRSAGKFASQSPSNATRKSNAVSAAEVC
                     ATHSASSPKLPPALLEMYETLDEAHRSALLEWYTRSTAAPGDAVGVIAAQSIGEPSTQ
                     MTLNTFHFAGIGVEHVTAGVPRLRELLMFPGSAPATPFMQIPFKEGVSRERAVATCYA
                     LRSVRLRDLILRLQLRLQGAKRNERVHLTLIMVLAEPELWTQVLGISPNNVQAATKKT
                     YGPVLKALIARRLRELDSQQTWSSSSVTLNEKDQDSGEPEAPVETEMLDAGLSDTSSE
                     SSADSVPADNELVARRSTDQDESSELSVDSESEGLEKIASRDHNDEIRSKTTVAPGDT
                     PCLPQVPDAPEDNDAVVVRFPSPNRVEMSLWLPSAAWYTLFLDELALAAAERVPVRAV
                     ENIRNTTLTTREDGGIALRTEGSNIRLAWTLSDDELDLDGLFSNHISEVLSVYGIEAA
                     RARLVRELQTVFAAYGIAVDYRHLSLIADYQTALGACRPFSRTGMRMLDSVPSALQRM
                     SFESASQFLRDAALAREEDQLESASARLCLGQVVSQGTGMFSVLASERCGTVAVQ"
     gene            <106560..>108377
                     /locus_tag="CYME_CMK038C"
                     /db_xref="GeneID:16994394"
     mRNA            <106560..>108377
                     /locus_tag="CYME_CMK038C"
                     /product="probable 2-methylthioadenine synthetase"
                     /transcript_id="XM_005536412.1"
                     /db_xref="GeneID:16994394"
     CDS             106560..108377
                     /locus_tag="CYME_CMK038C"
                     /codon_start=1
                     /product="probable 2-methylthioadenine synthetase"
                     /protein_id="XP_005536469.1"
                     /db_xref="GeneID:16994394"
                     /translation="MQRFVQSQHVFGIWKPGLWCCLREHARWFAAAAGPPSQKRKLLA
                     DGPTLADFLVSTSGDHTGSSVLSKSGTPTRLLERQIDSRRKRPTVGASASVVEALRAL
                     DADLAETPPAPYKVFIETYGCAMNTSDSEIVASILAARPDWFQLLNGPSASPDEADVV
                     LINSCAIRDKPEVRVLQRLSMLRAAERGRGQRAPRRILGLLGCMAERLKTRLLDEMPS
                     KRLVDLVVGPDSYRDLPLLLQGLVRTTDLQRFAYHVQLSLEETYADIAPLRDHGLITA
                     YVSIMRGCNNHCAFCVVPQTRGPERSREPASIWNEIESLGNEGFKEVVLLGQNVNSYC
                     YQSDHPYPKVTKFADLLEGVCEIAERHSMRVRYTSPHPKDFPHEVLRLYTRYAPGTLC
                     RQIHVPMQSGSSEVLRRMRRGYTREEYLALVARIRDTVGADVALSTDIISGFCGETEA
                     EHAETISLMEQVRFDQAFMFAYSERERTIAARLYADDIPKEVKLRRLGEIISTQLKIS
                     AERARAMVGTEQRVLVEEVVHANERQRLDSEISGKQATPAWIARTESNRRVWIPFSEK
                     HTVEGPGPMHKHRQPCIGDYVEVSITGVSGNRLIGEIVN"
     gene            <110778..>113345
                     /locus_tag="CYME_CMK039C"
                     /db_xref="GeneID:16994392"
     mRNA            <110778..>113345
                     /locus_tag="CYME_CMK039C"
                     /product="photoregulatory zinc-finger protein COP1"
                     /transcript_id="XM_005536413.1"
                     /db_xref="GeneID:16994392"
     CDS             110778..113345
                     /locus_tag="CYME_CMK039C"
                     /codon_start=1
                     /product="photoregulatory zinc-finger protein COP1"
                     /protein_id="XP_005536470.1"
                     /db_xref="GeneID:16994392"
                     /translation="MEGGSPAVGRAGSLADAPTSSDPAPTASANDRSNTADPQQPSTS
                     SPLVNAADPGAKNVALVEQTEPATPTASTGNEQHRTTQPAPRQFSPAQRCNHNQVKRL
                     GPALKSLECPICFDLFRAAVTTRCGHTFCFSCIMRHFRNHKSCPVCGGFLTRDQIAPD
                     SSVQKAVRLAQAASPSLLTRSKTSSRVDDVRSSTLVSDEEKPQRKAQRTGTLDTQEEC
                     VAESDGEFKSEAAAAFAALMSQQSGHAGRPRQALFAAGSTHAPREQRQEIAPAASDDQ
                     HRASSRERPILSKQDPIIEQILSDLERETQKGQESNFVDKLKRIASRLSGSEIDQIVE
                     TLLEQRRRLQRMSLGTDYTILKSFLEYNIELKRRELAKIEAELLQLEADLQRANELQQ
                     RRAESMKDSGERGAPEAAEKRVQRMLILFEQLQQRYLELRPPNLKESSPQPAGMDRDN
                     QQSHATRARPYDLGPSPLALSSVTAQSSGHLPTDITEVDADPLEQFAHELCTATKYAQ
                     MRCLTLLRYGEPFRGSNIVSCLDFDMFGELLAAAGVMRKIKIFDLHTVVDHDAQVKYP
                     ICELPARAKLSCLSWSPSTRQHIASSDYDGVVCIWDTESCKLVAEYEEHEKRAWTVDY
                     CPMKPHILASGSDDGNVKIWSTTQRDSVGTIRMNANVCCIKFAPLQHECLLAVGSADH
                     QAYVYDLRSMAQPLHILKGHRKAISYIRFFCSNREIVTASTDSTLRLWDLRSCQCERI
                     YTGHCNERNFVGLSVKPDWIACGSEDNHVYTYYRSLTSPAIVSDFAAEPAQHSAEVVA
                     RSGGALDVAGAPGSRFLQPDSGTFGGPHFVSAVAWRKDTDTLAAANSQGLIRIFELS"
     gene            <114262..>115650
                     /locus_tag="CYME_CMK040C"
                     /db_xref="GeneID:16994393"
     mRNA            <114262..>115650
                     /locus_tag="CYME_CMK040C"
                     /product="unknown TatD related DNase"
                     /transcript_id="XM_005536414.1"
                     /db_xref="GeneID:16994393"
     CDS             114262..115650
                     /locus_tag="CYME_CMK040C"
                     /codon_start=1
                     /product="unknown TatD related DNase"
                     /protein_id="XP_005536471.1"
                     /db_xref="GeneID:16994393"
                     /translation="MKPERQDEGILRWRLPRQKSAVQLAYVSLKSFPHGFRLRKALRY
                     WLSSSLGAWQRVHCSSGNAAGWTHCQRGRHGCCLSHTTRKAGIRLVQRFQSGRSFQAC
                     EALPAELTTTMAHRYFDAAANLTDEAFLGVYNGKRYHEPDLDRVLERAAQENVREVLV
                     TAGSLDQSKEALLLVRENRKQLAASSATSLPKLFATVGVHPTRCSEFFPKEDTASADA
                     EAHAREHLHALRALIEQGVGAAGGTQAPDENLDDDAVVAIGECGLDYVRTQFCPPAVQ
                     QRGFKLQLQLAGETGLPLLLHNRESTADLVQLLTENRHQIRAGGLVHSFDGSAEEAAM
                     LLDLGFHLGVNGCSLKTEENLRVVRESIPLDRLILETDCPYCELRPSHASYQFMHKQG
                     IDIAGYGWAGRARADKKRFCTGVGVRGRNEPCSIVQICAVVSSLKGVPMAHVAEATRR
                     NALSLFRCSEAV"
     gene            <115683..>117536
                     /locus_tag="CYME_CMK041C"
                     /db_xref="GeneID:16994391"
     mRNA            <115683..>117536
                     /locus_tag="CYME_CMK041C"
                     /product="pyruvate kinase"
                     /transcript_id="XM_005536415.1"
                     /db_xref="GeneID:16994391"
     CDS             115683..117536
                     /locus_tag="CYME_CMK041C"
                     /codon_start=1
                     /product="pyruvate kinase"
                     /protein_id="XP_005536472.1"
                     /db_xref="GeneID:16994391"
                     /translation="MLGFLLQFPRASSRDQPWSGKTRWLERRVAHSSGGRSKTLQSSR
                     GGLGRSSKKRWALSGTLADASGRPISAGQGEMHNGETTLGPSGSAAPTTTTAAVVDAA
                     IGGGQNRLPRERPVSVAVAGRNQLSSQRWSKIVCTIGPKTCSLEAIYQLAEHGMNIAR
                     LNMSHGSHEWHHNVIEKIRAVNKSGKYNIGILLDTKGPEVRSGDLKAPIKVARGQRFI
                     WTVRRDIPPEQLASDFPYITDVSYDDFINDVNVGDILLVDGGICSFVIVEKRGLDVIS
                     ECLDEGVLTSRRHLNVRGKSASLPALTEKDWDDIRFGVERNVDFYALSFVKHEDDIIQ
                     LQEYLREHAPGQTPLVLAKIESAQAIPRLRQILEAADGAMVARGDLGAEIPVEEVPIV
                     QEEIVYLNRAMHKPTIVATHMLESMIVYPTPTRAEVTDITEAIRQGSDATMLSGETAN
                     GSYPLEALTVMDTVAKSVFHQEQEGLLCAALSPVERSTGATLERDLLSDPMVSMTEAA
                     ASLATGVDAACIIVFTKSGRVASLVSSARSRCPIYAFTPSESTARKLTLFWGVTAFSL
                     EFCPDPEVTVHRSLEELTRRGLIRKNELAVIVSDLLVRDDFSVDSIQVRRA"
     gene            complement(<118378..>118908)
                     /locus_tag="CYME_CMK313C"
                     /db_xref="GeneID:16994389"
     mRNA            complement(<118378..>118908)
                     /locus_tag="CYME_CMK313C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536416.1"
                     /db_xref="GeneID:16994389"
     CDS             complement(118378..118908)
                     /locus_tag="CYME_CMK313C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536473.1"
                     /db_xref="GeneID:16994389"
                     /translation="MESKRPHVDLQDFLSRKRQFERERRAHRRKLLESRRARVRRRVQ
                     EFRRMLVLLEGRAASGEQTEQINARAPDQFSVQKNASPDKDGEQFADQSNRSSTERVP
                     KRYAQAISKGQEARTKRQAELFEREQQRQRLSEERERRAQLRENQRTAHLRRTRKGQP
                     YLNLQIEALLAKLKRG"
     gene            <120823..>122535
                     /locus_tag="CYME_CMK042C"
                     /db_xref="GeneID:16994306"
     mRNA            <120823..>122535
                     /locus_tag="CYME_CMK042C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536417.1"
                     /db_xref="GeneID:16994306"
     CDS             120823..122535
                     /locus_tag="CYME_CMK042C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536474.1"
                     /db_xref="GeneID:16994306"
                     /translation="MDLALPHFPSTERKRSDSSGRVEQRARVADFQQNVNVSQSGNCV
                     EGCSVPPRVLPKRPILKQRRPVDKSPDSTYLSSTSGNPRCIRFESVVRVINDGSSSPL
                     KEGTVAYVGEWLRAELVEKRLEQVFSKPASLLTPQDIYDVVYAQSESMLSAVHVYDPA
                     GPPVQKTTSTTQVFGVAPPEPREDSAYELSNMDKDTDDQPEDPEVKSVPETAPVLESL
                     GMRHTQRSSSTVATGIFWCFRRSTVRSDDPTRSKVSMEKEFPRTSVSRNEKPNDFDLS
                     SPEKTTEETLAGMEACVSPAQRRSTSLGLVPDFDCERIYAHLHTERIRILAMDLVKYR
                     AGNVFHDACIAFICRSLLPHRVTEICTGEPIQFQWLKELGCSVCDTSILFGPYSMLAM
                     LLTLQYISSHLRVSRRLLQSDVTQTIGSAQACTDVESQEVIGLSQGPQDRTGCGASGI
                     RLGGCTASSAKPEELTMNQKRDRFYFLELCLRLATALIHLLRHGRLNAICNYTDRVRL
                     ALDLLLAGWLADFWKRWERGRIRSVEAYILAAQKKIADGIGVLAMIRAGTRTEDASAI
                     ALYD"
     gene            complement(<122977..>124479)
                     /locus_tag="CYME_CMK043C"
                     /db_xref="GeneID:16994390"
     mRNA            complement(<122977..>124479)
                     /locus_tag="CYME_CMK043C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005536418.1"
                     /db_xref="GeneID:16994390"
     CDS             complement(122977..124479)
                     /locus_tag="CYME_CMK043C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005536475.1"
                     /db_xref="GeneID:16994390"
                     /translation="MDRGSVFDAGGTPTECQRTYPLHYTAERKSSSVEPPSPRYAIPA
                     LTSSSSAGLETSEDSGSHAQPSVRSEGEREARSAACALQRLSFVNDSGENVLERNSSG
                     ASSVTSAPDNLTPGAPNSNTSNSRDVRPRKPYVKSKAREKWTEEEHQRFVEALHLFER
                     DWKKIQKHVGTKTVLQIRSHAQKYFLRIQKHTTGEYIPPPRPKRRSASPYPRNSKSPT
                     REESPEDTAQKAQLVDEDRVLPVGSAEFKRSNSDPYQSASCSYASPLTYQECPVYYSE
                     ELPHYAGRLPTEAKRAMSAPPASVEEYERTRLMIGMQRAAYATDERRRKYAACTQSAY
                     NLLLCSQSCGTTGSYHSTQGAGFPTDSLQCTDIKADVPWGQARALAAPGAFMSMNGPA
                     HPFMLHPNRPQYGWTNVPFPPTHVHPWYPISVCGAGLGGSGSLQDFYCYGFASTRAAA
                     AWKPSGLAQSQGLGTASSCENIPHRGHAADQWRYAGSTYQAKQPPGDGSV"
     gene            <126839..>129004
                     /locus_tag="CYME_CMK044C"
                     /db_xref="GeneID:16994388"
     mRNA            <126839..>129004
                     /locus_tag="CYME_CMK044C"
                     /product="sigma subunit for chloroplast RNA polymerase"
                     /transcript_id="XM_005536419.1"
                     /db_xref="GeneID:16994388"
     CDS             126839..129004
                     /locus_tag="CYME_CMK044C"
                     /codon_start=1
                     /product="sigma subunit for chloroplast RNA polymerase"
                     /protein_id="XP_005536476.1"
                     /db_xref="GeneID:16994388"
                     /translation="MEGYVPVPISNSRAGRWTGTGSDGTRVFTQARDVCTRVPVLDTQ
                     LCMSHGAHPISKANVRLAFQKPGGVLGQVNVSVFAQNGCEIKPGCGNRVAVSKSEAHA
                     LGSESSCFTHGSRCLYPHPQRKSAQENVNSVDTDRGDTRMIAVGPRRTNARRSDNPEK
                     LEDSCESDSVITGIILRSPDEAYQDRGDHAGLEHAVASRNQRRNKIPRVDPRGLAAYA
                     DELLAAADIDIISLSAEFGSVDRNSRNQRTRISFPGSLRAYVRGLERQYQFEQSSDAP
                     ESVAEAENKMVKRSSPAAKGKSSLTRSEKRAAAAKTKGRQPRARKTERLTGAQVRMRA
                     GPRMKNTVSTGDASVASVNSNSGTVDPFDGIFSGLDDEEPDLDADSDKLLDALVEEDE
                     SAEAEPNTGERKDDTIRSYLYEIGRYQLLQPGEEVELSRQVCVLMDLERFQKSFREQH
                     GKSPTELEWARGCGYGEDVEALRKHIRDGRSAKERMVTANLRLVVSIAKRYSNRGVAL
                     QDLIQEGSIGLIRGVEKFDAGRGFRFSTYATWWIRQSITRAISDSSRSIRLPVHVHDT
                     ISMIRKHTKALHTQLGRPPREDEICESVGIDIAKYRLIMECSQNIVSLETPMHGTDDI
                     HNLGESLISPEERSEDTVSRDTLRDSIEKVLRCLTAREREVIRMRFGLADGRPRTLEE
                     VGVKFNVTRERIRQIESKALKKLRIPAENNFLDEYLTEL"
     gene            complement(<131371..>132774)
                     /locus_tag="CYME_CMK045C"
                     /db_xref="GeneID:16994381"
     mRNA            complement(<131371..>132774)
                     /locus_tag="CYME_CMK045C"
                     /product="pseudouridine synthase 3"
                     /transcript_id="XM_005536420.1"
                     /db_xref="GeneID:16994381"
     CDS             complement(131371..132774)
                     /locus_tag="CYME_CMK045C"
                     /codon_start=1
                     /product="pseudouridine synthase 3"
                     /protein_id="XP_005536477.1"
                     /db_xref="GeneID:16994381"
                     /translation="MSAVQNLSKLSRAELEAYAARLEQLLGLKRSSSRNKNSAREINF
                     KEYGVRKIALKLAYQGWSFPSGFAAQPADFSTSSAGKLSGIAFKSVESALFYALEKVN
                     LVPNLHWFVGSDGTCATGVSPNRPLSREKFGETWAVKGWQYARGGRTDKGVSAIGQVV
                     SLLVRCPPPGTGTNFYDYIHLLNRELPASVRVYAWAPVADDFSARFSAYSRTYKYFVP
                     NVFSDEGICSMVAAAKKMVGRHDFANFCKFDAETTKGNTERVILQCTVELAKDEFYRA
                     LFPRGILEFTIEGQAFLYHQVRFMIALLLEIGRGTENISLVDSLLGLDGSPRIDPRPQ
                     YVQAPEHPLVLWNIHYGENEPPWRYALERDSPWGKCSRNSTVVGILRPILLQWYADLT
                     KVIFNGALLRRTTHGSPFCKDEGSEAANEPCAGLAPLMFTHMVDADVHVPIEKRSSSG
                     LNAEQRIQKVRRLLDRQ"
     gene            <135094..>136485
                     /locus_tag="CYME_CMK046C"
                     /db_xref="GeneID:16994382"
     mRNA            <135094..>136485
                     /locus_tag="CYME_CMK046C"
                     /product="uridine 5'-monophosphate synthase"
                     /transcript_id="XM_005536421.1"
                     /db_xref="GeneID:16994382"
     CDS             135094..136485
                     /locus_tag="CYME_CMK046C"
                     /codon_start=1
                     /product="uridine 5'-monophosphate synthase"
                     /protein_id="XP_005536478.1"
                     /db_xref="GeneID:16994382"
                     /translation="MEQLAKDLFEIGAVKFGTFKLKSGIASPFYVDLRVAVSYPRVLR
                     SIAALYLECLQDFSGAFDVICGVPYTALPFATAMAVQGDLPMVMCRKEVKDHGTRRVV
                     EGAFTQGSRCLIIEDVVTSGSSILEVVGALRAEGLKVDHAIVLLDREQGGCEALLGQG
                     IGLRSVFRISDLVGTLRNLNLLEPGKVDMILDFIRTARAASDVKRPETNVPSALPVAA
                     SSSSPVRDQLYSIAEKKRSILCVAADVQSTKELLGIADAVGPHICVLKLHADIIQDWT
                     TDTSRRLRELADKHSFMLFEDRKFADIGNTVVAQFSAGVHRISSWADIVNAHAIPGPG
                     LIEGLRHACAISGRMIGLLLVAQMSSKGNLIDERYTATCLRMAREAFPFCIGFIAQER
                     LDPTGKLFVMAPGVQLDSKGDQLGQQYNSPQYLLKRKGVDFLIVGRGIYGSEEPAKAA
                     QMYKELSWSVLHG"
     gene            complement(<136941..>138443)
                     /locus_tag="CYME_CMK047C"
                     /db_xref="GeneID:16994383"
     mRNA            complement(<136941..>138443)
                     /locus_tag="CYME_CMK047C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536422.1"
                     /db_xref="GeneID:16994383"
     CDS             complement(136941..138443)
                     /locus_tag="CYME_CMK047C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536479.1"
                     /db_xref="GeneID:16994383"
                     /translation="MSAFTRVVHLYFLRLVAALAVFALLKVVFRFGVDWRFRGKPPYP
                     LDLPRPGRAPLLNKPERCFLSISSDDWGRWADAVPIFPDIAFASSHEELQTAPAGFWY
                     RLATSETREDLENLGSLLERLNADVTYEKRVVLTPHWIVGGPDFEAMRKLSRPLAVAC
                     HGRDSGRQDRCGYIELLLHDSAGGLSRPPYSRGDLRDLYRKLYMNELWHPEYHGRSHF
                     SVSRWLRELNIAGSKAEACFNHSLVCGSSEIALRSEFDWFDEHQHLLEWIQGGLHSFR
                     AFWGYRPRVLSSPHNTWTPWLADAARYAGFIGTSLGDVQKVYRMDGGLVITNRPRFDA
                     FYPGFDCEKSVNEIIKTLNSTKFANIMWHAQNAMRSTYSLEEYEKHLSCFERLIGKVR
                     AMLPGLAIVTESELHQIRVRGWSAEIWNSSIVYRNYQRTPVDVYAADPTAFGTVESWH
                     GKDLVMEELQGKATKTGPNSALHTGDTIRLYPDSIIRVRVSESRATIPSS"
     misc_feature    complement(138545..141072)
                     /note="repetitive element"
     gene            complement(<141619..>142956)
                     /locus_tag="CYME_CMK049C"
                     /db_xref="GeneID:16994384"
     mRNA            complement(<141619..>142956)
                     /locus_tag="CYME_CMK049C"
                     /product="similar to biotin synthase"
                     /transcript_id="XM_005536423.1"
                     /db_xref="GeneID:16994384"
     CDS             complement(141619..142956)
                     /locus_tag="CYME_CMK049C"
                     /codon_start=1
                     /product="similar to biotin synthase"
                     /protein_id="XP_005536480.1"
                     /db_xref="GeneID:16994384"
                     /translation="MPCRVLRTSLPSVRELLRRAPKRLEVEHVTTLLSVEDPNDVAEV
                     IQRADALRREQTGDAVSFVINRNINFTNACIKRCGFCAFSRTPRGMHKSETYYLPLEE
                     IARRAREARDLGATEVCVQAGLPPGASADLYTRVASCIKEAVPNIHLHAFSPEEVLYG
                     AQLRGVTTNEYLKLLRDAGVDSLPGTAAEILVQEIRDKISPGRITVSQWIRIAKEARL
                     SAGLRMTATVMFGHVETPAHIARHLLTIRALQHEVGVFTEFVPLGFVHWEAPMCREHD
                     PRYLAECRDGPSPAQRLLVHAVSRIVLGDCIRNIQCSWPKESPEGTIRLLQAGCNDLG
                     GTLMNESISSAAGAKHGQVMTPREMRRIATAAGPERYLIQRDTLYNILHREPSCALDE
                     YAGTKGNLRFGSFHELLKSNRFRFHDALRSETANGTSRNRSTWVRSRAPDAVQ"
     gene            <143062..>144576
                     /locus_tag="CYME_CMK050C"
                     /db_xref="GeneID:16994385"
     mRNA            <143062..>144576
                     /locus_tag="CYME_CMK050C"
                     /product="lycopene beta cyclase, chloroplast precursor"
                     /transcript_id="XM_005536424.1"
                     /db_xref="GeneID:16994385"
     CDS             143062..144576
                     /locus_tag="CYME_CMK050C"
                     /codon_start=1
                     /product="lycopene beta cyclase, chloroplast precursor"
                     /protein_id="XP_005536481.1"
                     /db_xref="GeneID:16994385"
                     /translation="MFVANLPETVYSRRGVLKSPQKSGVCWKLPKTANAAPVKYLERD
                     RRFRKPQVAVCLEAGQRLSQQENPPKDTSSLYFDIAIVGAGPAGLALAAELSELNLSS
                     ELSPVGKVVSIVVVEKDFSRRWLPNYGVWVDEVEHLDIKDCFAAVWPKVAVYLPHKII
                     KKREYARIDRQKLKQKLTAKCLRNGSGIVLQEGEVKGSDLEKGILRLRCTSANGQFSE
                     LEIRARRIVDTTGHSTVLVKFTEPHHPSYQAAYGIEALVESHPFPLDEMILMDYREPS
                     SIQRLPKGPDSSYYSVPTFLYAMPMASDRIFVEETSLTARPAVPFEELRDRLYKRLKD
                     LGITVNCALEEEFCLIPMGGSLPDLDQPLLGFGGTAGLVHPATGYMMARTLNLARPLA
                     RAIFLREARNLETNPWKEVLWTRTNVIQRDFYTFGGEVLLDMNLNEIQEFFAAFFKLR
                     EEAWKNFLSFRQLSGQERLAFGLGVFLKTTNKVRFKLIRKALQNWRPLIRSILS"
     gene            <146129..>146581
                     /locus_tag="CYME_CMK051C"
                     /db_xref="GeneID:16994405"
     mRNA            <146129..>146581
                     /locus_tag="CYME_CMK051C"
                     /product="similar to frataxin"
                     /transcript_id="XM_005536425.1"
                     /db_xref="GeneID:16994405"
     CDS             146129..146581
                     /locus_tag="CYME_CMK051C"
                     /codon_start=1
                     /product="similar to frataxin"
                     /protein_id="XP_005536482.1"
                     /db_xref="GeneID:16994405"
                     /translation="MLLKAARLWHCVVFGASVQRSSRRVGPIAEYSPRPRCPEDWPIA
                     QFSREAEELLQQLGDQVYDTFQGRTDVDVEFSQGVLTLRFPNGTFVLNTQTPNRQIWL
                     SSPLSGPARYYYDLDTGKWRNSRDDHMLVDRLQKDLAVFTGCNIQLNL"
     gene            150934..152279
                     /locus_tag="CYME_CMK052T"
                     /db_xref="GeneID:16994402"
     misc_RNA        150934..152279
                     /locus_tag="CYME_CMK052T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461373.1"
                     /db_xref="GeneID:16994402"
     gene            complement(<155922..>158084)
                     /locus_tag="CYME_CMK053C"
                     /db_xref="GeneID:16994403"
     mRNA            complement(<155922..>158084)
                     /locus_tag="CYME_CMK053C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536426.1"
                     /db_xref="GeneID:16994403"
     CDS             complement(155922..158084)
                     /locus_tag="CYME_CMK053C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536483.1"
                     /db_xref="GeneID:16994403"
                     /translation="MATLGSSEALRTGSGRSRPPEPGAEWAEVTEAFFAATQCLAPDE
                     MVFTGKSFRWASCISAVELTSPNLDSGASLPLGKTYLDSVQEGIVPDSIDELFCTEVW
                     KDTPALSLIKTSLSTAINWADGRCSLPELMLPNLYIFKALFREEHPGTAFTSFLNECC
                     IFFVRHIRALILHTNVHFEEDISVKMQLPFKLVRKISGNVPVFDSESTSKAIGQNVCP
                     FLRDQAVREVAEAAGSVGLDPRLQAQLIGHIDIWWHLCILASSTGQTLSDLNSQAHIL
                     QRLLSDLSVVAFHEEQDESTLGFDAAVVRHLLPPSPPMRMPRMKHKDALASIDDFAAF
                     CIRLDRASRFLRGKLAPPPFPSLERCTVACFDLACICVELHGRERLAGVSRACLCKEM
                     ISVARSFVHAYDQKTEGPHRTFDAERSTAIADASIEAEQLLPIIEVLIHVLCMNSGRQ
                     RRRLLRVLRKIGRDNGTRQAVLAALNSATGRGLRCRALSKAVETLRGIDMGRAALALW
                     IVLRIIDLGFDLELYSAIELRYLQALELLLLRSIDSILSFWYDPNEEHVSLHLLRARL
                     VLSRREYVRDVEVQDSARNVSENSCPRCSIQENVDGATHKSALIHGACSENELPPKEE
                     LSESEQAAFALRFRSLFDFVPISPGHVNSMLRGRYTLLREARHDADLAALESFKAAVQ
                     SLLTDVLKPTGNAPVGSVHHVLHRLRAVYGSCACLCEA"
     gene            complement(<158760..>160052)
                     /locus_tag="CYME_CMK054C"
                     /db_xref="GeneID:16994386"
     mRNA            complement(<158760..>160052)
                     /locus_tag="CYME_CMK054C"
                     /product="nucleotide excision repair protein yeast rad23/
                     human HHR23A homolog"
                     /transcript_id="XM_005536427.1"
                     /db_xref="GeneID:16994386"
     CDS             complement(158760..160052)
                     /locus_tag="CYME_CMK054C"
                     /codon_start=1
                     /product="nucleotide excision repair protein yeast rad23/
                     human HHR23A homolog"
                     /protein_id="XP_005536484.1"
                     /db_xref="GeneID:16994386"
                     /translation="MRLTFKTLDNKNLSLDGISPDTTVEELKRELGGREEFRWDPART
                     QEARLIFAGRVLSDPTQKLADCGMQDDDFLVVMPPRVATQRSRKTASVSSADAQLKTP
                     LQAGLASEATDSATIASEASRGIPADSPPASVSAKSSGATPAESGALSQTPQVEGTTT
                     SGIASSGLAVGDEYSLYMNRMRDMGFDDGSIERAMRAAHYNPERAIEYLCNGFPANTE
                     SLTEPLNDEARRPEHQTLPAQAGMDQTSRPAEAVHPELQQSRSELDIIRRLPHFALLR
                     RAIQQDPSQIQSLLAELRRMNPRLLDIIQRNQADFINMLNEPVTDEEAGREMRQLREL
                     VAQQGRGNMYAGADAPSMEPTNAIRIEVSQEEAEQLRQLEQMMEPMGVSRDTCLQVWL
                     SCDRNTELAAMHLMDNLEDYTAEYGAESDTDVGDHGES"
     gene            <160518..>161468
                     /locus_tag="CYME_CMK055C"
                     /db_xref="GeneID:16994387"
     mRNA            <160518..>161468
                     /locus_tag="CYME_CMK055C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536428.1"
                     /db_xref="GeneID:16994387"
     CDS             160518..161468
                     /locus_tag="CYME_CMK055C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536485.1"
                     /db_xref="GeneID:16994387"
                     /translation="MSCNLDTRARCERPSVVQPGSTTKCMANSLLFLYRVLSVFVLLG
                     AVTYLRVFQHDLSLITFSSQTLVLLAVSLTTLHLVALLNCRRSRSQPIMIALSRDVHA
                     EHHFPELEADVSPQFVLDDVEEGSSGTADTSISREMERSKTVHSVSMHNREDSVSMWQ
                     QYPAHTRSEAPCSKLPAFVESVFLLALANSIFLDAVWWLILRPRGEPSAPRRFSTYLL
                     HGPINVIMGSMEVLIGTIRARRAALVMGSLYLALYFLFAFMYHQARGEWLYFFLNPRS
                     RRNWFILIGLVSWYYACYALIFLVVAARDWMKVRLALRAK"
     gene            complement(<161886..>163754)
                     /locus_tag="CYME_CMK056C"
                     /db_xref="GeneID:16994418"
     mRNA            complement(<161886..>163754)
                     /locus_tag="CYME_CMK056C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536429.1"
                     /db_xref="GeneID:16994418"
     CDS             complement(161886..163754)
                     /locus_tag="CYME_CMK056C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536486.1"
                     /db_xref="GeneID:16994418"
                     /translation="MLTAHYLLASALLVVCFLWVSSGTTASLLGPSGSRGPPSFPNGA
                     AFSNATAYVSLDVLGRLQPLKLADLNADEYIDVLAIEPTTGRLYVSFWNHNLYRFGSP
                     VLLTENVTHAITADFNGDGVSDVMAFTNAGTAALLLGSHSSNFSSGASIAVNANVSTA
                     MLFSRYGDLLPDVLVPEGNGSFLVLTNRRKAKGTFQLSQWTPALCSIEKNITAFVDMN
                     GDCLPDLVLLCSDGNGSSRLQPNPMPPRSREGPPQGPPSATGSGPQIAVWYSPGTGDI
                     LSSTTPSKVWTPFGGSLQVEQLLFADFTGSGTISILALTSNGGLSFVSNNHGNGGYGQ
                     RCNFHGSANLLNSVAVAISSSSGASNVPLRPSAQMVLVDYNYDAFPDLYVMNGSTGVI
                     LKNTAQKNSLAFQLQTQESFSALYNVSEPVVAAAYDTDQDGRQDLLISASDGIELWLN
                     TISQTRNFLETAVQTAVSPYDNPRPFTESIGSTSIVAFQATNGLQLYACTQCPQSGSR
                     QFISACQCFTGLNTMLNYVQEIAIGAGSSQRSWTNLLPNSFAIIYPQDPSNPNTWRLE
                     FYTQRNLRSVIGVIIVLASAMILLGGIILFLLWREYCQDKQARLAREAYQSFGQYS"
     misc_feature    164021..167149
                     /note="repetitive element"
     gene            <167218..>168384
                     /locus_tag="CYME_CMK058C"
                     /db_xref="GeneID:16994416"
     mRNA            <167218..>168384
                     /locus_tag="CYME_CMK058C"
                     /product="geranylgeranyl diphosphate synthase, chloroplast
                     precursor"
                     /transcript_id="XM_005536430.1"
                     /db_xref="GeneID:16994416"
     CDS             167218..168384
                     /locus_tag="CYME_CMK058C"
                     /codon_start=1
                     /product="geranylgeranyl diphosphate synthase, chloroplast
                     precursor"
                     /protein_id="XP_005536487.1"
                     /db_xref="GeneID:16994416"
                     /translation="MTPPFFCHTFCSAGAFVPVNVSHFRAQLRKQETCEELASRDAWG
                     RSRSRGNCLHGKNLPSRHRQALLLLGTATAGSSAEVRHGSPKSRTTEAVEFLLAKRAS
                     IDAALNDAVQATSVMNARLAEAMRYSLLAGGKRVRPALVLAACRMFGGVDEQAMPTAV
                     AVEMVHTMSLIHDDLPAMDNDDFRRGRPTNHKVYGEEVAILAGDALLSEAFSQIAEKT
                     PATLVPPSRTLEVIRRLGNCVGLHGLAAGQALDLEAEGKPADEISLRMLETIHLYKTA
                     ALLRFSITAGAILAGASVDDIDCMESFANKIGLAFQVADDVLDVTATTETLGKTAGKD
                     VAAEKATFPRILGLEESRKYAEDLVKEAKGELAKYGDRASLLLGFADFIIQRAS"
     gene            <170564..>171715
                     /locus_tag="CYME_CMK059C"
                     /db_xref="GeneID:16994417"
     mRNA            <170564..>171715
                     /locus_tag="CYME_CMK059C"
                     /product="RNA polymerase I, III common subunit"
                     /transcript_id="XM_005536431.1"
                     /db_xref="GeneID:16994417"
     CDS             170564..171715
                     /locus_tag="CYME_CMK059C"
                     /codon_start=1
                     /product="RNA polymerase I, III common subunit"
                     /protein_id="XP_005536488.1"
                     /db_xref="GeneID:16994417"
                     /translation="MREPPVVARDGSLFDPNKEQERVRIRKTLHRIDEVSFEVSGVDA
                     PFLNALRRVLLAEVPTMAIEYVTVNENSTVMNDEFLAHRLGLVPVLADPRRFEFRRES
                     DEPSAQNTICFRLRVPPVNRKAHPEWNLSDGAVFAGDDAVPSIPVYSDDIIWEQLQTR
                     VGESCLSSTEGASPHRSSSDAQQQAEATDGLASAADSTAAVEPVQVQRGILLTKMLRG
                     QRLDIRMEAVKGLGHDHAKWSPVATAYYKMVPRVHLKGELKGELAETIRGACAVHVFD
                     IEESAGTLKVEDESRCTLCGECVRILEDKPQLLDSERPDNYSKFMQPMETDLRKVYEN
                     DFVSVCQQTDRFVFFIESVGQYRADVLFGEALAIFHSKCTKILEALQNE"
     gene            complement(<174288..>174866)
                     /locus_tag="CYME_CMK060C"
                     /db_xref="GeneID:16994408"
     mRNA            complement(<174288..>174866)
                     /locus_tag="CYME_CMK060C"
                     /product="nucleoside-diphosphate kinase"
                     /transcript_id="XM_005536432.1"
                     /db_xref="GeneID:16994408"
     CDS             complement(174288..174866)
                     /locus_tag="CYME_CMK060C"
                     /codon_start=1
                     /product="nucleoside-diphosphate kinase"
                     /protein_id="XP_005536489.1"
                     /db_xref="GeneID:16994408"
                     /translation="MFVPSLGFSLRENSVTSTVCCKRNQISVQPSQLRLGKFLVMNRR
                     ERTFTAIKPDAVHRGLVGEIISIFERKGYKLVGLKLVLPDRKLAENHYSELRDKPFFP
                     DLVDFISSGPVVAMCWEGKDVVRTARKLLGATNPLESEPGTIRGRYGIDIGRNVVHSS
                     DAVTTAEREIQLWFTEHELVDWDPAVARWVYE"
     gene            complement(<178993..>180258)
                     /locus_tag="CYME_CMK061C"
                     /db_xref="GeneID:16994414"
     mRNA            complement(<178993..>180258)
                     /locus_tag="CYME_CMK061C"
                     /product="DNA repair and recombination protein RecA,
                     chloroplast precursor"
                     /transcript_id="XM_005536433.1"
                     /db_xref="GeneID:16994414"
     CDS             complement(178993..180258)
                     /locus_tag="CYME_CMK061C"
                     /codon_start=1
                     /product="DNA repair and recombination protein RecA,
                     chloroplast precursor"
                     /protein_id="XP_005536490.1"
                     /db_xref="GeneID:16994414"
                     /translation="MFISLAGDPCFVRGKALKRATGPVSRGRVTARKSTGFLALALKA
                     VDGRSPELTPSSDELATPANRNGISEDAAAKLHSLKQVLDQIEKTHGRGSIMRLGEVD
                     RMRVETTPSGSLTLDVALGGGYPKGRLVEIYGPESSGKTTLALHAIAEVQRSGGVAAF
                     VDAEHALDPQYAAALGCCTDDLLVSQPDTGEMALEIVDQLVRSAAVDLVVVDSVAALV
                     PKAEIEGDMYDNQMGLQARLMSKALRKIAGSMSKSQCTVIFLNQLRVKVGVFYGSPEV
                     TSGGNALKYYSTVRIDIRRKETLKDNSGIICKVKVAKNKVAPPFRVASVKILFGKGID
                     RIGSLLEAAEHVGIIVRKGTWYALNGEQFAHGRSAAEQRLRDNTELANQLEVLVREGM
                     SKIPLPREFDDDVFVAEDLAPPEESMLEI"
     gene            complement(<182248..>185055)
                     /locus_tag="CYME_CMK062C"
                     /db_xref="GeneID:16994415"
     mRNA            complement(<182248..>185055)
                     /locus_tag="CYME_CMK062C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536434.1"
                     /db_xref="GeneID:16994415"
     CDS             complement(182248..185055)
                     /locus_tag="CYME_CMK062C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536491.1"
                     /db_xref="GeneID:16994415"
                     /translation="MWIGSEPGRACTDLSGANCGSRPKRTFSEPDKAMEDELLGAVPS
                     VCHTVHTKRTCAPDPEALTTGTLSSSGEVYAKGVVCSSDASAALDGGSSTTEASTTSS
                     TMPLERLLLEEERKVRDYQQSSRSLRQSVPPAMLRLAIKYSAEVLQHVEELKSCSRRV
                     IEAEGTPILASFPVDQESISSIPGELARFGSGCVVAGASSQETAFWTLAQAFAAEARC
                     ADVGHVKTLMEQCMICLPGGIVLERNIKMKRMIGDVLHSELSHLSPGVELAAEECRCF
                     EVLCSALQNPSHQVFLFDVLDPALVSETQSNPRETNSSRMVAFGSWKEAKALFIDIQR
                     RIDICLDLIMHALDTKASSLVRKSSVVDSIISRADRLKKRLEQRRDRNEKSRKRKPES
                     EPLSPQLQQDVGVGPDQSSCNEMKADEAESENGIKEVSPCLRSAKRRGKNRSHRAESQ
                     IGNEDGKQSAKTLFRFMRRRSEMENTMSIAPMKTVTFCGPLALQFDSPLREKAPLDAR
                     NVPSTAEEDTIWGPDCARAPRRRLSLAMDVLVAASRARQQDRTVTPAHQQPDIAVLVR
                     ELRLARKSYFVQVFLQRWSRGVICKEAITRFSNSEDVELVERGIQHIRADGDGGVLSK
                     ALLNQVWVALHRKQITAYSCISGRFVRPGYRYLHFYENSRPPYHGPWPLMEQVHKIRP
                     RAPFAILDDDLIDYDCDSDMEWEDDDSGEDLLSTSDEESAHGSSSCSGSSLECDTDTD
                     FIADDDASSDSESCHSSVSRRGSSNVVSQTEMDSGNPSFSHQESDARTAELRKLRKPF
                     ERRSRVVHLSADPDKVLQRFKVILSSAAPTDLSIEVPGASMTPAPSSQTPTKVTSPKH
                     SAHEKLSEKRPCPREHETHNTNIWAAFQKVICRRVRPFHDASSHSPALKQHDDGSLME
                     TCGLDQSESEKADLTKRDSGS"
     gene            complement(<186412..>187563)
                     /locus_tag="CYME_CMK063C"
                     /db_xref="GeneID:16994432"
     mRNA            complement(<186412..>187563)
                     /locus_tag="CYME_CMK063C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536435.1"
                     /db_xref="GeneID:16994432"
     CDS             complement(186412..187563)
                     /locus_tag="CYME_CMK063C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536492.1"
                     /db_xref="GeneID:16994432"
                     /translation="MKNRVPTKLANVQQSSLGFANSALWSRKIAALYLRGAHCAAYRV
                     RTSAPPGRFGNCGRLQVDTRHTKTLGFGFHATCTRIRNDSKILPRRNAGCIRMTASKS
                     ALAARIVLSGLIGLTAGFLGSLIGVGGGIIMTPLLTSVAGLSQHEAHGTSLVAVSFSS
                     CVGALAYARGRAVHLTAALIVALGAVLTASAGAAYSSRVKSALLRKYFGVFVLIIGVL
                     NFLRSLGLMYVQNTGTSSSAALSLGDNSGDLPRTMRIALTIGAAGCIAGFFSGLMGVG
                     GGTIVIPFLSYIAGFGQREAQGTALAAMVLPSFSGAVTHSRLGHVKNELLFGLLGGVL
                     FGSWIGSGVALRLPYTRLLQVSAVLFVAMGIRSIVTARRGSPRMSEQAE"
     gene            complement(<189222..>190451)
                     /locus_tag="CYME_CMK064C"
                     /db_xref="GeneID:16994425"
     mRNA            complement(<189222..>190451)
                     /locus_tag="CYME_CMK064C"
                     /product="eukaryotic translation initiation factor eIF-2B
                     alpha subunit"
                     /transcript_id="XM_005536436.1"
                     /db_xref="GeneID:16994425"
     CDS             complement(189222..190451)
                     /locus_tag="CYME_CMK064C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-2B
                     alpha subunit"
                     /protein_id="XP_005536493.1"
                     /db_xref="GeneID:16994425"
                     /translation="MHEPSIRERVSKDVQPDSGSLVSTSTATNAGRAAPWTSVPSSEG
                     ACAAPTGTDGSSIFTQRKQSQLDVTYLLAAQAKPGQPHEVAGVPEPEFDVLTRFRSEL
                     ARETPAAPAAVHVLTDLIRCSRSETIYGLELEVRRACDKMISYARSSELSVRAACELF
                     VKFITRTSFDFPDFAECKMRLIQRGEHFRAMTDTCRERIAVFGEPFILQGSNILTHGG
                     SRVVFSIIERAARMKRKQFRVVVVEGRGRHDAALSSGMTAKTLRFCCDVMRLGIQVTI
                     IPDSAVPAAMEVIDIVLLGAEAIAESGAVINQVGSLGIALAAKTFNVQVFIAAESYKF
                     VRIYPLTQRDISKTDSDHAPRSYRQMTRHEEIPKQLQFECPPSDLTPGSYIHLLITDL
                     GVLTPAAVSEALMKMYH"
     gene            <191968..>192990
                     /locus_tag="CYME_CMK065C"
                     /db_xref="GeneID:16994426"
     mRNA            <191968..>192990
                     /locus_tag="CYME_CMK065C"
                     /product="unknown transporter"
                     /transcript_id="XM_005536437.1"
                     /db_xref="GeneID:16994426"
     CDS             191968..192990
                     /locus_tag="CYME_CMK065C"
                     /codon_start=1
                     /product="unknown transporter"
                     /protein_id="XP_005536494.1"
                     /db_xref="GeneID:16994426"
                     /translation="MSSAMLEKVPESDEASIPLNVHRGVGTLTEEAPEVQSVDKPSRR
                     RALRTTLLCLFNALCTICIVSANKLVFEGYGFRYGTTLTFFHFSATGLGLFVMAVVRV
                     FRPIRLDLHKTCLLAFFGMGFVVFTNLSLLHNSVAFYQLFKHLNTVGVIVLDWSLYRK
                     PLPPQLRLPIFLLIVGVLINTFGDYRFNVLGTVYASGGVIVTSFYQLLVGRFQAELHC
                     DPMQLQFYTAPLSAVFLAPFLPVFDEYRWWRESSIWRHPMTAGGAGAIFLSSLIALLM
                     NISIFAVIGNTSALTYNVLGHAKTSILLLMDFFLYGRPLNLQNTLGVLIALAGVFLYS
                     RAKLSK"
     gene            complement(<195287..>196912)
                     /locus_tag="CYME_CMK066C"
                     /db_xref="GeneID:16994431"
     mRNA            complement(<195287..>196912)
                     /locus_tag="CYME_CMK066C"
                     /product="L-arabinose permease"
                     /transcript_id="XM_005536438.1"
                     /db_xref="GeneID:16994431"
     CDS             complement(195287..196912)
                     /locus_tag="CYME_CMK066C"
                     /codon_start=1
                     /product="L-arabinose permease"
                     /protein_id="XP_005536495.1"
                     /db_xref="GeneID:16994431"
                     /translation="METVTVRWKRFLSTFGARPCLLSCLLGGLLFGYHLAVFSTVTTF
                     RSFQDWFGSWPSGEQVLLGSYFVGAFVGCLYQRVLPFLAHGAGTAAWRRYLWLRWSSV
                     FFCLGSGLPFLIKRERMLTGRFQMGAFLVLLIHRLLIGIGAGIVNVLGPALCLEVAPS
                     TSRGAFVFLYQLAITIGILMANLVNLATGHEDVHRQVDPVAGGAGIDMRGNFLRPLRY
                     PLVPAILMCIGLLRYQSSMGVSAYRDATSADMLETGKPMSQRKEREHSMVASARALRP
                     DAAEAGHSFNVISRPSLQNESLSLKDVESFAMYAVLARGSSPTARSRASVWLLLRDPR
                     IQICMILQLLQQLTGINVVLVYGVQILEQVQSSAMGSSRRLARLSGPLYGAVLLSVMN
                     VIATLVAVGIIDRTCRRKLYLFSTPVLAACHLALARATRAENGSSSVAFTGFLALMLF
                     VAVFAVSHGPLAVLVANELFSPEARASANSIGMVVNAVATTAVSIGFPLLQRELFGIA
                     GTFLFFALILMGGEYWLWRYLPETRQPTSADSS"
     gene            <197082..>198473
                     /locus_tag="CYME_CMK067C"
                     /db_xref="GeneID:16994423"
     mRNA            <197082..>198473
                     /locus_tag="CYME_CMK067C"
                     /product="aquaporin"
                     /transcript_id="XM_005536439.1"
                     /db_xref="GeneID:16994423"
     CDS             197082..198473
                     /locus_tag="CYME_CMK067C"
                     /codon_start=1
                     /product="aquaporin"
                     /protein_id="XP_005536496.1"
                     /db_xref="GeneID:16994423"
                     /translation="MLQQLLFVSGALPLEARVCVHRDSPIPICEAGDRKHWRRHPKGA
                     TQPSLQSLGRPLIFPKLSELFSRSLTVMALDPEPRAGRSLGRSVDDAGSLRFHAGDGL
                     VPNELVEARSSFGALPPRHCLFAEFLGTALLTTFSGLIGLSSPAAVPFLAGAMISCIV
                     LSFIPTSGALLNPFVVLALYVTKRLRLVPSLAYTGAQLAGGTLGAVIFSLLATPDMYN
                     RVAGGTVSLQTNMSLWQGAGWEFFLTFSLISLVSTMGFAAFELHAENEYARWMQQAVF
                     ALLIGLLVGFLVGVGGPITGCSMNGARALGPLAVAQLRAWMTAASPEWLERASRGHFV
                     IYWLAPALGSVTGALLMEHAIVSPWLGRAPKSILQDLSVYTKRNMAQLRSYGTAGLLA
                     YGILNTIFYGSVFTYSLVFVFASQPGAIAKAWAASWVASQATKPFRLFLAIAMAPWIR
                     RLLERLPWNRHQS"
     gene            <200989..>203076
                     /locus_tag="CYME_CMK068C"
                     /db_xref="GeneID:16994424"
     mRNA            <200989..>203076
                     /locus_tag="CYME_CMK068C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536440.1"
                     /db_xref="GeneID:16994424"
     CDS             200989..203076
                     /locus_tag="CYME_CMK068C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536497.1"
                     /db_xref="GeneID:16994424"
                     /translation="MGIAGFQRWYLENFPSTVVTVTGESAPEHFDHVLFDLNQLIHLA
                     ARVARNRDQFFIRLFRWLDNILRLCVPKKSVFIAFDGPAPLAKLVTQKRRRVLESRKL
                     HRTRKRKRRCGVDVLSLSPGTELMQLTLQAVEFYVCSRLQSKRHLYQNVRFVVSGPTV
                     PGEGEIKIIDYIHRYVDPQHSVVVIGSDADLVVLGLATQKVRNFFVFVITPRANMQDA
                     PEHGTAQKRQAISAIVISVWQWIRVLDRFFPGETPSLRLDLVVMLMMQGNDYLPKLRG
                     TSFNSIWEAYKALKLDKGPMRGKYLVCREQRSFDWEFLYALMKRLINPLVPNLTKELI
                     EMYREASIRGQEALRLAQAGNASVEASSSCESESKDSVERNVHPSDLEDGTEPDAAHG
                     EISADVTDPEDILEKVDIPEGISVDDDEKLYDTEEWLRTLLWALAMYIDGFCPDFYHT
                     YSRAYGPSASDIVRWLKENDGDPLLQLQPPLSVAPPLPPHAALLALVPASAARLLPQP
                     IFKRVLLRSQQQAENSESAAEMGTNADETAKLITFILQDDGRRTNRSLLLRVVEGIRD
                     DEYEEIEKHRTRLSSSVAFALRQGDMSGNGRTCASSQERAPKLPEPPVQRFAKLSLSG
                     AEFSIEGVQLTSTPPCRSWCWSTDGTEARRTSKKAVSVQNLSYKRVFTRKIQSERSQR
                     DRKRINHATERNP"
     gene            <208732..>210771
                     /locus_tag="CYME_CMK069C"
                     /db_xref="GeneID:16994422"
     mRNA            <208732..>210771
                     /locus_tag="CYME_CMK069C"
                     /product="diacylglycerol kinase"
                     /transcript_id="XM_005536441.1"
                     /db_xref="GeneID:16994422"
     CDS             208732..210771
                     /locus_tag="CYME_CMK069C"
                     /codon_start=1
                     /product="diacylglycerol kinase"
                     /protein_id="XP_005536498.1"
                     /db_xref="GeneID:16994422"
                     /translation="MEKNPTRMQSRTSRKQLLEGFFLWQQRSLVDGRCSRCRMAATAV
                     ACVNPKSGGLRGAKVLEVLRKILGAEKCLNVLQVPSAAEWLVENFGAEENLRILICGG
                     DGTISRVVDSYVQVVSRLSASGDSASSDRQLDVLRKWAFAPIPIGTGNDLARTLGWGS
                     NLVGVSGPFFEGVVRYAVESVPVPLDTWQVTRKRLRRQQGSRSSSLLAHFSSGEASAN
                     RDRSVRFASAESGACAPGQGSDSESDEEEESTYARRFTMLSYLSLGCDADVELLFNSR
                     REANPRRYRSQTLNYISHALFGIERTMLSRARPLYKERITLYVDGQRIKIPRAAQSLL
                     FANIPSYGAGADPGGVARRQRRALARKQQQVLQLCRCFHRRSSGDHTVSQSEAHPPGG
                     SAVDKHAATIDARTEGAHHSPDPVERESSQAARQDAVGPHDSVSSAVLPCVDDGRLDI
                     MTMKSLVHFVWIKMGREAQRLRNGRKIRIELEESRSSLVRAASSLVAKHIAVQCDGEA
                     WNQARNECIEIEPFSFQVGFLLGPLYAGAIFKADSRMRLVRGLVAPYLKPTSAPSAVF
                     SQPDSIRYIEQGLSKASEAFLAGVGERARIARSAPDVPPRSSVSRTVASERSISVERS
                     GHASNRQPETHPEENDESGAPKQRERFSRSRWLSHALGSCFGGKRQPAGEPVGAK"
     gene            complement(<211164..>213434)
                     /locus_tag="CYME_CMK070C"
                     /db_xref="GeneID:16994412"
     mRNA            complement(<211164..>213434)
                     /locus_tag="CYME_CMK070C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536442.1"
                     /db_xref="GeneID:16994412"
     CDS             complement(211164..213434)
                     /locus_tag="CYME_CMK070C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536499.1"
                     /db_xref="GeneID:16994412"
                     /translation="MDLMPTKREPSTSGVGMPVSSSGGDPGHSDNESNLSRVLFVYGS
                     LLGREVEVTLRDGSRYKGTLYAAVPEEGVVLRFAERVRMHGLSWHEQLPKPAVPPVPF
                     MVFRRSDLVRLYAKGVPLASGDNAEAAPRPSVETGTRSGSVVTDREISHGAERESPSE
                     RELVAWADDQAAPDASATKRKAEGAHRNAPHRELAFDALDRYQRTKWDQFVENERKFG
                     VKTTYTEEHYTTKLDPNRFSEADIARAARLAAEIESKAADNPHVAEERGQFIQLADES
                     GCDDEELRYGAVVRTAEHPGESNEPRTSEEIGPRPTGIPASEDTSSSATDAPMRPAAS
                     KATAAGISIAASTEYLYALRRNRSSASLSRNSSSEYLLDQYDVEHKRVLQRLSSRQRL
                     EDARMTGVVVARSGSTSPAMGNGSDRASPALATTPTAPSAGPIPASVTVGREVVGLNL
                     ELSVPHVPDEVIQKLNEFKAQQQQQQGYESERSRERETEYFRRFSADIERKTSSGNLR
                     SMIRAGSKLSLAGSESSLAVEATSDERERSLIQSPKEQAKSEFSGGSATSGKAMDPNA
                     KDFHLNVNAEEFVPSQALIEPAPQEQQRFQNVSSGNPHRGRGGRSRYRGMSIAQREQV
                     FLIQGGGGYFYGPGMGAAHPAAQPYPSAYFLPYAPQPLMGPAGYSAMPMQPIPAYPPL
                     PHLLMPPYPQPFTSPTDFMGVPPGVASAEPIMGSRHTHSVRAEHGTHYTSPAAGVAPD
                     ASPLKSPGQEQAPTRP"
     gene            complement(<213683..>214234)
                     /locus_tag="CYME_CMK071C"
                     /db_xref="GeneID:16994413"
     mRNA            complement(<213683..>214234)
                     /locus_tag="CYME_CMK071C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536443.1"
                     /db_xref="GeneID:16994413"
     CDS             complement(213683..214234)
                     /locus_tag="CYME_CMK071C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536500.1"
                     /db_xref="GeneID:16994413"
                     /translation="MEVGDPGGPSSSTAEENAKNPNEFSSDPLKIHFRRASSEEEEER
                     YARKGFFARQDDIETLVAKKARARGTLALMSSSRGSKPHRVLERRRQRRQQYHEICFA
                     EEETRGADRIQLCGVGSRGRGVQGEAEADSRWLVERLGGVCAFVSVYPRLPSLFVDGK
                     TVLSPCYDSTGALGATADAHSMH"
     gene            <214646..>215215
                     /locus_tag="CYME_CMK072C"
                     /db_xref="GeneID:16994419"
     mRNA            <214646..>215215
                     /locus_tag="CYME_CMK072C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536444.1"
                     /db_xref="GeneID:16994419"
     CDS             214646..215215
                     /locus_tag="CYME_CMK072C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536501.1"
                     /db_xref="GeneID:16994419"
                     /translation="MRAATAFLALLCIQVFYYWVPRWQTGSELVSLSSYGTIYQRPSA
                     AADCYQGTVNNSAGGSTCTCNSGWYTVPENAPVQCACNLNCDLEGTKSCNRSLQVCFC
                     KDGYGTAPNQNPKNRVYCNVKYPSTNSSSNGGGATSPANSTGGGGFNLSGISLPTILL
                     ALVCLGIGAAIFAFCCCLCWPFVARARMY"
     gene            complement(<216001..>216447)
                     /locus_tag="CYME_CMK073C"
                     /db_xref="GeneID:16994397"
     mRNA            complement(<216001..>216447)
                     /locus_tag="CYME_CMK073C"
                     /product="probable transcription factor Hap5a"
                     /transcript_id="XM_005536445.1"
                     /db_xref="GeneID:16994397"
     CDS             complement(216001..216447)
                     /locus_tag="CYME_CMK073C"
                     /codon_start=1
                     /product="probable transcription factor Hap5a"
                     /protein_id="XP_005536502.1"
                     /db_xref="GeneID:16994397"
                     /translation="MSHSNQRLEQALAEMWRRHLRECETATDFKNHALPLARIKKIIK
                     SDEDVRMVSAEAPIIFGKACELFVQELTLRAWAITEEAKRRTLQRSDVSAAIQKTDIF
                     DFLIDIVPKEDLLVSQPNVHGSLSAPPVHALYANRMEHGHGTETGM"
     gene            complement(<216546..>217859)
                     /locus_tag="CYME_CMK074C"
                     /db_xref="GeneID:16994398"
     mRNA            complement(<216546..>217859)
                     /locus_tag="CYME_CMK074C"
                     /product="similar to glutathione S-transferase"
                     /transcript_id="XM_005536446.1"
                     /db_xref="GeneID:16994398"
     CDS             complement(216546..217859)
                     /locus_tag="CYME_CMK074C"
                     /codon_start=1
                     /product="similar to glutathione S-transferase"
                     /protein_id="XP_005536503.1"
                     /db_xref="GeneID:16994398"
                     /translation="MTLKSSKTSHALFVLSTCGSQSRRRPPVSPIRSHSAKLLRTPNR
                     RNSRRTRQLPTTIVCRMDERTVRRNSGAGILSSAVPFELLVRMARLFWRQLWHLMMSQ
                     LAPTRKGTGSYERPPPSYLSSGYKDQIWTGSFEEDQFLLFYGIECPWCHRCLLAAAFH
                     RLTDNSNASRIIVPVRVYPSPEGKWVLRPVGSRSNAEDANERLPATYRSARDLKQIYR
                     NADPSFRGRATAPLLVDARSGLIVSNESADIVRFMRHIATERQTPSGIDPFPAEYQSQ
                     IEADKTWIHDNLNNGVYKVGFARTQAAYEDAERSVFQTLAELEQRLAGQRYVSGTPYP
                     SESDIFLFPTLIRFDSVYHTLFRCCQRKITEFPNLHAWMRDMIQTYAAEVSHTFDVKE
                     TANSYFKSLFPLNPSGIVPKYDLGRLDVPHQREQLGAKPDSLQRP"
     gene            <218142..>219107
                     /locus_tag="CYME_CMK075C"
                     /db_xref="GeneID:16994433"
     mRNA            <218142..>219107
                     /locus_tag="CYME_CMK075C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536447.1"
                     /db_xref="GeneID:16994433"
     CDS             218142..219107
                     /locus_tag="CYME_CMK075C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536504.1"
                     /db_xref="GeneID:16994433"
                     /translation="MFIVNSFRNSSQKRPFVRRRQPIGLSVRPKRWCRTHGLVLAEHE
                     APGRRAPQKPAISLRLEVAKSAASIACALLFALVCEDQARNGLSSSGTSLASAAMESS
                     FCGTTSEARPAASEGTCIQRFLESLQIPGAFAADLTGFVEDDTGTSPGSVVSRVNSSL
                     QALVQNTGYRVFILIKRDIPLGTDLNSLAREVYESKNGDGNLLVLVLNPKTAKGGYYA
                     GDQVQRAIPNSVLMSIANETYPFNTLQGKYGAALLDVTNRLEAVLSGRDDPGPPVVRK
                     SEKVASFKTREETESQRKKYVGVVATLLIISVVAPMAQYFWYQRK"
     gene            complement(<219238..>221364)
                     /locus_tag="CYME_CMK076C"
                     /db_xref="GeneID:16994429"
     mRNA            complement(<219238..>221364)
                     /locus_tag="CYME_CMK076C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536448.1"
                     /db_xref="GeneID:16994429"
     CDS             complement(219238..221364)
                     /locus_tag="CYME_CMK076C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536505.1"
                     /db_xref="GeneID:16994429"
                     /translation="MKVIFRRSLFVLLFFQVPLWLVAPFFSASVGGSLTGVGSIVTCL
                     DSGRPGSIPCSKKWVLTLAVENGATAASSSVSATQAVYGSSSANATVRSADNPNTVYA
                     FKYQVHITLTKSRIRLDYPLYYQSDFNNKPYEIVYKYNQKGPLNWLDNQCVATWGSSD
                     PTCGYAYNPSWSTKPADRILYSQGFCCDCNAGDLLGLSPNRIRGGLDCSLLNFDNPTE
                     SAHCLRFDSLWYSAFQIGEPDVNFVILVNVTKCPLANSTIKSISGLVGNQDQAIQNCS
                     TEIISLSPSSPIGYASNGKISAQAIGDFAPWEGTPSYSEKLFFVPSVCTDTSEAWCVD
                     RISYIPTEINRWMLIDNDLVTITGDTCDKIGVSYSAFTNEGQRCERPTQSCLHDQLQD
                     YYDSDLALEQTGKVGSYFVQFFGDFDVSGLTPRNPLLRFFTNRTQATEVVLQFAAEEL
                     FYTIYLAPARFLRHLSKINPFTSQSKGGLIDLWIVSEGTGQNAAQFTVSASCEPNVEP
                     IQAQIVTLAPGQLVSISLPIIETKATGGAGVCNCTLRNALGQVLDVLVLEFNASSVRT
                     TDGAQGGSASTTSGNLTHTGSSPYPSGGCGSCGGLLDIGCIFANVCILNILFFIGLLF
                     LILLLLCCCRTCIWRCCCGCCGLLGKGFSLPPGLRARTQRRGYFTSVTALPGQTLPAL
                     PKAALVRSVSLEGPSMLQTVACSKAR"
     gene            <221643..>225629
                     /locus_tag="CYME_CMK078C"
                     /db_xref="GeneID:16994430"
     mRNA            <221643..>225629
                     /locus_tag="CYME_CMK078C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536449.1"
                     /db_xref="GeneID:16994430"
     CDS             221643..225629
                     /locus_tag="CYME_CMK078C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536506.1"
                     /db_xref="GeneID:16994430"
                     /translation="MICFSLFRIVSKLSLAALLWLVLHFLQKEILGTSPAVQMNVVPE
                     VARASGNTSPLFLFYEECGGANWTLNRFCSSNCWTSNSSPCGSSDDWIFVDCTSAGQV
                     SGLHLEHENIYCGGIPEELASLGYLSTLDLSYNPDLRTVIPTWISNFTNLVELKFEDS
                     GFYGEVPDSICMLRSLSSLKGRENDLSGTIPDCIGELKYLHDLSFASNEMSGQIPDSI
                     GNCSNLYFLDLSNNNFSGTLPDSIVYMKNLQILDLSYNSLEGTLPELFGFSELQLLLL
                     GHNNFSGTIPELPPNLVAVDFSSNNFSGQVPILPSTVTSANFTGNHFSCPIPLGSIYD
                     TASCICPAGWAGNRTTCKQCSPGTIAPTDGSSVCMACPNGTFANASTSFRFCGTCPAG
                     SFAVSPAGNCSICPKGTYQQSRGSSQCNTCAPGYFTDELGASSCKICLAGSYAELAGS
                     TECKACAPGTYAASNGSTSCQACAAGSYAGNYSSATCQICPAGSYAELAGSTECKACA
                     PGTYAASNGSTSCQACAAGSYAGNYNSTACEICPAGSYAELAGSTECKACAPGTYAAS
                     NGSTSCQTCKAGSYAGNYNSTACEICPAGSYAELAGSTECKACAPGTYAASNGSTSCQ
                     ACAAGSYAGNYSSATCQICPAGTYAASEGSSSCEPCPPGSSGNSIGSKSCSLCPAGSF
                     AASNGSTMCQKCPAGYFSDTPGAAACKPCPLGVFASSEGSRACSLCPAGQYAPVNGSV
                     FCLNCPPGSFSNHSGASTCYQCGAGYFSDTRGSTSCKLCPLGTFSAGQGQTSCEACPP
                     GFYTNQTGSTSCSSCAPGHYQPSTGAGGCLPCPAGTRAGASGAPRCDACPSGTFSNVT
                     GAAVCIECPAGWYSQGNSTKCIACDTGSYAQFNASGSCTEAPPGSFVNSTGAAYFQYC
                     PPGTFSNRSGASKCEPCETGTFVTYLGATSCTACRAGYSAPANGSVNCTVCPAGTFAY
                     TAPDAAGLGRGASTCKPCPKGTFNQYEAHTKCEPAPKGGYVSTDGSTKYEVCSPGMYS
                     DSSGAFVCEPCPNGYMSANSSATSCVKCPANTYSANRTGSTACKPCPTLAYFESVVVP
                     QYRVCSPNAASVFAIIAVILAGILLAMLVWYLARRYRAYRGTKPNKREQDVASSAPRS
                     AEVTHRRKSRSVLRRGSDDGEVHPMDTVSTFAAIPVSRDELESKFRTHRSFSEAIEPV
                     TPDQPQRRISRYSRSVSASRFGILLASTAASGEGRSQSLTRKRLSFATEQAARESAHG
                     DDAASDTDDIVPLPGSTPQHLAGNTPRKQITFATPQKEPKWIRVRTEEGAYYLLNRLN
                     GEMYAIGP"
     misc_feature    complement(222271..224271)
                     /note="possible transcribed region"
     gene            complement(<225676..>226848)
                     /locus_tag="CYME_CMK079C"
                     /db_xref="GeneID:16994444"
     mRNA            complement(<225676..>226848)
                     /locus_tag="CYME_CMK079C"
                     /product="unknown zinc-finger protein"
                     /transcript_id="XM_005536450.1"
                     /db_xref="GeneID:16994444"
     CDS             complement(225676..226848)
                     /locus_tag="CYME_CMK079C"
                     /codon_start=1
                     /product="unknown zinc-finger protein"
                     /protein_id="XP_005536507.1"
                     /db_xref="GeneID:16994444"
                     /translation="MEAVTPSDARGTSSEQPSASGIGAEPFRAAFSEHDLRVHIADLL
                     EDHEQNVPPKGTVRQANVGKSTRRPPWRELSVSVTSGTQALLHETGIPCAPLSAPAFP
                     VANLWSPSFETSRPLSRCASEDISSVCTAPGASTLDSPSQDSIPHSAPSTSRTTDALA
                     VSGAELFALECDESSGNVMSSISESSPLSRFPATPRSAPTGTWLGRIDSEAARLITLD
                     QRYHSGTSLQPRRKRRCSNLPPGAQRGQFGKHVCPFSGCGRRFTLSGNLQVHIRTVHE
                     REKPFGCPYPGCGRRFSQKGNANTHYRAVHLREIRFRCPVLDCGRPFAQKANLLFHAQ
                     RIHGLAELDLLIMSMHPFAADAVRTSSGAASTEAYTPKSDIDEGTPRAAFPNPAGG"
     misc_feature    227437..228910
                     /note="possible transcribed region"
     gene            <229981..>231360
                     /locus_tag="CYME_CMK081C"
                     /db_xref="GeneID:16994441"
     mRNA            <229981..>231360
                     /locus_tag="CYME_CMK081C"
                     /product="TATA-box binding protein-associated factor 6"
                     /transcript_id="XM_005536451.1"
                     /db_xref="GeneID:16994441"
     CDS             229981..231360
                     /locus_tag="CYME_CMK081C"
                     /codon_start=1
                     /product="TATA-box binding protein-associated factor 6"
                     /protein_id="XP_005536508.1"
                     /db_xref="GeneID:16994441"
                     /translation="MNGSGPGVLSAAAQGAQGIRSSTVHVIAATVGIARLREDVAAYL
                     ATDAEYRLREIIQEAGKFMRHSKRRRLKTSDIAAALRLRNLEPLYGFSSNESAPFVGV
                     TLPGESSLGGSNTVYFVGDEEVDLRDILDGELPRVPLETTLALHWLAIEGIQPRIPQN
                     PADVSSTARQSLTYILRDTVHDEPGRNASDTPDTDTGMVSFRPKVRHVVSRELQLYYE
                     LAIEALTRSAQETDETLRNACLASIARDPGLQQLVPYFVAFLFHHVSNHCRDLPQLQV
                     SMKLARALLENRYVGLEPYLHQLMPSIITCIVGRYLCRTADEDHWTLRENAASLLADV
                     HKMYGGTYENLLPRIAETLRLALVGEDKALTTQYGAIVAFQELGPALVEAHIVPLAPN
                     LLERWERKIEHELGEAPIKSAELELATSPKWSELRRVYAALAKALGVGAETLEAKYGS
                     KYAHFVIPS"
     gene            complement(<232326..>232985)
                     /locus_tag="CYME_CMK082C"
                     /db_xref="GeneID:16994442"
     mRNA            complement(<232326..>232985)
                     /locus_tag="CYME_CMK082C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536452.1"
                     /db_xref="GeneID:16994442"
     CDS             complement(232326..232985)
                     /locus_tag="CYME_CMK082C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536509.1"
                     /db_xref="GeneID:16994442"
                     /translation="MDREVRPSLRFAMVCASNMNRSMESHALLQKRGFNVWSFGTGAN
                     VKLPGTAPDKPIVYNFRVPYREIYEELRAQNEEYFRNASVLPMLERNMAVKPAPERWQ
                     DREASRQHFDVVVSFEERVFEAILEDCQQREPVDFELMHVINLEVRDTYADAAEGAVL
                     ALHLCELLEAALQSRADSGRYSEPVLMDSGHDASDPVERVLYAFEDRTGRRLLYSPQY
                     S"
     gene            <233717..>235078
                     /locus_tag="CYME_CMK083C"
                     /db_xref="GeneID:16994437"
     mRNA            <233717..>235078
                     /locus_tag="CYME_CMK083C"
                     /product="DEAD box protein"
                     /transcript_id="XM_005536453.1"
                     /db_xref="GeneID:16994437"
     CDS             233717..235078
                     /locus_tag="CYME_CMK083C"
                     /codon_start=1
                     /product="DEAD box protein"
                     /protein_id="XP_005536510.1"
                     /db_xref="GeneID:16994437"
                     /translation="MPEETKPVENQVAPTTGESSFAALGVCAVLCDACRLLNYREPTP
                     IQREAIPAALAGKDIVGLAQTGSGKTAAFAIPILQFLLEDPRPYFALVLSPTRELAFQ
                     ISEQFLALGSEIGVRVATLVGGMDMVGQAVTLAKRPHVVVGTPGRVVDHLTATKGFTL
                     KHVRILVLDEADRLLNMDFEEELDQILAAVPRSDADPSKGETFARKTYLFSATMTSQV
                     AKLQRASLRSKETVRIEVSAKYSTVETLVQHYLFIPEKYKDCYLTYLFEELVARHSCI
                     VFTDTQSSAQRLALMLRNLGYGAVCIHGGMSQPNRLGALNQFKSGEKHILVATDVASR
                     GLDIPLVDFVINYDIPPHGKDYIHRVGRTARAGRTGRAISLVSQYDVELFQKVEKLLG
                     RQLEALAGVQQEHVLLLLDRVSEAARLAVQEIREEKLVLHAAARKRRIPAGASVSRRR
                     RRS"
     gene            complement(235261..236932)
                     /locus_tag="CYME_CMK084T"
                     /db_xref="GeneID:16994438"
     misc_RNA        complement(235261..236932)
                     /locus_tag="CYME_CMK084T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461374.1"
                     /db_xref="GeneID:16994438"
     gene            complement(<239395..>240720)
                     /locus_tag="CYME_CMK085C"
                     /db_xref="GeneID:16994434"
     mRNA            complement(<239395..>240720)
                     /locus_tag="CYME_CMK085C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536454.1"
                     /db_xref="GeneID:16994434"
     CDS             complement(239395..240720)
                     /locus_tag="CYME_CMK085C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536511.1"
                     /db_xref="GeneID:16994434"
                     /translation="MSGPSTREKNISLIGVGRLGLCLALVAERAGYHVLGVDVLPQYV
                     EALNERSLKSNEPKVMEYLKAARNFRATTELDEAIEFSDHLLVLVATPSTGGDRHYDV
                     TQLSRVLMHINTRRPRNKIITICCTVMPGYIANIGRALLGDCENVQLQYNPEFIQQGN
                     IIEGLELPDTVLIGESSTYGGDLLERLWRSFVRNPDQITVHRMSPESAEIAKLALNCF
                     ITMKISFANFIGDVADRTPNADKYAILASVGADSRVGSKCLLPGYGFGGPCFPRDNRA
                     FGGYAASVGIDPMMSRATDTYNEKHATYMAEALLAKNLPEYTFEGVTYKHPCAVPIIE
                     ESQKLAVAARIARAGRRVRIRDQREVIDACRMEWGSLFTYEIVSDGKHVGSEVPNGTA
                     SEFGGGKHQSEASFTPPRSAGTGDVCHEAALNALDPRRGTLLDSFDRTR"
     gene            <243562..>244641
                     /locus_tag="CYME_CMK086C"
                     /db_xref="GeneID:16994435"
     mRNA            <243562..>244641
                     /locus_tag="CYME_CMK086C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536455.1"
                     /db_xref="GeneID:16994435"
     CDS             243562..244641
                     /locus_tag="CYME_CMK086C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536512.1"
                     /db_xref="GeneID:16994435"
                     /translation="MDHRVRDCPVRQEKERLGGGGAGRGAARYGSEGRRPLEGGPGRA
                     GSGGARVCYNCGGVGHTSRECPSERGVRGNMGDRGPGSSGPRGYPSTGRGAETRSCFK
                     CGESGHLARFCPTTSAAGPDGNAYGSRGRRENSRPDRRDWGSGHYQEPYSRDRDSDRA
                     QNVSEGGAGFGNRRGREDDRYDFGNELNEEQQTYENRRERPFHSEGVEEDEHYSEHSH
                     DEGYGDYDDDNAGSSVGQKRRLAGDAYDSGHHDGGSDASHGDGNSDDDGDDGYQRDSP
                     GSSYGADEDHDGRAQVNGSYKRSRHGNEGRGSERREAPSDYAHSDWNSLTLKDLKAEA
                     EKRGIDTTGMRLKKDYVEALENAAA"
     gene            complement(<246676..>249006)
                     /locus_tag="CYME_CMK087C"
                     /db_xref="GeneID:16994436"
     mRNA            complement(<246676..>249006)
                     /locus_tag="CYME_CMK087C"
                     /product="aspartate--tRNA ligase, mitochondrial and
                     chloroplast?"
                     /transcript_id="XM_005536456.1"
                     /db_xref="GeneID:16994436"
     CDS             complement(246676..249006)
                     /locus_tag="CYME_CMK087C"
                     /codon_start=1
                     /product="aspartate--tRNA ligase, mitochondrial and
                     chloroplast?"
                     /protein_id="XP_005536513.1"
                     /db_xref="GeneID:16994436"
                     /translation="MKLLRTTCGFAFLAKPLGASGVARDVRNCPLRYQPWAFGRLSFS
                     RCWLHFLTGNSGERSFLARRFEVATHPVGASRPQRKQPRSVKLLACSAASETQTSLRT
                     HVCGALRSEHVGCTVTVCGWAHTIRDRGGVTFLLLRDRHGIVQVTIDAASPEALRTQV
                     KTIRRESVVRVRGTVRARDPANVNASMPTGSVEIAAHVIEVLNRADPLPLVLDMERPE
                     TGNTTTGRPGSGQLATTGASEETRLRYRYLDLRRASLQSALIRRHEATMAVRRVLDSL
                     GFVEIETPILTRATPEGARDYLVPSRVHRGKWYALPQSPQLYKQLLMIGGMDRYFQVA
                     RCFRDEDLRQDRQPEFTQVDLEMSFVGAADVMHTVERVAEALFSNVLSEQELKNDEVL
                     VRNTARQGLRFPVMTYDDCMERYGTDAPDLRFGLELQPIWSANQGESNTAQHWHFFEA
                     LCAVAPFRGAETIRALVVPGAAPHTSRKVIDDYTQFVKQLGLSGLLWGKIGSSDGRPT
                     INSGPLNKLEPTVAGQLVEQLGARPDSLLLVAAGSRPVVLGSLGRLRVKIAKERGFVD
                     ETDYRFCWVVGFPLFAWDDEYNRLTSVHHPFTSPREDQRDLLLTLVQRIREKPDSLSK
                     DATLTQELLKLRAEAYDLVCNGTEIGGGSIRIYDPAIQSAVLSVLAISDEEQQAKFGF
                     LLQALRYGAPPHGGFAFGLDRCILMTCAQAKSLRDVIAFPKTTSASELMTAAPSDVDE
                     RQLADLGISRVAAHEERIDQIDAPKVPQDSQETMPV"
     gene            <249615..>250298
                     /locus_tag="CYME_CMK088C"
                     /db_xref="GeneID:16994420"
     mRNA            <249615..>250298
                     /locus_tag="CYME_CMK088C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536457.1"
                     /db_xref="GeneID:16994420"
     CDS             249615..250298
                     /locus_tag="CYME_CMK088C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536514.1"
                     /db_xref="GeneID:16994420"
                     /translation="MDTHKCKLCSSSARLGFILTLPCSQTSAFCISYVTSVDEHRPPG
                     LLTRLAGTRRRLRAGTLRAEGGSEDSRTAEESNSKVDGSSHSSGSVHGYGEPVPSIPT
                     RPFDASVVHPSWYINMRPDNPCVVCLGEGYIRCMHCYGAGYVVVGPEPEDFPERDREV
                     CTVCYGEGRHQCRRCEGTGKRPMWIIDPATRERRSISLERDLPWKKALMDLAETELRR
                     QESEKSKDA"
     gene            <254877..>255377
                     /locus_tag="CYME_CMK089C"
                     /db_xref="GeneID:16994421"
     mRNA            <254877..>255377
                     /locus_tag="CYME_CMK089C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536458.1"
                     /db_xref="GeneID:16994421"
     CDS             254877..255377
                     /locus_tag="CYME_CMK089C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536515.1"
                     /db_xref="GeneID:16994421"
                     /translation="MPSSSTFLAVQCSTCEQIQIQASRRDGRFRCKVCGEWQSTQKVL
                     AKSARPQELRPFVQTANRARGEQSCRSSRTISVPYVETPERHLHVSERPQGRQHNCTS
                     IRRSHGPNEAFVSSSRNCNAFGIPGVAGSSTNDHYLDAEILDELNEQRHDSFDDAIED
                     ALEEAR"
     gene            complement(<255507..>255866)
                     /locus_tag="CYME_CMK090C"
                     /db_xref="GeneID:16994440"
     mRNA            complement(<255507..>255866)
                     /locus_tag="CYME_CMK090C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536459.1"
                     /db_xref="GeneID:16994440"
     CDS             complement(255507..255866)
                     /locus_tag="CYME_CMK090C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536516.1"
                     /db_xref="GeneID:16994440"
                     /translation="MVLLFVAPLSTSRTGASPGGQHALWSERRPKRGSSALRAREEAA
                     ETSASAAAPCKLCGGSGRLQGGLAAVRGFHWWPIKAYRPCPACEAGRLRYRRRGQSLQ
                     DFVGNGRGTTETEPPAS"
     gene            257454..259088
                     /locus_tag="CYME_CMK091T"
                     /db_xref="GeneID:16994439"
     misc_RNA        257454..259088
                     /locus_tag="CYME_CMK091T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461375.1"
                     /db_xref="GeneID:16994439"
     gene            complement(<258125..>258748)
                     /locus_tag="CYME_CMK092C"
                     /db_xref="GeneID:16994447"
     mRNA            complement(<258125..>258748)
                     /locus_tag="CYME_CMK092C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536460.1"
                     /db_xref="GeneID:16994447"
     CDS             complement(258125..258748)
                     /locus_tag="CYME_CMK092C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536517.1"
                     /db_xref="GeneID:16994447"
                     /translation="MAETLAWSIFPVSNSSVRAAVAPESTGATTWLRRHRRHCWHRSK
                     NSHRLPAALSHVRGQYRSPRSRGKRDDDGSGNDSDGGFLGRGGDAFASGRSAGPGGDG
                     IFGSPVVLEEGNRLMRDHAELLRLGQKYKLFDREGKLAYIAQMESVFDRWKVFLKRFE
                     LSTDFQAQLYLKQLDAWLAQFGMRREDLLRNLEISLDMMRQDAEREL"
     gene            complement(<260779..>261279)
                     /locus_tag="CYME_CMK093C"
                     /db_xref="GeneID:16994448"
     mRNA            complement(<260779..>261279)
                     /locus_tag="CYME_CMK093C"
                     /product="retroelement, dead"
                     /transcript_id="XM_005536461.1"
                     /db_xref="GeneID:16994448"
     CDS             complement(260779..261279)
                     /locus_tag="CYME_CMK093C"
                     /codon_start=1
                     /product="retroelement, dead"
                     /protein_id="XP_005536518.1"
                     /db_xref="GeneID:16994448"
                     /translation="MRLIPSIMKLLCASLTNWIQRGLEERKFFAPEQDGFRSREECMS
                     HALTLTEVVQRRSISGQQPTYVCFIDFQKAFDTVPHEAPFLKMERGGVSEKCLAFFRA
                     LYADSWMRIRLGDGSRTPSIRMRRGLRQGDRASSLLFNIFINDLLNNCRQYGLEVPRI
                     NCGDAR"
     misc_feature    262538..265749
                     /note="repetitive element"
     gene            <265926..>266729
                     /locus_tag="CYME_CMK095C"
                     /db_xref="GeneID:16994449"
     mRNA            <265926..>266729
                     /locus_tag="CYME_CMK095C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536462.1"
                     /db_xref="GeneID:16994449"
     CDS             265926..266729
                     /locus_tag="CYME_CMK095C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536519.1"
                     /db_xref="GeneID:16994449"
                     /translation="MSPQDTCCPPDSWPALKVDYKPKGKLEDIGKGLKAYVVGNGPRA
                     VIALNDVFGIESGHSKEICDAIADKGFTVVFPDVFRGKPLQVSDMSKLFDELPGWAKQ
                     FDYEPALRKDVVEVILPYLHDKLGFKSNDQIALAGFCWGAFMLFHLAGDTKLPGGPFA
                     CGVSFHPSVQIEGVFQRDPLQLIDRATCPQLLLPSAGEPDYMKEEGDAIKKLRAKPFG
                     ASCGVKTFPSMQHGWVNRGDRNDPQVVKEAQEALQLAVDFMMRHTKPKA"
     gene            <267514..>268737
                     /locus_tag="CYME_CMK096C"
                     /db_xref="GeneID:16994446"
     mRNA            <267514..>268737
                     /locus_tag="CYME_CMK096C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536463.1"
                     /db_xref="GeneID:16994446"
     CDS             267514..268737
                     /locus_tag="CYME_CMK096C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536520.1"
                     /db_xref="GeneID:16994446"
                     /translation="MVHLYSVVRDTLPLKAFDESSKGVAFALALLGFAIVACSLLYWI
                     WFWRLQRYYEDAARAYLIRANAEGKLGATHLRRQSLRLLSYNVFVRPPGISARGNDFK
                     DERLARLLAQLVRLDVDVVALQELFRFGSPRQRAFVWAACRLGGYRYSAALPYPPRGW
                     HWPPRILDGGVTVLSRLPVERVAFTTYRSAHWHYIDCLVAKGVLCVHLRMPFHEPSTG
                     AVHPGKVALFATHAQAGNASYPGIRVIRRKQLQQLARFVQEEAGEGILPAIICGDLNL
                     NGMDGDLADRDSSEYTEMMSILNGDADASAKPVRVFRFRDLVKEANDHRHPVTVDAVT
                     AEGTPREPLLIPAKARKQPKRLDYILCDPGPRVSCRVLAARVEPFILDSWDTAPFRQL
                     SDHDAIFVEMEFTES"
     gene            complement(<272182..>273822)
                     /locus_tag="CYME_CMK097C"
                     /db_xref="GeneID:16994451"
     mRNA            complement(<272182..>273822)
                     /locus_tag="CYME_CMK097C"
                     /product="serine--tRNA ligase, chloroplast or
                     mitochondrial"
                     /transcript_id="XM_005536464.1"
                     /db_xref="GeneID:16994451"
     CDS             complement(272182..273822)
                     /locus_tag="CYME_CMK097C"
                     /codon_start=1
                     /product="serine--tRNA ligase, chloroplast or
                     mitochondrial"
                     /protein_id="XP_005536521.1"
                     /db_xref="GeneID:16994451"
                     /translation="MEPARGGEERSLTSFVHSIGLRKRMRWIQSAGNWLRVLRTGYPA
                     VAGSIAEARATRPYRMRGWLGDGTSFRPSAFRCRHSDSRCATPTNMMLTRVSGTPPPV
                     DLRYVRDHLAQVQENIQRRGVDVNATLVVQLYERFCALTAEVDLVRKQRNEVAARMKN
                     MQKLSPEERSECIALGKQLKERVTALEAELAETEQQLYAEAVRIPNRTHPDAPVGGED
                     QARLLRMAGKPRDFTDFSPKDHVELAQRLDIVDFEAAAKVAGARFYFLRNAGAMLELA
                     LVNWAMQHLTGKHGFIPLIAPDLVREETVWGCGFQPRGEASQVYSVADTSLCLAGTAE
                     IPLGGYYANEILDETQLPIKMAAVSHCFRREAGAAGTETRGLYRVHQFTKVEMFVLSR
                     PEESDRVHQELRSIEEELFDALGLHYRVLDMPTRELGNPAYRKFDIEAWMPGRNAFGE
                     ISSASNCTDYQARRLNIRYREQVSEKLRFVHTLNATACAVPRMIVSILENFQEKDGSV
                     TIPQVLRPFLAGLERIQVPPERHTPSRITEPAGAQPTR"
     gene            complement(<276284..>278584)
                     /locus_tag="CYME_CMK098C"
                     /db_xref="GeneID:16994452"
     mRNA            complement(<276284..>278584)
                     /locus_tag="CYME_CMK098C"
                     /product="acetyl-CoA synthetase"
                     /transcript_id="XM_005536465.1"
                     /db_xref="GeneID:16994452"
     CDS             complement(276284..278584)
                     /locus_tag="CYME_CMK098C"
                     /codon_start=1
                     /product="acetyl-CoA synthetase"
                     /protein_id="XP_005536522.1"
                     /db_xref="GeneID:16994452"
                     /translation="MPSTGLIQAAFVGLVQLPVQVRARGFDVPGKQRRCFPCNQRVLR
                     FRTVHRQRGIIRELRACAHRVERSRATTSLMPPQEVDAALASTLRASGVSASPEYLRN
                     SAFHIPDYETYCEMYTRSLRDPTGFWLEMARNNFYWRDPNAITPDSVYRYNFDVRQGP
                     IQVEWFFRAETNICYNALDRHVEQGLGNRVALYCEANDMDDMDTHRAITYAELLDMVK
                     RIARVLRRQGVRRGDTVTIYMPMVPELPAAMLACARIGAVHNVVFGGFSAEALAGRLL
                     DARSAVILSCDGIRRGPKRIELKATVDEAIEICQTRDPSFHVSCQLVLRRLGESMLPN
                     LTMQAGRDVDLRVAMEEAVSGPDDAIEWMKAEDPLFLLYTSGSTGTPKGVLHTTGGYM
                     VNAALTFKYSFNYQPGDVYFCTADCGWITGHSYVVYGPMLNAATQVLFEGVPTWPDPG
                     RLWAIVDKYQVTHLYTAPTAIRSLKKAGDEYVKRYKRTSLKILATVGEPINPQVWEWY
                     HQVVGDSRCNVVDTYWQTETGAHVVISPPVRGFQQKPGSAGVPFFGIRLAVLDDRGKE
                     IPFVPGQESEGYLCIRDPWPSCLRTIFGAQARFENGYFKPFPGYYMTGDGCRRDGDGY
                     IWITGRVDDVINVSGHRIGTAEVESALVRHPAVAEAAVVGMPHEIKGECIACFVILAD
                     GYTPSDTLRNELVQTCRKEIGAFAAPERIIWTPALPKTRSGKIMRRILRKISEQGRDL
                     DRSVLGDLSTLADPSAVDAVIQSFLS"
     misc_feature    complement(278678..280569)
                     /note="possible transcribed region"
     gene            complement(280279..282611)
                     /locus_tag="CYME_CMK100T"
                     /db_xref="GeneID:16994453"
     misc_RNA        complement(280279..282611)
                     /locus_tag="CYME_CMK100T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461376.1"
                     /db_xref="GeneID:16994453"
     gene            <282054..>283367
                     /locus_tag="CYME_CMK101C"
                     /db_xref="GeneID:16994454"
     mRNA            <282054..>283367
                     /locus_tag="CYME_CMK101C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536466.1"
                     /db_xref="GeneID:16994454"
     CDS             282054..283367
                     /locus_tag="CYME_CMK101C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536523.1"
                     /db_xref="GeneID:16994454"
                     /translation="MLFQHMRGGKRVESLLRRLARYLSRGAAIAGLLLCCLWVTSYLV
                     RSPSTGLRVPDANDGRAGAGAAALSEPLVSTTTTTTGDTARRQVADDAVTFALVVINH
                     GSVPFFLNWVCHYRCVLQSQFLAGTVRLPVTVRARATDGKVLDWLRQRSLDTPWLRIR
                     AARAPLARAVASYQAMKASNSLFYEIERQKFSAVHAMFARTTHLPSRFYLLVCDVDVV
                     FLHEPVRAILRYGDADLYMQCDGCNTELYGAQQVQCPYEYNTGFMLFAVDQRTRSGRL
                     RFQAIRQLIAEVVHESIKTERARQLQPERKSVHDQFIFNKVLKKWTHNHMVQLRSPYE
                     NMTSIAGIEYVRPRIMYLPYEVFPNGCVLFGYRHREPSPAVRALLERGLVVAVHANYR
                     NGASEKWRALRSVNLTIASTQEESLNAQLCPPCDEIQATASTGHM"
     gene            complement(<284187..>285101)
                     /locus_tag="CYME_CMK102C"
                     /db_xref="GeneID:16994468"
     mRNA            complement(<284187..>285101)
                     /locus_tag="CYME_CMK102C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536467.1"
                     /db_xref="GeneID:16994468"
     CDS             complement(284187..285101)
                     /locus_tag="CYME_CMK102C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536524.1"
                     /db_xref="GeneID:16994468"
                     /translation="MENKRSRTGGAPATVQPSEKAAQSRPQVLQRTGRSTSSGPLAAE
                     VSSAMSAIPALVSQKFQRGAREGAGPTKPFKSEEQSSEAVRTLAEHVRQLRQKKQEEG
                     SVRTTESSADNGLRRPHKNAPAVMDAGGKLSTRNARQVVSQRVAKPVDPRFDPLCGRF
                     DENVFEQRYSFLRDLRRKALDEAKIKLAALEKRLKIAHESERDTLRSLHKELRSEVDR
                     RQNQVRRDEVTESFQALLRRHKREETEQLAAGRKTRPFFWKRSMIRDQLQKERDASMK
                     KHRGWKRHLERREREAAAKDRKLLRDSV"
     misc_feature    complement(285239..287115)
                     /note="possible transcribed region"
     gene            286037..288486
                     /locus_tag="CYME_CMK104T"
                     /db_xref="GeneID:16994473"
     misc_RNA        286037..288486
                     /locus_tag="CYME_CMK104T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461377.1"
                     /db_xref="GeneID:16994473"
     gene            complement(<288321..>289763)
                     /locus_tag="CYME_CMK105C"
                     /db_xref="GeneID:16994466"
     mRNA            complement(<288321..>289763)
                     /locus_tag="CYME_CMK105C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536468.1"
                     /db_xref="GeneID:16994466"
     CDS             complement(288321..289763)
                     /locus_tag="CYME_CMK105C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536525.1"
                     /db_xref="GeneID:16994466"
                     /translation="MALVGYQHLVTGQLLGPLKRSTRCLTHRKFERPLHSRFLAVSVA
                     RSAYVAGPFFPNTTPRIRSFTRQHATLQMSRPADAFSVAPMMDVTDNHFRTLCRLLSK
                     HALLYTEMVVDSTLVYNASNADHWLAFHPAQQPIVLQLGGSDPQKMRAAAEIAAPYGY
                     SAININCGCPSDRVAGRGCFGAALMKDAPGVAALCRAIAEVVPASTPITVKCRLGVDD
                     LDTYSFARDFVQVVSENAPVRHFIIHARKAYLKGLSPAENRTVPPLRYDRVLALARDF
                     PHLHFSINGGIRTMPQVRHFLDTEHLYGVMVGRAVMNHPWEALAGVDAVIFGDDSCAQ
                     RTRRDVLQAYGAYVDKQLHAASIYGQETDERESCSRGSQWTPSLHVLLKPILNLFWGV
                     PRSKEWRKRVQQATDEQTRIRRNSSVKSNFSWETFLPQVAESTLDPWYVNTTWMAMQS
                     ESETAAPEDCNNNSAHIDSPASTAITSIAY"
     gene            <290208..>290801
                     /locus_tag="CYME_CMK106C"
                     /db_xref="GeneID:16994467"
     mRNA            <290208..>290801
                     /locus_tag="CYME_CMK106C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536469.1"
                     /db_xref="GeneID:16994467"
     CDS             290208..290801
                     /locus_tag="CYME_CMK106C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536526.1"
                     /db_xref="GeneID:16994467"
                     /translation="MASLSDQSGSIGSEQTRPSGAIPVESLPPQALEQLIASLQQEVE
                     QLADALQQLNFANQRWTLCKQSIEAFAEETTRVDLPGAQSRATDAISSTASAKPETSV
                     EVNQNQRLLVPLSRSLYVLGRVINPERCLIDIGTGYHVERKLADAAEFFDRRLKHVRG
                     SMRQLTLKIDQNQQQMQTIREILVRKLAGAQQAAEHT"
     gene            complement(291051..292947)
                     /locus_tag="CYME_CMK107T"
                     /db_xref="GeneID:16994469"
     misc_RNA        complement(291051..292947)
                     /locus_tag="CYME_CMK107T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461378.1"
                     /db_xref="GeneID:16994469"
     gene            <293054..>294616
                     /locus_tag="CYME_CMK108C"
                     /db_xref="GeneID:16994470"
     mRNA            <293054..>294616
                     /locus_tag="CYME_CMK108C"
                     /product="probable
                     dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase"
                     /transcript_id="XM_005536470.1"
                     /db_xref="GeneID:16994470"
     CDS             293054..294616
                     /locus_tag="CYME_CMK108C"
                     /codon_start=1
                     /product="probable
                     dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase"
                     /protein_id="XP_005536527.1"
                     /db_xref="GeneID:16994470"
                     /translation="MGRNRISQLAIVQILTLVVYWLIFAVSVQSVEPKLCGGKPLAGG
                     GTLSRHISSRSTPPVGRQLLALVDGETSSYSILFGVLRDRGYTVTVRTPKDRSLTLWN
                     EAGTHYLYDAVLLLAPSIKGFGRDGTANALLDFVDANRTLIMAASPNAGALFRSLAEG
                     IGLELDEAGTVLLDHVRAAHRSGAGQDTEGSRIFLVDPKPCPSLDLGATLPYWEKEMP
                     QRPLLFANATGSLVAPKQDLLRPVLCAPATSYSYEDGQVVETDEDAAPFTIGTEAVLV
                     AALHGRYGGRVLYIASTEALQDRLMSGEHGNRAYFEDLFTWALGERGILRITRAEHRH
                     VPQGNERPRSTPYRVGDRLRFELCVEEWDGRQSQQRWRPWLGGNEPQLEWVMLDPYVR
                     TSLRATKDQGCYATEFDTPSKHGLFKFRIEHFRDGYTPLLLSQVVPIRPYWHNEYPRM
                     LVRAYPYYAALFSTMMIFWIMAYAVLWKGLVSSKRLGIQTTSRSPHATVSSKDAAASS
                     TEDSDADHQKQE"
     gene            complement(295095..297232)
                     /locus_tag="CYME_CMK314T"
                     /db_xref="GeneID:16994471"
     misc_RNA        complement(295095..297232)
                     /locus_tag="CYME_CMK314T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461401.1"
                     /db_xref="GeneID:16994471"
     gene            <299097..>302468
                     /locus_tag="CYME_CMK109C"
                     /db_xref="GeneID:16994303"
     mRNA            <299097..>302468
                     /locus_tag="CYME_CMK109C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536471.1"
                     /db_xref="GeneID:16994303"
     CDS             299097..302468
                     /locus_tag="CYME_CMK109C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536528.1"
                     /db_xref="GeneID:16994303"
                     /translation="MNIAAVYVQRKRDGYTVARWEQTWLAPSESKHLAWRVANYFDPR
                     NVHEPATSRLETLMAEQGFAEYGLEHLGAVGANISAWSSGGYYQLSNRRLAGSYPTYW
                     LDPFELAVSENLGLTGVDAETGKPVVSALRVCVLWERADGLSDTLAAYDLLHRVSALV
                     RRYDRLFQSDVLTGTDASDLSESDEELTASELGQRCRLNLLLQYCMQGVDMADVEKWV
                     QNAPLCREYDGKAMNAWRSLWERKEQLRERALATGILSAAELIAIESAKATEALNSSQ
                     TPAVASKPSEATQKKKHSRGKRHKRDKGSKHAKEASPAATSSPKEQTDPLQTIIFTRT
                     AYTDATFMQKTRQAIAETLFGTSHVPENEWMEDFAYAKALDVPPVEATIDDWLAMLDA
                     KAAEERATAEAAAAIKRVNLWLVDDEFLDQNPGLAAELFERAPYFDGERLLQRAYDES
                     FSERAYAYFQNVFYLLERGHFKDALAILQDNIMAGMVRQRVLRTNRVPRAPAPDSAKT
                     ETEAANTSAQQRSQFETAAGHSAPREDVLTSAAGASTAERMDAPRQDAEQAIHFATIP
                     RGGQTQPLIEEVDDAPESAPKREALTASESMQLTSTAIIEVLPDEQTDAGSAPERQTT
                     AQALPDVAGAASSESHARTTGTATEKPHSEPDSNTWEQSGTETGVKAGSASEQEFGSD
                     DQSGRQAEAPKPRARLETTEEAVHPQVSGLGEESQDSLLSAGEHRVAHELVKNVIDAA
                     LGDAVDNVYSENATLSAVPMRSGLNEAPTAASATVDTALGCRRSRSTPDGVQAASDEG
                     SITETTPREGDTVIVLALESQTERISLTRDESSALDNAATAGAVSILGDRESLQEQQL
                     ERMPLQTMTTTAYQTGAVDGNAANGALAIADSSAQQRTGSESSLPPESEGPDPSPDHK
                     RLYLLGCWYKLALHILERITSLDRIATEQRTRSRQGANVRMSPEDERAQAHLSNLLAY
                     LPLLPRHRQAAVNVSIEKNMQLGNYGYARGWIDWAYDRFPFANSEATRARYDRILDEC
                     EDAAWQNEYVVPELDRLMEYYGRGALKLREYLLLAQEEVSGLWNLPSEQHSSGSESSS
                     SSSGTESANESSIEDASSVEEDLEGIVLSDTSSDA"
     gene            complement(<302857..>305016)
                     /locus_tag="CYME_CMK110C"
                     /db_xref="GeneID:16994464"
     mRNA            complement(<302857..>305016)
                     /locus_tag="CYME_CMK110C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536472.1"
                     /db_xref="GeneID:16994464"
     CDS             complement(302857..305016)
                     /locus_tag="CYME_CMK110C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536529.1"
                     /db_xref="GeneID:16994464"
                     /translation="MDAIRKLFEEQAAKNRENMARSYGIPASRFCGCCTECGAEPLLS
                     PFYERRLRLDSERTAWRQWQRELVRKQSEGQDGVRSTRLDSETSQTLPKERAPGTHGS
                     HSSLETHARRTAADQSPACAGDDCRCLESALESKLEPQVGSSEQCGSQGTCAPANAVL
                     ATPARSPEVTTSDEDASRESAERETFESFASRAGSLSASWNSAEASRSVASPTLSEYA
                     SMTSPRYEHETSGDDDFLDEHALHGDAPEHVVGDGGTSTSHEEEHAFTGTGMLAHMSD
                     TEPVKQCMDASELKKRSKTAEHRVCEYEHASNVAGSLAMLHADEDVVPSAAQADTDFS
                     ANATTISVPETLRTPALATETQSYGNADPMRPSPASLVGSRQNSSAALHENAAAERRI
                     ATSQGEVAKRPTVSMSEPLGHALANEEAVRMALETTGIADAEPVSGPLLESAGSGLDE
                     NTNGQRSMNEHVALNATTSPQTLATLFIATDSAEKRNRHQQRPSVESDTLSANQDRVL
                     DESTSNTAHHGEARASALTASTALAVSESRHVRASTVCTAATRWERAIAALEQLEQHG
                     RQELEHLQTQIRLWRMRIRAHVSDRRFRLWNELDWLRSSCVYLGWQQSFCDAVDKNAG
                     TTEALDVPSCTANADAMCTTCNVYETRFRQLQRDLALLRVHLHIHEATLQRLRTGTYL
                     SSPYVAMLEERNALRLTQRHLQSSLPASHASSRAGDS"
     gene            306059..307860
                     /locus_tag="CYME_CMK111T"
                     /db_xref="GeneID:16994463"
     misc_RNA        306059..307860
                     /locus_tag="CYME_CMK111T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461379.1"
                     /db_xref="GeneID:16994463"
     gene            <309394..>310425
                     /locus_tag="CYME_CMK112C"
                     /db_xref="GeneID:16994456"
     mRNA            <309394..>310425
                     /locus_tag="CYME_CMK112C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536473.1"
                     /db_xref="GeneID:16994456"
     CDS             309394..310425
                     /locus_tag="CYME_CMK112C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536530.1"
                     /db_xref="GeneID:16994456"
                     /translation="MQGLRRTLLHLRGALQRSRRLPCSCYPAGAVSLFALPERETVTG
                     AHRGNTSGRQALASCTSRLMTSLRARLRERIDWQSSLPLLDALVDARRTMLSPAYLAQ
                     YAAASAAAAGLYGATAWTGDATDDSRTGARNDTSTNGERKLATSSLPTITEASTANGT
                     RSDGPYRAPPITARVVERAGRRVASREGPHHIGLGWLTTVASAGAKALALILVQTLIA
                     GAVMYVWTHPQALLTASLIAMIAYASNPTETSFLEWSRRKAPVIAAQKQGFDAFRTRL
                     APYLLRFQDWEYFDFGLFSVVRVRDFADYVYLYIGVLNRWYLTGWYLDAPETDIRWEE
                     VRQANGSRS"
     gene            <312105..>313568
                     /locus_tag="CYME_CMK113C"
                     /db_xref="GeneID:16994457"
     mRNA            <312105..>313568
                     /locus_tag="CYME_CMK113C"
                     /product="alpha-1,3-mannosyltransferase"
                     /transcript_id="XM_005536474.1"
                     /db_xref="GeneID:16994457"
     CDS             312105..313568
                     /locus_tag="CYME_CMK113C"
                     /codon_start=1
                     /product="alpha-1,3-mannosyltransferase"
                     /protein_id="XP_005536531.1"
                     /db_xref="GeneID:16994457"
                     /translation="MKRAVSRLVVSVAIGIGVVDFVLLVLVVVRRPYTEIDWIAYMEQ
                     VKQAFENNERDYARIHGRTGPLVYPAGFLWIYYLLYRWTNGGTLRTRAQVAFAALHAL
                     GVALTCAVYQIATLDLDMERDRPSVAKPQRSARFLAPTSIGLIAALLVALSSRRVASI
                     FVLRLFNDGVESVLMQASVLFFVIARSRSHSGQHIRHQWLMDVIACLLYSMAVSVKMN
                     ALLYAPAVLVLLWEAHGFLQTLIYLVGVCGSWQLVIGWRFLRQHPWSYLRKAFEFGRV
                     FDQRWSVNFACLPEHVFVHPCWAALLLTLHVLALALFGVRAGVPLWLRCRPSENAESR
                     VNAFRTALLLWSSNLIGMAFARSLHYQFLAWVWWSSPFIALADWMMAVELFRPRVDLM
                     AIGWRLVPVLLIELVFNRYPPKCWASVVLHIAHACLLVRVWATVARWRRRDEQTPQRR
                     PVYGQPRPGMDDERQSMYVPERAAAERRQRPGVAATK"
     gene            complement(<317992..>319269)
                     /locus_tag="CYME_CMK114C"
                     /db_xref="GeneID:16994455"
     mRNA            complement(<317992..>319269)
                     /locus_tag="CYME_CMK114C"
                     /product="similar to
                     glucose-6-phosphate/phosphate-translocator precursor"
                     /transcript_id="XM_005536475.1"
                     /db_xref="GeneID:16994455"
     CDS             complement(317992..319269)
                     /locus_tag="CYME_CMK114C"
                     /codon_start=1
                     /product="similar to
                     glucose-6-phosphate/phosphate-translocator precursor"
                     /protein_id="XP_005536532.1"
                     /db_xref="GeneID:16994455"
                     /translation="MTTDYNRAYTKTLAFVGGFTPFRICASLRGLAGRSSRGPVCSKT
                     SALPVTSVLARSATSWAPRRWGFPRRPEYQWRGVQARTGKLAVAAVRMAAAAEDAASG
                     GVPKPVSELGIARRLKIGSYFLLWYLFNIVYNISNKTVLNAMGGGGWIVAWLQLALGI
                     PYILLVWTLGIRKAPTISLNDVQKLLPVAAAHTLGHLCTVLSFGAVAISFTHVVKALE
                     PFVNVVGSAIFLRSVFPLPVYASLIPVVAGVIMASVSEATFNWMGFLTAMGSNFAFTA
                     RNIFSKINMTTPKGQNMTPMNLYAVLTILSTFLLLPFALIAEWRVFPAAWRAAVAAMT
                     LPKLLVWVGVSGLFFYLYNEIAFMALDSVHPITHAVGNTVKRVVIIIASVIVFKNPID
                     WRGWLGSAIAIGGVLLYSLVKNYYETRGSKQQR"
     gene            complement(<320824..>323145)
                     /locus_tag="CYME_CMK115C"
                     /db_xref="GeneID:16994459"
     mRNA            complement(<320824..>323145)
                     /locus_tag="CYME_CMK115C"
                     /product="acyl-CoA oxidase ACX3"
                     /transcript_id="XM_005536476.1"
                     /db_xref="GeneID:16994459"
     CDS             complement(320824..323145)
                     /locus_tag="CYME_CMK115C"
                     /codon_start=1
                     /product="acyl-CoA oxidase ACX3"
                     /protein_id="XP_005536533.1"
                     /db_xref="GeneID:16994459"
                     /translation="MEKHLPISTDDARNSVRVTGGAVREAAATGVVQAFAGVRQMPRN
                     PARSDALQEMDSEKSATFRLCRSPAEAPGTPGVPLQLTFCRQRMRALLDAHDIAFRDR
                     IYAMFEQHADLFTPRYGLTVPEERELVMARWAVIREAQLLKGTLNYSPEARGRYDAVM
                     ESCGYVDHSLEVKMGVHYGLFGSSVALLGDEQQCRRWLQDIEDARMLGCFALTELGHG
                     SNVRGIETLATYDPGRGEFIIHTPTETAQKYWIGGAAETARWAVVFAKLLTPDGVHRG
                     IHPFLVRLRTDAGEVCHGITIADVGVKQGLNGVDNGRIWFDNVRIPREQMLARYSQVL
                     PDGSYRSSFKTGDEQFAAQLAALTGGRVSISVGAVNRMKTGLCIAIRYALSRRAFAPS
                     GDDEEADATANETHDGKTAPEEMLLMDYQSHQMRLLPMLATTYVLALATNRLKYRWHH
                     RLEDPNPKEIHLWSSGLKAFATWTMSDVLQECRESCGGMGYLAENRIGVLKCDFDVYL
                     TYEGTNIVLVQQVARAQLAAYAAGKLPPPPAVPAITSDRELAEPAFITASLARLHDAL
                     VRRLAERLTYATKQNSMKPFFAWNKMCLDLAIDVGKVYTCLLAYRIACDEVRQIDDPA
                     LKQILGYCCALYGLHMLDKYGALLTRMNVYADAPNTLERIHQQVEYLSSLLRPNALAL
                     VDAFSIPPMLLAPIAFDWITRNARAHIHKYGERQRVSSHSVVSALQAPPRVPDRNSTQ
                     QHVPGFPVCNQATLNRDTEITSQTKAGWRFPRL"
     gene            <324045..>324653
                     /locus_tag="CYME_CMK116C"
                     /db_xref="GeneID:16994460"
     mRNA            <324045..>324653
                     /locus_tag="CYME_CMK116C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536477.1"
                     /db_xref="GeneID:16994460"
     CDS             324045..324653
                     /locus_tag="CYME_CMK116C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536534.1"
                     /db_xref="GeneID:16994460"
                     /translation="MGRMNTISGTNGTVPDFTSMRESRDSQLRGTGQCERRRCPRVRA
                     RAGELSSNTALLFVVHTGVQKSFRCSLIVFITLLAETSSSRAMPRSAEQAHISKQMGI
                     HLLSDLGHGSALLTTQMRPPYLSIGLVSGTASFAVCITNAIRCTLTRRNAYSVRFLRD
                     VATRNCNATQMLTRKSALSNRDNVPFARLWKTTGTAYHSSPI"
     gene            <325502..>327076
                     /locus_tag="CYME_CMK117C"
                     /db_xref="GeneID:16994477"
     mRNA            <325502..>327076
                     /locus_tag="CYME_CMK117C"
                     /product="similar to Protein phosphatase 2C"
                     /transcript_id="XM_005536478.1"
                     /db_xref="GeneID:16994477"
     CDS             325502..327076
                     /locus_tag="CYME_CMK117C"
                     /codon_start=1
                     /product="similar to Protein phosphatase 2C"
                     /protein_id="XP_005536535.1"
                     /db_xref="GeneID:16994477"
                     /translation="MPSASGERLDVSNDALQRLSTSSFSTVSVDSAERLSAEQFKAIK
                     EPLAARARVETREMSGVPIPKTNKSRASAEGTSLGSSLRRAASRLFQPLRRSESGRSL
                     SSRLRGRDSVADSAASRRRLLPFSQVYAHGVVEEQGRRPTMEDRCCTLVIGDGADAIG
                     IFGVFDGHGGKLASNYCHDHFLERLLAHDAFITDTERALTETCHLIDQEILAESVRKR
                     TYAGTTVALAVLKDGKIYCCNVGDSRTVLCAAGGVAVPLSVDHSPMVPQEVRRIKAAG
                     GFINSRGVNGYISLTRALGDLDLKAHARRLFPHLDITGNLLIPDPDITIRELHPQDEF
                     LIVACDGVWCRLTNEEAVRITRAALRRYGGDPQAAATTLVHAALAAGSGDNVTVIVIV
                     LSRPDLMRDVTVHGGRAFQHLSSMALNETTSSSASTGEHDPEMPSRDSSQSNLSLASE
                     DNSLYNEQEDVSAYTTELGPTGLGGEPAEVVLGDAPEEQLNTLSLGDHMRAASADDQD
                     RQRSTSKFGLFQRRPR"
     gene            complement(<327510..>327953)
                     /locus_tag="CYME_CMK118C"
                     /db_xref="GeneID:16994458"
     mRNA            complement(<327510..>327953)
                     /locus_tag="CYME_CMK118C"
                     /product="40S ribosomal protein S12"
                     /transcript_id="XM_005536479.1"
                     /db_xref="GeneID:16994458"
     CDS             complement(327510..327953)
                     /locus_tag="CYME_CMK118C"
                     /codon_start=1
                     /product="40S ribosomal protein S12"
                     /protein_id="XP_005536536.1"
                     /db_xref="GeneID:16994458"
                     /translation="MTEVAESVPEAPSVPALPVVVPEEEVTDVNTALRIVLRKALAHG
                     GLSRGLRESVRALDSRKARLCVLAMSCDEPAMVKLVQALCAEHGINLICVPDGKELGE
                     WAGLCKLDADGTPRKVVSCSCVVVKDFGEPSKGLTFLENYLKEQS"
     gene            <328363..>332283
                     /locus_tag="CYME_CMK119C"
                     /db_xref="GeneID:16994474"
     mRNA            <328363..>332283
                     /locus_tag="CYME_CMK119C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536480.1"
                     /db_xref="GeneID:16994474"
     CDS             328363..332283
                     /locus_tag="CYME_CMK119C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536537.1"
                     /db_xref="GeneID:16994474"
                     /translation="MLPERDPTRLVSLHTRVAEAQRLARSWFQEVSGSQRYGQQRAVS
                     GATAVRVHSNEPIPEQVQRLLTQGSLREIDVVLETLLSEWARASEQTCTSIARALRSC
                     LPQVRNGAECFVARFAWRLVALDETSARVLLLAAAHSDREELACAVAALADRAYLERS
                     AVALPAMPEYELVRQTTNIAVAYLQAVMTPSTASRARRIFLRYALPSNLAQAALYLLL
                     QYRGDQFPSEEFSLILERFPQPDVSMLLWYLVRMEAFLSGTASVPDPSVIAGVGQTRS
                     MLSRRDAFREHRDSAAVLLLLHDWHALERYGSVWFSSMGPSKEQLNDLYDWKRVDVRL
                     FWTVRILGSSTNSEHLSHVADLSDALEALLERTQSLFPRTRALCQTIGHVLALESNLE
                     KLAEWLWSQESERIPLPLFVSYLFAVHQPQVQGAVILKLAHRNRLSHGKTQYPIEVLY
                     VVIAALLVTLRTGELVTGLNICLFIDCMQSFVQNNEVFLKTFLPCIQLVFGEALREAR
                     EQHRLAWERLWVTILGRLALRLPRAQRLLEQGLSRALNRDHQYATSVLSLYMKSVRDL
                     CSSVPARGMQLLALIQAVVLRMRETNAGHDAIAYALEALDHLVQAQLMDPAKTLRFLL
                     QQMPLSAYKSNRWPALLANAWFGLLTSILREYPWQPTRRAHRLLRVLLWLLHDCESDP
                     RAALALTRLGYRVWYAAQWWEHQQAPRHTAGALPSNDADLSGEAELLESLPHLMPNDQ
                     WTPRSIERLARYIQFAVDPALTEQVPLLPVLEASDAFYGLARMLIHGAWAHRSRAAYH
                     ARRLRLGRSRDSQAYLQRELTSLREYADSLPTLSPIRLVMNLVLDMEQNAPLALVSAQ
                     LMATCGATLRSGLSYEALYAMCGASGNTSESGGAARLARLLCVWLLAPSSNSSETPSE
                     SFWRLLDFDLRPYQIVLQPDEDALLEQMLRRFWMAPLWSCVSQGVEGATGAATAAAPT
                     DPADDLLEVMKQSWACFGATVWPWLVQRSALAYRMRWQPWLVQQRRIGAWLERICGRR
                     LIIPEAAPLFIEARLPFFRPVSLAESLLRLEGAGASLEHVLRSAGRHVWSALLDMDSM
                     ATTTTTSDVTAAVDEMKQSDEQRRQRLVAYWRALLCNEYAASCTEVVAPGALRADHAT
                     SLNRAESAFPDDDPLMETSSPVSSFEESIAYADPLCLVILERIQRQYSSRTQRLIALH
                     QALDEGSPHTHSKRSLRWYTRCIGLVQGAFGGIMLALLPLIPLEQATLCLDRLHTITS
                     LARQESSDQRITGAFVSSQDRQRDLTLLNELCERIRLELLCFPA"
     gene            complement(<332557..>332928)
                     /locus_tag="CYME_CMK120C"
                     /db_xref="GeneID:16994476"
     mRNA            complement(<332557..>332928)
                     /locus_tag="CYME_CMK120C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536481.1"
                     /db_xref="GeneID:16994476"
     CDS             complement(332557..332928)
                     /locus_tag="CYME_CMK120C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536538.1"
                     /db_xref="GeneID:16994476"
                     /translation="MPFCVGVRDSVMIAHSFRGEAFGCAQNLHGATYTVEAEFFADAL
                     QPDTNWVIDIGAASKALATALEPYQCRNLDDLEEFRGQNTTTEFMARHIHSRLRTLLS
                     FQGRLRVTLHESFKAWASFEA"
     misc_feature    334101..334789
                     /note="possible transcribed region"
     gene            complement(<334425..>335264)
                     /locus_tag="CYME_CMK122C"
                     /db_xref="GeneID:16994479"
     mRNA            complement(<334425..>335264)
                     /locus_tag="CYME_CMK122C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536482.1"
                     /db_xref="GeneID:16994479"
     CDS             complement(334425..335264)
                     /locus_tag="CYME_CMK122C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536539.1"
                     /db_xref="GeneID:16994479"
                     /translation="MASSEANHAGVSGNQGTAPETSQGATSTPRQATTMLPGYGGGYG
                     GGYGGGYGGAGYTGGYYGGYGMGGGYLGNFYGPGTYYGGLGSGLYGGYAALASRFTNG
                     VVNDGHSTTSQALGVLQSVMAPGQSAMATLQNVMHAIARVTGILEENMRTIHILFDSV
                     FGLVYNLTFLREELRGALQHFRPKSWFTEWLQRILGLWRLLLLLALTPFSLRLPPVAA
                     VLRFLGLVPREQQPIENDSDTDSFSDTDSEESHHVGASNPRTTLSWSARTAAAAANER
                     QSL"
     misc_feature    335467..336822
                     /note="possible transcribed region"
     gene            complement(<336135..>338099)
                     /locus_tag="CYME_CMK124C"
                     /db_xref="GeneID:16994480"
     mRNA            complement(<336135..>338099)
                     /locus_tag="CYME_CMK124C"
                     /product="similar to peroxisomal targeting signal type 1
                     receptor PEX5"
                     /transcript_id="XM_005536483.1"
                     /db_xref="GeneID:16994480"
     CDS             complement(336135..338099)
                     /locus_tag="CYME_CMK124C"
                     /codon_start=1
                     /product="similar to peroxisomal targeting signal type 1
                     receptor PEX5"
                     /protein_id="XP_005536540.1"
                     /db_xref="GeneID:16994480"
                     /translation="MASSWHPAAAPSQVCAPDDVSAARVEGRSASGGSAVPDGAGAWL
                     GQLGAAAGTRERAWGPAPTNQGPVFVGPRPGEAALELPLPPELAAELAARGVPLQGAG
                     ALAPPPALVAEFGRLQVHGAGPVPAHGQAAQTHLPNSFHSMQAAWNTSQFGAAPKHHG
                     GMSAAPPLDRAWASTASGRAQQHLEPGMRPMAWSGPYRSAYAPRYTSFYGPQNFASNW
                     SNVSRAPETQTEQVHQTDQQRDELEQSATSASLGQAEQRDVQATAHTQVSTDAPAASV
                     DAETPSSLSFEELLRQARVDLDDTFDDDYLHAYGRAMNDTAYRFQYTAEENRYLTDEG
                     RESQTADNRAAALAALAEGERLYAEGRLAEAIMAFEAAVKLDRELSRAWYFLGVAHAE
                     SDQDPQAIASLKRALECEHNEAQGDDMIADTLLCLGVSYTNELNPSQALRYLQQWLDL
                     HPSAQVQPASARAAPVSSASPADETYPTPTSQVDELYARQRALLERVQDLLSRHNDAQ
                     RDADLYSVLGVVHSLMRDYDAAVLAFRRSVELRPDDYRLWNRLGATLANHFRSMEALR
                     AYRSAIDRRPNFVRAWVNVGTSYANQGSYPQAIRYYIQALQRNPRALHIWSYLRTAAI
                     AMNRLDILAMAEDMNQDNLEAIAAALEQSS"
     gene            338380..339877
                     /locus_tag="CYME_CMK125T"
                     /db_xref="GeneID:16994481"
     misc_RNA        338380..339877
                     /locus_tag="CYME_CMK125T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461380.1"
                     /db_xref="GeneID:16994481"
     gene            complement(<339336..>340457)
                     /locus_tag="CYME_CMK126C"
                     /db_xref="GeneID:16994485"
     mRNA            complement(<339336..>340457)
                     /locus_tag="CYME_CMK126C"
                     /product="probable ammonium transporter"
                     /transcript_id="XM_005536484.1"
                     /db_xref="GeneID:16994485"
     CDS             complement(339336..340457)
                     /locus_tag="CYME_CMK126C"
                     /codon_start=1
                     /product="probable ammonium transporter"
                     /protein_id="XP_005536541.1"
                     /db_xref="GeneID:16994485"
                     /translation="MWYSTIPLAFDLLPVLLWWFQFTFCLTAASIVAGAICERVRVFA
                     YIGFVALMMGFVYPVISHAIWNANGWLNLFYNKVTNPTTGHIIGSFGFYGTAGSIDFA
                     GSGVVHITGGAGALVSAVIIGPRIGRFDENGKVRPIPGHNISLIVLGGLLLWFGWFGF
                     NPGSQLGVLSYADGGKVGSAVRGGFNKNGVPTVYSNAGQVALAAVNTLVLSASAGITT
                     LIIARFVDKYFDCASMVNGSISDTVAVTSPCSTIPTYSALCCGVIAGWIWVFGDKLIQ
                     RLRIDDPLGAVTVHAFGGTRCVLIPGFFAKPDTVAMVYGSYDGSGGCILWLWKAARCS
                     ADGDSLRLAVCGNEYRRLLLDPQVSRPATRPAGGGNSWE"
     gene            <342641..>347233
                     /locus_tag="CYME_CMK127C"
                     /db_xref="GeneID:16994486"
     mRNA            <342641..>347233
                     /locus_tag="CYME_CMK127C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536485.1"
                     /db_xref="GeneID:16994486"
     CDS             342641..347233
                     /locus_tag="CYME_CMK127C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536542.1"
                     /db_xref="GeneID:16994486"
                     /translation="METELYRESALFSWDEVATWTTRSLATGRTAEPESIASPGGPTA
                     SQGATQTALEASSGRVVDAGAVFGAPVRDSEAGFNDEYIEVLIWRLLRHKERDRAGAS
                     LWLEIARKRFYGSMQKFPDPGALGNLSTLQATLAQVLHGERWRLLDESISAVVFGADP
                     SWCYLLVAGTRLVCVRLSALKSAQTEVVAYEYRNGLGVGTALSSERVMRTPGSMRRES
                     VQESHLDTETADMRYFSMETYAPFPSNTVQTLHLPTEVYAIQALEDAPHAFIAFARSG
                     HLFRIEIMQPTGMDVTNVSYTLTTLASPKSFRNFGPAKRILQSLKTPGRLGATAGAST
                     PTRVSPLGVERRTPWLASSRSAGRAFGQVPIVATCAMRGHVLMLDMEGIFRLWDLGNP
                     QVFVESVPWRASLASSGSFGLVPHTHSVEIAAPNGVMASFLAVVSVLDASGLLRLQLI
                     HVVLRRAAEENSTPTGLELTTQLLADAEAPAEELTTCCFWQSQQALCLGWANGSITLI
                     PVSADAISSASTREASGEPWWSFSLKPVYSIAAEDEIDADLHLQGALDRTPGRDPVER
                     ILAPHRFPWGTVYRVLQRSLRSEQDAANTSAVTSEYALDQSMSPWTLSASPCLVRYLR
                     ERLVELATQDPATMDRFLRRVRMFYLENDASVLQLQPMPLLDAFSLVVHPWGAAVLRL
                     CDASECLFFRSRDHSFSTNQGDALPWMTFLSRLLVERFNASRCDASIGGSTPALEPLA
                     SPPALLQQDDSAALLHHLWDIVTGPCLLTADALQRLQPPPGLLAVVQATSLPQIAYVR
                     RTFAGIGANLAALGQQQQQQQLNFWNHQERLWDLALRISTSAELSDQYGHHFVERMLG
                     NGEWLVWLKMQHALSTDSVNANASASAGSATWLTLVPLLIRPSPSMVRLLVEKAPLHW
                     ALLLIDSFYENEMPAVRAHVAGLIALQRWREERQTDPVSPFVEAWTELQQKQRPLDLE
                     LLPQLVGSMSGALDYAERMVEFLEDQQAHEAACQMARVALATLRAERHVQAGGEPQPG
                     LVSVRERTEREITQTQLGFFLFMRALDTNALDEALSVLVKDLRESSAPQTRDALYLLL
                     QKAIEMKGMPWLLAQSLPPLCFLRSAEALWRLATACDLERAGSLYETTCAVYMTRNEW
                     WLAACVAVDWAERTRQALDAVPAAQQAQLLVDASAAGESERVTWLLEQRQCALQLALY
                     LLKQAGDKAVPVTPSWVMVQEADIRRAWLLVRYQRALRRQLNASGHSSGNLRFLFETS
                     DAAARSVAYQLVASPHRFDGESGIMAALRLTCLWWNEATAATAASSDAAAPSMALADV
                     RRETARIIRLAVERVQPLYDEHAAADAALVQIDKELEAALNYAALTARTGYVFTPALE
                     AWIQCTGKPMQTASSERRTNSQGIATERLPNRDLDPAAIPTSTAEARIPSRKQSDDAS
                     ESKPAPSTFKTKVTVGIASAPRWLVDAVALRENHLESMLKLLIQKQLYADAAQLVVLR
                     LECSSPRRHPIYLSQHVLLQLRELLNAAPDTSATTS"
     gene            complement(<347336..>347548)
                     /locus_tag="CYME_CMK128C"
                     /db_xref="GeneID:16994483"
     mRNA            complement(<347336..>347548)
                     /locus_tag="CYME_CMK128C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536486.1"
                     /db_xref="GeneID:16994483"
     CDS             complement(347336..347548)
                     /locus_tag="CYME_CMK128C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536543.1"
                     /db_xref="GeneID:16994483"
                     /translation="MVSAWSGALFGLAVQLMSNALQKLPLMRRPWEHVLFAAGGAFVG
                     HKLGDLEVELTQRIEAHRANQKRPGS"
     gene            <348770..>350731
                     /locus_tag="CYME_CMK129C"
                     /db_xref="GeneID:16994484"
     mRNA            <348770..>350731
                     /locus_tag="CYME_CMK129C"
                     /product="nitrate ABC transporter ATP-binding protein"
                     /transcript_id="XM_005536487.1"
                     /db_xref="GeneID:16994484"
     CDS             348770..350731
                     /locus_tag="CYME_CMK129C"
                     /codon_start=1
                     /product="nitrate ABC transporter ATP-binding protein"
                     /protein_id="XP_005536544.1"
                     /db_xref="GeneID:16994484"
                     /translation="MFTIPTNWHALVWSHTASRTRFPGSASFAKRPEHGTAASLPVQK
                     PRRNALLSAQWRESKRSWSSTAITRETMTPLELPFLRLSRMAAGDAPRSAAVTPDSAT
                     PVAELVNVSYHVREHFPVIEDISLALHRYEIVCLVGQSGSGKSTILRLFAGLVQPTRG
                     TVYFAGKPLRGVNPNAAIVFQNFALFPWLTVVENVMLGLGSEIPLAERRRQATAIVDM
                     IGLDGYENAYPRELSGGQRQRVGFARALVTHPTLLLLDEPFSALDVLTAENLRSELLN
                     LWTHGSMPTQSILMVTHGIEEAVSLADRIVVLGKGPGRIRAEIPVRLRHPRDRKSDAF
                     QELVDRVYKIISDEVTLPVDAVDQVTSVTERSGRGGATASDSRVLVSPPDRAQSQRGS
                     IASTEQETQNRAGDNAAAASPSTTNDGQPSDRPLSAAAKRQLLQKAARSNDERLNEFP
                     ALPPVRLGSVAGLLQLLASENSPVVDLYRLGQALQLDVHGLYPIVEAAEILGLLSVSE
                     GDVALTGAGHAFVAGSVDDRKRIVRGALLVAPDARLIQTICRLLQRAKHRRIPESLVL
                     DSLLDRYFEPSESRRQLDTAIEWGRYAELFAYDSVSGELFLEDENDANTNGMLADRRS
                     TETYQTETPNQRPRVTNAGHSVDTAPDLE"
     gene            complement(<351420..>352745)
                     /locus_tag="CYME_CMK131C"
                     /db_xref="GeneID:16994495"
     mRNA            complement(<351420..>352745)
                     /locus_tag="CYME_CMK131C"
                     /product="enolase"
                     /transcript_id="XM_005536488.1"
                     /db_xref="GeneID:16994495"
     CDS             complement(351420..352745)
                     /locus_tag="CYME_CMK131C"
                     /codon_start=1
                     /product="enolase"
                     /protein_id="XP_005536545.1"
                     /db_xref="GeneID:16994495"
                     /translation="MPSSIQSVRAREIFDSRGNPTIEVDVTTELGLFRAAVPSGASTG
                     KHEALELRDGDPSRFLGKGVTKAIANVNGEIAKALKGMDPTEQRAIDERMIALDGTPG
                     GFKRRLGANAILGVSMAVSRAGAAAKQLPLYKHINELAGKPPMLLPVPSFNVINGGEH
                     AGNRLAMQEFMIMPVGAHSFAEAMRMGSEVYQNLKSIIKKHYGIDSTAVGDEGGFAPH
                     IQDAHEAFKLLGQAIEAAGYQQQVRIAMDAAASQFWNEEKQKYDLDFKHPEGASSMLV
                     SKDELVQLYKSFCGTYPLVSVEDPFHEEDFDAYAALTEQIGEKIQVVGDDLLVTNIDR
                     IKVAAEKRACNALLLKVNQIGTVTEAMDANRFCRDLRWGVMVSHRSGETEDSFIADLT
                     VGLGTGQIKSGAPCRSERLAKYNQLLRIEEELGSSAVYVGDKFRTPWER"
     misc_feature    351431..351939
                     /note="possible transcribed region"
     gene            <354174..>354611
                     /locus_tag="CYME_CMK132C"
                     /db_xref="GeneID:16994496"
     mRNA            <354174..>354611
                     /locus_tag="CYME_CMK132C"
                     /product="probable transcription initiation factor TFIID,
                     subunit TAF10"
                     /transcript_id="XM_005536489.1"
                     /db_xref="GeneID:16994496"
     CDS             354174..354611
                     /locus_tag="CYME_CMK132C"
                     /codon_start=1
                     /product="probable transcription initiation factor TFIID,
                     subunit TAF10"
                     /protein_id="XP_005536546.1"
                     /db_xref="GeneID:16994496"
                     /translation="MTDAGRCIDNDDLGDFIASLEDYQTAIPDPLVQHFLNKAGFQTD
                     DPRVIRLVALAAQKFVADVAHEALTQRRIHRESQHKGSSSTEDDKVVLTKEDLKWALQ
                     EFGIRLARTEYFADNVSTTTTTTATASGTGGGGTAAGGGASGS"
     gene            complement(<354647..>359329)
                     /locus_tag="CYME_CMK133C"
                     /db_xref="GeneID:16994497"
     mRNA            complement(<354647..>359329)
                     /locus_tag="CYME_CMK133C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536490.1"
                     /db_xref="GeneID:16994497"
     CDS             complement(354647..359329)
                     /locus_tag="CYME_CMK133C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536547.1"
                     /db_xref="GeneID:16994497"
                     /translation="MERFIQRQRKRSREPESIDHTSGTVDYQVGRSLQRDHQKVAVGG
                     RRHSIEEAGAASRPSATRIEFPRKFSTDPRSDTSRTVQLRETVEKASERNAREDAVIA
                     CGEPRNHCYSRTAEIDDSTSCKPKDPETQATKYPGKLFMQEYAINDGREEQGLLNKQP
                     DVATQGSCTGDPEALPLKTPAATRVRSLLPIEQDPQDEVDDGASVEQASQCIVWNSAS
                     RRVCRVSPGVGSRTLTRTTLETEKTPHENLRRRASSECPEVSGQGRGTNADGTPVSAE
                     GFSPDSQTFEIWRRLRSRRRSSGLENTPVATTISPKTPFTEVRRRLVQRASRAVTVLL
                     EGNQPGVNAPTETRLTCIDTLDAAHAYNLEVEDEAMLDLFQLYTERSTESTGQLRSKV
                     GPREAASPRLTVVSVDRSCAANGKPSQTLLVRPCGAGDHFGTSVSDPEPRTHPSASFI
                     VVLQDSWSELNVQQGDTIRLVRCTAAGEYAPFQARCSGAAAQNDVPGHPFIVSAEENL
                     CILHPDVLVSGTSVANAFSCLRRVVLGERNRYSIHQPRTTRAALRGTLLHQLFQQLLW
                     CCIHSAETKPTVSEEDLCQLVRRYYAELYALGESEDELLSYLRESVPDLALHVQHLCC
                     EQHGVHLQVRGQCNLSGVDSMRIQKLYDIEESIWSPIFGLKGSIDVTVAAELLDRDRS
                     GQTLPITCLELKTGRQEGFSGIAHRAQLILYALLLSERYGTSVQATILLYLQNNQTGS
                     NCGAGSRLAHREHGQLTMSLHLIPMVRAELIGILMTRNKLAHYLRFRRASASAAEQED
                     PLDAVGRSWLHLPPPLQHQENLCSFCYVRDACALYHRVIDSGEAHSSAIPAVFREMAD
                     GLSNQHVAYYRHWLAITRLEEEAAVANREEVWLLSPTERSQLGRCVGELELVQVEKTN
                     GLGTGRFVDCYRHRFRIVVESASDKCGGSTASPAWRQCPESDDLHLEAMQGARWDLLT
                     GDYVLVSLYWRRPPRALPDGGDVSAAPSADVWDPLRQETAIAGGFVAQVQPLTGEIEI
                     DLERDCSKWLQRHPLVECIPASTVRWRVDREELSAGFSTMYGNLEALLYPEAERLRRL
                     VIDLEAPRFTLSPGAEHSQCPSSSALLHMERFAADLNEDQKRAIERVLRSQDYVLLLG
                     MPGTGKTATVACLVALLVDAGCSVLLASHTHSAVDNVLRRLVEHNVHKFVRLGNRTHV
                     DPQLWPYMLCTEQMPDTSAEPAPSPLLPSLDAFSARFEEAAIVATTCLGASHPVFYRR
                     RKFDYVIVDEASQIAQPVVLGPLRFAQKAFVLVGDDKQLPPLARDPLAQAQGADESLF
                     TRLCAAHPEAVVVLHRQYRMAADIMLLSNALVYNGSLVCGDQATAEQHLTNRQQGLRY
                     VSPTPDWLVHVLDPRKRVLFLNTDAAQDRAREFRCGQESICNYFEASIIVRIVEALDD
                     MGIERQHIGITSPLRAQVSLIQNQFHQGQRIRNAGTLPECRTIDQFQGRDKDVLLVSL
                     VRSNSNARIGQVLRDWRRLNVAMTRARCKLVFVGSAQTMRTSPFVARLITLIQDVLHG
                     LVPVTRLN"
     gene            <362347..>364920
                     /locus_tag="CYME_CMK134C"
                     /db_xref="GeneID:16994498"
     mRNA            <362347..>364920
                     /locus_tag="CYME_CMK134C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536491.1"
                     /db_xref="GeneID:16994498"
     CDS             362347..364920
                     /locus_tag="CYME_CMK134C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536548.1"
                     /db_xref="GeneID:16994498"
                     /translation="MQETSSEDIGALGKLLENPSPERGGETGVSALGANAKQHVSVGS
                     TAEFDRAGTSANSTHVSKEESSSRVLGGFFDIHQREPPPVSRWPWSATHGSASGSQST
                     CPGSDETKNGGEVARDAKEAMQSRTYTSLGGATREVLRGSGYGAPVKDPLAHDDNDRS
                     SQGIGYVSSTKWRGLSNQGTPLSMDYGARETSSVQRITSDLKHLALSALNGSPLGFAD
                     SPEGNAMSSMDVSDLLSVCKHESFQPRSMVIEQQVAQTPQRRESVSYHMDLAVDESSG
                     LQRDRFVQALGSGHSTAPGKELDPVVVQSFGAEPGTHDATERLGKGTRSERISTAFAE
                     SLPMPASRPETDTLLHRYDRTDEKAADAREWIRANRSPITDQGSLSVSQSVYQHGNIP
                     RGTRSEAADDALNGSAATQLRSDAFHSSSRVWGSAQPEYPGVEQRVHEVVHISRRLSA
                     LDKTRSTWSEETSRGPRVPAGDPDSFRQEAARLVERIRQLEGDLHRSSKEHPRANPVR
                     GSVAPPERRRCTPETLPVGAIESRAPDVPASSSAHVDDGLAVDHRSTGAEHVASGGVF
                     RETGIGARRDLDSTARERFRETPSHVPNALLSGERPLDEQGLLEAHELRRSPTLSTVD
                     STPVSVSPLHTPVARQSSIERRSLAASDHASWSQPAPDHSERHHTHVQTSGQEAFSEL
                     PRATLRQRLEITLRQLGELQAVVDQQFEVIARLDEERSALQERLADTTAPSTPMRTAS
                     TQTEYSKLTASSDDDDDEQPPTAVYWQRKYEQACREYRFYASQKSQALRIAQLRNAKL
                     ERLVERLQKQLHEAEADITVARERLTRLRREHQRLRTWVLENGLTLSPLQKLERESPS
                     P"
     gene            complement(<365107..>365292)
                     /locus_tag="CYME_CMK135C"
                     /db_xref="GeneID:16994521"
     mRNA            complement(<365107..>365292)
                     /locus_tag="CYME_CMK135C"
                     /product="similar to NADH dehydrogenase I alpha subcomplex
                     1"
                     /transcript_id="XM_005536492.1"
                     /db_xref="GeneID:16994521"
     CDS             complement(365107..365292)
                     /locus_tag="CYME_CMK135C"
                     /codon_start=1
                     /product="similar to NADH dehydrogenase I alpha subcomplex
                     1"
                     /protein_id="XP_005536549.1"
                     /db_xref="GeneID:16994521"
                     /translation="MAWAEVVPSLVIVTVAVASMGLLQGVFHRLATGERRRVGQDRWD
                     RLLYERDRRLEAERVGK"
     gene            <366419..>367513
                     /locus_tag="CYME_CMK136C"
                     /db_xref="GeneID:16994512"
     mRNA            <366419..>367513
                     /locus_tag="CYME_CMK136C"
                     /product="similar to vacuolar sorting protein/ubiquitin
                     receptor VPS23"
                     /transcript_id="XM_005536493.1"
                     /db_xref="GeneID:16994512"
     CDS             366419..367513
                     /locus_tag="CYME_CMK136C"
                     /codon_start=1
                     /product="similar to vacuolar sorting protein/ubiquitin
                     receptor VPS23"
                     /protein_id="XP_005536550.1"
                     /db_xref="GeneID:16994512"
                     /translation="MPGEATSTRQPGRELRMNHVNNLTMYERRNWPRIVQDIEETLRQ
                     CPSLLPAIAVRRFEDGREQRLVVLRGTVPIFYRGVQYNIPMDFWLPAAYPAEPPVLYV
                     VPTRHMQIVPMHPHVGSTGRVYLPGLVTWNASESRLHFIVAEVSSNFSRRPPVYSIHP
                     RNTHATQQSRPAGTGEAATPGHAPTAATDAATGATQHPGRTVLRQRILERARRRFRDE
                     FRRIAELQQALEQEVAAAAQLHDDQGAMRSTTPPEDMAIIQEHARVSQELQAVREEVE
                     AQEEWIDAHRELESDPDLETILASTDAHTNMVTEARASELAIQDTLQLLEDALRRGQI
                     DIDNFLRLVRELAYRRFFICRHLRTLDGNT"
     gene            complement(<372218..>372562)
                     /locus_tag="CYME_CMK137C"
                     /db_xref="GeneID:16994511"
     mRNA            complement(<372218..>372562)
                     /locus_tag="CYME_CMK137C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536494.1"
                     /db_xref="GeneID:16994511"
     CDS             complement(372218..372562)
                     /locus_tag="CYME_CMK137C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536551.1"
                     /db_xref="GeneID:16994511"
                     /translation="MPEEPNNTHTNGQAAQSARQGGEQGKRSPAAVEGEQKRADRLED
                     DLDFFEEDDDFDEFELHNWEPDLAAVEEDELEWQDDWEMIDQDEDFAAKLAAELAQNG
                     FTRSDQPAAMDA"
     gene            <374073..>377300
                     /locus_tag="CYME_CMK138C"
                     /db_xref="GeneID:16994508"
     mRNA            <374073..>377300
                     /locus_tag="CYME_CMK138C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536495.1"
                     /db_xref="GeneID:16994508"
     CDS             374073..377300
                     /locus_tag="CYME_CMK138C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536552.1"
                     /db_xref="GeneID:16994508"
                     /translation="MPEPVDDALRRRLLQPESLRVEGLSRTQDAQLSDSLNDDEEIAV
                     RFTGQSGSPQAQSGNLNRASAPFLGYFAEVSSATPRQAQHVQWKAARRRLVCILLVLV
                     PVIVMIGIVASLRQYITEHGTESLVRKRLSHWGIAATVPLYSEKRWRRVWNATLTYTG
                     QRGFFGVYIGSGASNSTLNKVWLEVPISELEQPFVIDSLITRGDAEAFMLHAPSNRAQ
                     ENWFALRLGKPRPSWAVDLYRPQLGVRIQHNDSELAASYAAGTWTGWSKILRIVAVTY
                     QDALSVNKTASFENVTDETKNLRLILDVTPWVSDGFAVLSEDAPAKLTAQTSSPAKAP
                     WSYRVIAAKAYPGNVEIRVEAMFPQKEAASGWNPSGVSAAEISFQLVRLPSDSLPLRL
                     ADERIGYFTTSFLLLDHDEGIHERIDVINRRRLPTVFYIDPTVPSRWRLCLKRGVENW
                     NLAFAQAGWNKSAARVEPAIRAVLPEDSDWPSDYDIGDIRFSTISWSPSLNSVFALGP
                     SNIDPRTGEILNSNIIFTHGWIRSLMRQYTNLVAAQQRLTAPNDSSRLSGQRRSSEAY
                     PMASVSTVRESPALRRVQLVDAARLDTAAFAILEVMALVSDVGDVPERFICDALIDTT
                     MHEVGHALGLRHNFRASANVRWQDLSDPEYVERNGISSSVMDYLPILIFADSQKQTRY
                     FQHVIGAYDILAIRYGYGGSERPTQLLEQLHSSSLSLRQAVDEALTEHRVELAPLAEQ
                     AVEAGLHFGTDEDDPSPNGVDVYVSQWDLSDDPLAYHENVRLVVGRALSSLRALVHER
                     DLSWSDYSELVRYALFFGSRSALYATKFLGSIELRRGHPADIAPGRAARTVQVPRKPV
                     DTETMQRALGLLRRLLSPLDHEAILGGGYPTWALDLVEPAGKCDGVVTHCLGTRPVSA
                     LTLLQQTRSQVLSLALHPQRLVWLQENALWGTASTLPLHTYLELLTNMFFDPKNVETS
                     PEKFPLVRDAQVDYVLALRTSFLNMSTTSKGQGAVSAVAYELRRIHCLVRRMLEAPAP
                     AAENTSSDTMHRAHLLGLSALLGDKFPPLDSPSLYGMLTVPCPTS"
     gene            complement(<378985..>379887)
                     /locus_tag="CYME_CMK139C"
                     /db_xref="GeneID:16994509"
     mRNA            complement(<378985..>379887)
                     /locus_tag="CYME_CMK139C"
                     /product="enoyl-CoA hydratase, mitochondrial precursor"
                     /transcript_id="XM_005536496.1"
                     /db_xref="GeneID:16994509"
     CDS             complement(378985..379887)
                     /locus_tag="CYME_CMK139C"
                     /codon_start=1
                     /product="enoyl-CoA hydratase, mitochondrial precursor"
                     /protein_id="XP_005536553.1"
                     /db_xref="GeneID:16994509"
                     /translation="MRSFVTGKSRLLLQRLLLLSSSPVVGGCTARASRQCRCFSAAPG
                     DYSNLQVEVRGNVGLVAIHRPAALNALNDETTAELLDALQRYDRDSTIGAIVLTGTDR
                     AFAAGADIKEMANRSFSQARRRDAGSFMDLFFALRSPTIAAVRGYALGGGCELALACD
                     IVYAAEDAQFGLPEVQIGTIPGWGGTQRLVRAIGKARAMEMILSGRRISSREAEAWGL
                     VAAVHPEDKLLTAALDTATKIASLSQPIVQMAKAAVNAAYEMPLRSGVLYERALFQST
                     FATQDQKEGMTAFLDKREPKWTNA"
     gene            <380243..>381280
                     /locus_tag="CYME_CMK140C"
                     /db_xref="GeneID:16994507"
     mRNA            <380243..>381280
                     /locus_tag="CYME_CMK140C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536497.1"
                     /db_xref="GeneID:16994507"
     CDS             380243..381280
                     /locus_tag="CYME_CMK140C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536554.1"
                     /db_xref="GeneID:16994507"
                     /translation="MNAGTFADELSALELVYGSESVEFSAETRTLRVHLPSSSSPFGL
                     TLTCHVPDGYPEKVSLSCSDLRLTADWLPAPKLESMLRSVCADLDLHGSRRADALEQQ
                     AGVICSIASVLYESRQSVLHDEQLQCTQHWDTSTQGVVSDPGYTESAPLDRPQSESPE
                     RNKPENRQKRTSSNVPASELVTGITASIPDSQRATACEQDVTSPGPSEVVRLVSSEPI
                     TERKSTFQGHAARIMSSSAAVLCLQSLRQHRKGRQATHLSWAFRIMGDDQHIHEDYCD
                     DGEQRAGRVVLELLRSMNQHNIFICVCRWFGGVLLHERRFHCIQLAAKRAALALLETE
                     RAAPSLVASRQ"
     gene            <382902..>384338
                     /locus_tag="CYME_CMK141C"
                     /db_xref="GeneID:16994504"
     mRNA            <382902..>384338
                     /locus_tag="CYME_CMK141C"
                     /product="glycerate kinase"
                     /transcript_id="XM_005536498.1"
                     /db_xref="GeneID:16994504"
     CDS             382902..384338
                     /locus_tag="CYME_CMK141C"
                     /codon_start=1
                     /product="glycerate kinase"
                     /protein_id="XP_005536555.1"
                     /db_xref="GeneID:16994504"
                     /translation="MNTKARKVQGNRHPRNTGEFVFSGGRGVDERFCRRAFAEPCATE
                     VVPSSPSMLAWTASPSPFRRCTLNAASISPRRSAFARCPLRPLGRKALRARLHASLEP
                     PRDTAATSSHEFTHHVTEKAKDWSGSGTWLQSYIEQGPLAAAIPPQYAPSRSLSRWQA
                     WGSYLFKELGLDGTLERDQNRIFRFYLPVFAWSLHVVNRLQRDERRKQHGVIIGLQCP
                     QGGGKTTLTAALQKLFDLEQRRCVSLSIDDFYLTRREQEALARAFPENPLLGSRGNPG
                     THDISLALQVLNEVVAAPYPGEHAEVAVPRYDKSAFQGLGDRAPPEQWPLVSRPVDVV
                     FLEGWCLGFRPLALHERPATMDPITLRHLMQVDRFLAEDFSRLYPLLDAFIVIALDGP
                     KLSESLRIVYQWRLEAEQQMRAAGRPAMTDEQVYAFVDKFMPAYKAYLGDLYGGPPLT
                     GNLSRELRVGIDETRSPTRLNPHSELVP"
     gene            complement(383609..386548)
                     /locus_tag="CYME_CMK142T"
                     /db_xref="GeneID:16994503"
     misc_RNA        complement(383609..386548)
                     /locus_tag="CYME_CMK142T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461381.1"
                     /db_xref="GeneID:16994503"
     gene            <386811..>392675
                     /locus_tag="CYME_CMK144C"
                     /db_xref="GeneID:16994518"
     mRNA            <386811..>392675
                     /locus_tag="CYME_CMK144C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536499.1"
                     /db_xref="GeneID:16994518"
     CDS             386811..392675
                     /locus_tag="CYME_CMK144C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536556.1"
                     /db_xref="GeneID:16994518"
                     /translation="MQPVWETSKENVQPIKPGRSLRRLEAALGAAASEQRAPEGLDAR
                     VPGHDLDGVHVHLGRDFPSTRSKVEDSLSAKVKRQAKAISGGLNEGSNTTDREQRAPL
                     TATVEKGGVAHARSPGTQRCTSSAGSDLETTIEWWEQRTSRAVEESPADPLAIWIAYI
                     RWRQEAFPSEGPRSQLATVMETALRKFGPATSDPYLEQYIEQYRNDSRYVRLWVQYAD
                     LCPDPTEIFLYMRAQNIGQCLALFYEAFASVLEAKHQFAMADRCYAEGIERGAAPLDR
                     LHRRHEEFQARMMRRLERQRRAQQHAGPLRHGDSDAGGTVPVRHTLRGGQQPTGLGGN
                     TAQSTDIPRSALSSLREPDASTRGGQPYSRRSASAEAHANTSAWNETQGLRRHDSQTG
                     AWEPRGSHVNAASMSERPGRSFVVHADSSQLTEQSTSAASAQLPERPGESGMPTDGLR
                     FPSVAAGKRENQGRIQPWNGVHLIQDNEARFQHQRAMNAALVPHDQRRTLAFTVYVDE
                     DEEEQEEQEEQQQLHTASDARSLPHTFDVAAPSTDPTRSAERRSSSGRSSTGMKHASE
                     RAEHTESPFVSGSSRSGAQLHTPLRTENLATSRHVVARSDSVQEPECSVALRNTPISS
                     QPGAQRTGETRAMSLSPPFSPSPSPPSSSASSGQRLNSEQLQVCSPTLHTRQAMADIE
                     SMFNEPLHFEFEETRVLREMTKSDPAKATPTAGAWQQVNDSLRSPLIVEADENTPCLA
                     TSAPTREAEARVHGSSGAQSRMLDSSFDADASDSDKENCLDSARKTESRSQRPVYPRS
                     SLATGGVLVERCLPSPTDADFIDVEEDFTVDNERAWETADPKRSVLESTAEAVAAVEQ
                     ALVPAMQFQCSLATRPSPGMRREVAESAACSLHAETMRGAKSSEERPQCFPTSDALDN
                     DNASCRQELSIPDNRSFEAAPKSPSSMRPKEALVIGQCLLDADTAPHRSVLPPGHGQS
                     PQAARLEDPATETAAQGASHSPDVLQRSPASTHQQLDAQNREQVARSRTGSPGALLTS
                     TTAPASPAAESMPLPDSRSPEQHMAALQPPTPPLPSTSSSLSCSAMHQLFQPVLRTPE
                     REAFLCEMEESTSSNASLMNPADLCNAHVQSDAWYLDLTTDSPLGTAATSKETCNATC
                     ASHGKGTQSQERSPGSPSSDCIPFLAKDMTVALLDGIGSMPSGSQAVPQPPARAQVES
                     SNADATGALDNMSAESLQADAAVNGTATATGTGTSDTVNEDNTANTTPSSRERAASAS
                     LCEDETASSAAASARSDSEADAAQAAYSTDTLRSAAQTHEVPLRHPLWALAGTDQLLC
                     SAPLSPIPEGHEEASSTLSSSLSSPCQHAAAVQEGTASCAASPGLSPLAARSSTGSAC
                     SAQSTARQRQANGTIWGTPKAASGNWTSNTESPSVDALHEQHSDTLVLRPFALTFREQ
                     EEAWLSEHLQRTKPCDQFVLANTLELEEHTSCNVRITKPQSRSECWYVRSVLSVSNDC
                     TQGHMQSSSAGKSSPAVYYLVERILGTNEEDTKRRRRRISLPACSEKSTRSAARTALE
                     RVFFECGPRSSSSSSSSSKASLLFQPMRRAKATNRMLLVLKEQPIGAARWECVVLQRL
                     HEASAASDGCCEDPILTRLPRVETLYEAPDTQSAYTILGQVPPWGTLGDLLDLVRTPG
                     YVERPHPHDVAMTGPLDNNNNNNNNSFYDYNYNYRHGGLDPAFVAFVASELLQLLLFV
                     HRQLIMHWHIRPESLWLVPGDSALAPRILLSDWQHALDLRVLTLLQRGPEAEALAAEA
                     KCRGGWVPRAFRCLAMEQPQQPWAFDVDLAAVGSTLWQLLGHQGPPARLAPMNQTDLV
                     RYLESRSCNELPPSDGVTAWIEPVVGALAGCPSRSSSESVSLCSLIQERFIEPVCSAH
                     WKRICERARSYAWLLMAVRQERTPKRSDDAVVERQRTARATLSAAPSRYRRTSV"
     misc_feature    complement(387524..388959)
                     /note="possible transcribed region"
     gene            complement(<394969..>397893)
                     /locus_tag="CYME_CMK146C"
                     /db_xref="GeneID:16994519"
     mRNA            complement(<394969..>397893)
                     /locus_tag="CYME_CMK146C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536500.1"
                     /db_xref="GeneID:16994519"
     CDS             complement(394969..397893)
                     /locus_tag="CYME_CMK146C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536557.1"
                     /db_xref="GeneID:16994519"
                     /translation="MRSKAFQIYPILYIEDQQHAALVPIAYAPRGIDDDAVRPEQRMR
                     NGLGCIMRFRAKTCQDASLAPLALRAGSLLVAPRPGTGRLLICESANALKELNIATLS
                     QPMCEPNLIDEYISDDTGDRYRSFSRDIPRTTQAMKVTSAQQAKRHRLAPAFVTYSRD
                     GIERTVPQPETDATSSCSWSIVVRDSRTETVLLTRAKCSVASGSSKTALSSPIEKSEQ
                     TRVSRDNQFERGRFAELQSEWMTRELLSSGASECSTSAGNGDADAKSSTSAAVQAILC
                     ALTCTIEKQPPPWSAEIARAVLPLYVHPNLQVRTWVLAVISHCEAADELQRWLADQLA
                     ADNGPLLDAMRAAFHPKFESERERLVAIEFWANLVRLLGRRGLGTPGIARRLLNLYER
                     ALADARPSVHAAVLRAWHALIGVVLDQRLPKHEQERSWIRVLLQPIRMTLRHVPRTEL
                     ILTEGHTPSERKQVRQALIDMLAFFCYRYLRYTDISIRSATARIFEALADFDDDDDDD
                     VGIDVDNPDQRNIVFSSVLEHLFATEQVREALLLAALHRDWSQTRLAASEFAHATRTA
                     CQPDQADSLVDELFDAHAMVVPSIATRQRADRQLIAREWLSVGARDLTYRRFGELLVL
                     ALHQAGDERPLDPSRSLLVQRSFTTLFGALNECSRQCEKSIGTLLDQLTETFTRYPID
                     WTLLASPCLSVVVPGHGDKRQSPALLLLWLVAQRRGSWPPWLDALALALPDFWSCFEV
                     LTPVEHTALLQHLAQLAARRVTMSNATNESEQQQQQQRSIAVHHQQLDTCFALVFQDP
                     ASSLQLPPAMYQNVPGTLLAHRLQQYRHWVPVPRAIALLPWYAVAASEHAPELIHYLY
                     RLDPENVHKCLRAVAPPLAARLRRLQAREPVSILKTSPATPSPAVCSRRRFPSNDAWT
                     LTDSPHDQDDTVRDLSAKKTSRHVRFEDEPGLERLPSSPLSSPVRRESAPCSSPLVGY
                     TL"
     gene            <394995..>395342
                     /locus_tag="CYME_CMK145C"
                     /db_xref="GeneID:16994514"
     mRNA            <394995..>395342
                     /locus_tag="CYME_CMK145C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536501.1"
                     /db_xref="GeneID:16994514"
     CDS             394995..395342
                     /locus_tag="CYME_CMK145C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536558.1"
                     /db_xref="GeneID:16994514"
                     /translation="MNTVPIPVVPVRITVTMVNARVRVHLQSGRDGKFSSLRGHERYR
                     LGHEGCQSGSRRRYSGNAVDCRPQDSVSRVRFSESILVHELVVDADEPPMEVPLHGGT
                     CGRFRGPDDTSSG"
     gene            <398194..>399639
                     /locus_tag="CYME_CMK147C"
                     /db_xref="GeneID:16994516"
     mRNA            <398194..>399639
                     /locus_tag="CYME_CMK147C"
                     /product="similar to GTP pyrophosphokinase"
                     /transcript_id="XM_005536502.1"
                     /db_xref="GeneID:16994516"
     CDS             398194..399639
                     /locus_tag="CYME_CMK147C"
                     /codon_start=1
                     /product="similar to GTP pyrophosphokinase"
                     /protein_id="XP_005536559.1"
                     /db_xref="GeneID:16994516"
                     /translation="MRLYDVGWAFAAPVGHISLRSKSGSRCALPNRGREPLRPRVYEA
                     LGSAKTARHCVCARLPAPAVPAIQHTSRESNASSYAVVDVLWPVLQRACTHIESKDSL
                     ERIFQALRLCAELPGEESMISVRNAAFLARLGVDADTICAALVDALPRTLLRYPPLDG
                     AVRAIVEDLDALRAIEQSALVDIGDLDEQNARRLREYILIALRDARAVLARLTQVLQD
                     LQQKVESESPAYDQQALALLVLQVHVPLAYALGLGAVMWPLEDLSFRILFPLSYRACE
                     SWHAHIWEQADQLIQEACATLLASLQNDPELRRYRYEITGRAKNLFSTFKKMLRSGKR
                     REDILDIVALRIVIDGIDESTDQHEVCMKVYKHVIKVWPELPGRFKNYCDQPKANGYR
                     SLHTTLRHPQGLPLEVQIRSREMHVDAEFGLASHRLYKGLITANASKIREFSSFAETV
                     RLENTHVLTDACSFQIDAAGEHLHMANAEVQ"
     gene            complement(<400880..>404980)
                     /locus_tag="CYME_CMK149C"
                     /db_xref="GeneID:16994500"
     mRNA            complement(<400880..>404980)
                     /locus_tag="CYME_CMK149C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536503.1"
                     /db_xref="GeneID:16994500"
     CDS             complement(400880..404980)
                     /locus_tag="CYME_CMK149C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536560.1"
                     /db_xref="GeneID:16994500"
                     /translation="MTSLLWDSFHSFLQQTRFENIESHDDAGTSDLETAVDEASPAER
                     AFLLKRLCEVCVERPLAGSRLHLFVTVLRRLLWTALLEMGYCEFPDRKESIKAPVSRG
                     LHSKRAPKRRRVNIGAALDSEAVSVHGNAAAFEEPESDEIQPSAGELVEPTPANRGEP
                     KDELHWDSWPPPEHVVTAWLVQATESSFQECWPLPIDEWLVVVRESPASKQLKAATAE
                     RALLRMRETRRLPPPLIAAWLPLLMLSGTRRVLLEEALSSLLARDRLDIPQSVLELAF
                     RRDTAYAKALLRIARGIQYPHPIWHREAGAVLFLLVASMPSFHATCTHLLLRKITEYL
                     EDLIRTERTIFAFPNMERPRSPTQACMIIACSKPELLETILDLMSACLDANVVWPDSD
                     LALFPSDALKKAPLRTDVAARILERIAVAPSRRLPLMSWQRLLLGATATQPQAFLSER
                     SRQLLKEYVVRPETVPFLRKLMRYLPDLAETAIYQCRKLLFQASSVGQIPVARALASM
                     VAFLGTQEQPRQPNFCSGSHKRSELVSLGQLLPDFMLLSLRILQQGSAQMRRVWYETI
                     IEEVEGNGLAPAVVGILRTHFYRTFFTATWKPSAPEIESPLRPGSHWIDDDAASLLCL
                     LALGHDMEGFDDFVARLSYMDLSHLDIPADVGDQPLDETDRGVLTRLLQTIETAIVMW
                     PILHVAEIPDLSPDSTPGTVAQRRHRAASTSAGADDAAAAGEVIGASPTGSHESQNHS
                     PGVPVSPSPNLDHLGAFQVAHPGGAAIRNDDLDLGVTELASRRERPTPAGRCQQPYRH
                     ADIHGENESAPAIASVPKSAGVQRLTECTDWSRFRTVIAPLLRLHQRAMERLGDPYAI
                     WQRGGCHASTSMNAKHDKTEAQHKTTSTSSKEKRKQTSDNDSGVGRSLGVSSTNTTIP
                     ATALEKFLALLTETLRTGRAFQEIFKLLEIALRRLLLVSSFPATMTTQGRLVPTLLQV
                     VALPLSGTEADTAYLLAILLLGKIRRSSAEHLPFLAEKRQGFVSAPTRGSGILLAEQR
                     QHAVAALLRSLRSHSWSLCVASAALLGALGPQAQAAPVPESGQTRWDTALWRRIRECL
                     DSSRKVPLHPAIRQCLPAGGSDIRLLFHASLADSLVPTSWYPEQHLCSIAMDILQTWA
                     SSTVLDWNVLRLFTLQLQSWLQEWNWLVERGYQYSESTANATQVSQHILRIWADWACA
                     LSLVTTTACGDGTTNLARVSAPELIESERTLVPVVAVAPWTFIRTCARTQTLGFQSLM
                     RVARAVHQKRIALCRPAWKRMTFVASQGLATAAYDLLTAATEPTAEESAAKIRDESQL
                     FPQLIYALESAEKALFATSQTYRDPGLVRRLRRPVARDFKLAAFQT"
     gene            401722..403237
                     /locus_tag="CYME_CMK148T"
                     /db_xref="GeneID:16994490"
     misc_RNA        401722..403237
                     /locus_tag="CYME_CMK148T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461382.1"
                     /db_xref="GeneID:16994490"
     gene            complement(<406334..>408646)
                     /locus_tag="CYME_CMK150C"
                     /db_xref="GeneID:16994489"
     mRNA            complement(<406334..>408646)
                     /locus_tag="CYME_CMK150C"
                     /product="chloroplast translation elongation factor G"
                     /transcript_id="XM_005536504.1"
                     /db_xref="GeneID:16994489"
     CDS             complement(406334..408646)
                     /locus_tag="CYME_CMK150C"
                     /codon_start=1
                     /product="chloroplast translation elongation factor G"
                     /protein_id="XP_005536561.1"
                     /db_xref="GeneID:16994489"
                     /translation="MFIFAAPSITNVAARGDCRRPARFSVPQLVASRTASFTPSMRRW
                     LPRPAVRCGARSTRMAVATEEEVAGRVVPLETVRNIGIAAHIDAGKTTTTERILLYTG
                     ITHKIGEVHEGTAVMDYMEQERERGITITSAATTCFWRNHQINIIDTPGHVDFTIEVE
                     RSMRVLDGAIAVFDAVSGVEPQSETVWRQADRYRVPRICFINKMDRVGADFFRCVDEI
                     RKQLNAVPAVIQLPIGSESNFEGVIDLVNMEEVVWLGDEFGSKYERRPIRDSLKAQAQ
                     EWREKLIEAVAESDEKALEKYLEGQEFGVDELRALIRNGTCKIQFVPVLCGSAFKNKG
                     VQTLLDAVVEYLPSPLDVEHVRGVSVDGEKEIYRATSDREPFSALAFKVLTDPFVGTL
                     TFCRVYSGVIRKGDTVLNPTKNIKERIGRLLQMHADERKDIETARSGDIVAIAGLKDT
                     TTGDTLCDVDNPVVLERMVFPEPVISVAVEASSKADNEKMGVALAKLASEDPSFRFKR
                     DEETGQTIISGMGELHLEIIVDRMKREFKVDCKVGAPQVAYRECITTRGEIDYTHKKQ
                     SGGSGQFARVKIIFEPLSPEEAASGEDFVFVSEIKGGSVPKEYFVGITKALESEMSSG
                     VLIGAPLLGLKARLIDGAYHEVDSSVLAFEIATRAAFREGIPRCKPRIMEPIMRLEVT
                     TPEEYLSNVVGDINSRRGLINEIGDRGALKVVKALVPLSEMFQYVSALRSMSKGRANY
                     TMFFEKYEPVPPNIEKELLEKFGGSRSSKK"
     gene            <409751..>411478
                     /locus_tag="CYME_CMK151C"
                     /db_xref="GeneID:16994487"
     mRNA            <409751..>411478
                     /locus_tag="CYME_CMK151C"
                     /product="phytoene desaturase"
                     /transcript_id="XM_005536505.1"
                     /db_xref="GeneID:16994487"
     CDS             409751..411478
                     /locus_tag="CYME_CMK151C"
                     /codon_start=1
                     /product="phytoene desaturase"
                     /protein_id="XP_005536562.1"
                     /db_xref="GeneID:16994487"
                     /translation="MSVAAAFEQRLESGVRVNSFESRPLRYSTSRGLASEQDSAFILP
                     CGVFNKHLGAWCPGRVGSTRLHAYRCGSVRPRRLCLRGLLGRPVPPLQAPQPVGIPGK
                     EIVIAGGGLAGLSCAKYLAEAGVRPIVLESRNVLGGKVAAWKDADGDWYETGLHIFFG
                     AYPNMLQLFRELRIEDRLQWKEHSMIFNMRERPGEYSRFDFPEALPAPLNGIWAILSN
                     REMLTWREKVLFARGLVPAMLKGQAYVDGCDKLTWTEWLRQQGIPERVNDEIFIAMSK
                     ALNFINPDEISASVVLVALNRFLQEAKGSKMAFLDGAPPERLCEPLVQAIEAAGGVVK
                     CNQRVSEIIYDEKSCLVRGLKLKSGEVIEADAYVSAVPVDILKLLVPEVWKHTFPEFA
                     RLEHLEGVPVINIHLWFDRKLTDVDHLLFSRSPLLSVYADMSNTCRGYADPDRSMLEL
                     VFAPAKDWIGRSDEAIVQATMAELEILFPRHFGPHAEQPARLRKYHVVKTPRSVYKTT
                     KGLQPYRPAQKTSIKNFFLAGDYTQQMYFASMEGAVLSGKLAAHEICNALRAGELPAR
                     LTDAVLAAS"
     gene            417036..419268
                     /locus_tag="CYME_CMK152T"
                     /db_xref="GeneID:16994488"
     misc_RNA        417036..419268
                     /locus_tag="CYME_CMK152T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461383.1"
                     /db_xref="GeneID:16994488"
     misc_feature    complement(417099..417713)
                     /note="possible transcribed region"
     gene            <421112..>422020
                     /locus_tag="CYME_CMK153C"
                     /db_xref="GeneID:16994304"
     mRNA            <421112..>422020
                     /locus_tag="CYME_CMK153C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536506.1"
                     /db_xref="GeneID:16994304"
     CDS             421112..422020
                     /locus_tag="CYME_CMK153C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536563.1"
                     /db_xref="GeneID:16994304"
                     /translation="MQYKLQVRNFIFVVLSLALLVGLASSVAAEALDTEGRWYQQQVT
                     VTPQVQCTPVTYTATCVPKQACVQYTTQQVCEKKQTVCQQVQQVQQVQQVQQVQKTVI
                     PVKKTVMPMKKQPMYRWYQYEQVQATATPTPICTQVCQYANVQVCAAYEQYEVCKVCT
                     QQYEEVQKCQQQYQQQYQQQYQQQYQQQYQQMYRWYQQVQVTQCPVECQAGQVQCQYV
                     KQVISTPKVPLTKLPPPPPPPSVTPVPTVIPTVIPTTVIPTVIPTTVIPTIVPTTVIP
                     TVVSTTIIAVPTTSPVSVTEMSSSVY"
     gene            <424741..>426552
                     /locus_tag="CYME_CMK154C"
                     /db_xref="GeneID:16994492"
     mRNA            <424741..>426552
                     /locus_tag="CYME_CMK154C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536507.1"
                     /db_xref="GeneID:16994492"
     CDS             424741..426552
                     /locus_tag="CYME_CMK154C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536564.1"
                     /db_xref="GeneID:16994492"
                     /translation="MKTLWYGVLLSVFLCFFARTLQTMAAGEAMGNACSVGLIGIRRS
                     AKTYRLRADNLVEVHWTLDLQLQAESAVAGVSDGVKRVCLNLTDYETDRLVSFTAVRE
                     RGGSGKSSDGKGVRHSGTLKIRAFNTSSGYPGHFMVLRCPDDAACNEAQALNIFAGES
                     SRNKPLKLELSYLLVRGVCPLAHVRALDESFNQTKSKPRDALVQRYRFRLESMLVKSL
                     YPVQEQRLQIQKVASPSGFRARLVGSPEGLEPASIRIAPGDIEKAASQDSEFDFEVRY
                     GPFTDADHSMLEAAHVDLAFDAPSGLEPSDIALSAMALAGTFRALKAKRVLAVSHRGH
                     IQVTETMTLLNDYPAAKEGTWSRLDLLVALQQNPFATRTIQEFFAVVPANARNFFYRD
                     ITGNISTSGFHSLSRLLAPFEQYKRWQTPEGKRTVAALGAKRNTHQVLGLRPRFPLAP
                     SWRTNIEFGFEVPVRAGDIWKHLGGGTFRLHQALTPPLHGLVIDDLDLWVVLPNAAVV
                     LDIQIPDDQQLYTLSIEHWKGYGYLDFVPRTVVHVRRRNLVTDLSPQTDSYLEITYRV
                     HAFYALWLKPLIFVGYLIIAVVLLALIPRLHLRIRKI"
     gene            <427557..>428066
                     /locus_tag="CYME_CMK155C"
                     /db_xref="GeneID:16994493"
     mRNA            <427557..>428066
                     /locus_tag="CYME_CMK155C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536508.1"
                     /db_xref="GeneID:16994493"
     CDS             427557..428066
                     /locus_tag="CYME_CMK155C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536565.1"
                     /db_xref="GeneID:16994493"
                     /translation="MEANTSSSGTVTGQRFAERRRSLPPGAELRQRLLKQLKELCDQI
                     GKAYSTLVQKAALVIEPADQAVSLEPDTQRQATCITNLSDEGELWTTVYELNLGVQNL
                     LMFIEDIRLLLLTQAQVPGPSVEENGLKTAGKGGCSPTELEGARFSDRLSSSNTHRFL
                     EQLWDRYTP"
     gene            complement(<429775..>430704)
                     /locus_tag="CYME_CMK156C"
                     /db_xref="GeneID:16994505"
     mRNA            complement(<429775..>430704)
                     /locus_tag="CYME_CMK156C"
                     /product="similar to rRNA methylase SpoU"
                     /transcript_id="XM_005536509.1"
                     /db_xref="GeneID:16994505"
     CDS             complement(429775..430704)
                     /locus_tag="CYME_CMK156C"
                     /codon_start=1
                     /product="similar to rRNA methylase SpoU"
                     /protein_id="XP_005536566.1"
                     /db_xref="GeneID:16994505"
                     /translation="MGNSGRLESAMQNMNLGSPMPEAPPEPTHNHTEFMPRRALSSSI
                     PEHADIESSRGLEADPQSPPLARPQRFYGDGGLVPRSCFLDLLRGRLRPKRVARMEQV
                     LLQRCERVTLLLENLADPHNGAAILRTCECFGIQFVHVLESIESFRCHSHTVPDDCGS
                     TRGVSRSCDQWLRIRRFHQLNECLASLRANGYSLIGTTLDTTRSVPIDNVDFTSLKRI
                     CIVLGNEERGLSSAMQRHCEQLIHLPMVGFSQSLNVSVAAACMLYHLRMKGCIQPDLS
                     PEQLQDLYTRWLVRANRNLRPVLERNGIKYDEI"
     misc_feature    complement(431273..435001)
                     /note="possible transcribed region"
     gene            <431447..>434263
                     /locus_tag="CYME_CMK157C"
                     /db_xref="GeneID:16994501"
     mRNA            <431447..>434263
                     /locus_tag="CYME_CMK157C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536510.1"
                     /db_xref="GeneID:16994501"
     CDS             431447..434263
                     /locus_tag="CYME_CMK157C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536567.1"
                     /db_xref="GeneID:16994501"
                     /translation="MSSKQLESKIVCPLCPQSRQEAGTIPAEVVGPLQGPAVGTRRAA
                     HRATAHRNCIIWCPEVCAGERGQLVNVDKAVARASRIKCRHCGEKGASIGCWEPRCSA
                     SYHLVCAYDPACDVDLILPDLELWCPKHAEGPTYQAYEEAKREARAAAAEELGGGFAS
                     PESSQKHRRGASAAQGASELQTPTRGADGTFEFSPRGSWRHTERIAPPSGQRPFQSGA
                     PQYAADAADDTSSASRGTSRTQRNAALYGLGETKRKRGRPPRSLVESAPESRRRRTAF
                     RTGVPAGGIDITVSSPGERGQTRNYHRQHLGGVHQDADAGRGWEVQKATAPPHGYQSS
                     NLAESRSTSRYNTQRQMQSNDRQLTMVETLGRHPRSTGARVSSAQTEDSANVPETSSN
                     SRNHSETSAAHRSDQSSDRDSEASLRGEGLEREEAEWKWELERRQKRWKRRARDQRAS
                     RIFSQILADVTAETVKERQKLFEPMSGEALQRFIREAEPYTTKVPQDYELREAIPQLL
                     QDLPWIEARPNLHLCERDSVLYFYTRTDVWGWYSDVRTICGAGHPHTIKVITKPRPEH
                     RLSIHLRWAVPEEPIGRMRFADPFNTQHAFRDNVLMMRWVLNGPFKRTRSCDLIAHGL
                     CYFPELPTARLWFTLCREIIRGLKPVPVPILPYRAYIDSAQPLETPFNYSRGSARSLS
                     FQPEGTASYQVLLAGGNGASTVATAAQPGALLTTAAGNAAYAGVGLWRSRPSRSATTT
                     GWLGSNAVDGAFSEEARERVRRQGYGFELDDLEGADASSEEEEVLAQLVQWQAKQLEL
                     VGEFPEPGDRFWPFSENTDPCLRVLDSAWKVETQHPLELIEKRNWARMDALFHHDSDN
                     LVILARTETQLRDKYGSAYASAVLAASAYNRELLTERQALLHQRFGERRSTLTNRRAT
                     PGGLPSEGFSSSSDTDSELDHALD"
     gene            <434984..>446839
                     /locus_tag="CYME_CMK159C"
                     /db_xref="GeneID:16994517"
     mRNA            <434984..>446839
                     /locus_tag="CYME_CMK159C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536511.1"
                     /db_xref="GeneID:16994517"
     CDS             434984..446839
                     /locus_tag="CYME_CMK159C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536568.1"
                     /db_xref="GeneID:16994517"
                     /translation="MLNGSAGISYSGRRNLRSNVPLDAGLLLLLLVHKVPNMDQVAAC
                     FRAAYADAVGSTPLLASAEERAVFVKNSLEFALKVEAQSRDVTAAGAEQQRTEIDRAR
                     QRLWFFCVGAAELLKEPGAQFPSPSLVTAAQQALRQRQQHWCNRLAAASRLSADTTLS
                     TADEVDSLIALVRIGLTVLGLFVCLSILGEREHWRGPFLCELWQQGRAVYEALERQKA
                     SSAALRTTASFLQSYWLDALCTATWWIADLSNHAAATAWTLDTSPSSLLQIRDSASAQ
                     CSVWNPLHCSFTQPCATIRDQHWNCRGCSALQASSWTPHQCTFLLTGRSFRDQHWYRC
                     STCAFREDEGVCTSCALICHAGHEVSYVRFSGFFCDCGANAAATTPRTKCLLCTLVRS
                     EETSSTTSSSEALHTSTETPRGAERRPAKAPELRDEHLLWMRPPSVSPLVELDSTKAC
                     FYHVFMEIAQLHGSSDRCPVRDASGSGETAPAGVLLAKAITEHLQSTFEWLRDSVLFR
                     FLQSPTPGEIPLETNAQSQSVVQMPGTEQAPRKAFLPALHRAAAAGDESPRTATCNAR
                     DVREIQQDTCQVRGAGTYIQRATWKPEAVQVLTRVRHVDTNQGQSTLGMGVFWQLLPC
                     GKQEARNPRELHWHHEPVLAFVDGLFLVTLAASEHHVAFLSDEADIRRSSASVPVHPS
                     SEPLERAPLAGCACTGTVRSTRPTALDARRWIRRPLGFCAGELGFAPSCPRRGSLQRL
                     LALNRETSTLRLYCVGSTVADVDGSLHAQSCASESPSRPVAAAAHPVVEPDKVRSVTL
                     PTSGQSFTASWGTTDAAAAGDGTTVVHSAEALVGASGSRPAPAGPSANTATLVNAVGV
                     SADAVVSDQLAEYPSNTRSRMQAPARRSTIRAHRAQRVLQRWREYHQVHAKRCLRLLL
                     RPVPGPGAASAEGGTAYGAAEVATVPKTTPATLSLEQPERSSTGTMTFAAPAEASQFG
                     ARRATSTDTTSSQHPGRLYLLLERQCLETGEPIQEASWLDAYAIDWLLCLGRSRSSLE
                     VLSIEYACWCWFCRWIREAHGEAAASAADTTSRPAGPDGTETCLTVSEAPSGTVSNDE
                     EPFLWLSFADMDEALAARQPCTLRPAPCTEAAAENARLLLEQTTGSESQILRWLPDAA
                     PEHDPWHMRERKRFRLMFSNARDGVAEGFVASSATTARDIWHSEVTEATLAGPVTAWT
                     YGRVFFDASDRNRSPPGRLLLFLVLSNQHLVVYEYVAEARAASSVDIETSGLRQVASL
                     ELPLFDTTPCMHTLANAPEEKPSSPSATSTSTPARVLGLFYEAAQQELMLYWSNGHWS
                     RWKLTWCREPGLDAAPEPDIGSRSIRNGHRSLSSERLLPFMPQLELTSVNSGCLFEGK
                     AIVAEREALEDVQRVPVRCPHGCCCTSSSCSLMLLRSARTLYLLWWQREKRCWMATRQ
                     GAPYSSVSDVRVRQAGANSGAETAAQNTSMATQADSREQLAILCSLDAGTQDALLPER
                     ARRMDRPIPERCRQQRLIQATGWAQLEATACESASAFLIDVIMLLEDGTVLGTQTRLS
                     CDVQISWNALEGSERPDRQPVSAVDSWKQQKHPEGVRYSCSGDVRLSQPHERDLSTAA
                     ARFAHLYWNHSTAEAVWLPASPEDGVAAADDEDEATPPDVASLPETPVEDHRGVRGNP
                     VLQVRYPWIHCATSVAYQMTCSRSVSPWLGRPQGNSVPSALLLADQRNSNGGLVGFFE
                     LLDRVPSGMLAWTGDMWQLGLRSMTETQSWLEQWPSDSMELLSAPIRAFTYRSSAEQR
                     PFRREDDAPGTRLTVLAYRVHSTSSSGAAREKRTAGLLQMPQRCEDTPLPLAADALLG
                     QEQGQHHQLVFHVSNVGDNDASWALLGIRMAWLQPNRSGVQGVATPTQLEPQLVELLV
                     QGDHEPATVPERGTSAPWTSRLSLELLPDPWVNPVPPEQGTWRWMEYCWDDPVVLRRN
                     PCNRQVVLTIRAPAMDAAEASAWLVLGTIEVYGVRLCDSRWPNLLGFLEWRRKLLRQL
                     DSAGNTRPRAEARKGEVSALQSQATTRPGTALSSTCPRLADKDEIGKALHAQDRLAPA
                     LSVSGTAVSSGIPVGNALPAADDGIATTVEQRSERSRMEINASSAEVASSSAAVSSGT
                     PLLPAQHIALCERDKLRSTEAAHSAAVQDIASADNIEDTAAGRIVWRACWMLAAILAI
                     TGDNATTGLQLVDGSLQHRLKSFPGASDAAEDANSPQMKHPSGYLDRHWFGTWRALWK
                     LLSTRKYCWQKRLMFAQSLQETGDEHAALEQLLHAETHQARRFLRLDDTENTLLLQQQ
                     ARKCFGCWSADQDQVPAAWTRDLVCWTVDSLDTCSDQHQGREALLWAIQGLEWLYEAC
                     ASWTTTTTTTTATTAAHSTTRSDQGHPLSIDAASVCSSQETLVLSIDLARVYAETAAA
                     WLSAFDTEGAGSASAPNEEDESSQRDRPTFTERNLWTGFLVAAKRLGDAWCSSSRCWQ
                     QRPSRHANEGSSSELDFSAVFSWLFEPFITEAAPNVLTRFLQVWLTDVDKLIGVDATH
                     PSAFDYLDTWLRACSHHCALHSSEQTECRARMQAAPSALHGRCALPWRRLPPERLRLI
                     LRASLLCVSDQNHWWSLLRLINNVVTSASHMDEALRTAEHFAALLSDEEAVVESSTRA
                     MDSWSTLEVFWIVSNTVAPHMMDSMSLFETATGPGATFEALAAGRQRECSQRRETHHD
                     IALSVWIRCFQQQWVPDHWSDCTAWLRAYFFLVLAASCLWFTVGNGNDLSGSADATTT
                     CIAAAAAAAATSSTCSRDTTTARMRTSTVVDDGDDDATTVSPASTFTATDPATARMRP
                     CEAGVASACSPDSLVEASNSGNEPGWNVAATRTLIESVELALWDWYGAGLCFGYLEQP
                     PAALTDLVEVLIPSRDVVSAAFQLVAVRQTLAALSTVDNGASALCDACCDPAGQTQRK
                     TSTYWNRWQRQQRVQQAVLWISAVRERELCTDLGLATLLPTLVTALKHDDRYSAGLLL
                     QSLLTLGSELAHWQQISLSLRLTWAWQLLRLLLVEPELRHWAQDALVIVLERLLCDLM
                     DAPDPGAWAATGQQSPACAGVCDASEASMLLVLLRKYVALYRPRALCKALPTLADWVT
                     LLAAHLHITAELVGLERFLMQATFPGSTTAVTERSCGREAGATPSNNQEQVSWPLSWL
                     LASPVCVDCFHEAQGAGLTLQAAGVHGARSSASLQTAQLSGSTCLGGASSAAAVAGTF
                     VKRQPLSTLATCVRFDDDRIQATWTSPKRLHCLGVRLRHTRRSLATILGFRVLVRSLG
                     TALDAAEVPGASATRAPANWRCLCELVYRQDGALLGVLCFLDEWPEPLLGADNALATG
                     LALGLTRQTGRCCVPETQICPRCARLVSERGGVCPACRENVYQCRACRFIDYGRLDAL
                     LCRECGNSRLMRCDIQVETSDVDQEGTLLEALMHWRFRHTTGTSSSSISNTGSGGGTE
                     TAPGGNASAPAVSAETHEPKAAAAAAAAAWIGARERRTALVAWCLHAPTEALLPVACA
                     RCAQRRLPRLWTMFAEAVGRAESASTDQWSQVFEPLHRALLVLFSSGGFIDGERATQQ
                     LPVTLGSLPQPARDAWLRILEEALVASESGPRNEHGEDARSRCEFQCDLGQAYLHLLT
                     QSFACSGAFGADRLLQGAEATSATTMLGGMQQRIVIPATLFNSTADYLAAVYSQRWCV
                     RLFQRRWCRGQSPWRRPCPEQSCSEACIWRALFHPYAPGVRTWALRVLAQRPGYWRWL
                     FHHRILLFGCWQALRHGCVDMLDAYWALWSWLWHHERAWVDFWDSTGGLELLCTVIAF
                     AAGGVPSGADSKTAIACGCRRNAWVPSLAEAVIHACLERIQEAVVLRGRLQWTRAALD
                     CLLCAFEALYVVADTRMSLAAQLALLIQRQAEREPLLAHWQARWMTQRLERLTMSAGT
                     VSCLHTGATVLERNEGNAYDR"
     gene            449007..450779
                     /locus_tag="CYME_CMK160T"
                     /db_xref="GeneID:16994502"
     misc_RNA        449007..450779
                     /locus_tag="CYME_CMK160T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461384.1"
                     /db_xref="GeneID:16994502"
     gene            complement(<449870..>453112)
                     /locus_tag="CYME_CMK161C"
                     /db_xref="GeneID:16994494"
     mRNA            complement(<449870..>453112)
                     /locus_tag="CYME_CMK161C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536512.1"
                     /db_xref="GeneID:16994494"
     CDS             complement(449870..453112)
                     /locus_tag="CYME_CMK161C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536569.1"
                     /db_xref="GeneID:16994494"
                     /translation="MSAPESARTCAASAEALFALFDLQVSEAATPYPFLYAVREQQER
                     HQERSQLHVSSPGRGAAPAQTNEHQTDSVVFEFQKAPSQEDFIRGSLYGQRFRLTRIV
                     ETCQRAGLSLSLKEPHAWTMRVLKDFICLQLDLKSLLSDDFALELLIGGRLVPLSLPL
                     LAVIRSIEAATSTIVVIYRLAGLDGEATEPHFTVETAKPPAEDASGTAARSNPSRVVR
                     RLLFKSFVRGGGLEHVVRLIPLAPSAAIHQLVALFDMEASDDSHRSSTHQVSVKESEL
                     ARCWSACLDTARRQRLTNEAFLAAAQLAARGSPELAAIANQLLDLLAKQLTPLEARQQ
                     DTSCSPCASAICEQASLWLRRSTPRQQQQQQKQPPARDHRSCTGLTGAFSGAQDAPTA
                     EKERLWLRLLARFGDVPTVLTALRLPLTSAVSIASEHWPKTAVRQCGIMLSFLPRGDL
                     WNALDTCGFIAWCQQTLQDLMSAVRTDVKTGSSNGTEQVPHQRLPPASTQPTGSQTAT
                     RALQSGSTEIRIEDLCRFLQLAVTSAPAELQKRLGHFPNSVQVASSLIQLARQPSSIG
                     NAAEDLIEAINRVGGPGSQHLHDAAALLQSTRRQAALLARQRATQAIQRQIDALCQRP
                     EAAACRNESSAAAETCVFCRETNTLDTSDALGAYVVLQALDLSRNWRMLRRQSAVHGH
                     ISSANAVEAAVHIEPLWVFSMSTAGLSVAHESCHRRALQNDARALAAYLALVQSCACG
                     PVDSKTAKTIVLFPLCVQGQRTNAQDMLQNLVSSVEKMYPTAPFYPDAQRGAVLRSPL
                     RIRALLLASLALFLYQMGPESVADATSTVGSAPHPAAKTASQGQQRWRPPAEKALSLL
                     PHWVAAILELSSTLTSSNAAAQNAARGETTLSAIELLEADLLCAEVEPQSNAPFSWSA
                     SLQKFFCELGQLVFESKSNSLRVGERLAPAWAHVAPPDRASVFEACTPEEPSPLAAPG
                     WTHTLSDDKSVNKPLWPLWIGLACCLVYLTRASWQQVRPHVEAAAQHWASEKPRLAVA
                     LALTDAWIHDWRAERHDDGVFLEWLRQHVSAERVAQLHATLDHSVGHLAL"
     misc_feature    453407..454720
                     /note="possible transcribed region"
     gene            complement(<454388..>455059)
                     /locus_tag="CYME_CMK163C"
                     /db_xref="GeneID:16994310"
     mRNA            complement(<454388..>455059)
                     /locus_tag="CYME_CMK163C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536513.1"
                     /db_xref="GeneID:16994310"
     CDS             complement(454388..455059)
                     /locus_tag="CYME_CMK163C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536570.1"
                     /db_xref="GeneID:16994310"
                     /translation="MSSIEEIYRSIPPVTRTYVTLAVLTTLGCALEVVSPLKLYLSWT
                     RIPVQPWRLLTNFTFFGPSISLDFIFHVFFLARYSRLLEETTFRGRSADYAWFLLVCG
                     TLLTLTAPFVNVLFMGPSLTFAMVYLWSRRNESVSLSFLGLVNFSAPFLPWLLLLFTV
                     LFGASATVDLLGIAVGHVYYFLSDVYPSLTGCRLLETPRWFAAFFGPADLTVPFADAA
                     APLRT"
     gene            complement(<455421..>456590)
                     /locus_tag="CYME_CMK164C"
                     /db_xref="GeneID:16994319"
     mRNA            complement(<455421..>456590)
                     /locus_tag="CYME_CMK164C"
                     /product="similar to mitochondrial carrier protein"
                     /transcript_id="XM_005536514.1"
                     /db_xref="GeneID:16994319"
     CDS             complement(455421..456590)
                     /locus_tag="CYME_CMK164C"
                     /codon_start=1
                     /product="similar to mitochondrial carrier protein"
                     /protein_id="XP_005536571.1"
                     /db_xref="GeneID:16994319"
                     /translation="MHSRGEEEYGALGVEKNPKKTLFFKRFNSVAKHARQFSYSFTAG
                     AVSGMVNTLVLSPLDVVRTRMQVGSFGNTAHALRTGSGLELRHFRDVFRATFRTEGIG
                     GFYRGLTASLMAFMPNWAIYFSLYEQLRGTLLEQWSKNPPKRSRLGANLFPSRGLSKD
                     MLASMMASMGAGAATALLCSPLWVVKTRMQAEVVLPGSVPRYRNPLECLRRIAREEGL
                     AALYRGLTPSLLGLIHVAVQFPLYEALKRSWVVSRPRSKEPGASTSALTEARPPVWRI
                     MVASSVSKIVASAVAYPHEVIRSRLQMISILSVESGIPPPEPFLNRTAKGIGTEPVRM
                     LRLVRYMLKEEGISAFYRGIGATLFRTLPATVLTFVTYELCKTFLEERAQESSLV"
     gene            complement(<458758..>459804)
                     /locus_tag="CYME_CMK165C"
                     /db_xref="GeneID:16994351"
     mRNA            complement(<458758..>459804)
                     /locus_tag="CYME_CMK165C"
                     /product="retroelement, alive"
                     /transcript_id="XM_005536515.1"
                     /db_xref="GeneID:16994351"
     CDS             complement(458758..459804)
                     /locus_tag="CYME_CMK165C"
                     /codon_start=1
                     /product="retroelement, alive"
                     /protein_id="XP_005536572.1"
                     /db_xref="GeneID:16994351"
                     /translation="MLESTSEDETPGYIRSRLDPPKKCLGLTPIVYEEALRTESASVN
                     EAWTDHGPELHEDATGHCQNRIYRHQYAAELRRLEPVPEWNDPIFWPESVRTLLCSSN
                     RKTPGIGGIAAEWMKLATPKDGTTGTLSIPDEPDTILCKRLLELIQRMFEEACIPDVR
                     RTAEVVPILKKDSHTDMNIYRTMRLIPSIMKLLCAIPTNRIQRGLQERKFFAPEQAGF
                     RSHEECMSHTLTLTEVVQRCSISGQQPAYVCFTDFQKALDTVPHEAPFLKMERAGVSG
                     KCLAFFRALYADSWMRIRLGDCSRTPSIRIHRGLRQGDPASPLLFNIFINDLLNNCRQ
                     FAAEAPWIDCGDVR"
     gene            <461434..>463770
                     /locus_tag="CYME_CMK166C"
                     /db_xref="GeneID:16994352"
     mRNA            <461434..>463770
                     /locus_tag="CYME_CMK166C"
                     /product="glucosamine--fructose-6-phosphate
                     aminotransferase"
                     /transcript_id="XM_005536516.1"
                     /db_xref="GeneID:16994352"
     CDS             461434..463770
                     /locus_tag="CYME_CMK166C"
                     /codon_start=1
                     /product="glucosamine--fructose-6-phosphate
                     aminotransferase"
                     /protein_id="XP_005536573.1"
                     /db_xref="GeneID:16994352"
                     /translation="MCGIFAYVVYGVERSRDDIAAVLVNGLRRLEYRGYDSAGIALDD
                     IVNPSTGERKPLVIKGPGSVGCLAEQVATALRSSPNFKVRQHVGLAHTRWATHGAPSV
                     ENSHPQASGPENEFLVVHNGIITNYAALKQVLGKRGYQFVSETDTEVVAVLLKHLYLE
                     MKAVCDTVSFPRLVMLMMHELEGAYALAIRSQFFPGELVACKRGSPLVLGIAYHDGEQ
                     VHLVQHSEPAKTDASRSPASTPGAVESEGTTRAAMSAAETATANGRFESSAVAAARQR
                     DGLEPASSGSVAKSTGGRCFRRRTPRRHSIDFKVAQVNLDCELPHGFSFNTSTSAPDS
                     GMGERAGGVELFFASDVSALVEHTREVVVLEDNDVVHASADGSVDIFSFLDAESQSLL
                     TQTRALCTLDIELEQIERGRFEHFMLKEIFEQPESIRGTMRGRVQPATGTVLLGGLRE
                     RLDDLVRSNRLIFVGCGTSYHAALACRQLVEQLTELPVSVELSSDFLDRACPLFRSDV
                     CVFVSQSGETADTLEALRYAKRRHALTVGVVNVVGSAIARITDCGVHLNAGCEIGVAS
                     TKSYTSQIVAIIMIALLLSADRLSKQTRRREIIDGLAALPTAIERVLMLNDKLRMLAV
                     GVLRDAVSILVCGRGYQYATCLEAALKIKEVSYIHTEGIHAGELKHGPLALIDQEMPM
                     IVFATRDNGYEAICNAVHQLLARGNPQRMIVVCSEGDGHFFQGLGVGTTLEVPHTADC
                     LQGVVNIVPMQLIAYHLAVARGLNVDQPRNLAKSVTVQ"
     gene            complement(463911..466546)
                     /locus_tag="CYME_CMK167T"
                     /db_xref="GeneID:16994370"
     misc_RNA        complement(463911..466546)
                     /locus_tag="CYME_CMK167T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461385.1"
                     /db_xref="GeneID:16994370"
     gene            complement(<469222..>470382)
                     /locus_tag="CYME_CMK168C"
                     /db_xref="GeneID:16994361"
     mRNA            complement(<469222..>470382)
                     /locus_tag="CYME_CMK168C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536517.1"
                     /db_xref="GeneID:16994361"
     CDS             complement(469222..470382)
                     /locus_tag="CYME_CMK168C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536574.1"
                     /db_xref="GeneID:16994361"
                     /translation="MRSFVSVGIFWLLILLYLNSAVLTNGIQRETWSEVSPARNSLQR
                     NLDYCQPLITIEDCRLEQVCIEEAVVKVCEKKVWICPASSNFENASPKEKYGLSKNAR
                     TEGYTNVRKGNVPVHAPNDCYQKCIYKNQTVCEMYALKNICRVCVESFTAEEKCSLVF
                     GPQKDVSGKVPVSDRWIPSTPQKTTLGKVQGTVASKSPAQPACTIICKEVKRVCHQEV
                     FSIQTPTQTPTIIIVKPTIPPTPTTTQIPTPMPPITIIPTPTPTLTPTTKPPTPTTKP
                     PTPTTKPPTPTTKPPTPTTKPPTPTTKPPTPTTKPPTPTTKPPTPTTKPPTPTTKPPT
                     PTTKPPTPTTKPPTPTTRHDNADYEAADTDYEAANADYEAANTDYGAANAND"
     misc_feature    469373..470436
                     /note="possible transcribed region"
     gene            complement(<472625..>473701)
                     /locus_tag="CYME_CMK170C"
                     /db_xref="GeneID:16994411"
     mRNA            complement(<472625..>473701)
                     /locus_tag="CYME_CMK170C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536518.1"
                     /db_xref="GeneID:16994411"
     CDS             complement(472625..473701)
                     /locus_tag="CYME_CMK170C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536575.1"
                     /db_xref="GeneID:16994411"
                     /translation="MIHNALRTHSLAVLLLLLFTNAVRVDSVLAARPAERRWYTSGGN
                     SVYVCPSSSSLHNCTLQNVCTKVIVNGSCSLTGTACTLRSSAEIGSGHGSQTLGREAT
                     KENQGLAGFDSKDFKVLRWRQNQYSGCGDCLSFGEQTCVEYRTANVCTACRTNYELVE
                     VCDTVVQRTLDGSDPVSKRWGQSYQQQNGNCQYECLFSGKQCRNVIIGTFLPTPTVQP
                     TLLPSASPSATVSRSVSPSATVSATISISTSVSPSTSPSISVASPSVSVSATASVSSS
                     VSPSTSPSISVASPSVSVSATTSISSSVSPSTSSSISVASPSVSVSATTSISSSVSPS
                     TSPSISVASPSAPLSAVSSIVTLI"
     gene            475474..478254
                     /locus_tag="CYME_CMK171T"
                     /db_xref="GeneID:16994427"
     misc_RNA        475474..478254
                     /locus_tag="CYME_CMK171T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461386.1"
                     /db_xref="GeneID:16994427"
     gene            <478688..>479671
                     /locus_tag="CYME_CMK172C"
                     /db_xref="GeneID:16994428"
     mRNA            <478688..>479671
                     /locus_tag="CYME_CMK172C"
                     /product="probable steroid dehydrogenase SPM2"
                     /transcript_id="XM_005536519.1"
                     /db_xref="GeneID:16994428"
     CDS             478688..479671
                     /locus_tag="CYME_CMK172C"
                     /codon_start=1
                     /product="probable steroid dehydrogenase SPM2"
                     /protein_id="XP_005536576.1"
                     /db_xref="GeneID:16994428"
                     /translation="MKLGYLTRFAAQPSIGTEYKELPLYLFALVGVIVVLLAGAQLLR
                     FLYRHLLRRPSRLADKFRGDWAFITGASYGVGAGFARECARRGLNLVLLARSAEKLAA
                     VAADCEQHGVAVRVVAFDLAQASEAEWNELFEGICDLEISVLINNAGVNLEFPTEFID
                     MDEAAIERIVRVNICAMNKITRRLLPKMIERKKGCLIFLSSAGGAVVPCPLLSVYGGT
                     KAYIDAFAVALSGEVRRHKIAVLSLTPFWITSEMSKIRRANWMVPSADAFARLALDRL
                     GLELRSNPHWAHELIALGLKATRSLPAQVAYVERLHRRIRERALRKLKRQQ"
     gene            <481068..>482783
                     /locus_tag="CYME_CMK173C"
                     /db_xref="GeneID:16994465"
     mRNA            <481068..>482783
                     /locus_tag="CYME_CMK173C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536520.1"
                     /db_xref="GeneID:16994465"
     CDS             481068..482783
                     /locus_tag="CYME_CMK173C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536577.1"
                     /db_xref="GeneID:16994465"
                     /translation="MSNRSRADTTGCVASWVLQFAVAESHGKHNYFAEFAPCVEKSAT
                     DRSSAQVSAQWQARHTAGVGGHNEQRFLLATCGGPGARVYAAPTGEPAVQDLQLLVSY
                     ASSLPRADTDECFCCTWAFEEATSDVLLCLGYESGIIRVVHLSNDSLCHTLLGHSGAV
                     HCLRSCPKRPSWLLSASKDESLRLWDLGTGNCFAIFCGLQGHRGEVLFCDWHRSGEKF
                     VSCGMDGTVRVWNIDAKVLQSFEMQRRRACVAERAGEGARHSAALPKFPSSAPQKVTD
                     PTPQKVLFRGIPGEVETPVAPPHPSKRHRRRRNAVGVAQAAPQTLDVPRNLACPSREN
                     ASPYETERTSSPATTPKKIPSPRRPSALRHFNRSPETSAAADLERIPYTTAPLVDGVT
                     LDAPARGVPPPMTLGDDAVRQAAGSRTRRYVEFVQFPDQVFRFVHGNYVDCVAYVGDL
                     ILSKSVHSKIVLWAPGMDDRGLLPSSSEHRVLIEYRYRGGDLWYIRFAVDPMQTLLAV
                     GSRMGTIYVFQVDDPGGKPIACLTHPQATAAVRHVAFSPDGKMILAVCDDSTVWRWDI
                     ESLTR"
     gene            complement(<483708..>484571)
                     /locus_tag="CYME_CMK174C"
                     /db_xref="GeneID:16994461"
     mRNA            complement(<483708..>484571)
                     /locus_tag="CYME_CMK174C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536521.1"
                     /db_xref="GeneID:16994461"
     CDS             complement(483708..484571)
                     /locus_tag="CYME_CMK174C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536578.1"
                     /db_xref="GeneID:16994461"
                     /translation="MHLHRLQASRWSVIVIFGGGAVFSACIAAQALRVPLFEVPFAGV
                     SMENATSVFRRVFIARHGERIDHVDRTWGERATYPQDPPLTDRGRRQARELGVFLRSA
                     GNIRTILSSPFARTLETAHVVAEELELPLYVEHGASEWLHAEWFGERAPELTPLAEWK
                     AQLPRLDLESHRSLVVAEFPEDIHQITQRCRKAIQLITERYKEGDILVVGHGISVELM
                     TKGLCGKHTKVNWVGYCAVCECVLDARIADTGASRDADEERTSDVWRLARNADASFLS
                     EPEDPQHIHYI"
     gene            <484677..>485651
                     /locus_tag="CYME_CMK175C"
                     /db_xref="GeneID:16994462"
     mRNA            <484677..>485651
                     /locus_tag="CYME_CMK175C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536522.1"
                     /db_xref="GeneID:16994462"
     CDS             484677..485651
                     /locus_tag="CYME_CMK175C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536579.1"
                     /db_xref="GeneID:16994462"
                     /translation="MQELPTFVTRRNKHATGCWWLQVLEPVRAQRHRRWVTLCVLCAA
                     VMLGVLATFGLVRDLLAARLENPSAHARGSEAAASSPLSQLKHLIIVAGNAVYTGSNF
                     ASASDDHQWYLEDYQKGQGLVFLQHLRRGIEIAQADPQALLLFSGGKTRLEAGPLSEA
                     ESYWRLASAQAWCGHAEGVSGRVLTEDFARDSFENLLFSICRFRQLTGNYPRNITMIS
                     LELKRKRIETQHRTAIRYPAAQFRFISTEEALHFGGPVPDSMPADRALAAFATDPYGC
                     LHEELLEKRRKRNPFHVVIPYPSGCPEIARLIRYCGRNIFKGRLPWDP"
     gene            <486306..>486896
                     /locus_tag="CYME_CMK176C"
                     /db_xref="GeneID:16994482"
     mRNA            <486306..>486896
                     /locus_tag="CYME_CMK176C"
                     /product="photosystem II protein Psb27"
                     /transcript_id="XM_005536523.1"
                     /db_xref="GeneID:16994482"
     CDS             486306..486896
                     /locus_tag="CYME_CMK176C"
                     /codon_start=1
                     /product="photosystem II protein Psb27"
                     /protein_id="XP_005536580.1"
                     /db_xref="GeneID:16994482"
                     /translation="MIKTRVTAFVQLPVSAQSGRAARVNAPRKHRLQSRKFVLHSELR
                     VDRRVFLRNSLAVFLGSLTAAFSASRTDWGAQPANAEVLRHAAPGYELHGDYHEDATQ
                     VVQSMRTVTRLERGTPGMKEKVDATRKQMNDFVALYRRNPNVAGAVSFSTLYTAINTL
                     AGHFASYGSTYPVPEKRKKRLEQQLNDVERALSRGR"
     misc_feature    complement(487608..488114)
                     /note="possible transcribed region"
     gene            <488236..>488826
                     /locus_tag="CYME_CMK178C"
                     /db_xref="GeneID:16994353"
     mRNA            <488236..>488826
                     /locus_tag="CYME_CMK178C"
                     /product="mitochondrial F-type ATPase F0 subunit d"
                     /transcript_id="XM_005536524.1"
                     /db_xref="GeneID:16994353"
     CDS             488236..488826
                     /locus_tag="CYME_CMK178C"
                     /codon_start=1
                     /product="mitochondrial F-type ATPase F0 subunit d"
                     /protein_id="XP_005536581.1"
                     /db_xref="GeneID:16994353"
                     /translation="MQRLKSLLTASLYPRSIDSGQVSRYGRRAFSTELEKGGAGEVAP
                     LDLKSLAENADPETLAEINRLRQAINELHAQFTVPSNAENLDWAQWEGRLLSKGLVTS
                     MRKAFESLQPPELEKERQELLRQIDSSFEPLIKQAQELAKDAEARLKALDDMLKELDG
                     LQKNLPRLTVDELMAKRPDLASEVESDLKQSKWFRL"
     gene            complement(<494580..>495962)
                     /locus_tag="CYME_CMK179C"
                     /db_xref="GeneID:16994354"
     mRNA            complement(<494580..>495962)
                     /locus_tag="CYME_CMK179C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536525.1"
                     /db_xref="GeneID:16994354"
     CDS             complement(494580..495962)
                     /locus_tag="CYME_CMK179C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536582.1"
                     /db_xref="GeneID:16994354"
                     /translation="MYAASCRLCLCGVHEGTQRLFRACGCRGTLAHVHAECLALWLRK
                     QGYATGVWPNPWVLAAAQRVLESATRNRDCDATRRMPLWEEHADDSGRVQKHCTLWTA
                     EQDQGSCSGFSAGIPRTLWSSVSHTTQESRNHMHRLNLMLYAFIAEWLVVLCSPRVLL
                     VSSCPSFVRSYWCAQRLRCELCGNMYSTECMEAVIWIWLGMETQDNACFDFRWTDPWA
                     NTAVEEGSQTPHDPRMSTVIDRVEGEKWLLLDCAYPDFADAEPRHVLVAVANAAMRMH
                     EQLMRRVVQRTERTLLSSNIVRNHADQAARTRDERSATRLGLIDTVVDVHATRHRIGF
                     TDPVDEQAQFHALSWAVHIALRALVITASVAVCFLLSFICGLVTEFAFDTVADVFLHR
                     YFHIPERCRTAVNPARSVLVGFYALVISVIVSKFLVVILSVMRNALQRVREHVRERIL
                     SALGFSSMLK"
     gene            complement(<497747..>498871)
                     /locus_tag="CYME_CMK180C"
                     /db_xref="GeneID:16994499"
     mRNA            complement(<497747..>498871)
                     /locus_tag="CYME_CMK180C"
                     /product="probable transcription regulator exsB"
                     /transcript_id="XM_005536526.1"
                     /db_xref="GeneID:16994499"
     CDS             complement(497747..498871)
                     /locus_tag="CYME_CMK180C"
                     /codon_start=1
                     /product="probable transcription regulator exsB"
                     /protein_id="XP_005536583.1"
                     /db_xref="GeneID:16994499"
                     /translation="MFGAVALRSACRLWLRSTQCTGPWAEASRYRSANAERCHKLQNV
                     SLYQLGKRCTSTWNNGDQHPSVCFTGDVLSLQAGLNTRFTADRASSALHSRFGSVRGA
                     SSLTPPRSASRGLAQGQAGVQNGAVAIVLLSGGLDSATTLAIARSQGFICKALSFDYG
                     QRHRCELEAARRVARAQQVTGQHWIRLDLGSIGGSALTAPDIPVPKAANVDDVWEHTP
                     ETIPLTYVPARNTIFLAYALALAEVQGSYDIFIGANAVDYSGYPDCRPEFFHAFERVA
                     ELGTRAGVAPSDARRFRIHAPLLQMPKTEIIRTGLALGVDYSITHSCYDPLDESGKPC
                     RRCDACRIRHTAFRELGLEDPQLSRFGAGSAAAPRTAKSE"
     gene            <499174..>500238
                     /locus_tag="CYME_CMK181C"
                     /db_xref="GeneID:16994510"
     mRNA            <499174..>500238
                     /locus_tag="CYME_CMK181C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536527.1"
                     /db_xref="GeneID:16994510"
     CDS             499174..500238
                     /locus_tag="CYME_CMK181C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536584.1"
                     /db_xref="GeneID:16994510"
                     /translation="MWTGLVVPGQQWKNTGTRRRCRRCLTGSTRAALAQPWQRLVQCP
                     VLKQPARNALAVTATHPALRRALVSVLLVGLCFTNDSRVYAVPAHEPVEQTDSTERSQ
                     AIERELEAKFTQALRLTEQASWEEADKAWSAVLALDPDNGAALSNRGLVRLSLHRLDA
                     ALADLQQAVERSPAEPVLHENLGLVYEARGEWEPALEEYTKVLQSVPASATALINRGN
                     VQVSRGAYAEALADYQAAADAETGLAAPREKMALVMAQLGRSDDSIQILRQVVRKYPT
                     YAEAHAALAAVLWGAKHDFLSAEDQWARISNNELREEMSELENLRIYSRWPPRMIEYL
                     REFLNLETANQEIESAGFVL"
     gene            complement(<500278..>502956)
                     /locus_tag="CYME_CMK182C"
                     /db_xref="GeneID:16994245"
     mRNA            complement(<500278..>502956)
                     /locus_tag="CYME_CMK182C"
                     /product="serine/arginine-rich protein specific kinase"
                     /transcript_id="XM_005536528.1"
                     /db_xref="GeneID:16994245"
     CDS             complement(500278..502956)
                     /locus_tag="CYME_CMK182C"
                     /codon_start=1
                     /product="serine/arginine-rich protein specific kinase"
                     /protein_id="XP_005536585.1"
                     /db_xref="GeneID:16994245"
                     /translation="MFVALAGGPARSPLRHVEPVMEQVPAYPVAKTPSESLSPSYESS
                     YSVEGPSAGRGASPEPPGTGGGYLPRDWEYQQRNKETTALSFSEQAPDADHESVASQN
                     RTQREAVQTHGRSETSRSDTGNWYLTEDAMEYSDTEDAADYRSGGYHPIQIGDALKNG
                     RYIVLRKLGWGHFSTVWLCWDEERSGLVALKIQKSARHYTDAARDEIALLATIREKAP
                     LRGTPVVTFLDHFELIGPNGRHICLVFEVLGRSLLSLIRYHGYRGVPLPIAKRVIVHL
                     LEALDFCHRDCGIIHTDVKPENCLFVPPREATVELAGQAISEALSMFEQRYGPILHSF
                     EGQRSSNAQVDLSDVASNSKPKLVLDTPNAKRPQSEPDALCAPTFAEPERACKPKSEG
                     MPPFRACAAVADRLQTQISDQVQSGLTEELITCNEDSDPARIRKTYNALRAALNTVDA
                     EVASQRDLQSQSTELIHARTQFSGEGPTLTSASLSSISEQSQASSSNASMKFTKDAHG
                     GVVSRLAYLKEKDPMRMQQADDAATACSVDSGYGALSTMTTTAAADRMKPSAAQQLAT
                     VKHPGGARTENGVAALSGCTFNVEPTRPLAWHGWETNSRVKLVDFGNACWTDKHFTED
                     IQTRQYRSPEVILGAGFDASADIWSCACVLFELLTGDFLFDPHSGRSFSRDDDHLALM
                     MELLGPFPRSLLDRGKYSGEYFTKDGALRKIKSLHFWSLSDLLREKYKFSRHEAEEIA
                     MFLEPMLRLEPMQRATAAQCLQHPWLSDVYAGAARQGMCAALAVTATTHTSSISPETQ
                     NKSADGNDSAAAAAITEQRVTQLAVNVSSALDLGPSSAASSSRGSITSPEAAERRTPE
                     SLRQRLAVRQHSNYAPSQTIFDKRCSSLGRQSAGCL"
     gene            <504552..>505628
                     /locus_tag="CYME_CMK183C"
                     /db_xref="GeneID:16994246"
     mRNA            <504552..>505628
                     /locus_tag="CYME_CMK183C"
                     /product="23S RNA pseudouridine 2633 synthase"
                     /transcript_id="XM_005536529.1"
                     /db_xref="GeneID:16994246"
     CDS             504552..505628
                     /locus_tag="CYME_CMK183C"
                     /codon_start=1
                     /product="23S RNA pseudouridine 2633 synthase"
                     /protein_id="XP_005536586.1"
                     /db_xref="GeneID:16994246"
                     /translation="MCVFVRVPGRPAALRSVVWKRSALLCQWSPVAWWSRPRLALGCR
                     GTRRSAAESTPATLGRVICTALSSSLRVRVNKALRERFSRRQADELVRSGRVTINGNP
                     ATLGARVSVDDVIAVDGELVSLSQSAFIAETDLAAIDSCFVYFKYWKPVGVECTTAPA
                     VPGNVLEASGLGAWADQHHLRLFNVGRLDKDSTGVLLLTNDGRVGNALLGRNSGFVKS
                     YLVTLDKPIADEDIEAIQQGFVVETEYRHDKKVKTIRLPTLPCAVRRRPQLNEIEIDI
                     HEGRNRQIRRMLISLGYQVRRLHRFAFCGIELGPELDKEGSWAPLNERELGIIAEALR
                     MHAEHKSMPSHKRPTQFRILDTRS"
     gene            complement(<506286..>506876)
                     /locus_tag="CYME_CMK184C"
                     /db_xref="GeneID:16994315"
     mRNA            complement(<506286..>506876)
                     /locus_tag="CYME_CMK184C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536530.1"
                     /db_xref="GeneID:16994315"
     CDS             complement(506286..506876)
                     /locus_tag="CYME_CMK184C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536587.1"
                     /db_xref="GeneID:16994315"
                     /translation="MFVALPAVVSARVVQPLVTPTSVKRRVGRRTQRPPLRRLPSPVM
                     KVRKKSVDEEEEAIRKPSSLEPEQTFYDGPPSWTELLLPGLSILTVIGVIPFAAALAR
                     QYWVRYRISNRSIYVRAGFMGRDETEVVYRDIEEVRYVRRFGGISADYVILLKGGARL
                     ELRAVPDFDKTYTFIMQRVSEEARKRSNYTKEKPSD"
     gene            complement(<507472..>509484)
                     /locus_tag="CYME_CMK185C"
                     /db_xref="GeneID:16994314"
     mRNA            complement(<507472..>509484)
                     /locus_tag="CYME_CMK185C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536531.1"
                     /db_xref="GeneID:16994314"
     CDS             complement(507472..509484)
                     /locus_tag="CYME_CMK185C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536588.1"
                     /db_xref="GeneID:16994314"
                     /translation="MRNNTPTAIEPKATPRTRRRLSFSVESPERGDAPRSEPKLAHHY
                     STRHSEKIRRCRPPVDDDGCTTGNVQLVGTPSGRATRLPANHTPRRVHFEATDRDAPS
                     QRISDALRFVWSLNLVSYSLAWAVSRIHERWSSIHGRLASGGRGRRWETTSLAARPRR
                     RRRSFKLAMFVLIGLLCVLTGCLKPGAPAYRKAFSALLSIPDRGRVFSGNLMPRKLVS
                     VFYSGFQRSGQLIARLGSVPVWLRQFSHHAKASMKGETIQTTRPRAISNFGSGLDWAR
                     HLSVFQRSTWRALWSASIASYHVLPGMHWYSEWLRHRAPARADSHWNELVHRIDRIEA
                     LLSEQLTRMENTSSSPWRGDDSQSQPDVETLLGYLRDNKAGALVDLDNLQHVHVQQAS
                     AISTELRELRESLATVRTDAMQLVRNLETRFERLEGMLRRQRAHMHNSQWMSTAASDY
                     ALASAGARIIRAQPSWTRTFVSYWSNRVRCVLRAAFGSRAARNCHRPLPFAPAIMLQS
                     QGLHAPLSRGRCWHVPRGSASVIVQLSEPICPATIMLLFSTSRASAHASFQNETPSVQ
                     VRYEALLSFRSPAMFTLQGTSTPNDCFGNSETRFCRVSLRVDPQVCVEPLSIVRVHFA
                     QIGNERKYAEHLDKPSTKRRPLHAYPAVDLCIYKLAVLDFAQENPI"
     gene            <512723..>514009
                     /locus_tag="CYME_CMK186C"
                     /db_xref="GeneID:16994313"
     mRNA            <512723..>514009
                     /locus_tag="CYME_CMK186C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536532.1"
                     /db_xref="GeneID:16994313"
     CDS             512723..514009
                     /locus_tag="CYME_CMK186C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536589.1"
                     /db_xref="GeneID:16994313"
                     /translation="MQTHGVPFAPDPTRQSANRLRVPTVATNPAAQVPPPAPPQGPHH
                     DTTVYQEARPAGDLRVPRETWNLQAGSLENTFNAGGAWQPLQSEAVGAPGAFFEPVSS
                     AAARDIGFSNVRLRSDSAAYQQHGKNIYGQQYWNQMFGSGQALTSMVSQFARVAWMNM
                     SGTSPQATQGASVSPDAGICPQSWAFYGIPKVYFQVDVGYVMRKLLILFFPFYHRSWS
                     RKRKPIDPFVNPMDPDAAIQHTTQRLLPPSEDPNAPDLYIPAMSFVTYVLLVGLLRGA
                     EGKFTPQAMGEWASMGLIVIVLEVLLIRVALFLAQGPSVPWFDLIAYSGYKFAGLAFA
                     TASTLLASRLTHGRTYVSLAVLLYVSLMMGLFLLRSFRRLLRSENPSGDMSTMAAYDP
                     TSWDTQQARRNYVLLFIALLQIPIYLLLGVQTWRHL"
     gene            <519560..>520348
                     /locus_tag="CYME_CMK187C"
                     /db_xref="GeneID:16994341"
     mRNA            <519560..>520348
                     /locus_tag="CYME_CMK187C"
                     /product="chloroplast translation elongation factor P"
                     /transcript_id="XM_005536533.1"
                     /db_xref="GeneID:16994341"
     CDS             519560..520348
                     /locus_tag="CYME_CMK187C"
                     /codon_start=1
                     /product="chloroplast translation elongation factor P"
                     /protein_id="XP_005536590.1"
                     /db_xref="GeneID:16994341"
                     /translation="MMRHVPCFLYSFLGNSSTARRTDVQRARHLQAQLSTACWRRAQR
                     TRTAQGLGDGCRVAFWRGVPRRPVAERWWSPRMDVNSNDFRVGLTIEVDGSPFKVIEH
                     LHVKPGKGAAFVRTKLKNLLTGNTMERTFRAGETVPEAQVEKFEAQYTYSAENEYVFM
                     NMATFEEEHVPNEVVGDTAKYLRVGQDVSVTKWNGKPIEVEVPATLTLEVVETDPGVR
                     GNTAQGGSKPAKLETGVVVQVPLFIEVGEKIKVDTRTGSYLSRG"
     gene            complement(<521514..>523052)
                     /locus_tag="CYME_CMK188C"
                     /db_xref="GeneID:16994342"
     mRNA            complement(<521514..>523052)
                     /locus_tag="CYME_CMK188C"
                     /product="phosphoglycerate mutase"
                     /transcript_id="XM_005536534.1"
                     /db_xref="GeneID:16994342"
     CDS             complement(521514..523052)
                     /locus_tag="CYME_CMK188C"
                     /codon_start=1
                     /product="phosphoglycerate mutase"
                     /protein_id="XP_005536591.1"
                     /db_xref="GeneID:16994342"
                     /translation="MNQKVKRPVVLICIDGWGINQSDYGNAILAADTPVMDEFYSKRR
                     NFAELDASGLAVGLPEGVMGNSEVGHLTIGSGRPQYQDLVRIDLAVKEGSLAKNETLL
                     EAIDRAKTVSNGRMHLLGLVSDGGVHSHERHLHKLLEILKDANVPEVYVHAFTDGRDT
                     DPHSGKGFIEKLLKHMRQLGEHMQLATCTGRYYAMDRDKRWDRIDLALRGLVNGDGEE
                     TADVLDTIQKRYDGGETDEFLKPIIVCKKGCITSKDTLLFFDFRSDRMREIVQTLGQP
                     APYETKVQVPKDLGIFCMSQYDIRFPFPVLFPPVEMKNVLAEWIGNHDLFQFHTAETE
                     KYAHVTFFFNGGVEKAYKGEDRKLIPSPKVPTYDLEPKMSMYQVGEALIEAMKSGKYA
                     FIMCNLAAPDMVGHTGVYEATVEACTHCDKVIGQIWKSCQELGYVLCVTADHGNAECM
                     LTEDGRPITSHTTNFVPFILADPDGKLHFKEESSKGTLADVAPTILSVMGLPIPKEMK
                     GRVL"
     gene            complement(<524368..>525744)
                     /locus_tag="CYME_CMK189C"
                     /db_xref="GeneID:16994317"
     mRNA            complement(<524368..>525744)
                     /locus_tag="CYME_CMK189C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536535.1"
                     /db_xref="GeneID:16994317"
     CDS             complement(524368..525744)
                     /locus_tag="CYME_CMK189C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536592.1"
                     /db_xref="GeneID:16994317"
                     /translation="MTPDESGPASLERVFAEKSFLRAFPVAPDELGAVDSNGLSNLEN
                     GLVGPEGDEGGAPSPRVSLAKRVSTQQNVASRAEVHNPYNTGFLGSKFAFLLNDVFHM
                     ALFGIGGTLARTGLDLVFGPSVGAVTSEYSAVFKVLPPNALGSFLIGFLIGSDDAFQP
                     HMPYIHTGLATGLCGSLTTFSSWNQQLVAMFARGKSPSNQWLRALFALVIGLEIPIFS
                     FTLGLHTERSIRFFLISHVYARRDEELAQLYLRYRELRSRARQPRRSLSAVDEVARAA
                     AALTGGHDRWGRRRPKIPIGSHEDIAYHRRRFYAFVICGVLSAILLTLAAVGVGLDPD
                     QTRKSYWMACIFAPFGVILRWQLSVHLNGRHPWLPLGTLAANVLACCFDAVADGVLLR
                     VSSFWVVVMMKAFVLGFNGCLSTVSTFVGELYRERNIEYAYAYAGISVTICLTLGLAI
                     YGPQYWTR"
     gene            525983..527810
                     /locus_tag="CYME_CMK190T"
                     /db_xref="GeneID:16994318"
     misc_RNA        525983..527810
                     /locus_tag="CYME_CMK190T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461387.1"
                     /db_xref="GeneID:16994318"
     gene            complement(<527162..>529477)
                     /locus_tag="CYME_CMK191C"
                     /db_xref="GeneID:16994338"
     mRNA            complement(<527162..>529477)
                     /locus_tag="CYME_CMK191C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536536.1"
                     /db_xref="GeneID:16994338"
     CDS             complement(527162..529477)
                     /locus_tag="CYME_CMK191C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536593.1"
                     /db_xref="GeneID:16994338"
                     /translation="MWRELDALNVLVVEHLLGPVAAAVVRCLSCRSSASLRELERSLR
                     KQLRTSARCSNAHLLSHSKLRTSLRVALVKLLERGVVQYSYSRLDQAPASCQYTLSRR
                     GALWLYGFPFLQRYITELHCRHWRKDQDLVLHSNDAGETILPSPRADHHETQLETSTI
                     VSLCNYLTPFRKVPMDWLLTATPDSDNQSKLIRSTLQRLVGIGLLEQCTARRVLAELL
                     SLELDDEHPEAREHSKPGDTMDQEACTLSEIDSTRQVPAPALLANRSAANDEKPSPQS
                     ADHEPQTRLRARRRLRLRKLDTGADDEAVDQPYAATPQPSVSNREMQAAPAPAPETAD
                     SSQKGESTMLALGTYLRVNERFIRDAIRDIHMAAWAAEQLHSCDDSHAGDAATSMPHR
                     LMVQRTAVLLNAMLYLRRVVQHGSLVHVLPARCSDPSLTSLAGAQKGFSLDQILYVIR
                     YRYRFPSDQCMETVSALDAERILEELADDRVGFLTIHERHGTKLYAPAYAYILDQYRT
                     HVLEGMLLAMGDLYLHRVWRMVLEYGPLSTRSCEEHALLPARAVRAYLFYLFQDGWIS
                     LGDHLTSAVTAVPISLPREPFPGSWRNGAQSSAADHEPDLELRQKTERAIGPGFASSR
                     SGIDVTPSALDSGSPDPTSTLCLSPDGAYAPDLEDSYRNSMTQSDTPTGASWLDLEGG
                     WHVDLDAIQRNVVRVCLLAMQNVFQQIQVRHTRLAEHNAVLRATNKSGIDPRVYDEHV
                     RGARHVGRQLRHLRETYYRLAEALMTFWDEF"
     gene            complement(<529922..>531349)
                     /locus_tag="CYME_CMK192C"
                     /db_xref="GeneID:16994339"
     mRNA            complement(<529922..>531349)
                     /locus_tag="CYME_CMK192C"
                     /product="Sec61 alpha subunit"
                     /transcript_id="XM_005536537.1"
                     /db_xref="GeneID:16994339"
     CDS             complement(529922..531349)
                     /locus_tag="CYME_CMK192C"
                     /codon_start=1
                     /product="Sec61 alpha subunit"
                     /protein_id="XP_005536594.1"
                     /db_xref="GeneID:16994339"
                     /translation="MTRVLDLVRPFLPYLPEVQTPARRVPIKERLIWSLVALAVYLIA
                     CQIPLYGFLNTGGSDPFYLMRLVLGASSRGTIMELGFSPIVTSGMIIQLLAGARIIEV
                     DYSNKLDRMLFEAAQKLVGICFALFEAIVYVYSGMYGPVSSLGHVRAALLIGQLFCAS
                     VVVMLLDELLQKGYGLGSGISLFIATNIAETIVWSAFSPMTINIGRGLEFEGAIIALF
                     HLLLTRTDKTRALYEAFYRQELPNLSNLLATVVVFMVVIYLQGLRIDLPIKSVKVRGH
                     VSSYPIQLFYTSNTPIILQSTLVTNLYFFSQILWKRYPNMFIVQVFGKWAQYRDTGQF
                     VPIGGLAYYISKPRNLGDMLVDPVRALCYVVFMLVSCAIMSYLYIEVSGKSARDVAKQ
                     LRDQELTIKGHRDTSLVKELNRYIPVAAAFGGVLVGLLTVVADLTGAIGSGTGILLAV
                     TIIYEYSAALAKETQNGSSPLAFFE"
     gene            <535432..>535950
                     /locus_tag="CYME_CMK193C"
                     /db_xref="GeneID:16994316"
     mRNA            <535432..>535950
                     /locus_tag="CYME_CMK193C"
                     /product="Smt3-conjugating enzyme E2"
                     /transcript_id="XM_005536538.1"
                     /db_xref="GeneID:16994316"
     CDS             535432..535950
                     /locus_tag="CYME_CMK193C"
                     /codon_start=1
                     /product="Smt3-conjugating enzyme E2"
                     /protein_id="XP_005536595.1"
                     /db_xref="GeneID:16994316"
                     /translation="MSSLALTRLQQERKNWRKDRPFGFSAKPVVTENGQLNLLHWSCT
                     IPGPAGTPYEGGLFRLDMFFPPEYPGKPPLCKFIPPLFHPNVFPSGTVCLSILNEQKG
                     WRPSISVKAILLGIYELLKEPNPADPAAEEPYKLFVRNRAGFDARVRQEVARLNVLAD
                     AQVCIAEKPAAP"
     gene            <538051..>539073
                     /locus_tag="CYME_CMK194C"
                     /db_xref="GeneID:16994337"
     mRNA            <538051..>539073
                     /locus_tag="CYME_CMK194C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536539.1"
                     /db_xref="GeneID:16994337"
     CDS             538051..539073
                     /locus_tag="CYME_CMK194C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536596.1"
                     /db_xref="GeneID:16994337"
                     /translation="MAGFVYRSPGGVVAFVNLPGRTGAVVRPVPRWGLASRSAPFPRV
                     RLRYACHDTRRRRQVLAATELLPRDKVLKTLQTVQVAEEVAVRLVDLAIKATKNYQVV
                     ATDFFLRPNELHGMKQALESLAFVGVTSSGGYAAAERQIAAFYPKDFAPTPEQEQQVA
                     TTHCESQLLALELAGNFIFDRASHSDFLGALIGCSGLRRERFGDIIILGDRGAQVVVL
                     KNDAETIRSSVKMVRSVTVRTRQLGSLAELEVQPPRTKTLTSVEASLRLDAVGSAGFG
                     MSRTKMVEMIKNGDVHVNWVPVKSASRNVAEGDTITARGRGRLQVISIAITSRGRFRV
                     ELKRYI"
     misc_feature    complement(538491..540217)
                     /note="possible transcribed region"
     gene            <539888..>541441
                     /locus_tag="CYME_CMK196C"
                     /db_xref="GeneID:16994332"
     mRNA            <539888..>541441
                     /locus_tag="CYME_CMK196C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536540.1"
                     /db_xref="GeneID:16994332"
     CDS             539888..541441
                     /locus_tag="CYME_CMK196C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536597.1"
                     /db_xref="GeneID:16994332"
                     /translation="MNVPAFAWSTLLPPEPEVDPQLYDDLVSIWCQALVEASLVPECE
                     LVASASALFRRVASRSSDAGGNSRRPAPACAPQILSALVSKGKCFFMPRTWPEDVLRT
                     ALAGGPLFEPPVQLGEAPANALNARQPAAGRFSGVPRLWRRLRTRKQDALVQAFPTAS
                     IEPEQMLSETYRIVMVDALASRCKDVCARLEEDRERNPRGLYILDEFCDRFCGRFVED
                     ALAVLIALSVQGSGRLCAVRYATDPPVIGFQYRARSISETDRSILALDAVRSKLAKRS
                     NAWKRVAVESEAQARDILAGFRGRLTANAIGDGAAGHVIVTRSLAHARERAAPHVRRK
                     LLAEHRIRQLQAAIEQLERTIWAMEQAQDNANVSRALGHGVRHVKSIQERDTSVDTLS
                     GTLDDLAEVLETNADFTQAVLDEAQLEGLDRDNDDELDKQLAHLLDASGETRVSEQKQ
                     LKEVGTRSLSMRCAAREAPAGADARPPLEKMRSTGPESPRRELRPTMTEDEQVEDLEG
                     TLRSVDLSQ"
     gene            complement(<542511..>543623)
                     /locus_tag="CYME_CMK197C"
                     /db_xref="GeneID:16994333"
     mRNA            complement(<542511..>543623)
                     /locus_tag="CYME_CMK197C"
                     /product="probable dolichyl phosphate glucosyltransferase"
                     /transcript_id="XM_005536541.1"
                     /db_xref="GeneID:16994333"
     CDS             complement(542511..543623)
                     /locus_tag="CYME_CMK197C"
                     /codon_start=1
                     /product="probable dolichyl phosphate glucosyltransferase"
                     /protein_id="XP_005536598.1"
                     /db_xref="GeneID:16994333"
                     /translation="MLHVSVIWSWTPFPPMTFFSVVVAAVMVAVGWGLLATALRPRPL
                     SRAAIRFKTAARAARGSGKFFYDPKAGKEKKSSFPTIFEPASVYLSVIIPAYNEEARL
                     EHTLQEALQYLERRSTDTTGYSPDPFTYELIIVDDGSRDATVRLAHRFTDRYGSDKVR
                     VLVLPQNSGKGAAVKEGMLVARGKLLLMADADGATRFRDFEYLERKMHDIADWDHELG
                     AVVVGSRYVSPLGASNASSSERAESSAGGGSVPQIHALRDWRRKLLGKGFNLLVKYLG
                     GVHDIRDTQCGFKLFARESARTLFLTQHLKRWAFDVELLYLAQRLRIPIAEVGVNWTE
                     IPGSKVRVVRAIVNMALDILRMRVRYFLGVWRIEYA"
     misc_feature    544046..546800
                     /note="repetitive element"
     gene            <547550..>550294
                     /locus_tag="CYME_CMK199C"
                     /db_xref="GeneID:16994326"
     mRNA            <547550..>550294
                     /locus_tag="CYME_CMK199C"
                     /product="mutS family DNA mismatch repair protein MSH4"
                     /transcript_id="XM_005536542.1"
                     /db_xref="GeneID:16994326"
     CDS             547550..550294
                     /locus_tag="CYME_CMK199C"
                     /codon_start=1
                     /product="mutS family DNA mismatch repair protein MSH4"
                     /protein_id="XP_005536599.1"
                     /db_xref="GeneID:16994326"
                     /translation="MSRLVTGSSRSLRTLSKRSGTFASRSTRLTSTNTTRSLVLAGVL
                     IQDKGRRVGVAACFVDACRVELRQFTDNYAYDRLAVGLEVLDPSELVVPDGIALSILA
                     PILQRDQGVATTSISGDGSGTVHADSRRAVPIPRRLFNEQIGLELMERFAVDAAAIRL
                     SASQPERDLATAACAAVLQYLEHRGELSFRPRAVQFVFTNCEDALFMDSCTVHCLELV
                     ERGDSESGTDADISLQRTLRFTQTAEGARALRRAILEPPANRTVIEERLDALDFMLSN
                     DAIYYELKEALRQTPSVERTIAQIFHIYPRARESLGMQAQSHIRDARVHGAQSIDHVV
                     DFRFVRSVWQLRRALDSLFRIREALDVFLEERSTQTGTRTLPVLLEWCRNVARLTALT
                     DLHHELGRCLASTTEVELELGSTERNRLHIAFALRAGANPLLDAARRALSDTVSSVHH
                     LAEATKGQLRCPRLHVAYSTLRGYHFVLPLRDAVQQSLTRTEIGGVLLRYPVRSGKKL
                     LFTTDALIRLNMQYQETLAEIWHLSSKELSKLAEMATSTASAHAIHEFCDCVAALDVT
                     LALATCIRRARDRSSCPWVRPQFPDTNVMAMKDGRHLLLSHLYEAQRRDPPRPNDVYI
                     DDAHNVMLLFGANASGKSVYMRQTALIVVLAQMGCFVPAAFASMPVYSVLLVRSRSDD
                     ALEHNLSSFAMEMREITSALHYIDGEALSSALNPLDQERRIHKLVLFDEVGRSTGSLD
                     GKSIAWAMLEYLSDTTAHIIFATHFSELARTQTYLPNVHVMHLQSRVENGTLYHDYKL
                     VEGAPASSRYGAEVAAQAGLPSAVVTRALQFRGVFSGDASTSTTTPTATDTGNQGFLS
                     IDDETWAHCRWYTKANTLLQRLVMLSYVATSPEDQCAGVAELASVFADLFETPTAVTR
                     "
     gene            complement(<550291..>550695)
                     /locus_tag="CYME_CMK200C"
                     /db_xref="GeneID:16994328"
     mRNA            complement(<550291..>550695)
                     /locus_tag="CYME_CMK200C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536543.1"
                     /db_xref="GeneID:16994328"
     CDS             complement(550291..550695)
                     /locus_tag="CYME_CMK200C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536600.1"
                     /db_xref="GeneID:16994328"
                     /translation="MASKIVAQLIIYGGQFLLRGLAEAYRQALANAQSTGAAQSAAAN
                     AVRRGRMTVEEAYRIVGATPGTSPEHIAERLRRLYTLNDPKNGGSLYLQAKVYTAQRT
                     LEEALKRSFELPLEDKGDSAKHHTASQQGSER"
     gene            complement(551340..553855)
                     /locus_tag="CYME_CMK201T"
                     /db_xref="GeneID:16994329"
     misc_RNA        complement(551340..553855)
                     /locus_tag="CYME_CMK201T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461388.1"
                     /db_xref="GeneID:16994329"
     gene            complement(554373..556138)
                     /locus_tag="CYME_CMK202T"
                     /db_xref="GeneID:16994327"
     misc_RNA        complement(554373..556138)
                     /locus_tag="CYME_CMK202T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461389.1"
                     /db_xref="GeneID:16994327"
     gene            <554700..>555896
                     /locus_tag="CYME_CMK203C"
                     /db_xref="GeneID:16994330"
     mRNA            <554700..>555896
                     /locus_tag="CYME_CMK203C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536544.1"
                     /db_xref="GeneID:16994330"
     CDS             554700..555896
                     /locus_tag="CYME_CMK203C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536601.1"
                     /db_xref="GeneID:16994330"
                     /translation="MDNRNLYSSALGTRISIESKGSGTNREQPVMIMAGNPLRVHVID
                     DDRIPTASMPGGFSAHDAPPGRGLASHSTEPQASRSVFAEGKSIVTPSERYRNGHQGS
                     HVATGIHTGDTFRSATAPLSRDGAGLPATRPSFPMQQSWKAGPLRPAVAVHDGGDVFE
                     WTQPDARQSIRSNQISPVSTSAELSPPMTRVPTPIPPPDHIEWKPPSMATGSPVTTSS
                     SPSERALDRSRGQQRVVPHSGWVSLESALRASIVPEHLRLPRLLTEQPVRADATRTRF
                     LVRLRVPSELDAFKIASIWRKRQETRFCLNCGVNDAPSWHRMEDDELGLIEIGEGWLN
                     SPTLLAQIAGSPGRRLQRAQCNACWKYSSRHGGEQRPPRLWKGSELDRLLGLRVMEAQ
                     LRLFQR"
     gene            <556430..>557074
                     /locus_tag="CYME_CMK204C"
                     /db_xref="GeneID:16994331"
     mRNA            <556430..>557074
                     /locus_tag="CYME_CMK204C"
                     /product="similar to iron-sulfur cluster scaffold protein"
                     /transcript_id="XM_005536545.1"
                     /db_xref="GeneID:16994331"
     CDS             556430..557074
                     /locus_tag="CYME_CMK204C"
                     /codon_start=1
                     /product="similar to iron-sulfur cluster scaffold protein"
                     /protein_id="XP_005536602.1"
                     /db_xref="GeneID:16994331"
                     /translation="MAFVGTRVVASRFFGAASKSSPARRARCLRSCPTVRRPALQTAR
                     HDGVALVQMSATSEPLTLSEASVEVVLDELRPYLMADGGNVSIVEIDGATVRLKLEGA
                     CGSCPSSTMTMKMGIEKRLRERIPEIESVVAVEDAGEQPSSEGVEQVLDQVRPFLKIA
                     GGSIELVSMTNIDGPAPVVNLRLMGTGAAIQSVKVEISSRIRRRFPRIAQIVFT"
     gene            complement(<559019..>560155)
                     /locus_tag="CYME_CMK205C"
                     /db_xref="GeneID:16994325"
     mRNA            complement(<559019..>560155)
                     /locus_tag="CYME_CMK205C"
                     /product="RNA lariat debranching enzyme"
                     /transcript_id="XM_005536546.1"
                     /db_xref="GeneID:16994325"
     CDS             complement(559019..560155)
                     /locus_tag="CYME_CMK205C"
                     /codon_start=1
                     /product="RNA lariat debranching enzyme"
                     /protein_id="XP_005536603.1"
                     /db_xref="GeneID:16994325"
                     /translation="MVWLGVAGCVHGRLDFLYEQFIEETHTRGIQCKLLLCCGDFQSI
                     RDEEDLKSMSCPRQYRELGDFPKYYSGEKTAPCLTIFIGGNHEASRYLQEIPLGGWVA
                     PRIFYLGRAGILRNARHDYRIGGISGIYYPKDYFRPRDEGVLLHGSQIHTVYHTRKTE
                     WRLLLHALHWNAFYGGSFSPETDIASRDRCHVFLSHDWPRGVMAYGDCSTLWTRKQWM
                     QRAHQRGIDGSPALAELMESSAAPRYWFAAHHHCRFAASTPQGTSFTALDQTLPGCPF
                     LTFVELPGAESADPVSDMEYDLRWLRCVQRHYRGEREPSGSISLAALQRVFESTRQKR
                     ASETPAPGYGNETAPNPQTSFLLGELGISWERLYNVDGVQANPQ"
     gene            complement(<564479..>565798)
                     /locus_tag="CYME_CMK206C"
                     /db_xref="GeneID:16994323"
     mRNA            complement(<564479..>565798)
                     /locus_tag="CYME_CMK206C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536547.1"
                     /db_xref="GeneID:16994323"
     CDS             complement(564479..565798)
                     /locus_tag="CYME_CMK206C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536604.1"
                     /db_xref="GeneID:16994323"
                     /translation="MLTGAQPQPLIANRTPVVRRQRPGRGVSARKRSRDAVTFFEIAN
                     GSPTADKVSSHECPVELVTDVCGNSAASEVPHEYVVRIQGLRALEQQQQKLWMLVQAL
                     ENSLVKLHCRVRDVEGSLAQICSSLSPNSASETATGTSKATDQSDSGSATTLSAEPTQ
                     QSVALQTSEEHASTVPESPSGCSPRRFGEVTQQQRANDSAGAGAMCNTPPAQRIYDTH
                     HGTRRFRLVWSRKNWQCSWIRFWGPVTIHTFASSNESAICSQLLFPEALKAPQFLCVC
                     GFYRESNRFWIRTTDGIEGFWANVEPSPNGGFQDPLGKLMLAERAETGHWLHTRVLQM
                     DDDCQVVFYATIRRVWGHPIDTVQLEYDDGRCSPPLAISAIRFQCVAAERLPKRETLQ
                     RAAFEEEPYPWNQSRAGVLDRTQALVVQPTPTKTQRPWAEDTRIPRD"
     gene            <566437..>567069
                     /locus_tag="CYME_CMK207C"
                     /db_xref="GeneID:16994324"
     mRNA            <566437..>567069
                     /locus_tag="CYME_CMK207C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536548.1"
                     /db_xref="GeneID:16994324"
     CDS             566437..567069
                     /locus_tag="CYME_CMK207C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536605.1"
                     /db_xref="GeneID:16994324"
                     /translation="MFVSGLPGSIGVRCFSPRREHLRQCCTVRRLQCAAQDLVQPNEE
                     FELVVSDEPLGPPDSADEEATPVAASGRGTGSEAVAPGEGGRTRGERRRSLRSSASWA
                     NIFVAPFGRKGTGSRPHLDLRPPSVQTRGASDVITCPDCKGTGLSICYICNGSHFYKP
                     NGEVIECPACHGKGRRTCIHCYGQGKVAELGGDWWKYGVLNWFKRRGKGM"
     gene            complement(<568099..>571425)
                     /locus_tag="CYME_CMK208C"
                     /db_xref="GeneID:16994320"
     mRNA            complement(<568099..>571425)
                     /locus_tag="CYME_CMK208C"
                     /product="similar to U5 snRNP-specific protein"
                     /transcript_id="XM_005536549.1"
                     /db_xref="GeneID:16994320"
     CDS             complement(568099..571425)
                     /locus_tag="CYME_CMK208C"
                     /codon_start=1
                     /product="similar to U5 snRNP-specific protein"
                     /protein_id="XP_005536606.1"
                     /db_xref="GeneID:16994320"
                     /translation="MSSAFRGGETDEVGSILVHGGARHGRSDALEAVASDECVPAIET
                     LTATTPGLPLAIPRRRLRKRHRIQETQTPEPIPALTRVRTRAPKRHQAPSDAGFYVQA
                     RPLRFKVSRRYLLHLAKHAGPERIWNILVAGHYHHGKTSLIDLLVSHQLHPAAATRYM
                     IGPRRHQQQPRWTDTRRDELSRGMSLQLAFMPLWVPDEHGVSQLVTLMDAPGHADFFD
                     QVVVGATLADAVLLVVDSAEGVLLGTERVVALALEMSLPLILVLTQLDRLILELRYPP
                     DAVYLKLKGIIDALNSLIERLQPQKVPYFDPRPPHANVLFTSAKLNIAFSLMDIVEKW
                     YGSALEVQRERSWTGGVQGALRKRRARKRTLAASLWGDRVYDKPTGLFLRKAAVAWTL
                     GTAKRSFVEFVLEPLYKTIALCATHESGSGSLEQLLVNVQALGTPRAFEPQAASSQRE
                     APTDLEMLQQAADSGPWALLRVVFDMVLGSPTALFGTLTRRRRHSKWFPEHCAETETT
                     VLVATHWRSLDGTDTVAVGRVCGARPLRADQLFAVQPGADRCKPSSVTTTTTTTMITQ
                     LQVAFGRVWYDVEQVAAGGLVLLPRVYPPSRGTYCFGLRCSDGPYSKTLDACVYRLHR
                     ALGYHAMPIYGIALAPCLPEVHRTAESLTADLVAQYSTSTASAEQLRQALAIIVRTHP
                     ATGFDGNGSVHGDAAHGFRTASTAGVVYGPGELYLDVILHELRRYLVQRHLSLVWRCL
                     RTNPVPFVDALRETIQAGAAKVQVGLRGRDGRTRSDQTALWSSPKSFLVSEDEFFSPE
                     PNEWSDNEDAAFHQPRVVLYVEPVHASRRAPAQQAGEPNAGPHPVVVHALHPLPNSVR
                     FERRSLPAEAAVQPEALEVEFAADLDGTTAPSGLPVTLQALWEGLRLASRRGPLLQGP
                     VVGVRYHVRALECICGSSAWEAPPPCWSAWHRMRTRLVLLARQAAHRALLDAKMQILE
                     PCFRLQAVVRAEKAELICRRLRKASELVEIRQQWPIPGTCFVIVDSDVPARVLVPGLE
                     VMLRFQSHGQASVQATVDPAVMPTCSARWIPVPGDADSVECPPLEAVVASDDSTVTEN
                     TLAPWLVRIVRMRRGLGTDL"
     misc_feature    571215..572801
                     /note="possible transcribed region"
     gene            complement(<573905..>575869)
                     /locus_tag="CYME_CMK210C"
                     /db_xref="GeneID:16994321"
     mRNA            complement(<573905..>575869)
                     /locus_tag="CYME_CMK210C"
                     /product="cysteine--tRNA ligase, mitochondrial or
                     chloroplast"
                     /transcript_id="XM_005536550.1"
                     /db_xref="GeneID:16994321"
     CDS             complement(573905..575869)
                     /locus_tag="CYME_CMK210C"
                     /codon_start=1
                     /product="cysteine--tRNA ligase, mitochondrial or
                     chloroplast"
                     /protein_id="XP_005536607.1"
                     /db_xref="GeneID:16994321"
                     /translation="MPRVRVPRLWHRKPYHLTLVRRFSPTNTPLGTSAASTLPGERRL
                     QWLPALGEPLYWYQCGPTVYDDAHLGHARTYVTFDMVRRVIREWYQCLPITAMSVTDV
                     DDKIIERARQQRLPNESIGQTCSRIAAIFEKRFFEDLDLLGVLRPLHILRVSEHIPVI
                     CAFTRRLLDTEYAYVTTSGDVCFDTSRVQSRYGVLDASRALDASHAGTATETAANTPA
                     ADNVPGKRHPADFALWKAVSATDEEPGWPFYVPDGANDDQKRIGYGRPGWHIECSAMC
                     AHVFGTHLDLHSGGMDLRFPHHENELHLSECYHRVRPWCRKWMHTGTLLIRGEKMAKS
                     RGNSRRIRDYLGWSEQGPNDLMRIRREADVFRMFCAMHRHSTPVEFGDTQRLQAARIW
                     DRLTGWLARIANDARSQSRKESSRALSVAGQESIATADASIEGDIPSTHWQPSFAVAS
                     GEHVADVDAVPDVFSSSHTQAAIPRNPTGRKVPAQLAEWSQRCHRALAEAFADDLDFP
                     RAVRALVEFTNQLYRFESGRRLDRMDAVEHNAVLVASEYLASILRLLGFQSIPGVSSA
                     NAQASASRVPTAFIAALVDFRMRIRNLAKQLRQDTAQPTQKATEALYGLSDMLRDDIL
                     FRLGAIHIEDRKDNASRWWIDPVRADDNDR"
     gene            <577808..>578884
                     /locus_tag="CYME_CMK211C"
                     /db_xref="GeneID:16994322"
     mRNA            <577808..>578884
                     /locus_tag="CYME_CMK211C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536551.1"
                     /db_xref="GeneID:16994322"
     CDS             577808..578884
                     /locus_tag="CYME_CMK211C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536608.1"
                     /db_xref="GeneID:16994322"
                     /translation="MTSSTEKLQSTEQPGQAKLRVQKRELGQTGLRVSVVGFGASPLG
                     GVFREDIDETDACAAVYQALHDFGINFFDTSPYYGSTRSERVLGKALAQLGERDDYVL
                     ATKVGRYGPNNFDFSKERVRRSVEESMERLGVRRLDLVQCHDVEFAPSRRLIVEEALP
                     ALCQLKQEGVIGALGVTGYPLAIYRDIIEASTVELDVVLSYCHGCLCDTSLRDSGVLA
                     YLREQNIGVLNASPLSMGLLTPDGPPAWHPAPPELKACCRTAAAWLASQQVNAGISTD
                     LAEVALQFAVQRFAQDDVASTLVGIDGTITLRKNMQALAKPLDDMLLKGVQEILKPVR
                     NVGWESGRPRSEWLEAAPGVRESA"
     gene            complement(<579136..>581601)
                     /locus_tag="CYME_CMK212C"
                     /db_xref="GeneID:16994340"
     mRNA            complement(<579136..>581601)
                     /locus_tag="CYME_CMK212C"
                     /product="similar to bromodomain containing transcription
                     factor"
                     /transcript_id="XM_005536552.1"
                     /db_xref="GeneID:16994340"
     CDS             complement(579136..581601)
                     /locus_tag="CYME_CMK212C"
                     /codon_start=1
                     /product="similar to bromodomain containing transcription
                     factor"
                     /protein_id="XP_005536609.1"
                     /db_xref="GeneID:16994340"
                     /translation="MEDGAQGKSSMVGLGEQQNAAPQTAQAVRAQGTPSTESEDASSS
                     FSESSALASVPNALNPPVRPGLHETVASETEAVSKELKEGLVDPAQVQGSERTDVNGK
                     PTGQSHAAENHGNQSDITNQLQAADPNIGTAKTRTPSVAPVLPDGSTPEEHSGISLRP
                     RPKRAAAPSLPNKPVSTSKKDAGEQSTLSADFVPADREERAKLHDELLQRMEALQEER
                     RRIIDIHSRQIMAAVLARHQAGAVYMPTDSDTNRSKGKTSSFDTAVQQNEGAHSQVHS
                     TDAASEGPRPSTGGQGVVGGTLGSPTISSSGRLRTPSQRFSQQPGERLDGTTILRRFP
                     QMRFCARVLKEIMKMKEARAFLLPVDKLWNPDAIPDYFEIIKQPMDLGTVRQKLESGE
                     YGTDPEAFRRDVRLVWSNAMTYNPPDSEYYNIAKMLNEAFERKMQFLPPPGEIQSTHS
                     TSHHAVSQAAARKRQRGLAAAFRQGSHAAKARRGGVDSALARNTERRRRSTGRNASQR
                     PYTGEAPGYGSYVSGANERGPHEGTPVRRSRKRMDPFERVRELEQRLAALQKEKREAE
                     ALLSTASTSGRGVAASPPVSAGGLPSRDAIASLAKVPVTQQEMAQLAEDIGRLDGQQL
                     RRLVELFGSRPGLLTRASSGEYEMNIQQASNETLRELQAFCNECLRPVGRDLDPLRTM
                     SPTAAGARVASINRMLLKLNHELERARKAAANAQRQRDVEHLGAASSPYFAAGSTEGR
                     TLYNGAGVPASGHPSTMPYAQSGGLEAPYPAATATTALDGGSSMSIHDHANAMMPATP
                     QYEMNGSDESSTEQSLTSDGDEY"
     misc_feature    581913..584065
                     /note="possible transcribed region"
     misc_feature    complement(582530..584268)
                     /note="possible transcribed region"
     gene            <584412..>589046
                     /locus_tag="CYME_CMK215C"
                     /db_xref="GeneID:16994348"
     mRNA            <584412..>589046
                     /locus_tag="CYME_CMK215C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536553.1"
                     /db_xref="GeneID:16994348"
     CDS             584412..589046
                     /locus_tag="CYME_CMK215C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536610.1"
                     /db_xref="GeneID:16994348"
                     /translation="MPNETPLSIVQTLFLERFRCVVEGIKQLYDVRGGRQAASASASN
                     ESSDGTPPGCYGWLLWLSGTGIPKVLPALKWHVGLRQFAMQTLCDDHLMPLVLSLEAT
                     QPRDCGCPTHPDASSAMDCCSCCYCWIGAVVSILDCFATGQVALSVRPEKNEKRRSPD
                     IRGPLMCPHREPSTPWPLSECAASYATFWQSMIRHVERALVQVESVTDKATLAGEEHE
                     ALPQRLFHQTQDDSVTLYASHGTAPVGRSKRMKYAGASHEDEAAGDQTIAPDSSDLAV
                     TGRTFTTSGHDQLACSIQETTYLDCLPDTARRRTSPGTHHRDALQPEPDQQRHNIYLT
                     WEPISHEYVADDRPAVHSGGSVSEPSCPRAERSWLSGRATGTGTCSADAWSAISAASS
                     PGRASSTTRERLHPIIGALIWRLVTSTATPMKSNKFPARRENVAPAFRASRFGAEQHR
                     ACSARSSHNRSAKSIHEGVSSLQAITDPSKRLGSDPLKSRSRKTAQSLDPTLVSDPSI
                     QQMSTQKLSIVSVERSMYARVAALVALLECLQDRDHVLVSGAMHPKVYPLINSFLCEL
                     VTSWERSGNRVGLTALVPYQAALQQKPSCDPAGPFSRKLFLSIIAAILRGTVQDLRQT
                     VHQFLDSSGDTQALRLERGKQVIQDVRFLQQSLEHIRCRMVDLEATPKAPNETLMEPR
                     LSESTPTIASLLEADIHCLMTLWEQLETRHQQVLCADSHSALDIGTRLTSFGETGTRN
                     QHSRSHEDDGDCVGISISSSSSGERRIGCAPCGKPARSLPGSVAQRVAQLLFEVAQRR
                     GLDASMTALHRFASRSGAPWLETLEVLLRGPQRIASSPESWTLWYKMCFELPRVFNSV
                     ERLAGKLLLDKFLKRCSAELVIDEQQEPALVLNSLRRYLEAFRRAESSSSVSGQRDLP
                     SQMDGMLPDLERLTAVVVRGSFAAAQGCASKPPEMTWSVAETLFVNVLTPTLQPLPCW
                     TPLEPVAGSAVLSSTQQTSCEAFQLWLTALEELAPWMPLYVLARRFQDVFRQRLSTVM
                     EMQCAISVAKRLVDSLLAILQALDRGLAAAQSLKEQPEQQQHQRQVGYAMEPQALSLF
                     RGTLLNMLLCGCVPIPSKDTPDTPVDSYAPHRHASAEQRSARCQSLRSALLVLVDGLQ
                     PLESAGPPIFFGSHFAATNRPQYAALGSDAAGPVPDLSPALYLDTRLVRQRLLWVYMR
                     ALCIWPRTASNETLRSRLLDTLSRLFAEAGTGLQLEPTAVNGLSSSRGSIVNSALQSL
                     LEIEQRLERHALGSVAADPCALSRACDAAYVLWLVDEREHAPQDEAVQRSNLRKRLWR
                     WELNAWHCEQRAATALNDLRDLESLHLFSQYLRCLVSGDHQRISLIEYLDGTLGEQLR
                     EALDEPNTQALLPIILPASLVPDFCACMSQDAHRRALLMLFWQHLYTATVAGGASIHL
                     EGLPNPAYCEHVLLTYGMILETIEPQSGLSWPEHNGSLELALGQWVADGLPSGVTTNA
                     LVAILSEELQRLVRRIHQRLAHGDQTPLVASACARDTVHPQGQEHQSGGS"
     misc_feature    complement(586003..587625)
                     /note="possible transcribed region"
     gene            complement(<593258..>595279)
                     /locus_tag="CYME_CMK217C"
                     /db_xref="GeneID:16994345"
     mRNA            complement(<593258..>595279)
                     /locus_tag="CYME_CMK217C"
                     /product="similar to 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase"
                     /transcript_id="XM_005536554.1"
                     /db_xref="GeneID:16994345"
     CDS             complement(593258..595279)
                     /locus_tag="CYME_CMK217C"
                     /codon_start=1
                     /product="similar to 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase"
                     /protein_id="XP_005536611.1"
                     /db_xref="GeneID:16994345"
                     /translation="MLFVRNWSLIRQLYIWGLDLTSRVIYGERAAGWRWQQHQQELET
                     DPSRCVSEFASDRGPAAAAAESGTASNYQNAGQSDTSSVSLHRESGPQGDLQRRLSRL
                     HSELELGGLGEWESYDAIRGLFDVIGDEACLTDRTEEYTNTRIRTHAAGARQQRAVLP
                     LIAVVPPLAEAVGAMAGDSLTKCFESSAPRVWNLMTRTRSTPVPIILWPIWLFSIFIR
                     YGILFPLRLGILIVGVSIFSTGFTLVHLLLRRRTRFKVYLQKQLIRFLASTLVASWSG
                     LVRYHGERPRRRPNQIYVANHTSLIDLAIMIKDYPFSTIGQRHGGLAGRIQDLMSLVQ
                     NHIWFDREEGHDRRIVQRLLQEHVQNGEHEPVLVFPEGTCVNNEYCIMFKKGSFELGA
                     LVYPVAIKYNKAYADVFWNSARQVFLTHLFALMTSWAVVCDVYYLEPQQRRPEETPAA
                     FAARVKHLIARRIGLIETNWDGFLKRHQVSPKFREHRQEMLAFLVRKQLERISTRKLP
                     SIAEEVLCKADIEVTQRHPLDSVPSWIDRSTHIPGVPACQALRGLQRRRSVQKLWLSL
                     PASASGRGEKHAQRSTMWSAVLERCQGLVVRLVALGLLVLLVGCISFVLSWLNKRVDY
                     IAYVLRFWLHLWSLVVETLDIARHSVQWEITEARKVLRSVGQACRRIWR"
     misc_feature    597198..598482
                     /note="repetitive element"
     gene            <599220..>599570
                     /locus_tag="CYME_CMK219C"
                     /db_xref="GeneID:16994343"
     mRNA            <599220..>599570
                     /locus_tag="CYME_CMK219C"
                     /product="calmodulin"
                     /transcript_id="XM_005536555.1"
                     /db_xref="GeneID:16994343"
     CDS             599220..599570
                     /locus_tag="CYME_CMK219C"
                     /codon_start=1
                     /product="calmodulin"
                     /protein_id="XP_005536612.1"
                     /db_xref="GeneID:16994343"
                     /translation="MRSLGQNPTEAHLREMIAEVDQDGSGTIDFDEFLALMASKMKDI
                     DTEQEVREAFAVFDKNNDGKISADELRAVMLKLGERLTDEEIDEMIREADADGDGYID
                     YQEFSNLLQWDQHT"
     gene            <602319..>603497
                     /locus_tag="CYME_CMK220C"
                     /db_xref="GeneID:16994344"
     mRNA            <602319..>603497
                     /locus_tag="CYME_CMK220C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536556.1"
                     /db_xref="GeneID:16994344"
     CDS             602319..603497
                     /locus_tag="CYME_CMK220C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536613.1"
                     /db_xref="GeneID:16994344"
                     /translation="MRVPRSQASVIRRCWVTFWPERVLPHARSGCDACVQRSALPVWG
                     RRSIWNARLGPAAASASASLSTLARRRVPSHFGFVIVPQQYAYIVQRFGRFSRVLDPG
                     LHFLIPFVDKIAYVHSLKEEAVSINSQTAITRDNVTIAIDGVLYVRVVDPAKASYGVE
                     DPYMALTLLAQTTMRSELGKLSLDKTFEEREMLNARIVDSINEAAAAWGMQCLRYEIR
                     DINPPANVRKAMELQAEAERRKRAQILDSEGEKESEINVAEGQKRSKILNSEALQLEQ
                     INRAHGEAEAILARARATAQAIRIVAAEMQQKGGRDAVALRIAEQYVQAWSKLAKEGN
                     TLIIPANISDVRGMIAQAFSVWETMGTQTSNARAARAVVSPAAEDKAALVASSEQSDS
                     "
     gene            <605318..>610189
                     /locus_tag="CYME_CMK221C"
                     /db_xref="GeneID:16994346"
     mRNA            <605318..>610189
                     /locus_tag="CYME_CMK221C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536557.1"
                     /db_xref="GeneID:16994346"
     CDS             605318..610189
                     /locus_tag="CYME_CMK221C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536614.1"
                     /db_xref="GeneID:16994346"
                     /translation="MTPETSTQRAHTEGRSPAEVVSGDDGNGCPGNNSSASVFEEAIR
                     VEKPPAPFEALETAAASRGLGALTTGTSTETPSTAPAGAGRPEEHSGTASRVGALGER
                     QSWPARGPGVPNARGVVGAGTTTAARMHTLGRGGRVVVQQPSSSAEQNAKPDVRSESA
                     DTPKATTAVAAAAMLKASRNDTGDRTAIPSTGPVVRSAQQAAWSRQRSVPDPARNATG
                     RIFSRATQGASARSATPTSDFPALVRENPTQSKPSAMQQRKPDESAAQLRPVAAAQDS
                     ARRGQHPLGTVSRNHTESGHVPKAIPSPLQLTDWSEDPDEEMNFSVPLDQRLAVPGMK
                     PLTRPAQKDSLREAQSPTTDSATISTRAIGGFDWTDSDNDEGKAVPSDDNEASKNDIA
                     SEVATGTATTANVENADGRQGAAFVESDEYQQQHQQQQSQPIAVGTRRPNIQPSLSKE
                     KMQVDLEEISRELHLLEEQRELAKQKAAERARQRREEEERMERERKERAALKLRQLEE
                     RIAAKKAEKATVKERTTPEHQAARTDSVKAADLGKDRKLPAARIDRAIASAQSGGPAS
                     SASASEKPYPLEQVRRDDASAGDTRITRTEHATEAGSRSAARNTQQRVRRAPLTETWS
                     QEEQHTRGRATASAGVRGTASAVPACDRSSLDRSRATASGASSTNLDQSRRQRRQGAP
                     RGQLSKSDEPRERSDSASASGSTSRDKTATEPEGPKIESSVRGSRSRTSAPWGRAGPA
                     SKPGKRNDREGAPSEAALSEHVQPLSLEDASLPSSPPPTWFTMPDTMADEEEPTVRSP
                     WAASSPALTPAASATGVAPKSADELDKWQLPSYPKPSFEDISRAFAAAGPVVASPAST
                     AYGLAELYGSSVSSQRVPVESKASLVSARRPGALQDERELEAPKRDTSRSSPGTQRGT
                     LSERTLSEPDATAADPAQHHLRVSSDVAVATTAVSQLSLSADADKTLTKEIPFHSDLR
                     TDAPEFVPFISYGGFGTSAFPVPQMSPTFFSAPYGEATRSDLYPLPAYMQPADWGTAS
                     AGDTIDMHHLSSGGEAAVPTRTVRQRAPPEDDDEDLAAAAISSALGERRQHRGGKGVT
                     AGRHAGTSSAPGRTRQRPTIAASTEVFRANRGRHRTGMGVGASGTDGTLAKPQRFVSE
                     DREAPSHSEASAASASASASRLEQEATTPMARSGQQQRTADSNTSASTELQTRRRSPG
                     LRTSSNSSNVRSVQDVRCESRRGTAAPTTTTATQSSPGENLKAADDESAQRSEPAPAL
                     SEQQSGAAASDARAGVQTRKVTTGVNRLKAVKPSRPATANKSAANALEPTAGTGTADR
                     NGEDALAPATTKRGKYCDRNAGADGKRRERWTSRPRPRSMREGRSRSTASVTGAASAA
                     TTEPKTATALDTAVKMLPFEVSGTRTPSPVQREQQKQEAVPEAPTRTSPAAEGAPKAL
                     VTPADPAEDPKTPAKDQRTREAGSSDARVSTTTPPLSSSASASASLSSKEQGAANAKA
                     TAATGQETKHEHSASRRHSQRKLHPRQRQQKHRFRNRTNAGSEQVESSARTMQPEPAP
                     TGNDRSSANDEHRASFKNVDVVPVAGASLAQPKFKLSTESAVAYRRVEANASPRRALR
                     QFREKVSEDAKDA"
     gene            610669..612571
                     /locus_tag="CYME_CMK222T"
                     /db_xref="GeneID:16994335"
     misc_RNA        610669..612571
                     /locus_tag="CYME_CMK222T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461390.1"
                     /db_xref="GeneID:16994335"
     gene            <613632..>615260
                     /locus_tag="CYME_CMK223C"
                     /db_xref="GeneID:16994238"
     mRNA            <613632..>615260
                     /locus_tag="CYME_CMK223C"
                     /product="similar to mitochondrial GTP binding protein
                     trmE"
                     /transcript_id="XM_005536558.1"
                     /db_xref="GeneID:16994238"
     CDS             613632..615260
                     /locus_tag="CYME_CMK223C"
                     /codon_start=1
                     /product="similar to mitochondrial GTP binding protein
                     trmE"
                     /protein_id="XP_005536615.1"
                     /db_xref="GeneID:16994238"
                     /translation="MQRTRSLAASVQSLARSLRSKQLRPYQKVTQHANRVETVSLGSL
                     SYCASVVTRYLCSAAQKAAGAAGTRPTIYALATAPGTGAIAVFRISGPETRQVLQAVL
                     HVPAQKLPQPRQLVPRTLYDPQRNYAFDRGMVVWFPAPASYTGEDMAELQVHGAPAVI
                     RAALVALAGYPGLVPATAGAFTKRALTNGKMDRSQVEALAHIIQADSLDGLALAVNNL
                     QGALRSQHHSWRAHLHAAMAIMEAVLEFGEEHLAHEIDAQLEQAAQRIRAVQAEMRMQ
                     IRLASPEGQRPELSLTPRIVLYGRVNAGKSSLFNLIGQREASIVHETPGTTRDVVEQR
                     AYIDGLAATIMDTAGLRETPQTASAIEAEGIRRARKVIEQTPLRVLVVDASTEEECSL
                     EHDPTAAWLPSAVVLHKADLVPDHQQREALRNRFSRCYRESDLFFVSSRTGEGVDAFL
                     NWLGERLRARFECAKDTDQRRCLIQTQRQHALLRVVHDLLDGALQHLIVPELAVEHLR
                     SSLQHLAEISGEGDRRFDAEDTLEHIFSRFCIGK"
     gene            complement(<616295..>617032)
                     /locus_tag="CYME_CMK224C"
                     /db_xref="GeneID:16994239"
     mRNA            complement(<616295..>617032)
                     /locus_tag="CYME_CMK224C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536559.1"
                     /db_xref="GeneID:16994239"
     CDS             complement(616295..617032)
                     /locus_tag="CYME_CMK224C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536616.1"
                     /db_xref="GeneID:16994239"
                     /translation="MSFACFVPLWDLWDLWGSKGHRLRKDDVFGLCLVGIGIISVIGV
                     TAPVPASVPRSAAFALPANAVTLENRERPASASVIHGYPRIVDGDTLAFGTTRVRLFG
                     MDAFEQRQRCRRPIHNTAPDAAPLKFDTYRCGLQATEHLRALIGARPVTCVPRGRDPF
                     QRIVAICSVEEASGETLDLGRAMVRDGWAVAFRKFSTMYVPDEEEARREHHGVWAASQ
                     ETNDETLLFEWPWQWRYEERRDTQRRH"
     gene            <617366..>618079
                     /locus_tag="CYME_CMK225C"
                     /db_xref="GeneID:16994231"
     mRNA            <617366..>618079
                     /locus_tag="CYME_CMK225C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536560.1"
                     /db_xref="GeneID:16994231"
     CDS             617366..618079
                     /locus_tag="CYME_CMK225C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536617.1"
                     /db_xref="GeneID:16994231"
                     /translation="MPAFATRQQSSHNDSQFTTGTRCKAMRYPAVIVDTVRGMVYGKV
                     AVTRCCINAGTIKVMEHVRSRLEAQFNVRRDDYRQDKVCLMERTGSSETYRTARILEE
                     ADTSVNLEVGQDMRIATIEHEIGDFPRHGIALLRKTISFNWRCPAYIPKSQPYSAQAR
                     ELCSLHDNEFDIFDDADDAASIPLHETARGLKRSAAAAAAMRGIFPGAMLGAANFVPV
                     SSSNSAPCRIPSQTSSSSV"
     misc_feature    complement(617868..618469)
                     /note="possible transcribed region"
     gene            <620472..>621983
                     /locus_tag="CYME_CMK227C"
                     /db_xref="GeneID:16994235"
     mRNA            <620472..>621983
                     /locus_tag="CYME_CMK227C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536561.1"
                     /db_xref="GeneID:16994235"
     CDS             620472..621983
                     /locus_tag="CYME_CMK227C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536618.1"
                     /db_xref="GeneID:16994235"
                     /translation="MLVSERNKLRNLVTLLVLVYIIIHEICCHKHWQQTAGIAGPLSE
                     TAAPLRWEHRAWNAIARATNLAVARTRRGSSRDRWFHEYGNWWASSVRLGNVLGRSPR
                     EPIGRYTLRQEWSWFVELLEESLEVDSVAPTGQFEGTGIVMAIGRPQRYAIPALVTLR
                     LLRLLGCRLPVEFWYSSARGESPFDSGLEAALRRMNRVPDTKGTANEAPIYFRDLDTV
                     VPRQRDLGGWESLFAIKPLAIAFSRFAHVLYLDADAHPLRDPTYLFSLFAPEAVSETR
                     SSRIPTAVFWPDYWIMPVDHPAFSIFRVVPRTWRERREQESSVLLVDKSDVHESWIPL
                     MLSVMLNVRSDYTYQYLHGDKDTFRFAWMALDAPFDRIEVPPAAAGHWSSEGLFHGTT
                     MVQHDPNGKPLVLHHNLEKLDACSLDRSARWWPSGRLWDAVQFGGQANWTTQGRWIGP
                     SSRICFTGTRVKTVPFEEYIGQDFETQFFRPALDAVLTDAFAKRHRWSRCRAA"
     gene            complement(<623603..>625960)
                     /locus_tag="CYME_CMK228C"
                     /db_xref="GeneID:16994236"
     mRNA            complement(<623603..>625960)
                     /locus_tag="CYME_CMK228C"
                     /product="mitochondrial translation initiation factor
                     IF-2"
                     /transcript_id="XM_005536562.1"
                     /db_xref="GeneID:16994236"
     CDS             complement(623603..625960)
                     /locus_tag="CYME_CMK228C"
                     /codon_start=1
                     /product="mitochondrial translation initiation factor
                     IF-2"
                     /protein_id="XP_005536619.1"
                     /db_xref="GeneID:16994236"
                     /translation="MFLPLRSCFSALCGNLKNVSEVLRAQAPPSTGRVLHQRPLSRGE
                     SGGTLQQVIDANGLGDVCWRHLQCWRSRSSVGALDKVLRGNSAGSSLPPARGAAEAAL
                     KLPARFESYASSLVRHTRVSSHFADAKILQHGYGTSFGTAVGRGAFQRSASRTLRSLQ
                     QRLGRPHEKPRRQRESLFTDDSKCLRIVSSRAQGSVEVRGPRIPSLRQVQLQRRAQCQ
                     WRSPSRSTALCARYIRHLGISATKAGPVEHIVDAAKTPATNTWLRPPIVTVMGHVNHG
                     KTTLLDALRETQLAGEEAGGITQNIRAFRVFWERILGQSADVPSVPWITFLDTPGHEA
                     FTEMRARGASVTDIVVLVIAADDGVMPQTLEAIHHARAAAVPIIVALNKCDKIKGRGM
                     AIYKALEEQAGLCVEALGGDVQCVEISALKRLHLDRLVEAILLQAAVLEAERTTSIQG
                     AAEGVCLEARMDRGYGLVLDCLFRHGKLCSGDILATPAAWGRVRLLLDEHGRKIQEAW
                     PTQPVTVIGVRRNEDDSEIPVEPGSIVRTVDSEEAAKAFVRSERSTAALETPASTAAR
                     GSEATRSGTAHTTGLELIIRGTYRGTVEAVAQAVQRMSTPNFPIHIMLASTGAVCKAD
                     ILLASSSLDRPAQIIAFQTKVPRAIAELAARHHVPVKCFTVIYEILDDIQQQQRRAQS
                     DEPQAPVATGRARVQQVFTYNAGKRVADALIIGGCRVIDGVIYRRHPVRILRQGQCVH
                     EARISSLKHYREDVAQVRKGQECGIAVEGFAFAVDDEIIGIADSG"
     gene            complement(<626742..>627626)
                     /locus_tag="CYME_CMK229C"
                     /db_xref="GeneID:16994242"
     mRNA            complement(<626742..>627626)
                     /locus_tag="CYME_CMK229C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536563.1"
                     /db_xref="GeneID:16994242"
     CDS             complement(626742..627626)
                     /locus_tag="CYME_CMK229C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536620.1"
                     /db_xref="GeneID:16994242"
                     /translation="MRQTAVDQTAICAAACGDSSTQCHATYLSENIVGGPGVYYCCTG
                     DFLVAGAVGCICDDGLDCKRVSQEAVASPSVTSVTTPIATPTPSPTPTAVSIQSSAPV
                     VTAAPATPVVIVVVETPVPPPPFVTPTAAPAPTPTAVSSAVPPETAAPPTSSPSSAEP
                     SPSSSIQALGLRALEYTNQFRAENGLGPLGYNQGLYVEALAWSQYMARTGVFRDQDLS
                     HPIVPVPAGIVFSGENVAFFTEAEHVAHECINLFISSPPHRANMLGDYELCSVAFAQN
                     SAGAWYCTQCFGNIFRTA"
     gene            <628813..>629859
                     /locus_tag="CYME_CMK230C"
                     /db_xref="GeneID:16994243"
     mRNA            <628813..>629859
                     /locus_tag="CYME_CMK230C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536564.1"
                     /db_xref="GeneID:16994243"
     CDS             628813..629859
                     /locus_tag="CYME_CMK230C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536621.1"
                     /db_xref="GeneID:16994243"
                     /translation="MSSYMLQRERGSRAPCYSMARCRVPARNRLHRWVLLFFSVFVLW
                     FAAQSMLVLGHAEEEFIPQRAVNQPELVQDSRALAATAAAPLQAMRLEAGTPAPTTGI
                     PYSALSPSVLSTAQQAALCAELCPNAVTTCAIKFIYGTGTTCCCSGAFFVRGSIGHLC
                     SDQSIPKLVPESLLNQVITAANASSTGVEDKPPGAITKANASALHLAGRSGLDRINQV
                     RAAQRREPIIWSQAVYESVSFWLSYLDTTHLFITQNLGKPAKPFPPGALFLAEVVLAQ
                     RLPENVTAEEAGIACGNALLNGNISAEITLANYEFGAVGTMPRSSGPEWLCSISLGNM
                     FRYGGTSFPNATGS"
     misc_feature    629483..631020
                     /note="possible transcribed region"
     gene            complement(<631023..>632462)
                     /locus_tag="CYME_CMK232C"
                     /db_xref="GeneID:16994248"
     mRNA            complement(<631023..>632462)
                     /locus_tag="CYME_CMK232C"
                     /product="argininosuccinate lyase"
                     /transcript_id="XM_005536565.1"
                     /db_xref="GeneID:16994248"
     CDS             complement(631023..632462)
                     /locus_tag="CYME_CMK232C"
                     /codon_start=1
                     /product="argininosuccinate lyase"
                     /protein_id="XP_005536622.1"
                     /db_xref="GeneID:16994248"
                     /translation="MDQTATPLPADTAASKQGQNRALWGGRFATETNELVARISESVS
                     YDHRLYKHDIAQSKAHVRMLAKQGLVTAEDAAQCTSGLDQLCSQIENGTFGAFDIKLE
                     DIHMNLESRLTRLVGEPGSKLHTARSRNDQVATDLRLYLRDEIQLLISLVRSLQRVLV
                     TLAEEYAQVIMPGFTHLQHAQPVVLGHYFLAYCEMFDRDAGRLEDTLNRLDFCPLGSG
                     AIATTTLPIDRFFVAEQLGFRHGPCRNSMDAVSDRDFALELLAAISISMMHLSRMSED
                     LIFWMSQEAGWIELGDAFCTGSSLMPQKKNPDVCELTRGKTGRVYGNLLALLAMMKGL
                     PLCYNRDMQEDKERIFDSLDTYKALLQIFREMILTLKPNQERMFAAASDPSLMATDLA
                     EWLVRNGVPFREAHHRVGALVGECTRSGRRLNELTLTEMQRVVPEATADCLELFDPLR
                     SVQARNIFGGTAPEQVRSQVAFWKRQPWF"
     gene            <633595..>639189
                     /locus_tag="CYME_CMK233C"
                     /db_xref="GeneID:16994249"
     mRNA            <633595..>639189
                     /locus_tag="CYME_CMK233C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536566.1"
                     /db_xref="GeneID:16994249"
     CDS             633595..639189
                     /locus_tag="CYME_CMK233C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536623.1"
                     /db_xref="GeneID:16994249"
                     /translation="MDWKALLICCESRCSTAGPVLELARLVATWDVVPQERSVQGAAT
                     LSFIARGIGTGFLDHEALRIDRENALRTLNDILVDDHHVRVMAAVAERVSEKFATSWT
                     PHAFSTVPLPPSEAHTPRTEACQSVGNGYEQLLRSVLERLKAQNPALFSAPRVPSAGS
                     QQVLRAPPAGTHMGSSRKRQRLEHTKANRNLDLPKAQSVWSSTCETATATTGSGLNAL
                     ESAPAPSSTYNKPELPAGPPLFDPDQQRVLHETSTLLTSALEALDHYGELPPRAANAA
                     VHRVCAALGIASALPANAVDEAPALRSLLQRGLDWCAHLLADNSPSSWSARAAVSEWV
                     FLVVVNSSSSLREALHEEHLVLAMQTLREGLHAVAKTFGQLVDSESDEHQGTQRDGID
                     QTHRQAGLRQWNKCVQLVVRLTNFVQSCPEIAESQRFQSISLSLFALHVADTLLDEVL
                     RSSESLSPADTRELIQRSGSLWSSTTRLLCQTYAAYAQCRHLVLEEVQTLLRRSRCGY
                     LSEEKTRNSVVSPVTVETSAERWPPLELVLEFIDVVGRIEFAPLLVGDSTCSDASVDR
                     VSARCSPTALKKRAAATTTTNTTKPSPRDLLDTSARFFDTVRTLIDALLSGGKATVFV
                     GVNDCFPTILSYLRNSMRKLEATTPAPLIFLQFLIRHTQMIASTQQALQAEDHLLLAE
                     RCLLLANFLDDFCDTELPHDSDAAPRESFSHLVQALATQHPLWLALWGCLLPMQTDHE
                     TLVHTTTVLESPSYHNGMFRIQYSESMLSSASLLCLVKPALKRIHDLLESVACLRLSQ
                     VMRSGRATLRARAMRLFSEVRGILQPAANECAPSHVQTLDSVRGRQENTPELQSTTMV
                     TASNPLCILTAHAFRTTTSACTPFTASNETALETASSSVDDMIKFASTCCLDVSPKVR
                     EAALTCYVSWMRRARRPSAVSETLLGRLRDISVAVRQKALVLLDAIFQDHEQLDNHAW
                     SPMAAHILARLDDPSPSVQRLAQRVLLKHIFQRQLVYRERAPTCPDTSDDCFDLNLSD
                     SDAASDRERTVVGQALRRRRLRVRYLDEQHSWLVSSVSHASATSASMDLSFQRLKQML
                     NALPQALSVSSSLPIPVLMERLLLVGDKIVCLFRAEATALVGLAMRDQAYGLLAILAQ
                     LDANLLRPHLPLLIDEIRLLAAECPIALPSATEQVFLWILRALMNCTRVLGQARAQVQ
                     LWSTLESAVVRLILQLQSANDGLADEANRLLRLLHDHNEHLATGAQRSAAYWQRVRWL
                     WTFVELHQNVADGESGVETSSAPSAAVVGLALQRLGRLIRYAPKAPPDVAIPLNNLHD
                     RLLTCCATLPAALMCPAAEMTTPRLTVLSGAFECLLQLSRCDGHFALKQLPLWQKLLQ
                     SGCITSETTSGSQCLSLLLGIQERLLRHLVEFVESERAVGAASTATATLPSSSSNVMR
                     PIVGGRIRVQAEPDRDNSQNATTSSWENCSIAAIDESEKECNVMFGTIQSILPSLAEV
                     LQTSLLGKSNSALVSAARLCQVALIEGILTPERLLSPLCYIFWTLWVRNEAIATTPKR
                     CLMGADHPSAVAKGALLHLLRDAPQQVAAGLGDGLLTAWRSCYDEHWTRESVGASAAV
                     GTVHAASGSHVHVATAKTQVSLTDAFLRLNLGYEGNEHVCGFLFSALKGTCFRRRVLQ
                     SIVQAITAPATDERYPLSVRCAAALFLATISAIDHTLQSQRNLHHELHLLLEALEHSL
                     DELEVAVEAVLGSATPSDTSPGDASPQPTETAICCGFVLQLRLYLLLRARYHALRSVA
                     AREALAGLAAPIVPIAWPELRAITNAALAQWRDTTTDDVALDEAPCTHPESDQGSAAD
                     ASTDSVPDDETWDTEESCGDVS"
     gene            complement(636167..638935)
                     /locus_tag="CYME_CMK234T"
                     /db_xref="GeneID:16994250"
     misc_RNA        complement(636167..638935)
                     /locus_tag="CYME_CMK234T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461391.1"
                     /db_xref="GeneID:16994250"
     gene            <640263..>643349
                     /locus_tag="CYME_CMK235C"
                     /db_xref="GeneID:16994251"
     mRNA            <640263..>643349
                     /locus_tag="CYME_CMK235C"
                     /product="DNA ligase I"
                     /transcript_id="XM_005536567.1"
                     /db_xref="GeneID:16994251"
     CDS             640263..643349
                     /locus_tag="CYME_CMK235C"
                     /codon_start=1
                     /product="DNA ligase I"
                     /protein_id="XP_005536624.1"
                     /db_xref="GeneID:16994251"
                     /translation="MTCNWQLAHVLWRQEHLRSMKVICTVAKKELSATFKRPSNGYEL
                     SFALPRPRPPQKHCGPTARRTAAAASRREVSCPTTPSRCRWSVRTHNLSAWNARTGTD
                     LSGAAVVPSLQAASQPALVSARLARCAPATCNAGHGISSRRERRRVSDFFGYIPLGSF
                     EGPGRLLTIFESAEVSLVKEMPPLHRKQSRRVVCVADTSSDDSSSSAMASEASKFPGP
                     DKFQNAALTRTSENELDANQPGTGTLDSVEETPVYGAPTTDASSDGLSPRTPRKPSGT
                     SSSLDREEGDAGGSELFGTGRLRPTASEQVAEVKSDVSPADADSNHRLASTLQTAQLG
                     SSEAKPPKKRARKGERAKRTLSTKANGDSDDEDRQTGLYGALAADDYLKLFEPCWEPG
                     QPVPYSFLANAFETMAGTSGRIDLTRQLACVLFHVLNRTPVDLLPTIYLVINRLAPAH
                     EGLEIGVGDALLLQALADATGRSLSKLREDYHRTGDLGDVAVHSRTTQRTMFAVPRLT
                     IRNVYNELLAIARASGKAMQEEKRRRIQKLLVAAKNNEAKFIARALQGRLRIRLAEKT
                     VILALAAAFVQNAAASRGTHPDAARVERAAHLLRTSSNECPSWNMITEALLELQDIDE
                     RLLERCHLTPGLPVMPMLAKPSRSIAEVLTRFEGMRFTCEYKYDGERAQIHGLADGSI
                     RIYSRNAEDHTRKYPDVMEQILQAVGSSSDQPSFILDSEVVAFDRDAQRILPFQYIQQ
                     RARKHVSLDDLKTNVLIVAFDILYWRGEPLTRKPLAERRAILRDAFQEVPGGFRFATR
                     RDVSDLDGIQKFMEEAVRDSCEGLMVKALEGPLSTYEPANRTQHWLKLKKDYLRTIGD
                     TLDLVPIGAYYGRGKRTGWFGSFLLACYNPETEQFEAVTRVGTGFSEEQMAQLHSEYA
                     QYVLDSPRPYVACSESVKPDIWLDPRQVWEVQCADLSISPAYVAACGYIAPDKGISVR
                     FPRLLRIRSDKRPEDATTSAQLAEMYRNQFRSTESSSESSSSAAPSDEEPERNADD"
     gene            complement(<647779..>649506)
                     /locus_tag="CYME_CMK236C"
                     /db_xref="GeneID:16994252"
     mRNA            complement(<647779..>649506)
                     /locus_tag="CYME_CMK236C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536568.1"
                     /db_xref="GeneID:16994252"
     CDS             complement(647779..649506)
                     /locus_tag="CYME_CMK236C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536625.1"
                     /db_xref="GeneID:16994252"
                     /translation="MEDDYGSIESAKPQQDASSAQAAIEASGSTRALILAAACLLTFG
                     SYFCYDTPSALVITLREKLQLTGFQYNVLFSIYSWPNVVLVFIGGLVIDTYGSRRASL
                     ALATLVLVGQVVMLIGVLQHRYWLLLSGRFIFGMGGESLGVCQSIIVSRWFAGHELAT
                     AFGLSLTVSRIGSILSFMLLPVVDQVAGIVSAFAVGVIICALSICAALVYASIELSVE
                     HKRAEGAAALQPTKTRTRAPAGERSPRSRRSSLLQVARCLDLSFWLCAGISMVSYALV
                     FSFIAIGSDLLHQAFGTSRERGSLLVSLVYDFSMVLAPLLGRLFDAVGLRGIFVLVSC
                     TLNLLSFALLEHTRTSAWQPVPRPVYGMICMGVAFSGLSSSVWPSMTVISPVWALGAA
                     LGIAQALQNLGTSLMSIYVGHVVDAFGYEAVLSRFVLIACIAVLLALWWNIDDWRYRD
                     GRVNRSAAAAEAAAAAAMELPVAAGTPQGAAVAYVPLYVPVYVMVSPEAIQSVRRACY
                     QKLGESEVGIRRRDLYAQLGIAHPAVVRKAAETGAQLPSPDAYHARVFRPERPTEAAG
                     SASSSQSTN"
     gene            <651784..>653604
                     /locus_tag="CYME_CMK237C"
                     /db_xref="GeneID:16994253"
     mRNA            <651784..>653604
                     /locus_tag="CYME_CMK237C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536569.1"
                     /db_xref="GeneID:16994253"
     CDS             651784..653604
                     /locus_tag="CYME_CMK237C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536626.1"
                     /db_xref="GeneID:16994253"
                     /translation="MMRSRFSRQQKVYLPVIGGMLCLLALAGTSTTAATLCDYCSQIG
                     RACNITLGQCVPCTPTSGCTERQVCNTNTGICAVKDLFHPFLWSDGVLIVLVFLATGL
                     SNAGGIGGGILLVPLLSLFAGFTLKNASANAQPLIFGASIANAMVNVPRRHAARDTPR
                     IDWNLVACTVPFFLMGTTPGTFMNQAFPSYFTAFVLALLLSVLSVQSALFGLRLLRER
                     LQERHKNAADEQTWKAEAAGNAADDTLSSRVSSPSVAETAIPVQSNEVDDCGRDATDA
                     TKPSADRASAERPDSSDPHLNHESRGNGCCSAANASNAVDSSDVHATGSETAASSPSN
                     NVHPLRPGRSRFLCYLDPLLCAQSREELLAAERPWFQWRYMLFLLACWLVLFIIQILS
                     GSAEKHSPVGAPLCGAVYWILFAIQESVLFAMGCFTIWRNLSLNRLRDRLGYPWYSKN
                     GLGDIRWTRALIFGYPVWAFIAGVFGSWVGIGGSSLLIPFLNLVGRADPATVQSSMSL
                     SNLLGSASGAFVYLAQGRLNISYGLFFGLFALLGSYTGVWMVYFLVERYQIRALFVFA
                     LTICFVTALGAILYIAIRNTLGVEAAGVGWVFTNICAYVG"
     misc_feature    complement(655329..656135)
                     /note="possible transcribed region"
     gene            <656636..>657280
                     /locus_tag="CYME_CMK238C"
                     /db_xref="GeneID:16994305"
     mRNA            <656636..>657280
                     /locus_tag="CYME_CMK238C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536570.1"
                     /db_xref="GeneID:16994305"
     CDS             656636..657280
                     /locus_tag="CYME_CMK238C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536627.1"
                     /db_xref="GeneID:16994305"
                     /translation="MNQGGALGGQAGVSRTNPPMNGATSDQSHRQEEKLLHKYGNLPN
                     RRDILQRRLRANHLHERKFYDSADATLAKAGRESVDQVGEFHPYVPPGLTPLTRRGLN
                     GTCSADQNSGGSSADEGSDSVHGRPRPDATASLAGTDEIGSNGDRTRLPSFGAEIQRE
                     GSMASSGSSIGSAAGFVPLRRSAEVQRSELPPVAEPDSVVLGFPERQNEESIGD"
     misc_feature    658127..660320
                     /note="possible transcribed region"
     gene            complement(<658843..>660711)
                     /locus_tag="CYME_CMK240C"
                     /db_xref="GeneID:16994240"
     mRNA            complement(<658843..>660711)
                     /locus_tag="CYME_CMK240C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536571.1"
                     /db_xref="GeneID:16994240"
     CDS             complement(658843..660711)
                     /locus_tag="CYME_CMK240C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536628.1"
                     /db_xref="GeneID:16994240"
                     /translation="MRSDSFGCRCYRFDRRNHRDGLEALGQCLRHCTFLAVDVEFSGT
                     GEDPAVHSADLSVRYEALRRLAGTSAIFSVGIVCFTAKCEELHRAICGLSEVTADREA
                     LQVQVPAVCAYQAHVLEFYFHCQDAFTISGDTAAFLVRHGMDFNRVFAHGIPYRRVAA
                     AEDALHEAARAVPAPGGTTEDAASQSGFGHISVARERGLGAERTPEPKRLRRRTQRHR
                     GCNSTAQPAAEPLHVLSVLLGSGKPVIFHNGLYDLLLMFAAFEAPLPPSVEEFRTQLA
                     TRCPGYFFDTRVLGEFVPARLRDCPAYLEYVFRKYERRWFRTQRGVRIEFPELAAPGY
                     VSKKATIYGSRAAASPAAIPRVCKRYARSGHCRLDGDCRFSHDIDQIIDADEASKTET
                     GDGFDEAVAVEACQPNGGHAVREMESACTLDTSPAAICETLKSQHISLDLSESLGIPV
                     SERPTEQPSSVDAFVTSFSPDESEHLEDRSAGQKPPETYPKRSNDPVSGCRAAATAAC
                     QSSLGNSMFVAGDDNAEAARFASMPPLHADAASGDAQSATLDRAAHSAGYDAFCTGYV
                     FASMLALPSVQLARVSSFANRIYLTGSAPQTLCLTPGSSPVASQLEPVINSGAGDS"
     gene            660785..662415
                     /locus_tag="CYME_CMK241T"
                     /db_xref="GeneID:16994241"
     misc_RNA        660785..662415
                     /locus_tag="CYME_CMK241T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461392.1"
                     /db_xref="GeneID:16994241"
     gene            <663405..>667520
                     /locus_tag="CYME_CMK242C"
                     /db_xref="GeneID:16994254"
     mRNA            <663405..>667520
                     /locus_tag="CYME_CMK242C"
                     /product="unknown RNA-binding protein, conserved"
                     /transcript_id="XM_005536572.1"
                     /db_xref="GeneID:16994254"
     CDS             663405..667520
                     /locus_tag="CYME_CMK242C"
                     /codon_start=1
                     /product="unknown RNA-binding protein, conserved"
                     /protein_id="XP_005536629.1"
                     /db_xref="GeneID:16994254"
                     /translation="MAPTTKRKTKFSLLDLRAEVSVLQERLGSGSRVLNVYNLGRKTY
                     LLKLSVPPLNASGRIPATETEEAWATGDSSWRREYLLIESGVRLHTTRFTRQAAAAGT
                     AAASLVSRQKIGTDETLDNSIATDLAHMDLDERDRELQLVLQRHRALAEHEQRAQSGT
                     GANAELPSGFTLKLRKHLRTRRLAEVTQLGIDRVVDFRFVGGSQSASAYKASANGQPS
                     RAALENHLIVELHSGGNIILTDGDYQILAVLRVFRAEPRPLADSADQRDPPATGPGSR
                     RMQQQDAVVGARYDISLARQFAPLTYDRLHEIFQECYQKRQRSGGDQLRDLQRNLGRA
                     LGWGPELIEHVLLEVGAPSPDPLPEYEQRLYRVLCEAAAFLSESPREGYILLRPVAEG
                     ASQASGADSEDVSDRYCEFTPRLLRQHQHLEPRMFPSFDEAVDEYFARMEELRYRQEI
                     ENRQRQAQGTLERMRRELETRVLTLKQQEERCLRKAALIETNLVDVDNALQVIRAALA
                     SGIDWKELDQMLVLERRRGNPVAQLIHSLQLQENQMTLMLADDSGSVDNTDAETGSSS
                     RQRRPAETRDLSNEDSASSVESASEDESGDSTSVCSSRVELVQVDLSLSAFANARRYY
                     EQRKKAAEKGTKTMEASAQALRAAEKKALEVLAGTASKNKRKKATPLNTLKAIRKPLW
                     FEKFRYFITSENYLVIAGKDSQQNEQLVRRYLEENTGDLYMHADVHGAASVIIKGKKN
                     RPAPPLSIQEAAIFAAACSSAWDAKVAVNAYWVYPEQVSRTAPSGMYLQQGSFVIRGS
                     RNYVPVTTSGSGPLVMGFGFLFRLAPESVWRHIGERPVRSGPDSLQEAQAAGAPQKQQ
                     QQVEGAGERILEIESDTLNATLGEDAHITNVNGASRAGQHSAADTITTEARSPLGHDG
                     GMQATKAAIGVRSHSEANGACVDAGSGLPDVSPDRPQDTHDNVTLPIASDTTTRTDTR
                     NGNSPGTIPGSHARTTLQLPSSSSETDPSNQSVHSTHAPKQVGVAETLTTGIRSDAAA
                     KAPGEISLQRSVQATEARSAAASGAEASRAKPVRGKKSKLRKLRLKYSDQTEEEREAA
                     LRLLGTTRMRIMEARDREGAATEAPASSSVKQAAGVDQGTNTTVQRNVNAEEAPASSS
                     VKQAAGVDQGTIASAQGQTSAQRNGTSAAPATHAQGHASTGSAASELPLETHRAAREE
                     THFQWQKIDQVEVSKILQSASAALAEHLSEAELANLSELDLFTGCPHPDDVLEYALPV
                     CAPYQTLAKYKYKVKLVPGTLKKGKALKQVLGVVQSQERSGARTTNAANAGADASEVA
                     QGAAATARELELIQAVDETVLVQQMLGNVRVLAPGLQESQRKKRTQKKSRG"
     gene            complement(<668088..>669242)
                     /locus_tag="CYME_CMK243C"
                     /db_xref="GeneID:16994255"
     mRNA            complement(<668088..>669242)
                     /locus_tag="CYME_CMK243C"
                     /product="phosphatidylserine decarboxylase"
                     /transcript_id="XM_005536573.1"
                     /db_xref="GeneID:16994255"
     CDS             complement(668088..669242)
                     /locus_tag="CYME_CMK243C"
                     /codon_start=1
                     /product="phosphatidylserine decarboxylase"
                     /protein_id="XP_005536630.1"
                     /db_xref="GeneID:16994255"
                     /translation="MVRQRTLWTIVASGTVTGLLAHQTVSFERSADLYGTPATRQAAP
                     WARTALETLPLRLLSRALGAVSRVYLPKATRRTLLSTYCACLPACQLDDIRDPLETFP
                     TLAAFQQRQLKPSARPIDSKASLVAPCDGRLLSCGQVESGALLQPIKGIRLSMRALLD
                     STDERDPLVRGPIMVEVATTETLGLSRTRGSTELNSKTMSMKSNHTAIQPDTEAKALY
                     YAVFHLPAGGYHRFHSPARWDIELRRHVVGQLLPGTPRILRRLGSLFTVNERVCLVGE
                     WTDGFFGMVAVAAFGNGDIYLHFDEDLVTNCHEYPLNYRRDMTYRWPVRLQPGDEMGG
                     FRQGSCIVLLFEAAAMVRDDSTSGHTGRDVGFLVQPGALVRTGEALFRAP"
     misc_feature    672498..673979
                     /note="possible transcribed region"
     gene            complement(<672941..>675545)
                     /locus_tag="CYME_CMK245C"
                     /db_xref="GeneID:16994299"
     mRNA            complement(join(<672941..673777,675087..>675545))
                     /locus_tag="CYME_CMK245C"
                     /product="ATP phosphoribosyl transferase"
                     /transcript_id="XM_005536574.1"
                     /db_xref="GeneID:16994299"
     CDS             complement(join(672941..673777,675087..675545))
                     /locus_tag="CYME_CMK245C"
                     /codon_start=1
                     /product="ATP phosphoribosyl transferase"
                     /protein_id="XP_005536631.1"
                     /db_xref="GeneID:16994299"
                     /translation="MAFVVQCSRSSIKERQRISTIVTSVRLRGGSCETRRCLRVRRAQ
                     GVRELRSCKVAASANLGNETTSLSADAEARDSIRLAIPSKGEIHQAAVELLNSCGLEV
                     DLRNPRQYVGSIKHFPEVELWLQRPADIVRKVKDGTLDIGVAGYDLVAEYNGTSTDVV
                     IVHDSLGFGICRLGLGVPILWTDIHNIEDFRRFTESRSQPLRIVTKFPNQSEIFLAAH
                     AIRNYRLLYQDGALEAATQLGTADCIIDLISSGVTLRENNLKEIPGGTILQSEMQLIG
                     NRSRLAADQTRYPFAERLRDFVRELIERMDAHFTAQQHYNVIANIRGESAGDVARRLG
                     EFTDLRGLDGPTISTVIPPRGVAHGMYAIGLVVKKTQIYSAMKQLRRVGGSGVCVLPV
                     TFVFEGTTDRWKRLCEELQIPFENDEWKTMPRPFSSDKL"
     gene            676179..678907
                     /locus_tag="CYME_CMK246T"
                     /db_xref="GeneID:16994230"
     misc_RNA        676179..678907
                     /locus_tag="CYME_CMK246T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461393.1"
                     /db_xref="GeneID:16994230"
     gene            <677472..>678560
                     /locus_tag="CYME_CMK247C"
                     /db_xref="GeneID:16994227"
     mRNA            <677472..>678560
                     /locus_tag="CYME_CMK247C"
                     /product="similar to 11-beta-hydroxysteroid dehydrogenase"
                     /transcript_id="XM_005536575.1"
                     /db_xref="GeneID:16994227"
     CDS             677472..678560
                     /locus_tag="CYME_CMK247C"
                     /codon_start=1
                     /product="similar to 11-beta-hydroxysteroid dehydrogenase"
                     /protein_id="XP_005536632.1"
                     /db_xref="GeneID:16994227"
                     /translation="MLGGFGDFFLLVGVTLGSILLNLFFLILSPVIVLYVKYGGVGNR
                     LKRQMPLPRVPRCVFITGASSGVGEALAYEYCKRARKQQVQDLVLYLTGRNATRLDQV
                     CERCRELGASKVHALVVDVADEAAMREAITKADQERPLDLVIANAGVSVTNTGLMEES
                     KSGATGYERSKKLLDVNIYGALYTIWPALDCMIARQRGGQIAINASIASYIAGPLNMS
                     YSASKAAVRFYGESLRTAMAPLGIRVNTILLGFVESRMTEPLKNRHGRLPFAKSAEEA
                     ATSLANQIERDVGVIEYPAWPFGVLGEWLNAAPPLVREWIWSMVMGRMVTRAERKLRK
                     RQAADVNIADSGTSTKYAILTRLVEKLI"
     gene            complement(<679935..>681098)
                     /locus_tag="CYME_CMK248C"
                     /db_xref="GeneID:16994228"
     mRNA            complement(<679935..>681098)
                     /locus_tag="CYME_CMK248C"
                     /product="similar to phosphate/phosphoenolpyruvate
                     translocator protein"
                     /transcript_id="XM_005536576.1"
                     /db_xref="GeneID:16994228"
     CDS             complement(679935..681098)
                     /locus_tag="CYME_CMK248C"
                     /codon_start=1
                     /product="similar to phosphate/phosphoenolpyruvate
                     translocator protein"
                     /protein_id="XP_005536633.1"
                     /db_xref="GeneID:16994228"
                     /translation="MTTPPRREQAVQLLKAVVLAYSFSTSLVIYNKWLFTNCAAEERQ
                     TSRTAGRCLGWGFPYPLVVTCFHMLFLSLATQFYMWCVPSSRPTIDKPYRKPRLLLVG
                     LFVALDIVFTNAGYLFLEASFVEMIKSSMPASVLLFGLAAGLEQRSGVLLAIVVIISV
                     GLAVATVGEMNFHPVGFALELLAVLCGSARLIEQQLLLRYGAEGKLHSAVGLSPIQIL
                     YYQAPISFVTLLPAALAIGTTRMRHDALLKDALYVIETILILIAGGLLAVGLNFGDIL
                     LIDRSSALTSTVLGTVKTAVVIGVSWITFRNRISWLNLSGYAVCVVGVFLYQRYRQQQ
                     PSTSTKFDTASAEADAQSEHTPATGPGVPESTGLAKEVNMRLDVSAMQEDTAV"
     gene            complement(682000..684810)
                     /locus_tag="CYME_CMK249T"
                     /db_xref="GeneID:16994219"
     misc_RNA        complement(682000..684810)
                     /locus_tag="CYME_CMK249T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461394.1"
                     /db_xref="GeneID:16994219"
     gene            682364..684756
                     /locus_tag="CYME_CMK250T"
                     /db_xref="GeneID:16994220"
     misc_RNA        682364..684756
                     /locus_tag="CYME_CMK250T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461395.1"
                     /db_xref="GeneID:16994220"
     gene            <684954..>687095
                     /locus_tag="CYME_CMK251C"
                     /db_xref="GeneID:16994221"
     mRNA            <684954..>687095
                     /locus_tag="CYME_CMK251C"
                     /product="probable DNA repair protein RadA"
                     /transcript_id="XM_005536577.1"
                     /db_xref="GeneID:16994221"
     CDS             684954..687095
                     /locus_tag="CYME_CMK251C"
                     /codon_start=1
                     /product="probable DNA repair protein RadA"
                     /protein_id="XP_005536634.1"
                     /db_xref="GeneID:16994221"
                     /translation="MLRKVREELAYDQALFALQAWQSGSRWWQRASATPFTECSRWPG
                     GGTSHAGQAAVKVRKRQRISVPKWQCAAKRSVEHVCRECGHTEARRYGRCPCCQSWDS
                     MVEQPRRRREAGGLQRPRDDFANQRRHKLWSGDANLWSGDSDQLNDWLQGAGTAPLPL
                     GILRRGLGPGTEHKVAKASALDGSSSGNASGKLPHAASMESNRAQPVEVHRLLTCSAE
                     FNRVTGGGIVPGSLLLIGGEPGNGKSTLLLQIAGDVASSGCRVLYVSAEESVEQVSSR
                     AARLFGLMEPRQEESTERRQSLERNLLIMHEACLEDILDIVEEIQAGRENAPPNSAPR
                     ATTASASTTPTATVPSTGAPSKAVGAGRKDASTVDNTDAQSPLGLLIIDSIQTVYTQE
                     NEQESAAPGSIVQVRHCTNRLLGLAKRQQQRLREPWQRTAIMLIGHVTKSGDLAGPKL
                     LEHMVDVVLYLESEQGLFQHRILRCTKNRFGPTDIGIFDLTSRGLVDVPNPSLLYFQA
                     AESSLMHDSDGAAKAPNNPFHTYARESTDGTAFSMVVDGTRAFLVEIQALVAKTSLTQ
                     PRRTSNGFDLSRLYVILAVLSKRARLRLETHDVYMNVVGGARIQDPAADMAAAVALAS
                     SLLARAPRPDTAFIGELGLQGEVRPVPRLDLRLRDIARLGFRFCVCSDRLSSRQETAA
                     RETGLQVIRCRTISQVLQFGIPEEIAPTEQH"
     gene            <690184..>692010
                     /locus_tag="CYME_CMK252C"
                     /db_xref="GeneID:16994222"
     mRNA            <690184..>692010
                     /locus_tag="CYME_CMK252C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536578.1"
                     /db_xref="GeneID:16994222"
     CDS             690184..692010
                     /locus_tag="CYME_CMK252C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536635.1"
                     /db_xref="GeneID:16994222"
                     /translation="MLATGNASKQEKRPPSGSAFERGRRKRSTTYTSRTKLRKPESPT
                     DEFGTAEPGSWASLVKSRPGSVALWLKYAASETQKRGPEAGREVLEQALQSRDLYRQE
                     ALWRALATKYQTCYEAALKKIRQAIQLLPRSASLWELYTELRYFPSEVLVRCPLDECS
                     DADDRTQVPLFVHFEQEWLTALQETHASLEEKEHVYLIWAATLRRLQNTQASSCSRAE
                     NLETAARDFPEKNIDAVARASSGETIAHAVLLRGARCLRSARLWKYFLESAVSLSGND
                     DLALLEEAMCSVPPLRNDSWFCDVLRARRERWALERDTRTLASHVERFPTDPEAWLMF
                     AEHYRSVYADETQAEAILLTFLQYGFSQAPGDSVARFIATLLDQSWSRTRSLARVRAF
                     QESALACASDRAARDAIFRESLRFERYKAVCLERCRELFRRWLAEAPHLASVWASWAQ
                     LEREVAKVPANAVLVLQVAVDLFHEAFELHPSGDAMCRQRQMLQILALWRSLIDSRLA
                     ECSDPQQQQDALRSAYRVLLNRYSNSLAVVCSYAALEAFTGEGGLDSALEFLRQRRLE
                     EHWPPEDQLRLTEFVAALRRTHAAVSRRIRARLWQDIRDPSD"
     gene            <694506..>695258
                     /locus_tag="CYME_CMK253C"
                     /db_xref="GeneID:16994223"
     mRNA            <694506..>695258
                     /locus_tag="CYME_CMK253C"
                     /product="probable ubiquitin conjugating enzyme E2"
                     /transcript_id="XM_005536579.1"
                     /db_xref="GeneID:16994223"
     CDS             694506..695258
                     /locus_tag="CYME_CMK253C"
                     /codon_start=1
                     /product="probable ubiquitin conjugating enzyme E2"
                     /protein_id="XP_005536636.1"
                     /db_xref="GeneID:16994223"
                     /translation="MAGGRSKNAGRRLRMGIHLPSKVVVHLMFHGHVQFPSVLQTGAA
                     SRHLPHAGKHSLRCDAPAAQRRRIFQSRRDLALESARSVRNGVFRFGAGAEAVVMSTP
                     ARRRLIRDFKKLQQDPPAGISAAPSEADVLKWTGVIFGPEDSVFEGGVFKLTLTFSEE
                     YPNKPPVVKFITKVFHPNFYYGDGGVCLDLLQNSWSPIYDVAAVLTSIQSLLCDPNPN
                     SPANAEAARLYLEDRREYNKRVLQCVEESWLT"
     gene            complement(<695891..>696937)
                     /locus_tag="CYME_CMK254C"
                     /db_xref="GeneID:16994218"
     mRNA            complement(<695891..>696937)
                     /locus_tag="CYME_CMK254C"
                     /product="probable tRNA splicing endonuclease subunit
                     Sen54"
                     /transcript_id="XM_005536580.1"
                     /db_xref="GeneID:16994218"
     CDS             complement(695891..696937)
                     /locus_tag="CYME_CMK254C"
                     /codon_start=1
                     /product="probable tRNA splicing endonuclease subunit
                     Sen54"
                     /protein_id="XP_005536637.1"
                     /db_xref="GeneID:16994218"
                     /translation="MRNQRGGAEDTAVLWWQFKRGLPRRGVKDEAQAPINTAELSSSQ
                     RKRLNRRRYEIFRFAGAPKTVSTKHLAVLEWSPAHHMALVRQPRGKIFQSLGIVRGPE
                     HWLYPEEAVFLVDRSSADLLVDGIATSVERCFALLLYERIPLEHYYAYAYLRRLGYHV
                     RRSLSDTRAAAIVGAPFASAFQGDRVPFHYDVWPPGNFKRSMPGVPLFRAVVLPFSAP
                     VWTAAQMRHLAEAAEPSSARIIVVERSIVAFFEVRAQGPLAKPANPADLWMAERALAL
                     QSLTNGPEADASVALGAFAAEDDDDDDDDDADAMSAQSSDWNASISGSDAEECSGVSS
                     HSASSSSSNDEQGL"
     gene            <697936..>698523
                     /locus_tag="CYME_CMK255C"
                     /db_xref="GeneID:16994257"
     mRNA            <697936..>698523
                     /locus_tag="CYME_CMK255C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536581.1"
                     /db_xref="GeneID:16994257"
     CDS             697936..698523
                     /locus_tag="CYME_CMK255C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536638.1"
                     /db_xref="GeneID:16994257"
                     /translation="MMHDADRGTAGGFSWESSVAVNGMYLATMKALTHHRVSLGGGGV
                     GAVDRRKSFGRSQLDRCKMLTAAVNKEDEHGNRTGDRNFPKRMKCINSSRKQRNRDLH
                     APVKKLRSLTSAQDEKQKRAWVKPEIRERRGNSRITSPPRQMLTPAGGASNLILSACV
                     SGRIPFDADLVIVPACSTMLGFAYALVRMRALFEV"
     gene            complement(<698853..>700400)
                     /locus_tag="CYME_CMK256C"
                     /db_xref="GeneID:16994247"
     mRNA            complement(<698853..>700400)
                     /locus_tag="CYME_CMK256C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536582.1"
                     /db_xref="GeneID:16994247"
     CDS             complement(698853..700400)
                     /locus_tag="CYME_CMK256C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536639.1"
                     /db_xref="GeneID:16994247"
                     /translation="MSAYLGSDVLSVSVSEDGSSGRALLWNTRERVVRRELQLTRPTG
                     AQRLGIGRAAAPEVSGSLRAQTFCPVLASPATWDRYVFGVNTGLHKSCIKFFTLERDS
                     EVAQVTLGENLTALACSHGGHFLAAGTAQGLGYLWDLHTGVLLAPSAGSGPSSAAANT
                     ETGHQSAAAWELQLLAVTTLVFTLDDAFLVTGGEDGSITVWATSELFAGQTHQPWRRF
                     PAVHAGAVVALHLGAAWQLHTARIYSLGRDRTLRILDFPTGMQLANIHLSMQGTSLVV
                     DDVFERAAYVGHITGDVLRICLPSLSLDSTRTLLIKKPLVNLESDGHSATTSTSWLRG
                     FTERDVPEKRAIRTLALVEDGSILAYGNENGSVGLIHLNSNAVVAEFRGQKAHRSETV
                     YLVTRIPPSDGAVPRWLWQRDVYVNEKKRQWSTGGTRHAPRVAPRFSLESKPYGESFE
                     LVDSLATRSTAVAAAAAGAANATNSGETADAAIVPARKHERDRFVAWTSVCMDRLLAQ
                     LDQREDT"
     misc_feature    702030..703766
                     /note="repetitive element"
     gene            <704054..>707293
                     /locus_tag="CYME_CMK258C"
                     /db_xref="GeneID:16994233"
     mRNA            <704054..>707293
                     /locus_tag="CYME_CMK258C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536583.1"
                     /db_xref="GeneID:16994233"
     CDS             704054..707293
                     /locus_tag="CYME_CMK258C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536640.1"
                     /db_xref="GeneID:16994233"
                     /translation="MAGRAGSNSRSNFNGEPAERSRRTSARGYRTTLDYGGGDWTAPG
                     HAPDRDTSQSQEPSVEQVSEHEVHADVMASSTASEGSCSAEQREFLTVESYRQQKNGE
                     QKPASDSGWNRNDETTERASRDTQSGDASGMSVTAGGAVASVSSSRSSTEASTPRWLH
                     LSRPPSSAGKSSAEFSEPSGAARERALRRRREWKRLAWRREAMEMNLLEEQFNRYCER
                     ILSARGFSRSERGAASMLPESIALAELAKRYQRRASTGQRLQGLSPAEIRERRNAQKR
                     ESKQRIQRYREERASLLRRFISAFKMELGELDDDNDNDNDEMPTETGEHGRSADSAYG
                     VHRGDLSIASTQERPFSEYAIADAMRSNANHVRQKTRLQAGSRSTAEALQDMSSFIAE
                     YRKDALEDMLFGSRPRSDAANMAIAELDGNLMLNQQLIGDDDTGQQLREANQIVSELL
                     AEMDANGPLVSAWDLSLLKTSGMNTIMVQSPSMGRLLVGIQVFQGLFTSERAARVLGI
                     SATVARNALERLHNNGLLLAIPRTAQLSNEYAYLVPEHVRRIPPHVILQLATERPTHK
                     MVTLVDLDSHSVASESMMIEAKQILYRVEHNFVQELRERLSRLQLESRSDQPDVWDRI
                     RIYFDELKDDFFYAIEVARNHYGIVGVSDFVASFSYPIRYLLKAEARTGIFRDIYERF
                     EPALRSYLTSLNRLGHNLSLWTRDVGTSAGDVVALQRQVEHGPSVADWHRLYPTCLGN
                     EHASDDALSSALLLGGTVTSAAMPSPLAEDAPCDSLTLSFPDEIEHAILSGLCLSRAC
                     IDSLDYEEAERILEQLLEVCTRHSPIIIPKSQSASSSAPSSTAVAPLGPRSFFPHQEV
                     HLLMHPTIHVAILENLGRSHALRGRTKAACRCLAQTLALRRQLGQEQSIPYALTLISF
                     GDSLIREHQLETARTVFEEALSIFDRFVHRYAERFELSSRAEALYYLALLHFVAGDER
                     KAIELLNVALEVLDARHSSNFICCSPRTVLTLETMIYKLLAQIYIAAGRRDRALVLLQ
                     NALNLIASTYARGIETGIHGGSQSQDERATRDLVDVLSQLSVDAESNAR"
     gene            complement(<707542..>708786)
                     /locus_tag="CYME_CMK259C"
                     /db_xref="GeneID:16994234"
     mRNA            complement(<707542..>708786)
                     /locus_tag="CYME_CMK259C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536584.1"
                     /db_xref="GeneID:16994234"
     CDS             complement(707542..708786)
                     /locus_tag="CYME_CMK259C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536641.1"
                     /db_xref="GeneID:16994234"
                     /translation="MQSNEGFPRIRHLFARVATPRRPRRALVLVRGPDTTPFLHGLCT
                     AHLTRYANEQGPVCTSTCFLDRRGRMLFEALVWIHGPERVYLDIDGRVVGLALRHLTL
                     HRMRARVAWEHLPATLYVEAFAHQGSGSNTDTRSGTVKQVETRVSAAGHEEMHAIDPR
                     SPVLGMRRWQCLTSSTPACTTMPGTGQHKRCYHSYWLAEAHRVLHAIPQGIQDVVPGQ
                     SLPLECNFEQLGAIAFDKGCYLGQELTARTHYTGVIRKRTVAGILSPDATDALQRAEA
                     AAAFLQRPPDATLPPELALLFPSEVLAWPGPALKQQLLRVESDTVERPQLEPVASAAT
                     QKRSVATLGTIIANLATALVPLADTDLHAAVPGTQRLLRVSGRSPASIANWYFAWWIP
                     PYLQAIASSTSVSPVSSATQES"
     gene            complement(<712641..>714658)
                     /locus_tag="CYME_CMK260C"
                     /db_xref="GeneID:16994229"
     mRNA            complement(join(<712641..713500,713872..>714658))
                     /locus_tag="CYME_CMK260C"
                     /product="probable mitochondrial processing peptidase
                     alpha subunit"
                     /transcript_id="XM_005536585.1"
                     /db_xref="GeneID:16994229"
     CDS             complement(join(712641..713500,713872..714658))
                     /locus_tag="CYME_CMK260C"
                     /codon_start=1
                     /product="probable mitochondrial processing peptidase
                     alpha subunit"
                     /protein_id="XP_005536642.1"
                     /db_xref="GeneID:16994229"
                     /translation="MLSFASRGIAEAAWPSGRLRNSIAASLRGARFSTLKATSPSSES
                     GAESGRPPWVWRKLQGWFGFEVPLSSPLAGVPAPEAATATPRPSGCRVSFLDNGVRVV
                     TPVNASPKAHSANDLVTSFGVYFNAGSRYEDLFTAGSTHALETLAFRSATLERSRFRL
                     AQDIERTGGSVGCAAARESIAFTGECLRDAAPELINLVCEAAVRPQLMAYGEVSAALD
                     DGIRAELQDALKVIEYEQEHAMGKDTQLQLVEALHATAYQGNTLGLPLFMNEKRRKKL
                     TPEVVKRFLSERLQNPGNIVVAAVGIGHEQLLRVAERALGWLPRPPADKAVVDMASHY
                     TGGEARLDGDGLAQIAVACEAVSWSDPDLIPVAVLNTLLGGGGSFSAGGPGKGMYSRL
                     YTGILNRHPWVQSCTGFNHCYTDSGLFGIHASAESGRLPELAEIICEEIAKMGQVTRA
                     ELVRAKNQTKASVFMNLESNTVVCEDLGRQILTAGQYIEPATLYAAIEKVTEKDIFRV
                     ATRMLRSRPTVVLYGEMYGVPTYEQISEAAGMKALQSGAA"
     misc_feature    713985..714560
                     /note="possible transcribed region"
     gene            complement(<717001..>717471)
                     /locus_tag="CYME_CMK262C"
                     /db_xref="GeneID:16994226"
     mRNA            complement(<717001..>717471)
                     /locus_tag="CYME_CMK262C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536586.1"
                     /db_xref="GeneID:16994226"
     CDS             complement(717001..717471)
                     /locus_tag="CYME_CMK262C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536643.1"
                     /db_xref="GeneID:16994226"
                     /translation="MFVSHGAIVKSAPKHWNGSKCPIRMQVRVPDPDRRSLLRAGAHI
                     ILGGLLATVIPGTSPSIAKIREKPTDKGEEAPKIDDEKELDKYVSGLKYEEELYENPD
                     PAEKEVYRTPRVEREPEYKKKEDEILEKESKVLKEEAREAARESEVLRQEFEKR"
     gene            <718434..>719225
                     /locus_tag="CYME_CMK263C"
                     /db_xref="GeneID:16994272"
     mRNA            <718434..>719225
                     /locus_tag="CYME_CMK263C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536587.1"
                     /db_xref="GeneID:16994272"
     CDS             718434..719225
                     /locus_tag="CYME_CMK263C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536644.1"
                     /db_xref="GeneID:16994272"
                     /translation="MAFVNVANTRINRLDSLGYRHRSWSHAFPQRRAWSRASTRRAQC
                     EASLVALKPYTSYHLARWLAKEWDNYDQHLANPPFWAHIRVSYRPLPWEFLEGHAFYV
                     ESIYTYAPKLPYRATIIKITRNSDGALETESYKVEGVEQFYTAAFDRSKLAELVRQAH
                     PRHTNRCVKLPEACNAVFEWVEAEQLYRCKTRPGCKCMVRRGDRDSYLDAQMTLSESR
                     CTALDIGRCPQTHEQLWGAVAGPFDFVVRKSWSDEVPLPPAAMDW"
     gene            complement(718727..720721)
                     /locus_tag="CYME_CMK264T"
                     /db_xref="GeneID:16994269"
     misc_RNA        complement(718727..720721)
                     /locus_tag="CYME_CMK264T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461396.1"
                     /db_xref="GeneID:16994269"
     gene            <721169..>729880
                     /locus_tag="CYME_CMK265C"
                     /db_xref="GeneID:16994270"
     mRNA            <721169..>729880
                     /locus_tag="CYME_CMK265C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536588.1"
                     /db_xref="GeneID:16994270"
     CDS             721169..729880
                     /locus_tag="CYME_CMK265C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536645.1"
                     /db_xref="GeneID:16994270"
                     /translation="MQQSVLEAFHETLESGADRERIPRQTSVEELALLDELDRLARLR
                     SSTPPCEDDQGGSSLRRPADWPDGQLRERSPSQHASLDPRSERSTDHGHSQRLATEPL
                     FENDAHVRFVRDGRAHRSRRMRFIGSCGSRGHLPLTRSTSTLTDLGRQYAIEEITSVS
                     AQQNAGFNASPRIQQPAVATPRRRGYLRSFAATTSSGELEQRQQPTPDVLNTAIIGRV
                     ATTVAADWTDDFCFPDRIPQEQVMDQRPQLPDHATMGLHPLFRVPSAPTLTSSASGGI
                     TRGSGVHQSSPSASLRSTFRNQRKPDVTVNGSEAPASNEKLVSGSVPLAMRAHAAGQV
                     QPSPTVGVAGSAAGGERSPATGRNRSNMNTPETLVAASLSPRTRMIMRTGRLADNLWL
                     GARAPAPKVARELSAVFDGQRQGRQSAFPPAHRSRSPERKSPASGAGFRVEPASAPPA
                     LRGTVPLSPLPSGPAKQPSPTPSLASTQSTSTEDSESASDSDWDAELGHQYQTSTAGE
                     AGALSDFIPATYTFDGSAGAPSTFEDGVIPAFFRIVDRARALYRGRVIMRYPRPSSLV
                     FLRLPETRASQLAEKELELWLIGLVTSSLGSPFEHPLIPPPVRQWVQSPANLQKLSGL
                     GEHSNGKLLRACSDLHSYMPWVPLVALSITQVSECVRSCRARRRAKLAFANLQRCLLL
                     VDALGMQPDWLPVLEPWLASYLFPTLGTLLFRVYTQARIDRGGIPHLVTLLDRTLSSL
                     SSQASASVRWQARLIIAELLLQFGPDLDAPLKKTFWERVCRDALHCLGHYADVLTAEL
                     ESTTADLAPEAEDASSLSAQQQSMDLVAPDGHGVQAASFGSIQVIARAACLLYWLLQG
                     VSPFNLEPLDYDTAALYDAWATTFWQLPQELRPYLHSPDALCEFLIQKCCPLLPRHCE
                     SRYRCSTVLGHRASLTGHYGEAESHFFEALVVMHGCPPLVDASPCVSEFAQSVLERYA
                     ECLRQGAKYRYAVAALTAAADAFLERTGQSPNLLLQRISELALSEQDYVRAIQANIAL
                     LRAVSLEGQLLQAIHVTLRLGYVLVEAGWFIRAEQLLTAVWHALEDAAASIASATQGT
                     SSEPLLTSLTREETRMNLSRSTTETPSRTNSERSDWLPWDPAERRVPSPSARTERRTI
                     ESHLSDILLLLADVRIRAGRLASAFQPLMQLQQLLPPARQAIIHRKLADIWLRLGNPV
                     ACRQAYLRYLAMSCAGTSTSTSKGAAVATSAASAGAPAPCQVLMSTAQAPQETSNYTP
                     KDVASATESRANARDSLHMQSIEVERLPGHDTFPAAAAAAASTAACIDNLDRARMFQL
                     VRGRAPPEATILALLYEEQFLDALAEIDCAMEMTSFRRLRNLARLMHLRGQVLREMAY
                     HLDSGSVLQAALPASVTIEVLPQLRLSRLRLVPPLKLVQQLPDAMQRTWKRWLAESIR
                     WASPEPPSPVDVIKAARLSFAAAAYLYSVMADEIYAALSTVAALRMGIEWALRRFVRA
                     EPDSTAPAATYQEGGALTKAPANDNDNDDAEQCEERLLEAASIFMETNMVQASMEVSI
                     TMAQLMILRQQPEAGVAFLREAWATFSSLYVDARNGRFAFTRLASPLLLRELRQLLSR
                     MVLVLYCLPSAVVLELHAMLDIHNQLSLETVLAEARSATRTGLRSMPPVLGQSSALAR
                     YRSSTDASVERSTNATNGPGESAAKASASRHCSEAPKTTPASSSSSSSSVTATRPRRT
                     APPRARIANGLGSSAPNWTASELPDVASSKHPWKRIGALWRQTKRVLGRGMPRSSRPE
                     RQPEPAVALGTNDAVSRQPSTYSPVLQRQQALHPQRPTDHGQQTPFSRSIRASKSKQT
                     AAAPGARGEAAPSTPVSLASSALQRTASQRAPRVQVSDDRAPPLQQRSRVKTPTTPAQ
                     VAVATEVMGASAKRKSPWHQILRQQRDIPQGKRDDAMLSSRSLSSGNKAAGTRAASSE
                     TRDMLSSSSSSSSTPARLVHQTTAAQARQHCTSTSTRSTLAGAQRAGTSTAGRLLLAT
                     ASSSHAGSVPGIQHAAVSEATELGPLFSQACNQIVRDVLDDTKRSETAQLYALLQQLD
                     WYEAHSPTMLNALFGSDDPVQVAWAMQQRFEMQTERYRRGEVSTAELALANEESLEIW
                     LHEMGKLSEVHPAAAAQSISPTALDNVVARQVDKAHRHVNAANAPVATTNTTSARTSC
                     TASASASAMPHDQHDGERSAGANVHLASTHGTAAFSAAAAAAATSAAAPSPSSLPALT
                     STAPDLLFICNVGGLVCVYNLQNGFRYLFTWEPCQFRDAASDTCLNGWFLLPHSAARD
                     ELSAGHALPPSPPVDALCPLQTLHAASALFVPITTMEASPWVVCPKNPQPIPCSTADH
                     QRREHSATVASLLGIRREHWLRSASAQDLSNTSTPSSGLGLLVCDLTLSLVPWELLLE
                     TPLMRAFSLRDHCDRCTCLDHDAADIAQLVVFQSPLPGPMLATHRTEEAVGDRLVFAP
                     DDVDVDDKTLETPRISATATASTCSLRARSVVAAHQAALTGDTEMRPERDVASTSDHK
                     CSGPNRGICSGWCWSADTNWETTGSGNLICAAPATPALDAKDPTWLPYQLSDGAEHPE
                     PLLCIDGVSLASVTSRSSIHDARATTTTTTAAAAAAAAANRGVALEPLVQVLPLTARE
                     AALRTDDHERPGLGIQARSSAGASQEAHLDQLTSVLAAGNAAATCAPPAPETSSCLVT
                     GTQQQLPHVTPSASMLPQFSGQSPACLSAAPTAGTTGKHRLLQQTTGASDAPFGDERA
                     RPGTPLTCSGDTAPRSSSFGTPMATTTTMSSSLPHGSNRSTASDLIAALGVFPFHELA
                     YPGRVLREIRAVCPSSITAFVPLPYLPLFERAVLQVLHIHEGNRRVRSVQQLVETLLR
                     TFLEQQIPVAFVHGHFD"
     misc_feature    complement(726453..730439)
                     /note="possible transcribed region"
     gene            complement(<730419..>731204)
                     /locus_tag="CYME_CMK267C"
                     /db_xref="GeneID:16994265"
     mRNA            complement(<730419..>731204)
                     /locus_tag="CYME_CMK267C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536589.1"
                     /db_xref="GeneID:16994265"
     CDS             complement(730419..731204)
                     /locus_tag="CYME_CMK267C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536646.1"
                     /db_xref="GeneID:16994265"
                     /translation="MGGTWRTLLPSAWSLGRAGSPLLSLQLLQQQTCRKGVPGTLPTA
                     AGLLPLVVAGRLRAPVDVRRFRACGEQRAPAGQRIAFDTLKLVRVFEASEFTPKQAEA
                     LSSALSQIIADALAYNTEVVATKAEFSALKSEMQILEKADFAVLRSDLQLVEKKVETF
                     MAQIYTELERIENRVIKWVIGAAGTAVMLILGIMRALGGGGGGGGGGGLNGSTKSSLS
                     LSTERGLLVHQAGPVVPGSASAAIPAERPPSSQATSVLNSKSE"
     gene            complement(<732992..>734974)
                     /locus_tag="CYME_CMK268C"
                     /db_xref="GeneID:16994266"
     mRNA            complement(<732992..>734974)
                     /locus_tag="CYME_CMK268C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536590.1"
                     /db_xref="GeneID:16994266"
     CDS             complement(732992..734974)
                     /locus_tag="CYME_CMK268C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536647.1"
                     /db_xref="GeneID:16994266"
                     /translation="MSPHRTLEGHRRGASLGTGWLVPVQRQSRRVVSVKPLEHAPRRF
                     VNLTYPPQKRVAKRRARPAAGNLLRAQTGAHVDGKAVAPEGTVALCLSNGHGEDLVAA
                     QVLRALYHHTSSWLHVDVLPLVGIGSAYMRLAQELALELHQEPATSNASAMPNRVPSL
                     CLLQPRATLPSGGFIYARPWALLRDIAAGLFRIVIGQWRRSRYWLHEKSTQVPAYMLR
                     SVRFVVLAVGDVWPLFLAVQSGVQHGVFIGTAKSDLYLQSPAGEWLFMQPYPHRWTSD
                     RWVYGLNTSEASRFCLGAAARAPGWHARLQGCWRFLRLLLLDVQYAVFMYRRYRIWRA
                     PFFWRLARLFEALLTGSSVYLPWERWLMRRLGTAGVYVRDQLTARNLSRLDVPRVAPY
                     ALNPMLDDLTETADIESHRVHDAEPFLVVAVLPGSRAPEAYRNWERMLSELEQALTNA
                     DDIRLSLEVPVASTLDCACLGGLAQKLGWHPTNHSTEDASRDSADVTQESTGEMLYAS
                     GGHRLRFWSSQSSSESSLVTGNPLKLCLQRADLVFACAGTATEQAVGLGKPVITSPGR
                     GPQFTRGFWEAQGRLLGPSVILADPQREHGDAVSKAVLRVCSALRDTAQRASICAFLR
                     EQAALVMGQAGAADYIAQSILQQLDKNQEDYVVGLA"
     gene            complement(<737127..>738755)
                     /locus_tag="CYME_CMK269C"
                     /db_xref="GeneID:16994264"
     mRNA            complement(<737127..>738755)
                     /locus_tag="CYME_CMK269C"
                     /product="fusion protein of 3-dehydroquinate dehydratase
                     and shikimate 5-dehydrogenase"
                     /transcript_id="XM_005536591.1"
                     /db_xref="GeneID:16994264"
     CDS             complement(737127..738755)
                     /locus_tag="CYME_CMK269C"
                     /codon_start=1
                     /product="fusion protein of 3-dehydroquinate dehydratase
                     and shikimate 5-dehydrogenase"
                     /protein_id="XP_005536648.1"
                     /db_xref="GeneID:16994264"
                     /translation="MPVSGAGIRCLICTSITANSAEEAIADMYEARRAGADLVEFRAD
                     YLAEGESWERVVDQRPLPMVFTYRPVCEGGLSDMNDHERVRLLQRAVQHGVEYVDVEL
                     ANMDLFRMPESVQLQDASTRPRLIVSYHSFTRPLTEAELAEIYTAIVATGADICKIAM
                     MCHDLCDNARLFALLKRTAGSKPTIAIGMGEYGQISRVLAAKFGPAMLTFTTLSEARA
                     SAPGQFRIEELIDHYRFHSLNPDTTVYGVIGAPVRHSMSPRIHNHAFGLCRLNHVYLP
                     FLVQDGSKLQKFLDTMTQFGLRGASVTIPHKQRIMECLDELDDVAKQIGAVNTIVVDP
                     LTGRRKGYNTDWQAAVDAVSETLMPGIEQGQARLTALQRRHVVLLGAGGAARAIAFGV
                     VHCGCGKLTIVNRTLERARSLANDLSPFGKTELVALSLEDFCQQQRNPATRERIDILM
                     NSTSIGMHPDVNVVPVPEEILEPHCLVFDAVYNPIETRLLSLAKRRGCLTVDGVEMFV
                     RQAAAQFTIWTGLRAPAQEMRNIVLQELGQLARR"
     gene            738892..741087
                     /locus_tag="CYME_CMK270T"
                     /db_xref="GeneID:16994262"
     misc_RNA        738892..741087
                     /locus_tag="CYME_CMK270T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461397.1"
                     /db_xref="GeneID:16994262"
     gene            complement(<741614..>744562)
                     /locus_tag="CYME_CMK271C"
                     /db_xref="GeneID:16994263"
     mRNA            complement(<741614..>744562)
                     /locus_tag="CYME_CMK271C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536592.1"
                     /db_xref="GeneID:16994263"
     CDS             complement(741614..744562)
                     /locus_tag="CYME_CMK271C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536649.1"
                     /db_xref="GeneID:16994263"
                     /translation="MGNALNTQAEALADGNEFPESKQVPPNLLLSPSWRSKDQDAASA
                     IAASAADANVSGTGAASGSVHPESVAQSLRLLGAHYWHRQVAHATAHWSSDSRAQSTV
                     PTSAAGGAGVTPTNQQGISVPPIGDRLWLRALIFLEREVVNPGTVHTRAANALPRDPG
                     TPSAARAALDDQQESLLGLVMQRLVTSLHAFESLAPVVLLATLGALDQLKAVYALQDP
                     GDQQPRIANTGDWHAAVHGAFWFLCNFLRPAVRRSWAQRGESLLPDQTALEHCQYIML
                     ILSVEYLMLSADRDQETFFWSSCLLLHLLDWMDTTKTYALIRRLDARIHRCIELLLGC
                     LVRDTLSRIRKMAGLGSGTIHDATTLESVLLQMATRGQGLNFLELDGKHFAERSTEEA
                     LATQSARPAALHAAVAKRSNWSWFQFWPFVSEHANAERVLADAAEADQLAEPSQEPVV
                     SMQQQQQQQQQQSPSRMHSRAAEAIAPAGTLHMHRSSALPEDPIARKTVVCMGLLLTL
                     LSLVTDDPDELAQPLFPNQRAGQPFRQALAGVLARTSCETLPAVVDANSEHQRTTITT
                     TAAAGAAADFGNDAVQTGLHSVQPLTLSNLHDVCVWWLHYPEGSYLFYFLTYDSAEHW
                     RRYLAVRTDPEIFLLTLLRLLYVESSVDVTELRLATLLLLTEDEGWSRALASHVLEQP
                     VTWYRETSLDADRCTLVDIVIGVLVRCIRRQPLKSPCIRMALAMLVGIAPGAVTAAAV
                     AAREGPLPSHLASRLWQLFAHFWRRLKRSSEQNPQTDDEYLLSYLGTTIELLFAVWVA
                     ADFEPRRCGTLGDTLINAAAELRHAILRTGRAHTPVDRFFAGLMRLLHIQEAEYITVD
                     GVQHPYPGRHTATDGLADDRDALRIPAAGSLPQRPTVGQQGVFRDPPDASSVREVFSE
                     WARQWRYQQSFKIKRLVYRFVERPDGCSARIRTRVWNLVAQRTGWPLGESAARASVDE
                     KANVCPRGQD"
     gene            <745217..>750160
                     /locus_tag="CYME_CMK272C"
                     /db_xref="GeneID:16994261"
     mRNA            <745217..>750160
                     /locus_tag="CYME_CMK272C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536593.1"
                     /db_xref="GeneID:16994261"
     CDS             745217..750160
                     /locus_tag="CYME_CMK272C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536650.1"
                     /db_xref="GeneID:16994261"
                     /translation="MSTDVLVTADTTLADLAWPIVSAAIRSATFIAFSLRTTVSVQDC
                     ERQLGSLATDTLTLDAVPDSSEPKHAGESFSPADECHIAASGAGHHQSLQRRYAVYRE
                     WITRQSVIELGMTTFRRRPMDRPWVSKARGKLSGEREPSVASGPGAEQSTKSSETAAF
                     DVQTFRFIFLLDNKGTGSVIPCFLVTPTALRQLSGRQYKEYSGQLEVDAGAVVGSPLY
                     SDTSDDDDNDEDDFDDVDVDDDVAHACTTVTAALSKSEPYESATQQRVPEIAASTESL
                     GWDRTAENVLGLALRQGIRYLPPRSQVTMETTPNSLPQPAVPLCSAASFETNAQRECP
                     SLNSVDVAGGTLQGLATSTAHAASLKTAGLGARSREWASLPPSTAKGEGAQLFRMLAE
                     SGVPLVFFDGLFEIMSMYEAFYAPLPPDLDAFIATLGIVTPRVVDVRCMTALMNLHGS
                     RKTRAPCRANANDLRPGEALLALMVRVALQSASVKHRHLLESIRGGRCFVNHPHAQAL
                     RRQAQAFAQQHNNTSARQRDGTGSDASLDNAGKQVGIILDGQQPPNESADSGAAGLAT
                     WDLEQMLTENSEPANAGEYASMLLVPLARAQTNALERYGQSSSDGTAAGSWPAPGVPA
                     DALADCTPLNEADACELIAALEDQELPDDALADFDMPPQNVSGNTRGAALRAFHVGAV
                     LAYLLERHGWSAIMDRFRGCISSGYGDDAIRLREPGSDANAAMYTGSTGSGPDVIQGK
                     LTFPVTSAASWRSRVGGFVSASDSKRITSPESQADADRVPAEARDWDQRHQARSTLHQ
                     GQHAEASPPANAFLSETPTIRTTVSAAAVAAPTPTLHQQSKAASLTPSSTVGHALADE
                     WISRLVSLLAPNRLTEMLYERTLMAASSIAQRALGAHSFAVGSYAEKTYLWESGLDVG
                     VFIAGATNNNNKCTHTQGHVSGVTGSPRRAATPNPNDDVHDDASCISDAWPTRLAAAL
                     CARATLLAFRRSTAVPASIADHSSESCMPANAHPQLLSSSQSMESPVHAWMRDADTHS
                     QAAWHAAARQRSRRRRRRRRQQQQQQQQQEQEHVVAAAISGAVTTGDLGTVEARSGPA
                     TVDSDASSSSCSGGERATTWRTQGNDGTFQGVSAGNAQCATSLHSPCMEQLDSICVER
                     TLTDDDNAGDGAVVVRCRTNGLTTQFLLNPAVALCRSCFLVECDELIGRRHLLIRCLI
                     LLKVWWRHSLATAQARALLSPLSGSLVSPFLALLLLSYLNCRGLPGDEPAHVLQGLFS
                     FYGFDMDWSRCGMSIYGPFDIQSGALMTHLTTRQPLIPDAMLRAHQLEYATCRLRYRG
                     SGEGSARDLGDTDAGTRTGYCDENDDNEGAGELRARTGRQRAHLGHFPLNVLDALDPG
                     WNIGLQMAPSPSLAFALVGAFRATAQKLGEFRDRPSRMHLDFIWGIDGALKPIWSLIH
                     EHCGSDAVLLLQRAFDDTPAEYASGERAADGLDQLSSGVVPAMPSTTVLRFWELRHLC
                     GLALAPEAVSTSPCSDKRTGLRQVHTYASSATREELGALPDIGELKQILAYVRFLILF
                     DTSEAGILAFLLQTLRRKRSLLVGELGQLLRSRMNKSAWQTLFKTRHGGLKRFLERYP
                     DLFQIENDHPLNPHVSLRIRDLGQNMHRRHRGEATAT"
     gene            <752280..>752720
                     /locus_tag="CYME_CMK273C"
                     /db_xref="GeneID:16994259"
     mRNA            <752280..>752720
                     /locus_tag="CYME_CMK273C"
                     /product="60S ribosomal protein L23A"
                     /transcript_id="XM_005536594.1"
                     /db_xref="GeneID:16994259"
     CDS             752280..752720
                     /locus_tag="CYME_CMK273C"
                     /codon_start=1
                     /product="60S ribosomal protein L23A"
                     /protein_id="XP_005536651.1"
                     /db_xref="GeneID:16994259"
                     /translation="MPRIRKGLAKTKAVAKVVRSGSTPKILAKAHEKVRFRKPKTRKL
                     ARAPKYPRKSAPATPWIDEFGVIKHPLTTESAMKLMEDHNTLVFIVDVRSDKRKIRQA
                     VAKLYGVQASKVNTLIRPDGKKKAFVRLAANYDALDVANKIGII"
     gene            complement(<753729..>755156)
                     /locus_tag="CYME_CMK274C"
                     /db_xref="GeneID:16994260"
     mRNA            complement(<753729..>755156)
                     /locus_tag="CYME_CMK274C"
                     /product="mitochondrial ribosomal protein S5 precursor"
                     /transcript_id="XM_005536595.1"
                     /db_xref="GeneID:16994260"
     CDS             complement(753729..755156)
                     /locus_tag="CYME_CMK274C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein S5 precursor"
                     /protein_id="XP_005536652.1"
                     /db_xref="GeneID:16994260"
                     /translation="MRLAPRLAAALGALHGARTGTAGHHRSGILGSASALGGLKWSSL
                     HGSDRGHIPRADGLHSLLSVLVRGFRAFPWGASRSAGANPIAITRMRGCQEAFRKQIT
                     VACEPRQFLKRGLVTETWSCVAKLDTAGLRSEHEQEVQRLSIFLQEVMSAYPQESKAL
                     VGIMRERVSATLYDAKKLVETLKAHLQTSGDALLSFEQLAQVYRTREALLDLSFGLRV
                     AVPIEAYPPGMVPQPELEEKRRLTKRDKILAEQEAESALQERRYRELYGPVADARDNV
                     QYENSDECPSGGYAQWYEDSSDPRTLLRGFHTVLLDMKRVAKVTEGSTRLSYRAAVCI
                     GNGKGVGGYGDGKARTVQGAIRRATREARRNLIYVPLYEQRTIPHESTARFGRCLVYL
                     WPLKSNTGLRMNYFYQCALDVIGVKDAGAKLHGSRNRINALKALFEALKQIHDPVDVA
                     KSRGYRVVDLSSYIEGKLQTALLRP"
     gene            complement(<756284..>759454)
                     /locus_tag="CYME_CMK275C"
                     /db_xref="GeneID:16994258"
     mRNA            complement(<756284..>759454)
                     /locus_tag="CYME_CMK275C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536596.1"
                     /db_xref="GeneID:16994258"
     CDS             complement(756284..759454)
                     /locus_tag="CYME_CMK275C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536653.1"
                     /db_xref="GeneID:16994258"
                     /translation="MQRAKGAHRSNAPSPPSTAGSSEGNVSGSEDSSSRASSCLVTDA
                     RTLNRLNLGQSHDPVAYESRHGNVAWNAGGCEHSPESWVKRSRHIGVGVGVGFSSQTV
                     GTLDAPDRTEKSAAGCTHTTECPEEPTFAAPGRVQPRAVPLASVDADVQRSASVGDHT
                     DAAGSQPQHRQVVERAAAAPQQGPAGTAVDRTCEGNTFGAENGKDSMDSSGSGSRYAT
                     RMRFQSIPVSGNLRYLSAGRAGHAMASVDNRVYIFGGHRSATGTPDPDTLPPPGLYRV
                     TTDGQKRYTVHFCDLIELDGETRLWRLMSNAADEQPAPRRHATMVSFDGSLYVYGGFD
                     AENHVLGDLWRFDLHSERRWVLVSCQGRARAPGALLENVGHAEHRATETASDAALGAA
                     TSISLARVPTAAAAATTTTGTSNVRGSEVRFRAVERGQSRSGRRESFRAPHPSIGAGL
                     SATPEHATSVQMIPLPEGGPTSGRAEHSAVTYGHLMIVFGGYDGRRKVNTTAVCDLRS
                     GKWFCPRALQETMATGRPGIDYPHRRCKHSAVVYDDTMYVFGGFQYRNKLNYGCSDLF
                     VLNLCTWSWHCPVLMHGGGPQAVHGHCAVAGAGAMYVFGGKVRLDATQRAAQPVLAER
                     PEHSLPPHALTSAVSADTSPTPSELRSSDLSRDIWKYHFHLNMWQRIALDELTEASLG
                     QASAERVRVELHPRQLASAAVVAPRDPLRCSMYLFGGTNRAKDRFFGDMYVFYGLGTD
                     RGDVLQPCRFCTELGKALHEPTLADVIFEVPESLDALPEEDQPAGPAVATAHTASPVD
                     ARCDRIDASNACVQGATSARTRHVSAAMNAGQCAAGFPREATQQRQRQQRASRCRLFY
                     AHRVILAARSEYFADMFHSGLRESLHGEWPRVIHLPDVSAPVFEAVLRYLYTGELPVH
                     DARIAARASGRACHDNAMDASAMLSVASTSERDGRFLLECLRTADMLRLDELRNFCVA
                     LVERAIRPENVAFVLEIAAQREDGMGGLKAYCLAYITHHFAEVIETAAFQDLLRRDPA
                     GLGKHVLQAYHESMTGPDAQRRPHSR"
     gene            762870..764448
                     /locus_tag="CYME_CMK276T"
                     /db_xref="GeneID:16994273"
     misc_RNA        762870..764448
                     /locus_tag="CYME_CMK276T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461398.1"
                     /db_xref="GeneID:16994273"
     gene            complement(<765680..>766501)
                     /locus_tag="CYME_CMK277C"
                     /db_xref="GeneID:16994267"
     mRNA            complement(<765680..>766501)
                     /locus_tag="CYME_CMK277C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536597.1"
                     /db_xref="GeneID:16994267"
     CDS             complement(765680..766501)
                     /locus_tag="CYME_CMK277C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536654.1"
                     /db_xref="GeneID:16994267"
                     /translation="MDKSRNSENVRMVGLRGITSDGADATSEPGSGDRIATREVWRPG
                     LGARIHDYVNMAQIPMLFLLSVASMITDRVWVHATLVVYADLYFLSDTMWILFAPYIV
                     KQPWAILVHHLVAMVLLMQPTTALLRLANLVGECRRVTTRCFEIGDLASLALAFTAIT
                     ADILIVELNTLFLLLRRNIRGGWVFEVLFYASWLGIRIVWYPYILFYKVLPHPAAAWS
                     TKVSFVVVVALQFWWTLAFLSPSYWKRQRGKFRETSLSRPAPGGVYSPTARDKFL"
     gene            <767155..>767991
                     /locus_tag="CYME_CMK278C"
                     /db_xref="GeneID:16994268"
     mRNA            <767155..>767991
                     /locus_tag="CYME_CMK278C"
                     /product="probable protein disulfide isomerase"
                     /transcript_id="XM_005536598.1"
                     /db_xref="GeneID:16994268"
     CDS             767155..767991
                     /locus_tag="CYME_CMK278C"
                     /codon_start=1
                     /product="probable protein disulfide isomerase"
                     /protein_id="XP_005536655.1"
                     /db_xref="GeneID:16994268"
                     /translation="MRVSVSDPKVFRGQGLSSSLRPVYRKSCALWIKFAGIFLALSLF
                     SECSNLALVLGTDHELSRNDTLLELTRYSFDRKVKELLSDHPAMLLQVYAPWCGHCRR
                     FEPTLRRISQQLAGGCRDPPTHPCIPVARIDGDREMVLALRLGVWGFPSFYGLRANPD
                     NPNRPVVLFYNGSHDQDALVAFVDRVAKQVPIDAIPDAVRLDGWRHPFGAILRLASAG
                     VLAPYQAAAGLSSLMTRWQFWAVFAVALTGSLLYWRRRRPWMPRQYTRTATMNGHVKK
                     PQ"
     gene            complement(<769882..>771504)
                     /locus_tag="CYME_CMK279C"
                     /db_xref="GeneID:16994287"
     mRNA            complement(<769882..>771504)
                     /locus_tag="CYME_CMK279C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536599.1"
                     /db_xref="GeneID:16994287"
     CDS             complement(769882..771504)
                     /locus_tag="CYME_CMK279C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536656.1"
                     /db_xref="GeneID:16994287"
                     /translation="MDSVIRASTPGNATPTDASLVSFFHEYPRIIGASNDFQVTVGYF
                     AGIGYTAIPYLAVALFFLIVGVVFVCVPWRVLLCLPRRRPRPLVSAPEPATFFYAKKV
                     ASDEKSPDLFSEEDTSTEPSAPVLDEEISTVAAETAPPASNGCRFLPPPLCAVYPVSA
                     TIGLVLMAGAAAVALAGVIVSHQTLDDTLGVVRGGSHAVRLEGRAVVSLYTNASGELQ
                     SLVTSLESVVSSSSLSGLNFSDIPAQARSIYRDVANVLNSLDSGLGSVNLAESIHFGL
                     MLACAIVLLVLAFLTAAAFYLSNRFAIRSASVETARVHSDDPVTLNQRRSRWTKWFLR
                     ITLLAPVLFAALSWVGLGASVVYGVLNGDLCSAASARQVQLLRGENIHGETGGPDHIS
                     SHSLDHLIYCPAVTSLTHVLDEQQRDLDKVSTALEPLLHHNITLQNYKQVIQDFESTG
                     GFRATLLHGVLTEGEHILDMLSNGTQILEQWRACGPVLNILADALQEQCNSGIQAALL
                     AFIGFILCVVFGSILLFYIVGCSKAQNQALGL"
     misc_feature    774119..776720
                     /note="possible transcribed region"
     gene            complement(<774475..>776037)
                     /locus_tag="CYME_CMK280C"
                     /db_xref="GeneID:16994281"
     mRNA            complement(<774475..>776037)
                     /locus_tag="CYME_CMK280C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005536600.1"
                     /db_xref="GeneID:16994281"
     CDS             complement(774475..776037)
                     /locus_tag="CYME_CMK280C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005536657.1"
                     /db_xref="GeneID:16994281"
                     /translation="MARTRNQAQSEFSSEQRTCLPSDDRVLGGPPTVDSATPTSSAMR
                     AASSRQAGSVFNADSERPSKSANRSPTVTSAALDTGQYGQTSCRRATRPTASTQLDYV
                     DESKLPQIPPSVNGRGPWQPCEDERLKALVNMLGVGAWPRIAQYMVNRSGKQCRERYI
                     NNLAPGIVKTEWTRNEEMRLVQLQAIYGNRWSVIAKEFPGRTDNAVKNRFNSYLRRLE
                     YQKRQQTEALKKERLRQERARITEEISKQNPSKRREKLPDVRPAALAIPVPDEDAAAV
                     TSPRGIESLPRSFSGNLHIHDVRTTCSRPELKRRRSGERSSTSTSFSALGSEALAQPL
                     LASGAETTARLHQDVELPPYETDIEHRIEVAFLRSSPDSFLSHENAIGAELTSPVLSD
                     IKSVLFPEQTASPARFDALRNVLSEEECSLLDKYANLKFAEQQTGTSRDAVREVGSSR
                     APSLLLTKAESANTESQPGDTTATSPAYYDALITPVTLRPNVQVSEKLPIGSHTSRSE
                     LLDDQLRYLLNE"
     gene            <776555..>777316
                     /locus_tag="CYME_CMK282C"
                     /db_xref="GeneID:16994280"
     mRNA            <776555..>777316
                     /locus_tag="CYME_CMK282C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536601.1"
                     /db_xref="GeneID:16994280"
     CDS             776555..777316
                     /locus_tag="CYME_CMK282C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536658.1"
                     /db_xref="GeneID:16994280"
                     /translation="MPPQKRQNRPCSLAALRFLCSAKGAAPQVRLSRPSSVKPHLRCY
                     SVVGSSALTAVVVNCPYGASITFVAGEAERHEANKNRLPFRLMELGSGFRAICSRVLS
                     PKINNGHEFSTRHWMAASAPLQQPVRPALWLRPSLESLSTNPDGDDDDDDDDDDDDND
                     KRRVTCCTSNVVAYKSGGGIRSEVLPRIPIVPGCLHRYLSTDTIVAINHVPLFRGFAG
                     ADATALSSSRSMRRNQASRYLCTILPASASGAWST"
     gene            complement(<777523..>778131)
                     /locus_tag="CYME_CMK283C"
                     /db_xref="GeneID:16994282"
     mRNA            complement(<777523..>778131)
                     /locus_tag="CYME_CMK283C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536602.1"
                     /db_xref="GeneID:16994282"
     CDS             complement(777523..778131)
                     /locus_tag="CYME_CMK283C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536659.1"
                     /db_xref="GeneID:16994282"
                     /translation="MCAASWQALQCDSRDFTATQFLLAEEKQDKTERRPIPEICLSCS
                     VPTPCRCTQWPTALPIYCSAELRPRETQPRARSAMPPRNAYECFTKLSGFHVSSSAST
                     ERPKFSSQGGIVTRANGNVKTHLKARRYASGRWLDARHQAMLYVDRSIDRSIDTTPSI
                     SYDAFAWQSIIRPTTAIIHHDVLRHVPQSTGPAGGGTEVSLH"
     gene            <778697..>780355
                     /locus_tag="CYME_CMK284C"
                     /db_xref="GeneID:16994283"
     mRNA            <778697..>780355
                     /locus_tag="CYME_CMK284C"
                     /product="DNA primase, large subunit"
                     /transcript_id="XM_005536603.1"
                     /db_xref="GeneID:16994283"
     CDS             778697..780355
                     /locus_tag="CYME_CMK284C"
                     /codon_start=1
                     /product="DNA primase, large subunit"
                     /protein_id="XP_005536660.1"
                     /db_xref="GeneID:16994283"
                     /translation="MALHSRRASGGLVFLQSTGDAGAANATEHALYLTCSAGSCTLRE
                     LLGWGLQRLALLQELSDSELEPAEAEAQIERMLRSPAYRFLQEYPGKADAWSHFILRL
                     ALGSFEFARDWWIQAERQLLRFRLRRRALSLRSIDSLVALAEQVAPPELRAAPRPLLE
                     AVPGEKAPKEVYDTLRGDGYPLIHEQLKNLGHTGTGNLENMGLPMFRVPFELVLQWVR
                     HRQLWLQAGYAWVPALAVNELVLGWYEIFLRRGTATAEQHFAVAPKATRLRERLTPIL
                     LYLREQHSAWKRTRIRGTGRLHGIDRPLGTELHLTELDTAIPDMPLCMRLLLERLRQC
                     GHLRHGGRLQLGLFLKEAGFTLSDSLQFWRDALRVNSNGRPIANHEFEREYAYGIRYN
                     YGLEGKRKNCPAFSCARILDMRPGAGEHHGCPFQELAQPALEQAVRTHLRITDPMDIE
                     EITRYAAAGQPQRACAGCLRSGLQHRGNRFEEEEEQQQQQQHEAGTAAPSETLTRVYG
                     DSQRLSIASLRLVEHPNEYFAQMRLARHMEPGTPQSTALDGVAH"
     gene            complement(<780810..>783167)
                     /locus_tag="CYME_CMK285C"
                     /db_xref="GeneID:16994284"
     mRNA            complement(<780810..>783167)
                     /locus_tag="CYME_CMK285C"
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit B"
                     /transcript_id="XM_005536604.1"
                     /db_xref="GeneID:16994284"
     CDS             complement(780810..783167)
                     /locus_tag="CYME_CMK285C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit B"
                     /protein_id="XP_005536661.1"
                     /db_xref="GeneID:16994284"
                     /translation="MTRAASSGADTWKTSKVNAKQALVDRAVNDALASTLVVENVPVI
                     PESKHAKLVNVIQKIFSPLGVIKYLEIPPTGGYGIVEYATAEEAERARKQTDGFQLDK
                     AHRFQVSLLSDVERLRQLPPDASFEPPAELLAELSDETARHMETRPNLLSHLADPRGR
                     DQFVVCTGVDTAVYWVDPLLPPELEHERANWTESDVAWSPQGLYLATFHRQGIALWGG
                     SEFQKIVRFEHPQPRLIHFSGNERYLVTFNAPDSPEPLVVWETGTGRRLKVFESPLRL
                     PPRLLERLWSDVLEERARADAANPMLASMQSAEWKRMETERERGMPPPDIGRFPWPLV
                     QFSADETMMARLGEDCIHVFEMLPDRIELLDHRPVSVPAALGFAWSPTTPNLLAIWTP
                     EEGQSPARVLLLEMPSRRELRQKALYSVANIELIWHPQGKYLACRVERYTRSRKGRFT
                     NFEIFRVNEKDVPVETLEFSERDKVLAFAWEPKSDRFAILHQQHLPPNTAAAAAAAAT
                     TTTPLGGLGTAAGGVAGAMGLASGSTRPMVTFYEVQKDTVRTLFRLERKQCNRICWSP
                     TGMGHVLLAGLGSMGGVLEWWNVADHELMGVDEHFACSDICWDPSGRFVCTWVNASAS
                     RIEHGYQLWTFYGRKLGAPHFMENLFEFSWRPRPAKWFLSEQEEREVRKNLKQYRAKY
                     EAEDTAMRAHRRRDIRVARRDALAEWQKLVERNRARYRAETEKRAALWKHIPGGERHI
                     TDALAADAEGAAPGDDEVLEEWVEQVLEVEEKVLEKYLDENDERD"
     gene            783943..786983
                     /locus_tag="CYME_CMK286T"
                     /db_xref="GeneID:16994279"
     misc_RNA        783943..786983
                     /locus_tag="CYME_CMK286T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461399.1"
                     /db_xref="GeneID:16994279"
     misc_feature    complement(786944..787812)
                     /note="possible transcribed region"
     gene            <788016..>790466
                     /locus_tag="CYME_CMK288C"
                     /db_xref="GeneID:16994278"
     mRNA            <788016..>790466
                     /locus_tag="CYME_CMK288C"
                     /product="probable potassium transporter"
                     /transcript_id="XM_005536605.1"
                     /db_xref="GeneID:16994278"
     CDS             788016..790466
                     /locus_tag="CYME_CMK288C"
                     /codon_start=1
                     /product="probable potassium transporter"
                     /protein_id="XP_005536662.1"
                     /db_xref="GeneID:16994278"
                     /translation="MQCVSCSARVRVTTQAYPARLSAWVVSAKAPALTHSRGERPNCC
                     AANVDRCNVSRSGTKPCSARHIFSGQFAPRRRLALPGTSRVNTGRCTAFTLRNLVSES
                     GGTAFALRDALELLAATVLTIPVFKKLRLSPILGFLLAGVILGPHGLRLVRDVEDITA
                     LADFGVLFLLFEMGLELSLKRLRVLRKYVFGFGTLQMAMTTAILGLGAYLVGGDGVSW
                     QEATVIGGALSLSSSAFVLRLLQERGEQNSRIGLATFGVLLFQDLAVIPLLVLLPLLS
                     DLGEVAESMGTPSGFWHELQQISEQLGLTVIKAIGGLAALVLVGGAALRFIFDLVKES
                     KSPETFTAMVLLTVLGTAWVTDHMGLSMTLGAFMSGVLLSESDYRNEISVDVEPFRGM
                     LLGLFFITTGMSADLNLFWQEPLLLTALIATLLVAKSSIATLVGRPFLPTWSEAARVG
                     LLLGQGGEFAFVAFALAKRLGYLPEPVNALLIDAVVASMALTPALAEVGARLFRPSGS
                     AANAPEKPAMEADISATAKGDHAPETEEQAAMAPVPSDSDTAVVAASAVPSESTQTLP
                     GDVVDANTIPGPEELKAIIPGDHALNDMVVICGYGLAGRIVSCMLAKKIIPYIAFDRD
                     ALVVRRAVELSVPCVCADVRNVDALRAMGIVAPAAFVITFHGSHFMDTKDFRETIETI
                     RNAFREIPIFARARNLEERRYLESIGVHASFPESFETSLFLGREVLKSFTRREAEVEA
                     IVTEIRRNEQLREEFQQWEIWHNAALSRRSAEAAIASWPTAAPESPTLDHNGTSNGTV
                     TDPSSREAQTAEEARHSR"
     gene            complement(<791310..>792149)
                     /locus_tag="CYME_CMK289C"
                     /db_xref="GeneID:16994275"
     mRNA            complement(<791310..>792149)
                     /locus_tag="CYME_CMK289C"
                     /product="20S core proteasome subunit beta 2"
                     /transcript_id="XM_005536606.1"
                     /db_xref="GeneID:16994275"
     CDS             complement(791310..792149)
                     /locus_tag="CYME_CMK289C"
                     /codon_start=1
                     /product="20S core proteasome subunit beta 2"
                     /protein_id="XP_005536663.1"
                     /db_xref="GeneID:16994275"
                     /translation="MLLEQDFQGFSFDLFLRNQQLLRRWSNESKERIENVLAKPPRKT
                     GTTIAGVLFAGGVVLGADTRATEGNVVADKNCSKIHYIASNIYCCGAGTAADTEATTQ
                     LIASQMELHRQAVDRDLVPVAAAMTRLKHYLFRYQGYISAALVLGGVDELNGPSLYTV
                     YPHGSVDQLPYVSMGSGSLAAMAVFEARWHEALTEEEAKCLVYEAISAGIENDLGSGS
                     NVDLCVVKNGGRAVDYLRGYAKENVRVYRKPTGHVFARGTTAVLAQELRKYVQVTRVV
                     SDL"
     misc_feature    792531..793734
                     /note="possible transcribed region"
     gene            complement(<793104..>794603)
                     /locus_tag="CYME_CMK291C"
                     /db_xref="GeneID:16994286"
     mRNA            complement(<793104..>794603)
                     /locus_tag="CYME_CMK291C"
                     /product="delta12 fatty acid desaturase, chloroplast or
                     ER"
                     /transcript_id="XM_005536607.1"
                     /db_xref="GeneID:16994286"
     CDS             complement(793104..794603)
                     /locus_tag="CYME_CMK291C"
                     /codon_start=1
                     /product="delta12 fatty acid desaturase, chloroplast or
                     ER"
                     /protein_id="XP_005536664.1"
                     /db_xref="GeneID:16994286"
                     /translation="MNTSIYESRIRGEKSNDTVKQGTPEAKRCFSVGCSGRTGGVADA
                     CPHASTACGTMCASDQARSDAQACDKVLTDVSVLGGTGHQAMITNREFPSVKALLAAI
                     PDECYERSFVRSSAYAAMSVLLTLACGWFGYTYLWNLQVGVVSRMAGWASLAKVGMLV
                     LWALYAAVTGTIATGVWVIAHECGHGAFCSAAWLQDLIGFVLHSSLLVPYFSWQRSHA
                     VHHARTNHLDEGETHVPHTANSVSGKTNLRIMHWIGDDAFGALNVFMHLVLGWPAYLL
                     YGATGGPVRGLTNHFIPFSFGQGELQSVNETLPRPVSLYPGWRWKLRVLASDLGVLAT
                     LGLLYSWAQYDGPVRVCVVYGLPYLVTNMWLVLYTWLQHTDVDIPHYDSQHWSWNKGA
                     LLTVDRPYPKLIDFLHHHIGTTHVVHHVCSRIPHYHGKKATEALKKAFPEHYLYDPTP
                     ILQAIWRIGCNCVAVRQVGDLWVYTVSCGEEEMNERAVDNAVRKAQKTA"
     gene            <795287..>796318
                     /locus_tag="CYME_CMK292C"
                     /db_xref="GeneID:16994276"
     mRNA            <795287..>796318
                     /locus_tag="CYME_CMK292C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536608.1"
                     /db_xref="GeneID:16994276"
     CDS             795287..796318
                     /locus_tag="CYME_CMK292C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536665.1"
                     /db_xref="GeneID:16994276"
                     /translation="MTNICFIDQGLLLRKRGFSCRRCSVCCDTQRRARLGALPRRAGA
                     SRLVNSSIQVTAEYAQALAQANELFNLYNADVPWPWFIRGVVHLQHNRAALAVADLER
                     ALLMGFRGSEVRIFAAAALFRAGKVSDAVTYYLEVMRNEIGSVGNPLAEPNELRKLIG
                     PYIPLWKPPGKLFQQAVCFYCARRFEDAFQALDKVVALGRDYIYAGNEDTGDPLTWEH
                     VLWRIASYRRLKGQTPILSQSELAAVPTSDIPLSLIDLYRTNDVAVEEALCQHESEIA
                     TLSDQIRFQFYRGLFWQHRTDSQLHQRALRHFEQVAKQIPDENTLDSLDDSAAFLVDV
                     TRIMLHRTL"
     gene            complement(<796868..>799021)
                     /locus_tag="CYME_CMK293C"
                     /db_xref="GeneID:16994301"
     mRNA            complement(<796868..>799021)
                     /locus_tag="CYME_CMK293C"
                     /product="AAA-type ATPase family protein"
                     /transcript_id="XM_005536609.1"
                     /db_xref="GeneID:16994301"
     CDS             complement(796868..799021)
                     /locus_tag="CYME_CMK293C"
                     /codon_start=1
                     /product="AAA-type ATPase family protein"
                     /protein_id="XP_005536666.1"
                     /db_xref="GeneID:16994301"
                     /translation="MTSCNGRTTSSGKAFLSLSEWPKDVTVGSVVTLYGSALCTLWPS
                     SAREVVDAPLVCDENPPHLVRSELHDVNAVRIAAPAAAFDAVADKGAPPEQNRACVQV
                     IGPRAPASELWLEELLFPEADASLGPPQCEDSASLRALLLYLPVVAGAVIHQRWRVLR
                     VHGGNWITLATQIHRTPKRVEHTLVRAIGDATPDTQVYFRFAKKLIDYIKTLWCLPRA
                     YGGGVIHGCILAGPAGVGKTYAVRQASQDLEAEHITFRLREKGRDLGTLRSNLEALTA
                     EIFWRLSRASCEERPCKNTIILFEDIDRVCGERAPFAARNASEATDALPLLLVNWFDT
                     IEHRLSAGRSRVVCVATVRRLGDMPVSLRRGGRFEGLIHATVPTFEERIALMRALGAP
                     DPASLAAQTPGYVASDYVRLASCGFSFQRAGGVAARAHQTYRIEHPKCLDVLVDGTNA
                     SSLRHQFRGFDALGGHHATKEALFRALAWPLLYRSTCVRLGVRPARAVLLYGPPGCGK
                     TRLVRAAVETLWRQGAPFTFIHVSSADLYSAYLGESERTLREIFSIARSSSPALVFLD
                     EIDNLIGIRNADTSAGASDVANRLLGTLLTEIDAMNETDAHVVLTGATNRIDRVDAAL
                     LRPGRFDLQLEVPLPSAVDRRAILELYLTRAPTETPMRTTFDQQASETALLPGSVALD
                     ELVAQTDGWSCAAIEQLCFDLVSRQAELTGCEQAP"
     gene            complement(<802724..>803923)
                     /locus_tag="CYME_CMK294C"
                     /db_xref="GeneID:16994302"
     mRNA            complement(<802724..>803923)
                     /locus_tag="CYME_CMK294C"
                     /product="26S proteasome ATP-dependent regulatory subunit"
                     /transcript_id="XM_005536610.1"
                     /db_xref="GeneID:16994302"
     CDS             complement(802724..803923)
                     /locus_tag="CYME_CMK294C"
                     /codon_start=1
                     /product="26S proteasome ATP-dependent regulatory subunit"
                     /protein_id="XP_005536667.1"
                     /db_xref="GeneID:16994302"
                     /translation="MSTGEDPRRQAALQEYRRVFQQHEQLSEKIRGHRETLRQVRAKF
                     EKTEEDLRALQSVGQIVGEVLRPLTEEKFIVKASSGPRYVVGCKARLPRRRLKKGTRV
                     ALDMTTLTIMRILPREVDPLVHKMLADAETRQRIDYSEIGGLSEQIRELREAVELPLT
                     NPELFIRVGIKPPKGVLLYGPPGTGKTLLARAIASNMDAYFLKVVASAIVDKYIGESA
                     RVIREMFAFARDHQPCIIFMDEIDAIGGKRFSEGTSADREIQRTLMELLAQMDGFDEL
                     AAVKLVMATNRPDVLDEALLRPGRLDRKIEVPLPNEQGRLEILRIHARSLNIRGDVDY
                     EAVCRLADGFNGADLRNICTEAGMFAIREERDYVVMDDFMKAVRKLSENKKLEPKMDY
                     GQAFKKS"
     gene            <805448..>805852
                     /locus_tag="CYME_CMK296C"
                     /db_xref="GeneID:16994296"
     mRNA            <805448..>805852
                     /locus_tag="CYME_CMK296C"
                     /product="ubiquitin with short C-terminal extension"
                     /transcript_id="XM_005536611.1"
                     /db_xref="GeneID:16994296"
     CDS             805448..805852
                     /locus_tag="CYME_CMK296C"
                     /codon_start=1
                     /product="ubiquitin with short C-terminal extension"
                     /protein_id="XP_005536668.1"
                     /db_xref="GeneID:16994296"
                     /translation="MQIFVKTLTGKTITLEVEPSDTIENVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGYIRVVVEDGEGAVSTGYASYPTTTTM
                     GSSAETAEAVSTSELSKSSCPRCAAYASINGS"
     gene            complement(<806155..>807141)
                     /locus_tag="CYME_CMK297C"
                     /db_xref="GeneID:16994295"
     mRNA            complement(<806155..>807141)
                     /locus_tag="CYME_CMK297C"
                     /product="probable ribonuclease HI large subunit"
                     /transcript_id="XM_005536612.1"
                     /db_xref="GeneID:16994295"
     CDS             complement(806155..807141)
                     /locus_tag="CYME_CMK297C"
                     /codon_start=1
                     /product="probable ribonuclease HI large subunit"
                     /protein_id="XP_005536669.1"
                     /db_xref="GeneID:16994295"
                     /translation="MEPVSESFIMGIDEAGRGPVLGPLVYACCACQAGRLQELEATGV
                     RDSKKLSAQCRERIFQTLGENADWIYSRTRILSPEMLSATMLGRKRVNLNETSYAATI
                     SLVKDALSSGMFIEGLFVDTVGEPDAYQMRLKRIFPKIPRIVVQSEAESRFAVVAAAS
                     IIAKVTRDKALRTWTFPEEANDPQLRFSREYGSGYPADPLTQRWLRKHLDPIFGFPSI
                     VRFSWSTCSRILEKECVQVDWPEEDSTSGALLPFIMRRKNHSPGPCGCAFLEAAHVRR
                     LVVDEPPPLPVPTPKLVPAKRPTRRRPDCAKRSRVERKSVSKPSSRRDQKRA"
     misc_feature    807246..808736
                     /note="possible transcribed region"
     gene            <809955..>810701
                     /locus_tag="CYME_CMK299C"
                     /db_xref="GeneID:16994290"
     mRNA            <809955..>810701
                     /locus_tag="CYME_CMK299C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536613.1"
                     /db_xref="GeneID:16994290"
     CDS             809955..810701
                     /locus_tag="CYME_CMK299C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536670.1"
                     /db_xref="GeneID:16994290"
                     /translation="MSNAFVTGLESCKLRQSVRFEIENGANAEPHASLDRWRRSPALV
                     RRRTRSLRLPLWQLRRQSGCIRIRLLCANSEPSSTGRPRVTPYPSQRAIFSNDKKAFT
                     PAELNDLFVRCNEPPRDERKILRCLKYSFSVVSARLLGKDQRLVAFVRSISDGVMNAT
                     LWDVLVDPNLPNPAVMRRNIIRRMLDDLSRDIPLCSVAMIAPEDLVIFYEKECGFVAE
                     PNGIRAMRLVRWPENLDELDPIETEDGGQI"
     gene            complement(812340..814357)
                     /locus_tag="CYME_CMK300T"
                     /db_xref="GeneID:16994291"
     misc_RNA        complement(812340..814357)
                     /locus_tag="CYME_CMK300T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461400.1"
                     /db_xref="GeneID:16994291"
     gene            <814853..>817411
                     /locus_tag="CYME_CMK301C"
                     /db_xref="GeneID:16994288"
     mRNA            <814853..>817411
                     /locus_tag="CYME_CMK301C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536614.1"
                     /db_xref="GeneID:16994288"
     CDS             814853..817411
                     /locus_tag="CYME_CMK301C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536671.1"
                     /db_xref="GeneID:16994288"
                     /translation="MRHWRPRRAHPHSRILWVFLSLFNIFICYAATVALGGEVSAHAY
                     DRCNSSLMATAGFNDSAAQQFVFQTALELLYTSFASSEAAASLVRRGYAHNVLEYAAM
                     LAMRGNASDCPFFRELLREYGTAFARNPKALASDFFAALPLAAAIHYGLENSWITVSD
                     PGLDPAVIRAVCKPDWTLRGAQNQAMIKAAGTALCLASIPSQILGGSATTTYAAYIEA
                     VWDDFAVRAQGDTTENAPQYNVIFLSGLWVLVNLNQTRCDWLQKSANAFNMFMDFANQ
                     VSPLGILPSYGDDGLGTPLVFAGDWASVLALAAKLYAGHVTGSGDMTAVSLLEAAAYR
                     VWQFQTSGPLTTKAGNSVGVFLHPVRSTQPLFHMALLAHPTWADLRAGATAAVGANSA
                     ATRAIVTARVPQTPDKVIVTATDGSDAGNQSLFACASVYSSPFAYHAHAQQLGTMAML
                     SMNDAVLLYGLGYNNRLQNQSNTMVLVPRQQLSMPSVMNGIWQSAMLPTENLEPYVAG
                     MSFETLATGLLSLQQTASLLRNFNRTVTFRVQYRGPGTGKLTVRNLRLVSGAGEERAA
                     PLLASTGMRGASDNGAEVAFENCGGDAVAFNTYALRNGSVTFSVTEYPYVAFDWKFEV
                     FPNTACEPGKPPPAGAGSITAPSYTLLIFRASPSSLFDINVLTDPMPRPRDVEAAPMT
                     SLGEAGSSPWQAAARYRIRGYGTADTIWTRELFLSAIAERTLLVRDTVECGDALLQRG
                     YASIGPVWNFLGTAYQLNSSDRTVYIRGFPNAVTKVAHDDRLVAEVRVRSNTTAQLQV
                     SNTQLLWANVRPVVVRAQAPITSSQKTLRFETTIRLVSESPAGALWHKYQTLDF"
     gene            complement(<819048..>820130)
                     /locus_tag="CYME_CMK302C"
                     /db_xref="GeneID:16994289"
     mRNA            complement(<819048..>820130)
                     /locus_tag="CYME_CMK302C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536615.1"
                     /db_xref="GeneID:16994289"
     CDS             complement(819048..820130)
                     /locus_tag="CYME_CMK302C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536672.1"
                     /db_xref="GeneID:16994289"
                     /translation="MSQFLNRQQSTCFGSMDRSKTVFPGAERTLCNSSADGSAMPDAV
                     QKTEGFWGALPVLAPGNVVEGDVGAHDTVVVLVPAWVRVSRMPQVQRSHRRILVALFV
                     SVSPQATWCSQCLDTGQCSGLLTSGCRIETCRFQRKKLRAPLATEGRRAVTVRATSSR
                     AQTYWRHLPGTAYLFGLRNVLRNWFQLTQARKRRWQPLVGPGGRTSSGQSKPRTLLMA
                     SDEHRTTFGHTEALSGLPTEVFAIEVGFGVDLHGQDAQVAAERACNDALHRNSYPGLR
                     KFLPPPGDLQQMRVHVLLGLPPEFHNRVDKHALRRLFPYGQVEVEIVPGGLAASSGIY
                     LGEHGDRPGDDRLVIANAVITVGYNP"
     gene            <820879..>822051
                     /locus_tag="CYME_CMK303C"
                     /db_xref="GeneID:16994298"
     mRNA            <820879..>822051
                     /locus_tag="CYME_CMK303C"
                     /product="similar to ADP ribosylation factor 1 GTPase
                     activating protein"
                     /transcript_id="XM_005536616.1"
                     /db_xref="GeneID:16994298"
     CDS             820879..822051
                     /locus_tag="CYME_CMK303C"
                     /codon_start=1
                     /product="similar to ADP ribosylation factor 1 GTPase
                     activating protein"
                     /protein_id="XP_005536673.1"
                     /db_xref="GeneID:16994298"
                     /translation="MAPDDQPEELDAAKVLAELQRLPDNKRCADCGAYHPQWATVTYG
                     TFICLECSGRHRGLGVHVSFVRSVSMDRWKPLELRQMQVGGNAAFIDFMRRFAGITPS
                     VSADIPAKYATPAAAIYAQRIRALARGEPWQDPEPGRVPRMPALSGCSDSGGPAAPAS
                     VSSGAFPGGFPRQTPLLAQSGRIESVSSRPVSLSGGRSMRSVPHGSVDHDALSVEQAL
                     KTAGSTLSELTEQGTELARTATMKLSAWISRAANLLEGPNTGHQELTSHTESIQMTRR
                     TDNGSYTGAVRDDNDDEQQSLLAGIRHLPKGSGLEGIGNPRRPAPTEEQHSASRSSNS
                     TENSSIFRGFLGNESSLSSSLRRDLRHLQRSQRNLDDGPSTASDASVHYASQKRFQ"
     gene            <825879..>827063
                     /locus_tag="CYME_CMK304C"
                     /db_xref="GeneID:16994300"
     mRNA            <825879..>827063
                     /locus_tag="CYME_CMK304C"
                     /product="similar to syntaxin"
                     /transcript_id="XM_005536617.1"
                     /db_xref="GeneID:16994300"
     CDS             825879..827063
                     /locus_tag="CYME_CMK304C"
                     /codon_start=1
                     /product="similar to syntaxin"
                     /protein_id="XP_005536674.1"
                     /db_xref="GeneID:16994300"
                     /translation="MDRLDELRKGQSSPDNGSGVQESAGDMRSDLEAGPSTSGATRTA
                     VRTGTGRSLGEPGAVGDASKSDTVFDRMENGLARLQHRFLRGIPGSSRRGAQRTGDAS
                     GAAESSEAGEASESSTQLSTFYEKVDMVKAQIADLVAETEQIRAAHRARLEDPTRMQP
                     PPDMRRARMLAIDIKRQLDEMKLEEQKKASQTRGQASSSAQARIIGGTHAALSRRFLS
                     ALKDFQQLQGECDSELREQAERELRIMNPDITHEQATAILEAAGSSGNAGELMRQQML
                     QATDRDYEQIRIVARDMEERAAALRELESGMEELRNIFLDMSVLVESQGETLDEIEKN
                     IAAAKVSTKRGTRKLQTARKRQRTYYRLMFCGFYCLIILLVVILVPVLVTTLRTSTST
                     GG"
     gene            complement(<827248..>827856)
                     /locus_tag="CYME_CMK305C"
                     /db_xref="GeneID:16994292"
     mRNA            complement(<827248..>827856)
                     /locus_tag="CYME_CMK305C"
                     /product="similar to DnaJ homolog, subfamily B"
                     /transcript_id="XM_005536618.1"
                     /db_xref="GeneID:16994292"
     CDS             complement(827248..827856)
                     /locus_tag="CYME_CMK305C"
                     /codon_start=1
                     /product="similar to DnaJ homolog, subfamily B"
                     /protein_id="XP_005536675.1"
                     /db_xref="GeneID:16994292"
                     /translation="MLEGQDPYKLLGISRNAEQAELRAAYLRLALRWHPDKHPPETQA
                     LAEREFKKVTEAYKRCEELRKHSSTREPHEAASSRFGSRFTCSPNSSYADAATEAYWR
                     AFRRASAVRDAAGFAAFTAPRSEAADSRADPWRWIRWRAGLEWRRMRRGAHAATLTGV
                     LALGTSLVLTTRGVSLLWEKRNAAHSFDHAVKRRASASRDKR"
     gene            complement(<834269..>835150)
                     /locus_tag="CYME_CMK306C"
                     /db_xref="GeneID:16994293"
     mRNA            complement(<834269..>835150)
                     /locus_tag="CYME_CMK306C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536619.1"
                     /db_xref="GeneID:16994293"
     CDS             complement(834269..835150)
                     /locus_tag="CYME_CMK306C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536676.1"
                     /db_xref="GeneID:16994293"
                     /translation="MKAAFLSSFTLEPLLHTGCDRKELHSTQNRLALPALYGKRSPGR
                     LARRTLHSVLDADVKAQRSGPRKPNNGDTSDLEQPQSASALFVSEIVKIAGPDRGIFA
                     LNEFERDAIASQLARLEKKNPTKAPLCELESKLLGTWRLVYTDRMILGRRRALLYLTS
                     SAKPGLVHLGEVTQQIHAPEKVPAQFHGAHVSETGRAENRVEFRVFGGIDGVYTVQAF
                     YGADVSNSARVWIQGISSSLQPANFVSIMNEQRQQVLKELFDPTGYLDVTFLDDVYRV
                     TRDEKGFVYLWERISTA"
     gene            <837797..>839179
                     /locus_tag="CYME_CMK307C"
                     /db_xref="GeneID:16994297"
     mRNA            <837797..>839179
                     /locus_tag="CYME_CMK307C"
                     /product="probable thylakoid lumen rotamase"
                     /transcript_id="XM_005536620.1"
                     /db_xref="GeneID:16994297"
     CDS             837797..839179
                     /locus_tag="CYME_CMK307C"
                     /codon_start=1
                     /product="probable thylakoid lumen rotamase"
                     /protein_id="XP_005536677.1"
                     /db_xref="GeneID:16994297"
                     /translation="MITALRRYAFEHRNEESVFLLGCRAMWSQLAPVHSLQRLERKFR
                     ARCRSRKPLLRLHHGSGDGEFSVSRRELLKHSAAALTAAALSQLGVAALTERHVVDEA
                     AAANRTLSGASGVVNKDPESLLRWALPIDNEHLRQLQTELEATLRELRQKKWSQISSH
                     VRKASQMTSRNANDLLADVSEAKTAEAQRALSTLQSMLGSLQASADAKDAENFESMAK
                     DALRQVGTLEELSVKGFPFQVPEEYSHLPQLLGRATVEFVLRKSGEEGSPKQFDIDGN
                     LYDRARLVMVVDGYSAPVTGGNFVDLVSRGFYNGLRIIRSDGFVIQTGDPEPEGKIHG
                     FIDSKTNQERTIPLEIFAKGDPMPLYGTTLEDDGRGGQATVLPLTAFGSLCFARNEFE
                     PNSGSSQFFWFLFEPDLTPAGRNLLDGRFAVFGYTTEGAFFLRDVKVGDIVESAKVVQ
                     GLENLRQPTA"
     gene            complement(<839580..>840872)
                     /locus_tag="CYME_CMK308C"
                     /db_xref="GeneID:16994312"
     mRNA            complement(<839580..>840872)
                     /locus_tag="CYME_CMK308C"
                     /product="short chain dehydrogenase"
                     /transcript_id="XM_005536621.1"
                     /db_xref="GeneID:16994312"
     CDS             complement(839580..840872)
                     /locus_tag="CYME_CMK308C"
                     /codon_start=1
                     /product="short chain dehydrogenase"
                     /protein_id="XP_005536678.1"
                     /db_xref="GeneID:16994312"
                     /translation="MFPQFPIVWRLAINAWHIYGLLASISLTCLIVSYFGPLLFMSWA
                     PRCNLCRRYFADLESARASGSESVAEAVDRTIGRRSSQPASTQESRRKRANSVKRGGA
                     GTAAAEEPRNPVDVAKEPWALVTGASSGIGLCIVRELARQGINVVLVARNDALLPKAV
                     EQLHTEFPERSFRVVATDLSDATPANNTLEKEVGVIPGYLSDVKEATADLFAADTLRL
                     VFSNAGYLLMSFYWQRGLAEQMRNWECNVTAALRLTHYVLERWAQNQHRFGDLERTGA
                     TSRTSRRRLLVFTSSSSFFLPTPFATLYGAEKAALTSFAQSLAVEVRDLGVDVLVVHP
                     SYTRTNLYAGQPKLAILRFLDRFTGASPEGVAESIMRSIGRGFLIRDIGLYSSLTRWL
                     NHIIDIGLLSSILVQLRHLVPEYRAFKAASEAPRQRAC"
     gene            <841034..>843190
                     /locus_tag="CYME_CMK309C"
                     /db_xref="GeneID:16994311"
     mRNA            <841034..>843190
                     /locus_tag="CYME_CMK309C"
                     /product="unknown zinc-finger protein"
                     /transcript_id="XM_005536622.1"
                     /db_xref="GeneID:16994311"
     CDS             841034..843190
                     /locus_tag="CYME_CMK309C"
                     /codon_start=1
                     /product="unknown zinc-finger protein"
                     /protein_id="XP_005536679.1"
                     /db_xref="GeneID:16994311"
                     /translation="MLLLVVEVVYGKGRSLLQQAQCMHPHQSSEADESSTGVQNESAP
                     RWANTRLTKGPSEAAPEAPVSDLSPESSTALPAVGAASERGEVCEAWRKQPATGTESV
                     DPPARANDFRKPKGYARREPEDCPKWLDFRAGNPEIPLDTVTGRIHLLADRQSARRVQ
                     EPQLESSAPAASTTAAVRKPTESSLGDHIARSILEHKQSTLNEDEDQTKRAEVEVGTP
                     KTLAEASSDSVKGSHATGEVPAAHWKSSPSSLTCSDFARRHAKASMIFDQTTLLCMLG
                     VPGYLSTADLAQFVAPFRSRIRRMRIVWDLSYSNSYAVLLRFLSPDDAVLFRMEYDGR
                     AFSEALAPERCRVLPVERVVYRCTSKQSSRLVASLALPSEQDGDEIVEYDESTSSDAD
                     IGHLEEWPTCPVCLDRLDLESILVGLCNHALHTACLARWGDPSCPVCRFVSETLNPQK
                     TSCQVCNAQTQLWICLVCGHVGCGRYVQHHALAHFRDTNHVFAMELQSGRVWDYGSDS
                     YVHRVLLNEVDGKHAVLEMRASTGSRAVAASGVPYHSDGGANAPASSSQRSAPEIDEE
                     RTQLFAATIASKVDSLSQEYEMLLLSQLESQRLWYEAKATELERAWSKRVQELEQRLE
                     RLSKPKCSRDAATGDGAGNEFDAKLLRELNERLLRDAAAWREQVERLKRERDELAEQV
                     NDLLQHIEASAKLSARGNNSTSIRLEALRNRRITKP"
     misc_feature    complement(843728..846845)
                     /note="repetitive element"
     misc_feature    846983..849085
                     /note="pseudo-gene of L-lactate dehydrogenase"
     misc_feature    complement(848500..852495)
                     /note="repetitive element"
CONTIG      join(AP006493.2:1..852849)
//
DBGET integrated database retrieval system