GenomeNet

Database: RefSeq
Entry: NC_010138
LinkDB: NC_010138
Original site: NC_010138 
LOCUS       NC_010138             859119 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 12, complete
            genome.
ACCESSION   NC_010138
VERSION     NC_010138.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 859119)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 859119)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006494.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..859119
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="12"
     misc_feature    660..3242
                     /note="repetitive element"
     gene            <3841..>5538
                     /locus_tag="CYME_CML001C"
                     /db_xref="GeneID:16994781"
     mRNA            <3841..>5538
                     /locus_tag="CYME_CML001C"
                     /product="similar to dolichyl-phosphate-mannose:protein
                     mannosyltransferase"
                     /transcript_id="XM_005536623.1"
                     /db_xref="GeneID:16994781"
     CDS             3841..5538
                     /locus_tag="CYME_CML001C"
                     /codon_start=1
                     /product="similar to dolichyl-phosphate-mannose:protein
                     mannosyltransferase"
                     /protein_id="XP_005536680.1"
                     /db_xref="GeneID:16994781"
                     /translation="MAPAVKRRAADATAASLPASSPSAERVQAADLDVMHQGRTKEDT
                     PQHEHPGADPQKQQASPLERLVLRSTAHVRANPDAWLTGALVLLGLWTRLYRIRWPPE
                     CVFDEVHFASFAHHYLNRTYFFDIHPPLAKLTLAAVAKLAGDVPNRDWYVDKVYPPDS
                     RYYAMRACAGVFGALLPPLGFRIARGMGMSRIAATSVGVFLLFDMLNLIEARHILTDS
                     QLIFYAALCIDAFVRLWRTPPASRARRWAAVRAGLASGAALSVKWTTLVVPGLFGLES
                     VAGAALAAEPLEWSTCAIVAATALLLYVALWYPHFRILIYNGPGGDFMSAEFQRTLIG
                     RDGYDPQARKPPFLKLVWQLNKEMLLANARILDEHQWQARWHTWPYVGRGLLYWNRWQ
                     EGTLDADGRPLRPHHAMQIYLIGNPLLFWMCLAAVLGTVAAMPFLLRLIRQRKKRGTS
                     TDAWERYLRLATFLLLGYALGILPYMPIQRSTFIYHYLPSLLFAELLFAHAVLDLPAL
                     PSVLQLPLAGIVWIVVFWCFWYFRAWVYGHIALTADDHEAMRWIKYTSSVGDNKGWH"
     gene            complement(<7035..>7550)
                     /locus_tag="CYME_CML002C"
                     /db_xref="GeneID:16994838"
     mRNA            complement(<7035..>7550)
                     /locus_tag="CYME_CML002C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536624.1"
                     /db_xref="GeneID:16994838"
     CDS             complement(7035..7550)
                     /locus_tag="CYME_CML002C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536681.1"
                     /db_xref="GeneID:16994838"
                     /translation="MAAPTSCSAGKGREASASCCLEVLPVDVAFVQLHAFSVVGERLA
                     SGAERTPLSQVLPRRWTPLHPASLQDRKQAWVLGQVLQRHRSSSALQGSRVGRPQAAI
                     VQLRASLDRSALAGMSLAQAGFLVIGAREPVLLDVGPLHQVDVTMLLTGVATVGGVLV
                     GLLIAFIISRQ"
     gene            complement(<8914..>9867)
                     /locus_tag="CYME_CML003C"
                     /db_xref="GeneID:16994839"
     mRNA            complement(<8914..>9867)
                     /locus_tag="CYME_CML003C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536625.1"
                     /db_xref="GeneID:16994839"
     CDS             complement(8914..9867)
                     /locus_tag="CYME_CML003C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536682.1"
                     /db_xref="GeneID:16994839"
                     /translation="MDELPEQVLVEFRAGRAYLDSGLVHSDGRKGCVRVVRAADGLVH
                     FQWLDRATRAIEEDLIVFPGDANWRRVHACRTGRMFVLGFASSDLQLFFWLQEPRCDA
                     DVRLAQRLRNALECRPLDDPAGLDHADEVRLSDAESRPGPGLSSQVPDGATRPSSAAL
                     GQSLVDALQRLGASAASDAVHAADDASRQPQARADDTPDLGALLRWGPALERLLREPG
                     LGPASAALCREYLPSSIDLESVLQSAAFRQQLEALSTALRRSRGDAGPLFAAFGIEPP
                     PAGDWRHDLEALLEALRLRAEESARSRSEGPAPESRHGGGR"
     gene            <11304..>12884
                     /locus_tag="CYME_CML004C"
                     /db_xref="GeneID:16994844"
     mRNA            <11304..>12884
                     /locus_tag="CYME_CML004C"
                     /product="similar to high-affinity iron permease"
                     /transcript_id="XM_005536626.1"
                     /db_xref="GeneID:16994844"
     CDS             11304..12884
                     /locus_tag="CYME_CML004C"
                     /codon_start=1
                     /product="similar to high-affinity iron permease"
                     /protein_id="XP_005536683.1"
                     /db_xref="GeneID:16994844"
                     /translation="MVQLFSLAGFIITFREILEACIVVSICLAYLRRTKNERYLRDVW
                     LGVAAGVGVLIVIGIAFGIVFWTRGQKLYTGLTELLFEAIVRLVAVVLITWMIFWMLS
                     TAAHMRRDLEGGIARALSRRGRWGVALLVFTSVLREGVELIVFLFGITGGVSWSSIPI
                     AAAVGVAVALVVAWAIYRGALAFDLRLFFALSSLLLIAFAAGFLSTAFLDLQKANLFG
                     AFTRNGNEDESIPSTERPWWNAALWSTEACCADDGNEFFNLLHELFGYVDAPTFVSTV
                     VYFGYWTLAGVLWIIVERRTLERKLCQMHTGYLVSTAFLAVAAMVGLVVAARSPTWNG
                     ILVTCLTQVLAIIGVGAASAPHAALPPRARFALQGSCWIGLVLVACLALALQVAQAIC
                     SPQIGASQYCSIPDFYYWFVIFSPDWIAKTRDDNSFHALAVLTVSICFTMLFCLGQGL
                     VGFYEWKRSALAMQRAGQAPAALAKEANTSSDLEGGKSTPLDDSSIDELTWEALDSTQ
                     PPQHASQIEISARRMLAD"
     gene            <13229..>14464
                     /locus_tag="CYME_CML005C"
                     /db_xref="GeneID:16994845"
     mRNA            <13229..>14464
                     /locus_tag="CYME_CML005C"
                     /product="similar to dTDP-4-dehydrorhamnose reductase"
                     /transcript_id="XM_005536627.1"
                     /db_xref="GeneID:16994845"
     CDS             13229..14464
                     /locus_tag="CYME_CML005C"
                     /codon_start=1
                     /product="similar to dTDP-4-dehydrorhamnose reductase"
                     /protein_id="XP_005536684.1"
                     /db_xref="GeneID:16994845"
                     /translation="MHCYRTVKNARAMRIPFLAILKDNGSSSTQYLSMQESRRSHQAA
                     QRLQRPARLPDETPGARPDQIPETRHARETWGSTVSPASRRVHSSDIQNFPQPGHECQ
                     QVASSMPDESAQVRFLIVGRTGWIANMVAELLEQRGERYAFASFRLEQREACERELDA
                     LCPQRVLNCAGVTGRPNVDWCEDHRRETVRSNVLGVLNLADCCASRGIHLTNFATGCL
                     YHYDDGEHRPTAEGGRPFTEDDPPNFFGSYYSRTKAMVEELLRSAFDNVLILRLRMPV
                     SDDLSPRSFVTKIARYEKVVNIPNSMTVLTELLPVALDMSERGLTGVYNFTNPGSISH
                     NEVLELYRKYIDPKFQWKNFTLEEQAKILKAGRSNCELDVRKLLRDNPGAQIREVHAA
                     MEEVFRRMQAKGVKPLVAP"
     misc_feature    complement(14295..15966)
                     /note="possible transcribed region"
     gene            complement(15578..17590)
                     /locus_tag="CYME_CML008T"
                     /db_xref="GeneID:16994847"
     misc_RNA        complement(15578..17590)
                     /locus_tag="CYME_CML008T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461402.1"
                     /db_xref="GeneID:16994847"
     gene            <15676..>16806
                     /locus_tag="CYME_CML007C"
                     /db_xref="GeneID:16994831"
     mRNA            <15676..>16806
                     /locus_tag="CYME_CML007C"
                     /product="dTDP-glucose 4,6-dehydratase"
                     /transcript_id="XM_005536628.1"
                     /db_xref="GeneID:16994831"
     CDS             15676..16806
                     /locus_tag="CYME_CML007C"
                     /codon_start=1
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="XP_005536685.1"
                     /db_xref="GeneID:16994831"
                     /translation="MSSQSTALSNGAKSVTGGQPDGNSDARVVYGDRLRFVPRNILVT
                     GGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIRGDIRSHD
                     LVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGKVRRFI
                     HVSTDEVYGGESNMETESSILAPTNPYACSKAAAEFICRGYVKSFGLPVIITRGNNVY
                     GPHQFPDKLIPKSICLLAQRRPCFVHGSGEHARNFLYVEDAASAFDTILHCGETDEVY
                     NVGSEIEKRNIDVVHDIIDLFGLSAEANRHIEFVKDRTLNDMRYRIDSSKLHALGWRP
                     QVSWEEGLRRTKTWYCDPNNLKRWPNYLSGLVPHPSLTEEKH"
     gene            complement(<18282..>20915)
                     /locus_tag="CYME_CML009C"
                     /db_xref="GeneID:16994848"
     mRNA            complement(<18282..>20915)
                     /locus_tag="CYME_CML009C"
                     /product="probable vesicle transport related protein SLY1"
                     /transcript_id="XM_005536629.1"
                     /db_xref="GeneID:16994848"
     CDS             complement(18282..20915)
                     /locus_tag="CYME_CML009C"
                     /codon_start=1
                     /product="probable vesicle transport related protein SLY1"
                     /protein_id="XP_005536686.1"
                     /db_xref="GeneID:16994848"
                     /translation="MLKSRFRLLALHSLREHHIWMTGTRQTEKPAHIYCSSAVKVLYI
                     ISLMTASFLLLVNVESLPRAAGALDCGGIAAAAIPAYAQTHGGVDGRRLPPCLLPAGS
                     QPQKATMLTRAEPSRHSDLATQLKSLAKTWFSLRDRQKAVLCEALSNPLRGAEAATGH
                     SAANGALHGQLNPGYDAAAATVDDLDAEDVYRDFWKVLVIDQTAREVLAPVLKVPTLR
                     TCGVTLHLNLESSRQVIPEVPAVYLIQPNHENIQTIVRDCAADRYAHCSIYFLSAISR
                     DELERLAEALARARRIESVTRVVDLYCGFVCLKRNLFSMPPSIARRSFQRLFSAQADE
                     QAIQETIATIVDSLFAVCVTLRCVPYIRCLRRGASERVALQLCAKIWEYMHTPGGAAL
                     FREHSEAGLPPLRRPLLALLDRDVDLAIMLHHGWTYEALIHELLPFELSRVSMPATKP
                     GTERTQYDLDDEADPFWAENASLPFPQVAEHIETALTAYRAQVQEINARTGGGSNVQK
                     LLAETADETQLEAYMQATGTSTREIADAVAELPRLTRWKRQLDMHTNIASALLEQIKA
                     RKLDLLFQLEDSLLERPSSVQSNSLDRFIGEADLLAKPHSSTASADASSLSQRARDCL
                     RLLLMYQILSPSGIPQTKLAEYRHVLDICGCQTSALSYVMRQRAATPRQLDPAATHRD
                     GNSPSPARKSSSRMIDRLTTATGGGREIFESLVTRIYEHGHKGLTQLASTVKGLIPTT
                     RSGIVASIVDSWMRNASPDDDLDSASRGAEHEHPGAAAERAASLLLDPLAARDGHCTN
                     KASSLPRGSFTEAIVFMVGGGNFIEWENLTTRIHDDRQIIYGTTEMLSPEAFLDDLTA
                     AAAAATNASEDPKPPQPSNGL"
     gene            <21347..>22687
                     /locus_tag="CYME_CML010C"
                     /db_xref="GeneID:16994832"
     mRNA            <21347..>22687
                     /locus_tag="CYME_CML010C"
                     /product="similar to DNA topoisomerase VI subunit A"
                     /transcript_id="XM_005536630.1"
                     /db_xref="GeneID:16994832"
     CDS             21347..22687
                     /locus_tag="CYME_CML010C"
                     /codon_start=1
                     /product="similar to DNA topoisomerase VI subunit A"
                     /protein_id="XP_005536687.1"
                     /db_xref="GeneID:16994832"
                     /translation="MRTGPQISAAAVTKWTCWQRQRQLERMAVWIVASLAAPGAKQVR
                     EARYEHRLRFSTEAVPLWKLTMLLVRLYHSSWHAGSRESTYLRELFYRLVPVFDSQQE
                     LTQYLDRLLAAARISRFSLGIIAESRGWVFFGSGIQLQKRSIENERPRYVQSEAANAR
                     LCTPHRGLMPIPDDIVLDPGAYQLVVEPRQDLVVVILIVEKFGVFRCLVDEGFASILP
                     VLTILVTGGGQPSLATRALVAQIARCLEAHHAAFRSTNAPHTYPRFDIYVITDYDPYG
                     LCIARQYRRSLAAALPQFTADSKFTRLPRWIGPRACHLFRARSSRANCELLRAKSEAD
                     QSPLMRGPMPSQRALVLARNIFAEAVLQGDSLVAEELHNMIGSQLYTDPSMLKLARNL
                     PWIDGCPGAAGDGIGTHDLHTLVLLLGPGGFARDFLPRLILETRQEELRKSLGL"
     gene            complement(<22738..>23052)
                     /locus_tag="CYME_CML011C"
                     /db_xref="GeneID:16994834"
     mRNA            complement(<22738..>23052)
                     /locus_tag="CYME_CML011C"
                     /product="transcriptional regulator bolA"
                     /transcript_id="XM_005536631.1"
                     /db_xref="GeneID:16994834"
     CDS             complement(22738..23052)
                     /locus_tag="CYME_CML011C"
                     /codon_start=1
                     /product="transcriptional regulator bolA"
                     /protein_id="XP_005536688.1"
                     /db_xref="GeneID:16994834"
                     /translation="MRAVMRTLAPVRERIESKLRSALQPQVLRVVDESDLHEGHASKP
                     AHGETHFRVAIVSAQFVGLSLRERHRRVYQILDQELAESVHALQLETRTPAEASDLLA
                     SK"
     misc_feature    23795..26320
                     /note="possible transcribed region"
     gene            complement(<24401..>25660)
                     /locus_tag="CYME_CML012C"
                     /db_xref="GeneID:16994563"
     mRNA            complement(<24401..>25660)
                     /locus_tag="CYME_CML012C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536632.1"
                     /db_xref="GeneID:16994563"
     CDS             complement(24401..25660)
                     /locus_tag="CYME_CML012C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536689.1"
                     /db_xref="GeneID:16994563"
                     /translation="MITRSRSKRYQTEDGCPVSSQDTLELGSADRLTVEIQTPGRGQR
                     ERRGAHSRGDPTGTSSACVTPQQTIKVLALESPGLPSVEFGLGVHSGPTCAGGVESVP
                     LTARAARELRRLGFDVPSPLPSRTSKGTPHVRATKACHMDSELTPASLQKPIATAMPA
                     VTLDTPDSARSLCAERSSENAGTSAACTGAASERITELERKLWQAAKRNDEQRSPLCT
                     RYAGCPSDDIEKLEKPRIGASSVVVAMNAQESHEATEETHSVQPARSVSSHDAFEDDA
                     ALARPAQENEPSRSEAREPDARHQRQGSPQQNKTKISAGRISVNGGACNSPNVSEFTH
                     VCPPSVSPLKSGIADSTQRSRSKRVRKMNGLRQESAFACGKSPGTSITLVLHHQFRAS
                     AYAPWRLRWRRRFGRRRRYHGRWLIVY"
     gene            <26857..>27654
                     /locus_tag="CYME_CML014C"
                     /db_xref="GeneID:16994545"
     mRNA            <26857..>27654
                     /locus_tag="CYME_CML014C"
                     /product="lipoate-protein ligase B"
                     /transcript_id="XM_005536633.1"
                     /db_xref="GeneID:16994545"
     CDS             26857..27654
                     /locus_tag="CYME_CML014C"
                     /codon_start=1
                     /product="lipoate-protein ligase B"
                     /protein_id="XP_005536690.1"
                     /db_xref="GeneID:16994545"
                     /translation="MRSKCILRTLQAATVQAVPKYGLRECWFYDFGDRLLPYEPVHRW
                     QQQLRAIRLGRSGEAPATTLRFPDAFMLLTHTPVYTLGTAASPGDLGSALQEASCAVV
                     RTERGGKVTYHGPGQVTGYAIMNLRRYRCDLRWYVSLLEEVVIRCLRDFGIPGERRSD
                     HHGVWVAGGTRKIAFIGVSVSRWVTCHGFALNVNREVLPPFRRIVACGLDGNTVTCMQ
                     DLLPHPNTCSTEQVRNSLATHFSELFDVALKPYAPSAASGTDSRSGT"
     gene            <28521..>29096
                     /locus_tag="CYME_CML015C"
                     /db_xref="GeneID:16994564"
     mRNA            <28521..>29096
                     /locus_tag="CYME_CML015C"
                     /product="similar to ferredoxin"
                     /transcript_id="XM_005536634.1"
                     /db_xref="GeneID:16994564"
     CDS             28521..29096
                     /locus_tag="CYME_CML015C"
                     /codon_start=1
                     /product="similar to ferredoxin"
                     /protein_id="XP_005536691.1"
                     /db_xref="GeneID:16994564"
                     /translation="MKRTAFAPGLPLNRRRLVRTAPRATGAGTARKPAQRPLVAGTTA
                     SNGAAPVRGIATRKRRGGALPGDPAAPKHNVTILNYRDDESLTLAVPEDRYIWWYFRE
                     NGYELPSSCLNGCCTTCAAKIVRGSLEQPEALGLTREFRDKGYCLLCVSYPRSALVLV
                     LQSEDEVYEQQWATTFESGGKRWGGLIPEED"
     gene            complement(<29339..>30595)
                     /locus_tag="CYME_CML016C"
                     /db_xref="GeneID:16994548"
     mRNA            complement(<29339..>30595)
                     /locus_tag="CYME_CML016C"
                     /product="probable DNA-(apurinic or apyrimidinic site)
                     lyase"
                     /transcript_id="XM_005536635.1"
                     /db_xref="GeneID:16994548"
     CDS             complement(29339..30595)
                     /locus_tag="CYME_CML016C"
                     /codon_start=1
                     /product="probable DNA-(apurinic or apyrimidinic site)
                     lyase"
                     /protein_id="XP_005536692.1"
                     /db_xref="GeneID:16994548"
                     /translation="MSRARLPPLLYTAVVRLRTAVGIEPLIRGMASSTRAAVNPDTAR
                     LLVSARRQKQASFPLVPLAMAGEGERKRRKTVQRSPKDEKKAEKGNAVQNAGRGELRD
                     TGKESPADVPISSSGRPWGAPQDPKVAKLASYNIASLRSALSRSKHLFDAFIVHECPD
                     LLTVQEIKVSEPIPEAIKSALQEHYETCLFHPCRSKRGYSGTALFLRKGSCLGEPVRV
                     QYGFDPELGVEDSEGRVIIVEFSSCVVCSMYVPNSGEGLKRLDYRIRVWDEAVRAQLK
                     RLGQGTGKPIIWCGDLNCAHQEIDIWNPEGNRRSAGFTDEERASFSQTLQECALLDTF
                     RWLHPSVRAYSYIGYRHVQNYFQNRGWRLDYFCCSASAAAHIVDSYIRFDIEIYGAAF
                     QQTQVKREEVRRLSDHCPVVLLFRTV"
     misc_feature    complement(30697..31656)
                     /note="repetitive element"
     misc_feature    31530..32513
                     /note="repetitive element"
     misc_feature    complement(33161..36063)
                     /note="pseudo-gene of triacylglycerol lipase"
     gene            <35509..>38457
                     /locus_tag="CYME_CML020C"
                     /db_xref="GeneID:16994594"
     mRNA            <35509..>38457
                     /locus_tag="CYME_CML020C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536636.1"
                     /db_xref="GeneID:16994594"
     CDS             35509..38457
                     /locus_tag="CYME_CML020C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536693.1"
                     /db_xref="GeneID:16994594"
                     /translation="MNSELDQRDTAFSRDEFSLLLAEPALKSLEQRCTDSELREWLSL
                     LVAHYRTTEYPEPRFLDDTLETLRRCIANAVEENREAQLPEGDIYDSAGETAGPLALE
                     LLLSSLDLIAKSVLKNAALEMPRDHGTSEASDRSAASKAAGKHASAVRSTASTALRLL
                     SGLFSADDSRVGPATSDAPSESALHVLLHKLPCLLQLVADGYRANPALYRRCKSFVNS
                     FLAEHLTAYSCALCIASADISEGNVLPTSASLGFLESIIKLSTGSDTVPPAVLCACIS
                     KLTTAIALEQAQQGQASSRNAGASQSILTDPSLSTLPRAGLALSEVASGKASNAPMAN
                     SKALAAEHRQSALQSREQRRVLAVFLAGVSAENLKRLQNLHGHALIVLQLWIDHIKPS
                     DLAADEMLSAFSMLMDATIRYYREPVCPLLLLQAVQSFVYRCSSERAKYPLTFLDRIR
                     AAIETVIGIAGEDWQPLGARDPQQTQHERSVRFAFSSLGLEFLTAYAIPLVEAVFRED
                     KTMRRKLISAISVVALRILKAPSPEDPENTPPAIVRELTAALDPRLHSLGRGLDAMAY
                     DCDIQIYADVAAGWRPCFEGDLQVAYKTRAALLIYKLLEPSMLDDFGNEVTESSESGG
                     RSQWRVKDLQERLVSAFEDIAFFRFKNRMMLLLLGQSLGAIFRHSDSLQIALIGESST
                     RNQSQSVTTAALFQARDVSADEARSLRRIAFMLFHSRVGEFTSQSRSLLRRIESDWRK
                     NDAKVSAACFLLLRVMLLRFPPEHLLGSRATLLSETLRILRGATGEPIAALGAIKFVD
                     QLLLLNMPEFSYVLPMFLAIEPYADGFAPEPLLSRGIFAENEPFRKPAQSIGTLLPPY
                     AVGQSAKRQGKPILVELAAGVEDFGDALPPEAGRPIRIDPQRFLRSRQNHLSVSAKET
                     PQSSRSVSPTEALRALRSYALHLESSNEQRRCVYILALCYVRATRNQRRELDSDMNST
                     AFQVLLEGIV"
     misc_feature    complement(38699..41013)
                     /note="possible transcribed region"
     misc_feature    40706..42564
                     /note="possible transcribed region"
     gene            complement(<41909..>44488)
                     /locus_tag="CYME_CML023C"
                     /db_xref="GeneID:16994580"
     mRNA            complement(<41909..>44488)
                     /locus_tag="CYME_CML023C"
                     /product="transitional endoplasmic reticulum ATPase"
                     /transcript_id="XM_005536637.1"
                     /db_xref="GeneID:16994580"
     CDS             complement(41909..44488)
                     /locus_tag="CYME_CML023C"
                     /codon_start=1
                     /product="transitional endoplasmic reticulum ATPase"
                     /protein_id="XP_005536694.1"
                     /db_xref="GeneID:16994580"
                     /translation="MTPSEHDTGKDPALGTDAAGPSTEKKKPGDYLTAILDRKKAPNR
                     LIVDEATQDDNSIVCLSPAKMEELQLFRGDTVLLKGKKRRDTVCIVLADEECEDAKIR
                     MNRVVRNNLRVRLGDLVSVHTLPDVKYGRRIHVLPFADTVEGVTGNLFDVYLKPYFLD
                     AYRPVRKGDTFLVRGFRSVEFKVVETDPDEYCIVAPDTVIHCEGEPINREDEERLDDV
                     GYDDIGGVRKQLAQIRELVELPLRHPQLFKSVGIKPPRGVLMYGPPGCGKTLIARAVA
                     NETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKSH
                     GEVERRIVSQLLTLMDGLKSRSHVIVIAATNRPNSVDPALRRFGRFDREIDIGVPDEN
                     GRLEILRIHTKNMKLDPDVDLERIAHETQGFVGADIAQLCTEAAMQCIREKMDIIDLE
                     DEKIDAEVLDSLAVTQEHFNFALGTTNPSALRETAVEVPNVTWEDIGGLENVKRELQE
                     TVQFPIEYPHLFEAYGLSPSRGVLLYGPPGCGKTLLAKAIANECQANFISVKGPELLT
                     MWFGESESNVRDVFDKARQAAPCVLFFDELDAIARSRGGSLGDAGGAGDRVINQLLTE
                     MDGVGARKNVFVIGATNRPDTLDSAIMRPGRLDQLVYVPLPDHKSRVAIFKANLRRSP
                     VAENVDFDELATATQGFSGADITEICQRACKLAIRETISKQIEKKRADADIQAMETDS
                     GPTAVPVLDEEPVDALLTRAHFEEAMRHARRSVNDADIRKYEMFAQQIQQSRGFGEFK
                     FSDASGTGSGPGLSSETAARFGSGGGGAPGSAPGAGGGGGSGGLAGTGNNNNNAPDDD
                     LYS"
     gene            <47346..>52496
                     /locus_tag="CYME_CML025C"
                     /db_xref="GeneID:16994575"
     mRNA            <47346..>52496
                     /locus_tag="CYME_CML025C"
                     /product="similar to CBL-interacting protein kinase"
                     /transcript_id="XM_005536638.1"
                     /db_xref="GeneID:16994575"
     CDS             47346..52496
                     /locus_tag="CYME_CML025C"
                     /codon_start=1
                     /product="similar to CBL-interacting protein kinase"
                     /protein_id="XP_005536695.1"
                     /db_xref="GeneID:16994575"
                     /translation="MGQQQSRTLRNPSGHLQDASRDEETGAVTDSPKTNCCPRLSQTL
                     DSGEAQGAETLRDAAGPSEGSGGATVGRSHHTTPLLRATSAAAALATGNPRGGASEPG
                     GPGEGVQGTIGSPGLTYSRFHLMQIAAGRPLDAVTIVETVYGRMVGLGAPAPPELSEA
                     RTASSLTVGEANMNLSTLQPTSYPNTFNAALPAVEPPVLVLDESSEPVAGFQPLHGRV
                     VSNSATTVHESVPVQYAESDAKAGIAQSAGVQIARLRAHARQEAADDSRSSASPESSE
                     EAGALSVSLPSSPQLSRISSWRKSQPRDHRFMKDGVRYSRSMRHQSSSLSLRSLGRAD
                     TMDDEAAREPSLLETGTPSQSQTCFQVRSEEESFAGPRTVSEKGMRAALSNNATGMAT
                     ILEAKTSMDPSIQAEQSAAISAQLESAPPKTSLGSPPRSAPWRPADTATESKELRVGA
                     SGDGYAPEVHTAQDHALFGNYAAYAPDATFSFATAIPVSVATLYFADPDKRGIFYEKS
                     LASILHKWQRFREECRRDLTLRSRTRLRALKAAALFSTSVVKSRGILTLKSVRRCVEH
                     VDVRRIYLGQTNNRAQIGPEAATSLDFDTWNDTEGDPDADSASSDNQANAEDETAEDD
                     DEENPPQQQQQQQQQSSENAAAYAAGRVMQDLPGSMQHASASSSAVPAADRVGACDSH
                     QDDQDTRMSDDESDEDEDFDESDDERSSFEDSDSTSNDSSVVLRRTPANHASHGVAAR
                     DQRSAPASEAPIAQAADSASAPNNLLAERTPQASSSEAYRQMQTSASAQTSTTSATTT
                     ASSTTARAQRSSATGRSRELAQSDWIQAQVKEVERLERRANRWQLYTIHKLLPWGEDR
                     ICDKFDQFDLGAIRRTRSWPTMDPHDASAHVDHTALMAGTFIERQTAAGFEHFDLTEA
                     AISLEAAARMLRHDIVKLAEIMEDNDEERKNFSVWLLRLATGGRIRNELQTPETLQGL
                     RCANPSVSSAEQCTLHTHTQNGRAPTSTPMASASLVGASTRQLMPAAVPPGACLDERS
                     TMRSAEDEIQSGNIVDMHGIAAVLRMLWEDCIDVFEADFANRRHDDLAFPNDETTEAF
                     RRLLDNIVDSFSPAASLSVSHRDSRHFLTTEEFMSLADLLTRMYVRQKNRMECVGRYE
                     IGRLLGRGSEGRVHVARDIYTGRRYAIKMIRRGKFVEFARIDREVQAMQVVARHPNVI
                     HLHEVLESRRNVYLVMELCGGGSVYEFAYARLCRTSEQLDRNKPEPLLDEAEVRFLVR
                     RLVETVAFCHAHGVSHRDLRLNNLMLLDSGELKIADFGQVGLFSAGWDMFETNLVGSL
                     YNLAPELVQGQVYQSTKVDVWSCGVILYWLLEGHPPFPEEDLNRLIPAIVQCRYAPMR
                     LASPLAQDLIRRILVPPAERPEAAALLAHPFFTGVEADSPAAADTTPKPTTASAAAAG
                     GMSAAAPDGTVAGTSTANAANALGYSRVRGSDPAWERPLQMDVRDFALCDASILQSIE
                     ADGGSLALQTMSSVLSDGDIHFHPGLCVELHRRYRWTLRCYWPEHDIKFSVALVAGPP
                     RDDDGYLCCCGGEFQYHRRAFASRAQRPPLVYTLSFRRRGGGSLLFMRAVCKIADRFY
                     QRYRRLLQTPNRWKLDTSDQKTLPVGVEVSPETNEAPAGAAVGIAGGRGSLESRLNPS
                     RFSRPVRRLLYRLHLSSAASRRGTPSQAQSPTTNSGAQRIPSENDDAV"
     misc_feature    complement(47831..49832)
                     /note="possible transcribed region"
     gene            complement(<52719..>56747)
                     /locus_tag="CYME_CML027C"
                     /db_xref="GeneID:16994576"
     mRNA            complement(<52719..>56747)
                     /locus_tag="CYME_CML027C"
                     /product="sister-chromatide cohesion complex Cohesin,
                     subunit SMC3"
                     /transcript_id="XM_005536639.1"
                     /db_xref="GeneID:16994576"
     CDS             complement(52719..56747)
                     /locus_tag="CYME_CML027C"
                     /codon_start=1
                     /product="sister-chromatide cohesion complex Cohesin,
                     subunit SMC3"
                     /protein_id="XP_005536696.1"
                     /db_xref="GeneID:16994576"
                     /translation="MSTSMANRNARRHSRARVRYWRGALGCALHRVLVSSRGAIAGPF
                     TTARQRTRLMHIHSIRICGWKSYKDETFIGPFHEGLNVVVGRNGSGKSNLLEAVRLLL
                     GDAGPGLNAEQRSALLHEGPSGRVLSAFIEVTFDNSDGRLPIERSRVVLRRMFGLQKD
                     EYLLDRRSVSRAEVTALFESAGFSRSNPYYIVQQGKVAALCTMKDDQRLELLKEIAGT
                     RTYEEKRAESLRILEESIGKRAKIREILEYIEKRLQELENEKEQLVAYQQVDRERRSL
                     ERAIYERELTELKTQLESLEHERQHEGVQLGKMHQECRRLEVELEEIEQRIAEIERER
                     ARLEVDQSSVKLELVKAAEQRSALETELALVTQQLENETIELDRVEQKIQTLRQAAQQ
                     RRAERDRILPEYERLREQEQHLRTAMAMTQQELVQLQARETRDVQFRTVDECNAWFHN
                     EIARNEELRHETRSQLQETEREIHRLEFELSSIAERRKTNETQFASDREQLNALNARL
                     AELKRERNEAHRARQELWRREAELESSRATLLSELTESERRKRMSVGSKFLNAYQYIC
                     NLQYSGTIYGPLYTLFETDEKFYVAVEAAMGSALCYIVVDTDETAAYLIQRLREANAG
                     RLTFIPLNRVRDDASDAAKRNSMSPPPTEEAVPLVSRLRLRDERFSPVFERVVAGTLI
                     ARSILIASKLARGYNVPCVTLEGDLVNKRGAMHGGYTDRRQSRLASLLRYDKIRIQIQ
                     QIESEREQIRAQLAALESQIQRTMNELQKSEAEKRNLFNQLRDHQRALTQLDREKLSI
                     EAALETERQRMQTLQRHVHEYELVLSSLRDEFSERTAALSSSSSSPTPQTAISADAFV
                     ARLAALEKELESVAAARATLEQRLVEIESELETCIERQLRELEKRFLRETFEDAPELF
                     DSASGISVPVALQSDPDEAPPSIAELQTRQTSLRRELETLGSVLQAQRVSQDRIAEAL
                     QRTATELDALARKRDSLEAQLPVAKEALATESQRLQIHVARHTHLQQRKAETERKLRE
                     LGPAPAQHHELAHVPLTTLMQRLEATNTRLSQLGQVNQKALEQYLVFANQREELRTRL
                     EELDRGDDSIRTLIHTLDHRRANDLQRTFKGIARLFSAVFAELVPGGTAQLVMQRGPH
                     PTASDTTDTNVDFAGVAIRVRFPSEDHFSLMAALSGGQKTLVALALILAIQRLDPAPF
                     YLFDEIDASLDAASRERIAALLQQRQPGPDAGHGTEASAARSSVSRPQLILTTFRPEL
                     VRVADRCYGVTIRGRVSCVEPVSVAEALAFVTGPASLPIDATNEQVAILAPTGDTESG
                     TAPDMQPVAGGERTSLLQASYE"
     gene            53524..55401
                     /locus_tag="CYME_CML026T"
                     /db_xref="GeneID:16994690"
     misc_RNA        53524..55401
                     /locus_tag="CYME_CML026T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461403.1"
                     /db_xref="GeneID:16994690"
     gene            complement(<60154..>60993)
                     /locus_tag="CYME_CML028C"
                     /db_xref="GeneID:16994628"
     mRNA            complement(<60154..>60993)
                     /locus_tag="CYME_CML028C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536640.1"
                     /db_xref="GeneID:16994628"
     CDS             complement(60154..60993)
                     /locus_tag="CYME_CML028C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536697.1"
                     /db_xref="GeneID:16994628"
                     /translation="MDQLGDHDVSAASQLQASASTKEATRVCELGDVQYWEAFYANEL
                     EQFEENPEVLEDWFQRWTRPHLGRWLQQTAGCDVERLRLLDVGCGNGEFLRELAHKYG
                     FRRLYGFDASIYGVRVAKRSFVQLWDESVRKEVQLDLQVSDVLTYSPPTSDGHVEIVH
                     DKGTLDAILLSGDMAKVHAYIGRCIFEWLNPIKNKSMLVITSCNCTAAELEHLVMSVF
                     KSHWRDASDQGGSPGCVLRCLEEVPRYRELQYGGQRGSAVVTSAWTWQSPGDIIIKSP
                     TSV"
     gene            <64700..>65734
                     /locus_tag="CYME_CML029C"
                     /db_xref="GeneID:16994691"
     mRNA            <64700..>65734
                     /locus_tag="CYME_CML029C"
                     /product="mitochondrial F-type ATPase F1 subunit gamma,
                     precursor"
                     /transcript_id="XM_005536641.1"
                     /db_xref="GeneID:16994691"
     CDS             64700..65734
                     /locus_tag="CYME_CML029C"
                     /codon_start=1
                     /product="mitochondrial F-type ATPase F1 subunit gamma,
                     precursor"
                     /protein_id="XP_005536698.1"
                     /db_xref="GeneID:16994691"
                     /translation="MQGVRAVGLSSVRRVYAAARAHVQSSTPGGGGGGGGGVGNFLSS
                     SNEKALGGVRFASLKAVRNRMRSIASIGKITKAMKMVAAAKLRGTQARQDLSRPFAAS
                     VRQFFDLLPLEKLGSETKAGVAEPKRRLLVVITSDRGLCGSVNTNVCRLARQMLPHGA
                     ASPVSDGVETNIMVIGDKGRDALQRTSAAFFTTTFRDVFKAPVSFPQAVIIAEEILAQ
                     SPDEVVIFYNRFKSAISQVPTQQPLLGLQLLMDNASVFDGYEFDSDMDSSQVMVDLFE
                     FEVATQLYGALLENATSEQAARMSAMDNASTNAAEMLDKLTLQYNRERQAVITTELVE
                     IVAGASALQK"
     gene            complement(<66055..>67338)
                     /locus_tag="CYME_CML030C"
                     /db_xref="GeneID:16994694"
     mRNA            complement(<66055..>67338)
                     /locus_tag="CYME_CML030C"
                     /product="DnaJ homolog, subfamily A"
                     /transcript_id="XM_005536642.1"
                     /db_xref="GeneID:16994694"
     CDS             complement(66055..67338)
                     /locus_tag="CYME_CML030C"
                     /codon_start=1
                     /product="DnaJ homolog, subfamily A"
                     /protein_id="XP_005536699.1"
                     /db_xref="GeneID:16994694"
                     /translation="MFGRLSGRGQVNNTAYYELLGVSRDATTEEIKKAYKRMALRLHP
                     DKNPDADTQEKFKELTVAYEVLSDPEKRRIYDELGEEGLKEGGGMPGFRDPMDIFEAL
                     FGGGLAGRSRGPRKAEDVVHPLRVSLEDLYNGKTTKLAIQRKRVCTACKGSGASPDAP
                     RNVSFTCSGCRGTGMEVRIRQLAPGMVQQIQSVCSECSGSGRSVPRKYQCPTCKGERV
                     IEDRAVIEVHIDKGMSHGQKIVLRGEADEEPGVEPGDIVVVLQQKSHPVFQRQGSTLL
                     MEQPIKLVEALCGVCFTIRTLDDRTLVVRSRPGEVIDGSMPLKTIAGEGMPIYRRPTQ
                     HGVLVVKFKIEFPRTIELKYRPALEEALGQRCAEPELDGVDGSEKEDVELIDFDESQL
                     RAGMDEGPRDIYETDDDHGANGIPGGAQRVSCAQQ"
     misc_feature    67643..70585
                     /note="repetitive element"
     gene            complement(<72694..>74028)
                     /locus_tag="CYME_CML032C"
                     /db_xref="GeneID:16994759"
     mRNA            complement(<72694..>74028)
                     /locus_tag="CYME_CML032C"
                     /product="sodium-dependent transporter"
                     /transcript_id="XM_005536643.1"
                     /db_xref="GeneID:16994759"
     CDS             complement(72694..74028)
                     /locus_tag="CYME_CML032C"
                     /codon_start=1
                     /product="sodium-dependent transporter"
                     /protein_id="XP_005536700.1"
                     /db_xref="GeneID:16994759"
                     /translation="MPRYSLHLGELSFLTTCAGYSRIWSPATRWSGRTNPVGKSLRQG
                     VPRQQPVAALPAPLRLRGCQFGSSDRDDMQKLQAKSSLSGSGAAGSPLGSAAGGSALA
                     PSTTLESSSPVRASLWERFVRYSTLATNLFPLWTLISAVIALRRPETFLWVSTSYFTL
                     GLAILMLSMGITLTPRDFARVLRRPGAIGVGFLGCYALMPLLALLLGHLMGLSPELIA
                     GLVLVGSINGGQASNLCTYIANGNVALSVMMTTCSTIGAIFMTPFLCKVLIGAVVSVD
                     ALGIALSTLQVVLAPIATGMLLNRYANRIVQRILPFSPLIGVISTCLLVGSAVAQVAQ
                     PILAAGLSLQIPVFLLHLLGGGLGYFIPRFLGYNEVVCRTIAIETAMKSSAFGFLLAK
                     LHFKEFAVRVPSAVSVVWMALMGSSMAVLWRYIPVKRTTRFDRTLLRRKLFK"
     misc_feature    74178..74913
                     /note="possible transcribed region"
     gene            complement(<74686..>77301)
                     /locus_tag="CYME_CML034C"
                     /db_xref="GeneID:16994766"
     mRNA            complement(<74686..>77301)
                     /locus_tag="CYME_CML034C"
                     /product="similar to vesicle docking protein SEC34"
                     /transcript_id="XM_005536644.1"
                     /db_xref="GeneID:16994766"
     CDS             complement(74686..77301)
                     /locus_tag="CYME_CML034C"
                     /codon_start=1
                     /product="similar to vesicle docking protein SEC34"
                     /protein_id="XP_005536701.1"
                     /db_xref="GeneID:16994766"
                     /translation="MKVAEDTFARWESLDAVYDGDPALRETQEQLFLRARELFSRADF
                     FETVAEDDQESSVFRADTSGDFTPEQESALGTELDVIDLQLEDVRRSALERIQHDIEV
                     DLERVRNALEQVQSFLTTLEEMETRCTQAQKDLSMFRATLKDAYTKKTVLERKAQSMR
                     ERLELWEELERLSQKLDTVEMASLRTSSLDADGVGNDIHDVLVALGMCQERMQHSGAL
                     AHSAELAAAHGSSNSSNSVWSATEHDRLEKILQRARELTCSHLGVLVRHLTSGLAMEL
                     SRLPADQRRLQAPDREDAIVNLRFRQLSKQTRQFMDAICNLAPADSPETMQFFAKCEM
                     LFVEQRRRLVLPLAQEQARLAASAEELDLAARSTTTMLLKVCTMELQLFQALMLPSSE
                     TTQDMLLRVSLGAKAQPLSALRQWLRSIADLISIYILPRVLQESDLDALVRCIDFLQK
                     EAMETELSRSTSDLVASCFTEPVTSLLADTRERTIYRAQLFIRDQILRFQPSDGDLQA
                     LYAHFQRPNRGHGPQQLSLEGPNTQPVTSTPSSAVYRATLLTLQVLALLHGRIDALVF
                     AGLAREAIEACIRNLQTAARRLALLEPPASRESLEPDKSSVLALASLRKASAPGQTQG
                     SVQRSPLSSPRLDPHAATSDSAELFYLKQLLILHQNLMLFEQLDIVDQERQLRYLSFD
                     EFRAGVSRIIRGQVSLRHLFGSVRDLIPKRMDLNSKETLRDELRAAYEAVVFRALREL
                     LQPLLVFLAEVAASSNVAALKGEAGTTATVDCVREIWATVLLRFDRVPIDPNLETQPV
                     ALRQILDFWQRLFGPHGSRVLTEILRENVQEVLSEFVAVLHRHYSVEERRAVGVDAER
                     VRALMEAFAPDAPSQ"
     gene            complement(<79102..>79971)
                     /locus_tag="CYME_CML035C"
                     /db_xref="GeneID:16994767"
     mRNA            complement(<79102..>79971)
                     /locus_tag="CYME_CML035C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536645.1"
                     /db_xref="GeneID:16994767"
     CDS             complement(79102..79971)
                     /locus_tag="CYME_CML035C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536702.1"
                     /db_xref="GeneID:16994767"
                     /translation="MLRTEHYAFLPCISRALEERDSLGIRRELRARQQRLSMQQSRSK
                     LGRVCVTGANSPLGQELVGALTRTPDPSLRPDAIGVIGARDPIESHSAGAGLHFPGPG
                     VDFLECAATDLEHYNPRTLFSINDDDLGLRRRSIFRENQVVIDLLRAQGETNEPRSKT
                     RLVLVTLLGCGDSEDAIPSQAFDVLRPLLLELSRVEQYVRESGLPYTIVRPGALEHGD
                     ADSRAIVSESKVGFGTIHRSTLAHLLLNVAASEKAVNKTLMALDMNRLLVAAPYVRPF
                     EVWESPPFEVFDL"
     gene            complement(<81691..>82878)
                     /locus_tag="CYME_CML036C"
                     /db_xref="GeneID:16994799"
     mRNA            complement(<81691..>82878)
                     /locus_tag="CYME_CML036C"
                     /product="6-phosphogluconate dehydrogenase"
                     /transcript_id="XM_005536646.1"
                     /db_xref="GeneID:16994799"
     CDS             complement(81691..82878)
                     /locus_tag="CYME_CML036C"
                     /codon_start=1
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="XP_005536703.1"
                     /db_xref="GeneID:16994799"
                     /translation="MPGGSREAYQQLAPLLEQVAAQVPGSGPCVTYIGPGGSGNYVKM
                     VHNGIEYGDMQLIGEAYDLLRGAVGLDAMAAAEVFASWNAGALQSFLVEITARILRVP
                     DTSSSAASAPALVDQILDRSESKGTGLWTMTEALRRGVAVPTIAAALDGRFLSARKDE
                     RERASRVLRGPERLSGTGHASELAAAGASPGAAGAVAETGPDTAPERVAALASGSVRA
                     SASTSRSDASAERALIAAIEDALFCSKLCSYAQGLSLLHRASCEQGWSLDLGELARIW
                     KGGCIIRAQLLERIEGAFRRDPSLPNLLLDADLAAEIGRRHESWRRVVGLAASLGVPA
                     PALTASLSYYDTYRQAVLRSSQLVQAQRDCFGSHGYERLDDPGRRWHTRWLSGGDSAG
                     VSS"
     gene            complement(<82571..>83398)
                     /locus_tag="CYME_CML037C"
                     /db_xref="GeneID:16994797"
     mRNA            complement(<82571..>83398)
                     /locus_tag="CYME_CML037C"
                     /product="6-phosphogluconate dehydrogenase"
                     /transcript_id="XM_005536647.1"
                     /db_xref="GeneID:16994797"
     CDS             complement(82571..83398)
                     /locus_tag="CYME_CML037C"
                     /codon_start=1
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="XP_005536704.1"
                     /db_xref="GeneID:16994797"
                     /translation="MSATEGSSPSSAVRESASSHPAGRAISDAGVIGLAVMGQNFALN
                     LASHGWRVSVYNRTYARTAETVERAQRELAADDTTASGSVTGFADLRSFALSLKRPRR
                     VFLLVKAGSAVDATVEALAEVLEPGDIIVDGGNEWYENTERRAASVAARGLLYVGMGC
                     KRWRGGCALRAFPDAGRFTGGVPAACAAAGAGCGAGTRLWAVRYLHWAGRLGELCEDG
                     AQRDRVRRYAADRRGIRPASGCRWLGCDGGCGSICLVERGRPAKLPRGDYRAHSTRA"
     gene            84242..84371
                     /locus_tag="CYME_CML038R"
                     /db_xref="GeneID:16994798"
     rRNA            84242..84371
                     /locus_tag="CYME_CML038R"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_002461404.1"
                     /db_xref="GeneID:16994798"
     misc_feature    84358..86308
                     /note="possible transcribed region"
     gene            <86611..>87510
                     /locus_tag="CYME_CML040C"
                     /db_xref="GeneID:16994812"
     mRNA            <86611..>87510
                     /locus_tag="CYME_CML040C"
                     /product="uroporphyrinogen III synthase"
                     /transcript_id="XM_005536648.1"
                     /db_xref="GeneID:16994812"
     CDS             86611..87510
                     /locus_tag="CYME_CML040C"
                     /codon_start=1
                     /product="uroporphyrinogen III synthase"
                     /protein_id="XP_005536705.1"
                     /db_xref="GeneID:16994812"
                     /translation="MFLWASSPCLVIGRGAFPLGKSRSLTCGANRRRVSSLGSIDSLG
                     ATLGIALTRERGKNSKLATLVRRRLPEARIYELPCIAHKVRTDADRIVQLLASDADSI
                     DWILITSPTAAEVFAQVVRSAQERGLQRLPPIASVGAATNTALLKYSLQANFIPSRAI
                     GACLGDELPVEKLPKVRILYPTSASASDEIEKRLRSRVPAVEFIRIDMYDTIEAKWTT
                     EDIDTARNSVDLVTLASPSAVKVWAQRVGTKQPAVCIGKTSADAAKEVGFSEVYAPSD
                     PGLEAWVDTLVRVFEQKRTETRG"
     misc_feature    complement(87884..89256)
                     /note="possible transcribed region"
     gene            complement(<91404..>91730)
                     /locus_tag="CYME_CML042C"
                     /db_xref="GeneID:16994814"
     mRNA            complement(<91404..>91730)
                     /locus_tag="CYME_CML042C"
                     /product="ubiquitin-like protein Rub1"
                     /transcript_id="XM_005536649.1"
                     /db_xref="GeneID:16994814"
     CDS             complement(91404..91730)
                     /locus_tag="CYME_CML042C"
                     /codon_start=1
                     /product="ubiquitin-like protein Rub1"
                     /protein_id="XP_005536706.1"
                     /db_xref="GeneID:16994814"
                     /translation="MLAGTACRPPHQYPGKLFCFQLRSEPSETMLVKVKTLTGKEVEL
                     DIEPHDPIQRIKERIEEKEGIPPQQQRLIFGGKQLADDRSAREYNIEGGSVLHLVLAL
                     RGGHVC"
     gene            <91933..>93993
                     /locus_tag="CYME_CML043C"
                     /db_xref="GeneID:16994806"
     mRNA            <91933..>93993
                     /locus_tag="CYME_CML043C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536650.1"
                     /db_xref="GeneID:16994806"
     CDS             91933..93993
                     /locus_tag="CYME_CML043C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536707.1"
                     /db_xref="GeneID:16994806"
                     /translation="MRKELSSSASSDLVMEAACKCHEPSHHQVRGLESSFITVPSQAL
                     FRLLSKKELGNERRQTTINVKSRCYTFSILYGQGVRYAHSDVRQRLSVSERAFLTFSN
                     VTDNRLFLEVTQLHAKTLRACSEHGISHRGRVSKLAESDAPVAPVEGAATLGDPDTHA
                     VSYEDALVEFRETGDYKRLWRDIRALREAQTPIENGQLNTLMMACIRRKKPDVAIRIF
                     HELEPLVLGSPNIECYTTLIVAYGRLRQADKAVEILNELQARCRTLNNEEQSDNLALC
                     PSLRTYNAVMNACVAAGDVDKAHQVFGEMVDAQGIAPNEVSYNILLKSHARRGRVEAM
                     QLVLDQMRAAGCAPSLVTYTTLVKGYVTANKLEKAEEVLNDILYKKRLEPDSHLFNCL
                     LEGYVRANDWKKALKLADTMRQHGTMPDGYTNTQLVKVCIQAGRFDLAEKIVERMPRP
                     LPLQIYSMMISGYGDSGRLWSALRLAKEMRNDGVHENVRTVSAQMSACLQAREPALAL
                     SVFLRVMREDPSFVPDQVIYTLLIRANGLRADVDSAYQIFSLVKTKYYTVRTEVYNAL
                     IEAAMLSGRDDLALSALDELIEKSPGVNEQTFQDLTCVCLVDQQKQFRFLSQVWNRLR
                     PLGAPIDGRFYARFLEVTSHVGDLELARTLIRDRWAGHFLINGATAQEVRSLEAYVAG
                     REAA"
     misc_feature    complement(94490..96258)
                     /note="possible transcribed region"
     gene            95272..97347
                     /locus_tag="CYME_CML045T"
                     /db_xref="GeneID:16994822"
     misc_RNA        95272..97347
                     /locus_tag="CYME_CML045T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461405.1"
                     /db_xref="GeneID:16994822"
     gene            complement(<96791..>97381)
                     /locus_tag="CYME_CML046C"
                     /db_xref="GeneID:16994823"
     mRNA            complement(<96791..>97381)
                     /locus_tag="CYME_CML046C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536651.1"
                     /db_xref="GeneID:16994823"
     CDS             complement(96791..97381)
                     /locus_tag="CYME_CML046C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536708.1"
                     /db_xref="GeneID:16994823"
                     /translation="MGRKRRLESGFTRVLNPKDERIIQKEKSKEKLAPLVQRPRDEER
                     LGAVPPELFFQYNTALGPPFRVLIDTNFINFSIQNRIDLQKGLMDCLFAPAKACVTDC
                     VVAELEKLGRKYRVALRIVRDASLVQRLKCTHKGTYADDCIVERVMAHRVFIVATCDR
                     DLRRRLRKIPGVPIMYIAQHKYTVERMPDAFMAPRV"
     gene            <98113..>99402
                     /locus_tag="CYME_CML047C"
                     /db_xref="GeneID:16994817"
     mRNA            <98113..>99402
                     /locus_tag="CYME_CML047C"
                     /product="similar to mRNA-binding protein"
                     /transcript_id="XM_005536652.1"
                     /db_xref="GeneID:16994817"
     CDS             98113..99402
                     /locus_tag="CYME_CML047C"
                     /codon_start=1
                     /product="similar to mRNA-binding protein"
                     /protein_id="XP_005536709.1"
                     /db_xref="GeneID:16994817"
                     /translation="MAFAISIGFSGTKMQRSSVANSRASSLRTRRLHAFAGFPLVGAR
                     ASEFSGAHPLGRRQALRSMGQRHGIQGLQCRSAAIIVNPPSGGHASIGLYLARQLLSL
                     DLEVYLLVAGQEDKYRSKQPNSALLGLREAEPHAASFHISFGDADDPSILMNMVQTRR
                     PSAGPIAAFIDNRSQTLDEALLLHKFAMGLNAERYLYVSSCGIYEPGDYAPFIETDQV
                     RQSAGQAQVESRFLRDSVIPFAAFRPMYIIGKHAAKLDYTNFFLDRITRKRPIPLPGK
                     GNAFVSLTHAEDVASMLACAVLARPDEVSGQVFNAVSPRYVTLKGLAEMCHRVVHGDK
                     SKPEIIYYDPVKLGIDPKEATGLPFRVSYPFIADPGKAMRLLAWQPRHDRTLQNDLQE
                     MYEEYLELGLHERRVDLTNDDRIARSVGAAAKAAAAK"
     misc_feature    complement(101976..103689)
                     /note="possible transcribed region"
     gene            <103427..>105475
                     /locus_tag="CYME_CML049C"
                     /db_xref="GeneID:16994820"
     mRNA            <103427..>105475
                     /locus_tag="CYME_CML049C"
                     /product="glutamate dehydrogenase"
                     /transcript_id="XM_005536653.1"
                     /db_xref="GeneID:16994820"
     CDS             103427..105475
                     /locus_tag="CYME_CML049C"
                     /codon_start=1
                     /product="glutamate dehydrogenase"
                     /protein_id="XP_005536710.1"
                     /db_xref="GeneID:16994820"
                     /translation="MWSIVTGNRLFGVLSTTGTRFPAGAYLAKSSAAAPQISREGSRG
                     TIRRFSSDTDKETGVKQPSDDETSLEFPHALNVHYDALNAPPSPTKQPLSVANDPPAS
                     AAKAAAAALDALLSETAAAPLPKTPTRELTFLESVDLFFDEAAKLTTVSPALLGHIKE
                     CNNLLEFTFPILRTNGQIELIRGYRAQHSHHRLPTKGGIRYDVRVSEDEVKALAALMT
                     FKCATVDVPFGGAKGGVVIDRTKYDDMELERITRRFTVELIKRNAIGPAVDVPAPDYG
                     TGPREMGWMKDTYEAFNPNDIDRIACVTGKPINLGGIRGRDNATGLGVFFGIREFLAR
                     TDVVERYGIRKGPGIEGKDVVVQGLGNVGYWSSRFMCELGRARIVAIAERDGFLVSRS
                     PNGLDPTDVKRHFAMHGHLRGYEGPLNVGQGQVEYVPGDPCQALELECDILIPAALES
                     VIHGGNASRIQAAVIAEAANGPVTYAADRYFKTSRKLGVDCPLIIPDLLLNAGGVTVS
                     YFEWVKNLGHLRFGRMTRRVEEKSMRAIANVLERHGMKLEERDLKELEAGADEATLVR
                     SGLEDTICAAVEETWNTAREMNCDLRLAAYCNAIRKIALDVSWWRTRLLCCAPQMFQS
                     DRQLRSWWQSSQVHRTKLTNVGTDDCNPESVCYLWNFPVNFLVIVKTWLKPRICLRRN
                     "
     gene            <106929..>108080
                     /locus_tag="CYME_CML050C"
                     /db_xref="GeneID:16994821"
     mRNA            <106929..>108080
                     /locus_tag="CYME_CML050C"
                     /product="ribonucleoside-diphosphate reductase beta chain"
                     /transcript_id="XM_005536654.1"
                     /db_xref="GeneID:16994821"
     CDS             106929..108080
                     /locus_tag="CYME_CML050C"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase beta chain"
                     /protein_id="XP_005536711.1"
                     /db_xref="GeneID:16994821"
                     /translation="MNSQVMHGTKRVGAPHENGFEDIAFGETFSPEIKEKGGTSAVIV
                     GLDGSERGDTRVRSHVPAIFKAEEADRYTLFPIKHPKIFEFYKRHVASFWTAEEIDLA
                     ADMDHWRNRLTEAERYFVSHVLAFFAASDGIVLENLAERFMRDVEIPEARCFYGFQIA
                     MENIHSETYSLLIDAYVKDPEERTHLFRAMETMPCVRRKAYWAIRWIGSDASFQERLV
                     AFAAVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACHLYSMLPAEE
                     RVPAERIHSMIRDAVECEKEFVCDALPVSLIGMNQQLMSAYIEFVADRLLVELGYDRL
                     WNTPNPFDWMELISLQGKTNFFEKRVGEYQKANVTTSATDNVFALDIEF"
     misc_feature    complement(107659..109136)
                     /note="possible transcribed region"
     gene            <109654..>110946
                     /locus_tag="CYME_CML052C"
                     /db_xref="GeneID:16994826"
     mRNA            <109654..>110946
                     /locus_tag="CYME_CML052C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536655.1"
                     /db_xref="GeneID:16994826"
     CDS             109654..110946
                     /locus_tag="CYME_CML052C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536712.1"
                     /db_xref="GeneID:16994826"
                     /translation="MSDTIHRIKHFSRGSRRCCVVLQDKNGPCPLVALTNTLLLRGSL
                     APFPADMEYVSSDWLCNVLAEYLFEKQIPALSANADRVADLEYGVADVVQLLPVLQHG
                     MDVNVGFRDCTDYELTAETTLFDVFGVLLLHGWLADPSDQDAYEAVSRRRYNAALEVL
                     LQHPTDALSQMCSESEPGASANLDVLRSSPEIASAQVRTEIFAKTARAAISTDRAAGT
                     RSTVESNPSCQTRRTAATMSPTKEAQEAEESERGAEAAHIRRFIENSPTQLTYRGLIR
                     LHEILREGEYAVFFRNNHFSTITKHDGVLYVLVTDEGLAMTRGVFWERFDDLDGDTVF
                     VDENWEPANAARCMPDALESASAANRSAAHRTQTGPVAGERYAKDPAMRAFSPPRQKP
                     DASAGTWTPKALKPTSQKKTAATTCAGQSPRHSRCSVQ"
     gene            complement(110964..112465)
                     /locus_tag="CYME_CML053T"
                     /db_xref="GeneID:16994827"
     misc_RNA        complement(110964..112465)
                     /locus_tag="CYME_CML053T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461406.1"
                     /db_xref="GeneID:16994827"
     gene            <112037..>112375
                     /locus_tag="CYME_CML054C"
                     /db_xref="GeneID:16994828"
     mRNA            <112037..>112375
                     /locus_tag="CYME_CML054C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536656.1"
                     /db_xref="GeneID:16994828"
     CDS             112037..112375
                     /locus_tag="CYME_CML054C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536713.1"
                     /db_xref="GeneID:16994828"
                     /translation="MIKEVIGNPVQTGEQVDTFRSVYSPSVDHGDGRFTGMSRKDGSR
                     PSPGPFFRANARDGILEGAAYPPGATKLPLLLLLLLPLAVSLMVTSIGGYVIRVDSII
                     WRDEHRDRSA"
     gene            complement(<112961..>116911)
                     /locus_tag="CYME_CML055C"
                     /db_xref="GeneID:16994829"
     mRNA            complement(<112961..>116911)
                     /locus_tag="CYME_CML055C"
                     /product="carbamoyl-phosphate synthase,
                     pyrimidine-specific, large chain"
                     /transcript_id="XM_005536657.1"
                     /db_xref="GeneID:16994829"
     CDS             complement(112961..116911)
                     /locus_tag="CYME_CML055C"
                     /codon_start=1
                     /product="carbamoyl-phosphate synthase,
                     pyrimidine-specific, large chain"
                     /protein_id="XP_005536714.1"
                     /db_xref="GeneID:16994829"
                     /translation="MQTINCSSARKNRFLFVVPGEADGKRASPSQRSVAFVQHQTGVV
                     SIDRRAATAHGRCGSASRKARPTGQRGRRLYVAAPGATSFSGENLFFGASTFAPVPQF
                     KKRSRAGPTGSYGLRMEGVDGHKRWMNVGPPTPPWLDVLPPKDRERDFDKVLVIGSGA
                     IRIGQACEFDYSGTQACKALRSLGYEVVLVNSNPASIMTDPETADRTYIEPITVEALE
                     MIIERERPQVLLPTMGGQTGLNMAMQLAKKGILEKYNVRLIGANLEAIRKGEDRLAFR
                     EAMERIDVPCCPSGIANNMEEARAVAAQIGRFPLIIRPAYTLGGTGGGIAYNREEFEE
                     IAAGGLEASPVSQILVEQSLLGWKEFELEVVRDKMDNVVIICSIENVDPMGIHTGDSF
                     TVAPTMTLTDKEYQRLRDMSIAIIREIGVETGGSNIQFAVCPRTTNVIVIEMNPRVSR
                     SSALASKATGYPIAKVAAKLATGLSLPEIKNDITRDTVAAFEPALDYIVCKFPRFAFE
                     KFPGTSDVLTTQMKSVGEAMSIGRSFKESFQKGLRSLEIGRHGWGLDAKDEEVLSRTE
                     LEAALRIPRPNRIFRVRQAFQAGMTVDEINALSSYDHWFLQNMKELFDLGESLRSKKS
                     LQDIDRLTMFTLKRNGFSDRQIAFALRKLGVTETEVRRYRKSLGIRPVYKRVDTCSAE
                     FEAYTPYLYSTYESCNAWDDDAVGGNGDGSTTGGSVLDLRSDGTTGDGSSFHGSFIAA
                     GMESEVPPSDPSKPKIIILGGGPNRIGQGIEFDYVCCQACFALRDAGFETIMVNSNPE
                     TVSTDYDTSDRLYFEPLTLEDVISILEAEKPDGIILTFGGQTPLRLAVPLQEYLNSDE
                     AKAAGVYTRVLGTSPDSIDAAEDRDRFQAILRELRIRQPENGIARSYQDAKRVAEEIG
                     YPVVVRPSYVLGGRGMEIVYSASELERYMAEEVVVESEHPVLIDKFLLNATEVDVDAL
                     ADSTGRVVIGGIMEHIEQAGIHSGDSACSIPTVSLPYEVLVQIRQWTAALARRLQVVG
                     LINIQWAVQGSDVYILEANPRASRTVPFVSKAIGVPIAKIASMLMAGANLDELGYTTE
                     ILPRAISVKESVLPFDKFAGADTLLSPEMRSTGEVMGTDYSFGAAYAKSQAAAGTPLP
                     KSGTVLLSLKDADKAAAPALVRDLLDMGFRVLATRGTHAALVAAGIDDARVEMIHKAG
                     EGRPDVLDAIKNGDIDLFIITPSVPADSARNVRRAALMTKVPIITTIAAARAAAAAIR
                     TMQSQTLEVKSLQEYHPKYKEISEQIRRGMERAANKLRRVAPAASRDVKEPISS"
     gene            <117322..>117633
                     /locus_tag="CYME_CML056C"
                     /db_xref="GeneID:16994849"
     mRNA            <117322..>117633
                     /locus_tag="CYME_CML056C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536658.1"
                     /db_xref="GeneID:16994849"
     CDS             117322..117633
                     /locus_tag="CYME_CML056C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536715.1"
                     /db_xref="GeneID:16994849"
                     /translation="MDMKIGDPGTRSRRLQEKHAKIPTLADYRAMQRKNKQNGDMREK
                     EFARRDDLEAVVTMWARALGILALVSATRGNRRIELESETTTPPSTPDDAWCGRKDPR
                     S"
     gene            complement(<119784..>122264)
                     /locus_tag="CYME_CML057C"
                     /db_xref="GeneID:16994850"
     mRNA            complement(<119784..>122264)
                     /locus_tag="CYME_CML057C"
                     /product="unknown kinase with aarF domain"
                     /transcript_id="XM_005536659.1"
                     /db_xref="GeneID:16994850"
     CDS             complement(119784..122264)
                     /locus_tag="CYME_CML057C"
                     /codon_start=1
                     /product="unknown kinase with aarF domain"
                     /protein_id="XP_005536716.1"
                     /db_xref="GeneID:16994850"
                     /translation="MLIDSAHERLLPCFNSEDSAMAHATRSLSSHSRRFYLLFVQFSG
                     IQRLFLPTGTSPGAHCELGRRLYQERPYSQSGLGNCHRRVYNSRRLYMIATERASVAG
                     PTSPGAGSSSSNHVPEHNADTVPTGSWRLLEAQRALQLVRETARQSSTALTGRASVAA
                     PLQTADFERSIIKRVEERASMHMDARGNDASAWNYETIVKSAAPAVRYDPERLREKYA
                     RQTLLVRTRQARIAAPLFVFIGRVVLDIQMGKEQERRKIRAAEFLQIFSNLGPAFIKA
                     GQALASRPDLLPPEYLDEMQKLQDRLPPFKNEDAYRIIEEELQAPVHEIFSRIEPEPV
                     AAASIGQVYKAYLRDGKDTPVAVKVQRPDCEKIISLDIYILRELSGILSRMLTFLRRD
                     INLVSIIDELGKLIFEEIDYLNEARNAERFRELYGSLPDVVVPKIYWQYTRRRVVTLS
                     WVDGVRLNSPCLSDAQAQKLVEIMVQCSLRQMLENGFFHADPHGGNLLATRDGKLCWL
                     DFGMVSEVEPAQRYGIIEAVMHMVNRDFESLARLYVRLGFIPPDTDLAPLVAALNRAL
                     PDVLDASVSELNFKSVINKLGSVMYKFPFRLPPYYTAIIRCLGVLEGLAIQVRRDFKI
                     INNAYPYIASRLLTDPAPELQNALSVLLFKDGRIRWSRLESLLDSASLTSEYDFSVVA
                     SQLLEFILSPRGDIIRRHLAEDLVNEFDQLILDTVSYNTQLLQGKRPVPTKSMIYFQK
                     ALSLALANSALARSIRGVSETPSIQSLLLPYAVDSRKFLPILQLIGSKREGKRLLMDI
                     VTNLMERATLRGIRAIFGIEQDRVSAPR"
     gene            <124473..>126677
                     /locus_tag="CYME_CML058C"
                     /db_xref="GeneID:16994833"
     mRNA            <124473..>126677
                     /locus_tag="CYME_CML058C"
                     /product="excinuclease ABC subunit C"
                     /transcript_id="XM_005536660.1"
                     /db_xref="GeneID:16994833"
     CDS             124473..126677
                     /locus_tag="CYME_CML058C"
                     /codon_start=1
                     /product="excinuclease ABC subunit C"
                     /protein_id="XP_005536717.1"
                     /db_xref="GeneID:16994833"
                     /translation="MTFCRHYVYFIAPFHTRRETRAFLRPHLVKKASQQLCPQQQLPQ
                     STYKSRAFQASGTTPGPQVPSLPEKGETGASSDRWQRLRPQILALPRSCGVYFFRDRK
                     GRLLYVGKSLCIQERVASYFRTSSVEQRGRQVIAALDSVDRVEYFVTGNEVEALAVES
                     NFIREHQPPYNTLRKDDKRFPFVRVTWSEMYPRLVVTRQRPRVNQNTRGRDRVYGPFV
                     DSKLLNHVLRFIQRTFPMRQRAQPLFRDRPCLNYDIGVCPGVCQKQVDTTTYREAVRR
                     AELCLQGRVTQVLSELQADMQHAVKKEDYERAASLRDAMRALQRIAVESTVGVVSNLT
                     QRVLLMNADFSADVAAAAITQDGKIVSIELIQMRDGMVMNRLHFSLRVSPLVRDTEMT
                     HAQGSREQLDHIAAAVLQQTLIEHYANLTDANENPDGILVYPALQDHSILEKLFQERW
                     RSRRVRVETPRTGLRAELVQLAKENAEAHLKDAYNQITNAVGPLEDLAMRLGLAQRPF
                     RIECFDISHLSGTCVVASQSVFLDGVPAPHAYRRYRLNQNDSDPAKGANDLLNMQQVL
                     RRRFRRAAESAPVDLPDLVLIDGGIEQLKAACSALEACGLSPRTGAPNLIALAKRDEE
                     VFTLHSTSPLQHFRDGSVDSMALRLLRHIRDEAHNFALQYHRQLRNRGTMASVLERIP
                     GLGPVRIQILLNHFGSFEGIFGAGYQQLAAIPRIGEKLAQRIHEYLHETTGN"
     gene            complement(<127508..>129433)
                     /locus_tag="CYME_CML059C"
                     /db_xref="GeneID:16994840"
     mRNA            complement(<127508..>129433)
                     /locus_tag="CYME_CML059C"
                     /product="6-phosphogluconate dehydrogenase"
                     /transcript_id="XM_005536661.1"
                     /db_xref="GeneID:16994840"
     CDS             complement(127508..129433)
                     /locus_tag="CYME_CML059C"
                     /codon_start=1
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="XP_005536718.1"
                     /db_xref="GeneID:16994840"
                     /translation="MATTAGTRRSPSGGALCWAAAPVAAVRFGRWAPPRAHSWTPRRT
                     YPTWSLSLVRSARWCLLRGRRAQACGAAVMSAAEGSSPSSAVRESASSHPAGRAISDA
                     GVIGLAVMGQNFALNLASHGWRVSVYNRTYARTAETVERAQRELAADDTTASGSVTGF
                     ADLRSFVVSLKRPRRVFLLVKAGSAVDATVEALAEVLEPGDIIVDGGNEWYENTERRA
                     ASVAARGLLYVGMGVSGGEEGARYGPSLMPGGSREAYQQLAPLLEQVAAQVPGSGPCV
                     TYIGPGGSGNYVKMVHNGIEYGDMQLIGEAYDLLRGAVGLDAMAAAEVFASWNAGALQ
                     SFLVEITARILRVPDTSSSAASAPALVDQILDRSESKGTGLWTMTEALRRGVAVPTIA
                     AALDGRFLSARKDERERASRVLRGPERLSGTGHASELAAAGASPGAAGGVAETGPDTA
                     PERVAALASGSVRASASTSRSDASAERALIAAIEDALFCSKLCSYAQGLSLLQRASGE
                     QGWSLDLGELARIWKGGCIIRAQLLERIEGAFRRDPSLPNLLLDADLAAEIGRRHESW
                     RRVVGLAASLGVPAPALTASLSYYDTYRQAVLRSSQLVQAQRDCFGSHGYERLDDPGR
                     RWHTRWLSGGDSAEVSS"
     gene            130037..130166
                     /locus_tag="CYME_CML060R"
                     /db_xref="GeneID:16994841"
     rRNA            130037..130166
                     /locus_tag="CYME_CML060R"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_002461407.1"
                     /db_xref="GeneID:16994841"
     gene            complement(<130877..>134044)
                     /locus_tag="CYME_CML061C"
                     /db_xref="GeneID:16994538"
     mRNA            complement(<130877..>134044)
                     /locus_tag="CYME_CML061C"
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily c"
                     /transcript_id="XM_005536662.1"
                     /db_xref="GeneID:16994538"
     CDS             complement(130877..134044)
                     /locus_tag="CYME_CML061C"
                     /codon_start=1
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily c"
                     /protein_id="XP_005536719.1"
                     /db_xref="GeneID:16994538"
                     /translation="MVPPRKRRSRTAREQQGNGTHIPDGNKSTSTPSEEVRTGAAADA
                     REDTAFPSAEGQRPADSRRKRVKSCNISMKDYEDPHQIAKFEAISAQLNAEPPEQLGF
                     RPGDSVDVSPRALSLLTGNLLQFQERVLGRNSVEPPEIRGFMTKLPNRLFHDYSAHGS
                     LRTILECCFRFRVARGIRRFDLHKPDMTGVFLEMLQEVERELIKRKQLQMPRLFFAPA
                     LGSAEIDRLSAIARKHGASVVSSPREATHIVYPDPPGTTEAETEAEDYCVSLKRKGNQ
                     VLTHWWYFPDSYDSWIPAQEVEDPDGELHGEEENLSGVIEGKIWHVQKRFLEDCEKFN
                     EWCNENDYEVIPEEEKLNVDEWKPPSASRIDGHLRGSESKTAAPTPSKRKSAEPSPVK
                     PEPDGTPERVTVRAVREESAEPMKIKVRLAPPIASQDAGSSSNAPAEQVPAPNIAGPI
                     TFTTETGAAVDAEQPSAAAGAAPRISRPAVRPLVPDDATLRMRNVTASSRDEQLQKRL
                     AQQREALRERRKERNDAAAAEEDALPGPAAHAPRDRESLAPRRVAEALGGLAERETLP
                     AAAAATAIGEKSPIRVPAHSRWFRIDAIHDIERRALPEFFSGKFASKTPEVYMLYRNF
                     MIDTWRQDPTRYLTGTAVRRHLAGDVGAVMRVHAFLEQWGLINYGVAPETRPQTVSGG
                     FSGSGATLISTSSGSLAASSAGLEGGLPRIFLFDDGSRIPKSRMHLAPMATRRELYAA
                     AAAIEYQCDVCGRDCSQRRYHCLLKADMDLCPECYHQGKFPEDFNGKDFIELRPVLSL
                     GSAASATGTLTAPSTDDWTDVEVLQLLEGIEAYGDDWDAVAQHVGTRSRDACITKFIR
                     LPIEDPFLEDDLSRLAVPAVAGETAQTERNEPPLFADAGNPLMAHIAFLANSVSPDVA
                     AAAARAALAAIMKSDAPPEALADANAIQAVAATALGAAATRAAELAAIEHLELHRATE
                     QAIETQVRKLEEKMKVLEQLEEEFLREREQVEIYRKELFAERLNLVARREALSSTATL
                     GASPATALNASIPEWTVARDTRKQC"
     misc_feature    complement(134109..137267)
                     /note="repetitive element"
     gene            <137711..>138469
                     /locus_tag="CYME_CML063C"
                     /db_xref="GeneID:16994539"
     mRNA            <137711..>138469
                     /locus_tag="CYME_CML063C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536663.1"
                     /db_xref="GeneID:16994539"
     CDS             137711..138469
                     /locus_tag="CYME_CML063C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536720.1"
                     /db_xref="GeneID:16994539"
                     /translation="MKTQQRPVLAYAHYISDDLKTGKKGSVTLEKPASGSPILTLVYK
                     LSNDLKVFATASVKNFQASKVGGAVSLRNVKKVRSGVLDMVVDVKDEDRRTTYTYQTV
                     VDDKNKYSLAVSANGGPLGVFKKEEERRAHIKWDATLDDIDALQIKYSFASDNDVDVK
                     LTHRVDDKWSWDATYHYKNESFSANLIRRISDDKSLKIGGNFRSKAYQVEYKIGAEDG
                     GPYIFTLKGMVDENSKLRDTLNQSEFGLKKRFDF"
     gene            complement(<138732..>139664)
                     /locus_tag="CYME_CML064C"
                     /db_xref="GeneID:16994830"
     mRNA            complement(<138732..>139664)
                     /locus_tag="CYME_CML064C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536664.1"
                     /db_xref="GeneID:16994830"
     CDS             complement(138732..139664)
                     /locus_tag="CYME_CML064C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536721.1"
                     /db_xref="GeneID:16994830"
                     /translation="MEYGDDRFDYREWVRAVEAATSCEERRWRRVLRWYLKPSWETVD
                     AHGNRLSCRFSSSDSSSLTEDNFESVGSSSSTPSDRASTESRAGDTVSDTEANETDYE
                     LHGPDVPTEAQLEHAIKVLLDSDNIMREPASSRAVRHCCTNILGDAVRIASMYVPPPR
                     PSADDSESGAGVDDTMLLLRGAGPMMDPSEATPEHETLRPCSGHEPFPSYQPGAASRP
                     TDAPDVPTVSDHHRNSGGDSGWSAYASGREQQFRLWSEEITAFRDAAELADLTMAEGE
                     ALALALERYEERMHRLLEALQEHDSGQAASLAGE"
     gene            <142695..>144341
                     /locus_tag="CYME_CML065C"
                     /db_xref="GeneID:16994842"
     mRNA            <142695..>144341
                     /locus_tag="CYME_CML065C"
                     /product="probable arginine-tRNA-protein transferase"
                     /transcript_id="XM_005536665.1"
                     /db_xref="GeneID:16994842"
     CDS             142695..144341
                     /locus_tag="CYME_CML065C"
                     /codon_start=1
                     /product="probable arginine-tRNA-protein transferase"
                     /protein_id="XP_005536722.1"
                     /db_xref="GeneID:16994842"
                     /translation="MSSVLEDFGNVLDSSRCGYCGDNEQCTDNTEGERCGSLAAHTER
                     RRRRLRGALWAHRLRLEDYRVLMDHGWRRSGCFLYYPDNDHGCCPQYAVRVPLWDFEL
                     TRSQRRVLRRWQNFVSVQGDLAERCFIFYGLTISSNLESAKPLPSAKLNKTELQPVAP
                     KPVDDRLEQLRIHLEPSLQRVPVKRRQVSGGAHFTTAIAWKLAYEHRTFVTQEAEQLA
                     ARLWDRGAAQLGITRMEVSNGHVNLYDSLTQSATETECRSSRNPCARAELPDKPIRSK
                     PVLRMELLPAAYREDAFHLYCKYQRRVHGDTDEELKPDRYSRFLVEHPFHDDGKGRRL
                     GVSHLHFYIDDVLVIVSVLDMLPGYLSSKYCFYDPDLPSRLSPGIFAALCEIQLAWTH
                     LGASHYYLGYYIHSCSKMRYKVSFRKAQLLCGHCFRWQPFANVARDALDRDEHCVGFC
                     NRSRAATATDDANGAPGVGVRGVEERHSRAADARLEKVLVWLLDASGCSAALAPQPLS
                     SVETVELRERIRAALQRLAAMVPPSFLERIIYLPPRQVFS"
     gene            complement(<144338..>146560)
                     /locus_tag="CYME_CML066C"
                     /db_xref="GeneID:16994843"
     mRNA            complement(<144338..>146560)
                     /locus_tag="CYME_CML066C"
                     /product="similar to phosphate starvation-inducible ATPase
                     PhoH"
                     /transcript_id="XM_005536666.1"
                     /db_xref="GeneID:16994843"
     CDS             complement(144338..146560)
                     /locus_tag="CYME_CML066C"
                     /codon_start=1
                     /product="similar to phosphate starvation-inducible ATPase
                     PhoH"
                     /protein_id="XP_005536723.1"
                     /db_xref="GeneID:16994843"
                     /translation="MARPLIAYSCTSVHGGQAVPFRSTSPLPGRGLRSRTRHSCRTFT
                     RPGHVYASSGRGGGPRDMRYIGRAVALHGVVPVGSGVGFGGIVQQYRERSARKRGPEA
                     AEDVASASANGEQGMHRTPPILLGRRLYVLDTNVILHDSSCLWRFGHHDICLPITVLE
                     ELDKFKRGNEEIHFHAREFLRMLDEMTILHSRAARNDQPAAESKDCASAHLRGSKFSA
                     RDGSGTGDWNLTAASPSSRDWLVQGVPLNKENAEHGSVRISLHCRDARMERLFFYDSP
                     DMRILASVHALAVAESAEPPTWTPPPEEGELTDSVYGSVLQTNHAGQRLLYERVVLVT
                     KDVNLRMKARALGLHAEDYEQDRVESISKLYLGQRLIENVPNELIEALVGRAEGLTAA
                     EFTSLMRSHASACCAEKSTNDVGFVPSETARSAIHWLGQQIMHKRSLANPAASKENDV
                     APDGTCAPQAASAAAPAATAEDSFAMKPLPNEHFILRNASSSVLATFAMSKDCGDFTF
                     QRVDRVSAYGIMPRNAEQTFALRVLLDPSIPLVTICGVAGTGKTLLCLAAALEMTSRG
                     FYEQIFVSRPIVPLGNRDVGFLPGDLDEKLAPYMQPLYDNLGVIKAAHLHTKDNGKVV
                     PTARSREIDDMMASERIKIAALAYIRGRSLSRTFLIVDESQNLTPHEVKTIITRAGEG
                     TKVVLCGDLHQIDNPYVDGHSNGLSYLIERMKGQSLYAHVTLEKGERSELSKLASELL
                     "
     gene            <147508..>148833
                     /locus_tag="CYME_CML067C"
                     /db_xref="GeneID:16994789"
     mRNA            <147508..>148833
                     /locus_tag="CYME_CML067C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536667.1"
                     /db_xref="GeneID:16994789"
     CDS             147508..148833
                     /locus_tag="CYME_CML067C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536724.1"
                     /db_xref="GeneID:16994789"
                     /translation="MMRLEARSMKPCTLDGASDPDLQRANEAFVWSTAPGGERATGAV
                     QRRESYTRQRHWPRPWRPALSADNWRKCRFSAARGSPFLSGSARALETSLHSRYPALN
                     SAVPGGHVSMQYGQAATARDANEARTGVYQPSIEAKLKTLTEKVKLACVQCRAPLELD
                     SANRLRCPNGHGEASWIQVSEKSRGGGFWDLTPQRFRYNVDERPRGPSVELRRDLFQS
                     PFVAFLYERGWRDQFRSSGFPGPDAEFRIVQSFFKGANCVMDLSCGSGLFTRRLAASG
                     DFDHVIAVDYSEAMLRELVERAEREPLPERIGGGFVSDRITGIIRADVERLPFANESI
                     DCIHAGAALHCWPCVQDGLHEVYRILRPSKGPGSGRFLATTFLWSTSPFGLAVREGRL
                     LSPSAGYRFFDAKELEWLVKSAGFERVEIEVIRQCAIIRAWKEPRARHG"
     misc_feature    complement(151175..152103)
                     /note="possible transcribed region"
     gene            <152682..>153902
                     /locus_tag="CYME_CML068C"
                     /db_xref="GeneID:16994743"
     mRNA            <152682..>153902
                     /locus_tag="CYME_CML068C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536668.1"
                     /db_xref="GeneID:16994743"
     CDS             152682..153902
                     /locus_tag="CYME_CML068C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536725.1"
                     /db_xref="GeneID:16994743"
                     /translation="MRSHEIPGARAQKLSSPSATPDEFARAALRLSCAAIVGVRARAL
                     TQPRLRRKALFYITRESCEVIVDVCESFIQRIGYIAARLAEHSGRSQVTILDVLQTLD
                     DWIAPCGGDSFRVSSLVQYAAIEELLPPRDLEPFPRRRLPRNVERKTQEPSALEAAWS
                     ADADAREDELATDDCLLDLNRLMWDKRLAGDGEERGDSEAIKFKPESANEPGSGVVKE
                     SGTVTASDASSDERSRIADATLPSKSAGDNADAQQNPEQARVHGACIERWMPPFPPLH
                     TYMDTPVYAAPENESEVDKLRRLNEQRLQVENALARARATGYRPIENPYLQLPTVGRD
                     VTKAIDMRPESRQQVHAAVGSRTLSAREPLESEIVTARIRPSNQEVSDKAERILAESG
                     GVTESALPSSEYST"
     gene            complement(<154898..>156694)
                     /locus_tag="CYME_CML069C"
                     /db_xref="GeneID:16994837"
     mRNA            complement(<154898..>156694)
                     /locus_tag="CYME_CML069C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536669.1"
                     /db_xref="GeneID:16994837"
     CDS             complement(154898..156694)
                     /locus_tag="CYME_CML069C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536726.1"
                     /db_xref="GeneID:16994837"
                     /translation="MEELLREQVFNAIVSFLQRERLPASANLLRFEACQVTAPSTDKL
                     TGSRSGGVAAAVAGSRSLPSQDEGGGGTALEGVSGRSTLRFAAGTANSPEPLELDPFL
                     VGSAVLYGVEEALALELSAERLLQALDEASAVRKRRRRFFTSEVSTSTAAVDHARDEH
                     MRPACCAVHAALARAPGSLGSAREAALESRGSLLAANLQVAEATSSDEVRYEVGSGAC
                     ASPESGRVHADPAQPHQERTSQRGCTGRLENDGRRGKPQMAVPASNLHSNSEDRRSTF
                     RVSETCQLGEAPCEPAGATASLRQLAERRQSFTRERPDCGGMHETSPRCVCSNADGAQ
                     SSETPQSAVNEAHHAAVESVAVTTRAAHASPRATSDTTVAAAAVVDHPVAAVRLQQNE
                     SVAAEAARRPPNATTTSTSTIPATLTTQDNESNAGKAIGDASVAQTRLWPGPGTLHFM
                     RHSDMSSTSSAEATPTEPPPGRLRASPCSDARATASTLQASVVPPDNTRRGRDTPAIV
                     TPPARNGSGTRPSPVTPVLQGATTSRERAGSSALADDQQSETRTRPELPATRFETGFS
                     KDKLRKLQDLDIDAFLTNKVYARQRNDRSRVS"
     misc_feature    154958..158309
                     /note="possible transcribed region"
     gene            156786..158853
                     /locus_tag="CYME_CML071T"
                     /db_xref="GeneID:16994773"
     misc_RNA        156786..158853
                     /locus_tag="CYME_CML071T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461408.1"
                     /db_xref="GeneID:16994773"
     gene            complement(<159585..>160349)
                     /locus_tag="CYME_CML072C"
                     /db_xref="GeneID:16994774"
     mRNA            complement(<159585..>160349)
                     /locus_tag="CYME_CML072C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536670.1"
                     /db_xref="GeneID:16994774"
     CDS             complement(159585..160349)
                     /locus_tag="CYME_CML072C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536727.1"
                     /db_xref="GeneID:16994774"
                     /translation="MTTVGARPVLLLELAKYALRSDVEYVLKRYGDVWQKAAVAQIFR
                     GSNRRNSDRARWLVQFRDPEEAARVAQRLLDYQQRGRGSRSSNGGGAAGEQGAQPFGR
                     GRRARSVFSAVSLAPESFLERELHRPALSRVSDVGRAVVCSNLARGVEAADVWRLFVN
                     AYDVEEVRLHDSAAEVEADADTHTEDTSGSTAEQTDAAAQLAAEGTEVADAVPVRKAR
                     PLACVVFRSEDDAWRAIVERQGAYVKRRPVELSIVQ"
     gene            <160692..>161771
                     /locus_tag="CYME_CML073C"
                     /db_xref="GeneID:16994775"
     mRNA            <160692..>161771
                     /locus_tag="CYME_CML073C"
                     /product="similar to actin-related protein"
                     /transcript_id="XM_005536671.1"
                     /db_xref="GeneID:16994775"
     CDS             160692..161771
                     /locus_tag="CYME_CML073C"
                     /codon_start=1
                     /product="similar to actin-related protein"
                     /protein_id="XP_005536728.1"
                     /db_xref="GeneID:16994775"
                     /translation="MTEDGRPVVIDSGALYTRVDFAGNDVPSVTVRTASETPVNGVSV
                     ETDPGRSAGAIPDWERLAGFWDSVLTESLGTRAENQPLLVVDWAESTKFSRELLAQVA
                     FETLGVPALYLAAPAVLALYAVNRTTGLSIDVGHTSLRIAPVYEGFQFGYATTTLPIG
                     GIDIEARLRTLVLETHIGDATTTRALDTLDWRVLKEAVSEVRPKQGVDGETSTFTAKQ
                     YAVVEGRSILVTPDQYLGCTEMLFTPATSPDGKNRSTFTERVHLALMQCEPDIRRELA
                     ANIMLYGGGAALKGLAERLRSELVDVLPSSMHPNVAVAHDPSTVAWRGGSILASITMF
                     QQLWVTKQDYNEHGPLCILRKDTMR"
     gene            <165362..>167023
                     /locus_tag="CYME_CML074C"
                     /db_xref="GeneID:16994772"
     mRNA            <165362..>167023
                     /locus_tag="CYME_CML074C"
                     /product="similar to trithorax protein ash2"
                     /transcript_id="XM_005536672.1"
                     /db_xref="GeneID:16994772"
     CDS             165362..167023
                     /locus_tag="CYME_CML074C"
                     /codon_start=1
                     /product="similar to trithorax protein ash2"
                     /protein_id="XP_005536729.1"
                     /db_xref="GeneID:16994772"
                     /translation="MDPPPESLRSVWCAILFRALKALEQANSNRSSFTAREIIDYVDA
                     HWDQVAQGAEFRRKFSVELTRRLQPDSALVELDRNPSALDAEQTHEAYWKLRLGVDSY
                     DWSLITEEHASRLADDLDLEPAPKRARSTSAETKSTASLLLAPAPGTTASGSPETPTE
                     PQRVATLADIESSTGRTSAVSNRAEERSASGPAGVPRTEGNTRTRHGGHSARSAATDG
                     GQRTIRRGGLVAQFSESVLARLKAGVPVEEIDPLELIDDAAILEWRKPPRGVPYTLSE
                     HQRDPKLQLSSDLLTVTGERGFRSIRGIHGVATGDWFFEIQVLAGEPPPLPCHESVVD
                     RDGVQPHIRVGFGSCRAEVSFPVGWEVHGYAYRDKTGDKVHDCIPEAYGSCWGQLGDV
                     IGCRICLPPSLDAREEALIRRLDDAWFDFKGMNMGLGSKPKMPPPTELLYTTDRESSH
                     VATGTYIEFFKNGVSQGIAFRNLIPAVYYPMISLYMGARCRANFGAEPFRTSIPPGCR
                     GFCESTPPPWTLTPEANADSATFRSDDGHTGPYVPGISTIETLEA"
     gene            complement(<168594..>169217)
                     /locus_tag="CYME_CML075C"
                     /db_xref="GeneID:16994770"
     mRNA            complement(<168594..>169217)
                     /locus_tag="CYME_CML075C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536673.1"
                     /db_xref="GeneID:16994770"
     CDS             complement(168594..169217)
                     /locus_tag="CYME_CML075C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536730.1"
                     /db_xref="GeneID:16994770"
                     /translation="MDKLFVIRTLQQPGVQEELAERGALCAGAGAVSGLVTAAVRGYR
                     VSTAAVIGSAGFVLAGVPFFALQRVFQERRQGVQDPWNSVLAGAFVGWFVGLGISGPG
                     RCPQSALTLAALCGAVHWSLSTVGHWRQRTPASSSAAVRNETESFQWPEWLPIQPVRP
                     GYRPPHVELAELVAKRASLEEELRERRARLEHERGAEPASPCDCSPK"
     gene            <169683..>170882
                     /locus_tag="CYME_CML076C"
                     /db_xref="GeneID:16994771"
     mRNA            <169683..>170882
                     /locus_tag="CYME_CML076C"
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /transcript_id="XM_005536674.1"
                     /db_xref="GeneID:16994771"
     CDS             169683..170882
                     /locus_tag="CYME_CML076C"
                     /codon_start=1
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="XP_005536731.1"
                     /db_xref="GeneID:16994771"
                     /translation="MDTTMRRVCSRWQLLEHWRYLRGLGERAAAPRDWQPGRNQFRYL
                     IRGQSPNHFSPNRVYCTKQAGNSENHLRRITIRDIQRMHEERVPICMVTAYSYPQALH
                     ADLAAVDIVLVGDSLAMVELGHDTTQFVTLDDMLHHCRAVARGCRRALLLADMPFGTC
                     ETSTADALRNVTRMIQEGHAHGVKIEGGKRMAPVIEACVHSLGVAVMGHVGLRPQSYS
                     ARGGFRAFGTNASEAAELLEDALALQEAGAFALVLECVPARLATAVTTALRIPTIGIG
                     AGGGTSGQVLVYHDLCGMMTHPHHAKVTPKFCKRFAEAGAEIHRGLVDYRTAVKQRRF
                     PTASYAPYQLPDAEWERFGRLFEQLTGQGLQSISAPEDAQTERLDPKHPLSKDTSTDE
                     TEYLYRS"
     gene            <172117..>173250
                     /locus_tag="CYME_CML077C"
                     /db_xref="GeneID:16994788"
     mRNA            <172117..>173250
                     /locus_tag="CYME_CML077C"
                     /product="transcription initiation factor IIB"
                     /transcript_id="XM_005536675.1"
                     /db_xref="GeneID:16994788"
     CDS             172117..173250
                     /locus_tag="CYME_CML077C"
                     /codon_start=1
                     /product="transcription initiation factor IIB"
                     /protein_id="XP_005536732.1"
                     /db_xref="GeneID:16994788"
                     /translation="MSAPTMERDVPDVCGECGSTDLVEDTKNGDLVCAQCGVVAAELL
                     IDLGHEWRTFENDDSAYDPNRVGGSINPLLDSGLATSISQGPAGANALNERLARAQSR
                     NVLDANDRYVTECYNRISYLCERSGLPQLVKDRACELLRLYYDHLTLGADGVRARARF
                     REDETASIISAALFIACRNEGFPRTFNEISVIVSVAKSRVAAYVKAMEMSIGEAAKIS
                     RIRTTDDFVSRFCSYLEIPNIVRSLVNQVARAAAEKDGIHGRTLVSIAAGAIYFVLLL
                     WRETCPQSIPATLRVSDEALVNRIAEVSGITEGVVKTVASRIRQYRDRGLLPPDWVRR
                     FPSRLEPELPTSSSERQDPTGNELIHEQSAPTVSSKRPRQGSH"
     misc_feature    complement(172625..175129)
                     /note="possible transcribed region"
     gene            <178211..>179434
                     /locus_tag="CYME_CML079C"
                     /db_xref="GeneID:16994783"
     mRNA            <178211..>179434
                     /locus_tag="CYME_CML079C"
                     /product="valine-pyruvate transaminase"
                     /transcript_id="XM_005536676.1"
                     /db_xref="GeneID:16994783"
     CDS             178211..179434
                     /locus_tag="CYME_CML079C"
                     /codon_start=1
                     /product="valine-pyruvate transaminase"
                     /protein_id="XP_005536733.1"
                     /db_xref="GeneID:16994783"
                     /translation="MPGSDSVSATLYGLGGSSTIQLSKGHPNPRLLPLSAVYEAFGQS
                     RVRPDAEVSHLQYGAPQGPLALREQIALLLHSETGSSTATPENLMITNGSGQALDMVC
                     SVLLSPGDLVVVEDPSYFLAFYTFRDYRLNVVGIPVDAFGMQVALLEQRLSEDPTFRP
                     ALVYTIPICQNPTGMTMSRDRMRRLVELSRQYCFKIASDEVYLLLSFNSDEQPLSLRA
                     FDDANQPTVIAMNSFSKILGPGVRLGWIDAHPRYIERFLQTGLLLSGGGLNPFMSAIA
                     TELLRSGFQREHIHRLRAAYAAACKQLCDSLDDHLAKHPKLRIKYQRPRGGFFVWIEL
                     PSEIDAAAFLEYCVHEHGVSFFEGIRFTTDTSHHRSALRLSFSWLEPHELAEGAKRLV
                     EALAAYSQRRHGPAI"
     gene            <182219..>183571
                     /locus_tag="CYME_CML080C"
                     /db_xref="GeneID:16994777"
     mRNA            <182219..>183571
                     /locus_tag="CYME_CML080C"
                     /product="acyl-CoA dehydrogenase, mitochondrial precursor"
                     /transcript_id="XM_005536677.1"
                     /db_xref="GeneID:16994777"
     CDS             182219..183571
                     /locus_tag="CYME_CML080C"
                     /codon_start=1
                     /product="acyl-CoA dehydrogenase, mitochondrial precursor"
                     /protein_id="XP_005536734.1"
                     /db_xref="GeneID:16994777"
                     /translation="MLRVFRLRLFGWGHFQRRLDRSVPRYSVEVYGQTRSLATPAGVA
                     GAQTAAHLSVLQATVARFAREQIAPAIFSREQQGCIEPSLWRALFEQGLMGMEIPSDF
                     GGSGLSFVETCASIEQLSKVDPAVALVVDIQNTLLNRAVLHFGTREQQALWLPRLARD
                     TVGSFALSEPEAGSDAFSLRTHADLEQATSTTSRRYVISGSKLWISSAAEAQWMLVFA
                     TVDPAQKHRGITAFVIDNVDEAKALGQLQIGPKEDKLGIRATSCCPVHFHRCVIDADR
                     QVLGGLGQGYRVAMRALNEGRIGIAAQMIGLAQGALDATLPYLETRCQFGRPLIDNQG
                     LQFQIAQAAAELEAVRALTFQAARLVDEHQGTSAAAHLAEIARQAASAKLLAAQTACR
                     LTRRCIEWMGGMGFIRQTLPEKFYRDAVIGKIYEGTENMQLATIFRFLSATHHTRHDS
                     "
     gene            <184527..>186182
                     /locus_tag="CYME_CML081C"
                     /db_xref="GeneID:16994778"
     mRNA            <184527..>186182
                     /locus_tag="CYME_CML081C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536678.1"
                     /db_xref="GeneID:16994778"
     CDS             184527..186182
                     /locus_tag="CYME_CML081C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536735.1"
                     /db_xref="GeneID:16994778"
                     /translation="MSAFASEPRCTSPSQTLPEVALYADGQGSAPLSEQELVHGAEDW
                     AHIAAFYRLLEERRRRNKYLLQRSVHAGLHRWARHLVAPQERSRKRTQKRRDEPGHPG
                     RLLERILRGKLLCSLGLWRPDSTRDRQLTGADRTCWPNLTEDAFIERLKLAFRSESEE
                     LVLHLGPVFVDPSANKFSALTTNGIAARMPRSALMRVTVGMGMIALNQETMLDFETSV
                     PPADLKSHKGITTEMARMRTIVQRSFRVPVEPRAPLHPEHWPAAISIPECSFVTLCFD
                     LRSELLGLLGAITPTEYPILEIRAELPLLIPERDAYSTNGLPDGLAATSSDVPCGQVW
                     RKALKLCDPATGHWMPNQIYLLELQADASGAVWVPGHAPQLALGIEWRPHREQHPGYG
                     AAWSTGTNQRLKIPKRAEMLQAPAVRELPMRPWESDKVQAKYNGWQSNSADTNGLVEP
                     AKAAPLLRYRIWRSPPAHCTGVSMRNGYKGARSHQALITVDRSTLTCIWCGIRVRHLL
                     ALMLHTWKRHMTWRYTGHRLKIWYPRSQQRMTRHQNPVTQGSI"
     gene            <187139..>188185
                     /locus_tag="CYME_CML082C"
                     /db_xref="GeneID:16994779"
     mRNA            <187139..>188185
                     /locus_tag="CYME_CML082C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536679.1"
                     /db_xref="GeneID:16994779"
     CDS             187139..188185
                     /locus_tag="CYME_CML082C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536736.1"
                     /db_xref="GeneID:16994779"
                     /translation="MRGSSRASRASGRSAHDFAGATTTAAGTGAKLISRSRISVVAAS
                     PGQGAVYANLPDVQPCDRSTRGRRQGNATDRRQKRTRSAPALRQARTLHSGRLRQRCA
                     WRTSTSETVPMTAAANGATAPASRETPRERPGKAAASSDSRLFDRTYYHSFTFAPMSP
                     DEVLAAYDSELEEVDDAWLVQLSDHRIDQFLDVLPVEKVLMKAWNAFLKEVYPILGDR
                     SVRDAVRRFAPWFVARLRVNASSSACHPYEALRTAFLMHLRALWQFHLLGSEQVAEAM
                     IAFDRAWLNGQGPVFAAAADLQPRLGEGSTNHTHAGLSPNSLPRSDHANGIDGDAELD
                     PENPLCACASVQAC"
     gene            <189421..>190200
                     /locus_tag="CYME_CML083C"
                     /db_xref="GeneID:16994786"
     mRNA            <189421..>190200
                     /locus_tag="CYME_CML083C"
                     /product="short chain dehydrogenase/reductase family
                     protein"
                     /transcript_id="XM_005536680.1"
                     /db_xref="GeneID:16994786"
     CDS             189421..190200
                     /locus_tag="CYME_CML083C"
                     /codon_start=1
                     /product="short chain dehydrogenase/reductase family
                     protein"
                     /protein_id="XP_005536737.1"
                     /db_xref="GeneID:16994786"
                     /translation="MDFRSDALQGKVAVITGASRGIGAAIAECFLEAGVQGLALISRT
                     PSEFVTQLRKRAESRGTKVGFYSLNLADTEAVERTARQIVQDWEHVDILVNNAGIALL
                     NPLTELSTVDWDLTMTVNVRAPFLLSRIFVRESMIPRGAGGKIIHISSVAAFGGVPEH
                     AAYCASKAALNSLTKTMAVEWGPYGIQCNVVCPSIIMTDMGRQVWEDPEKHGPVLARV
                     PIGRFANPPEIARVVLFLASPENCVVNGQCIAPDGGYTAGL"
     misc_feature    complement(191926..193591)
                     /note="possible transcribed region"
     gene            <194043..>195155
                     /locus_tag="CYME_CML085C"
                     /db_xref="GeneID:16994802"
     mRNA            <194043..>195155
                     /locus_tag="CYME_CML085C"
                     /product="similar to UDP-galactose transporter"
                     /transcript_id="XM_005536681.1"
                     /db_xref="GeneID:16994802"
     CDS             194043..195155
                     /locus_tag="CYME_CML085C"
                     /codon_start=1
                     /product="similar to UDP-galactose transporter"
                     /protein_id="XP_005536738.1"
                     /db_xref="GeneID:16994802"
                     /translation="MLNVPAPPATTAVYSVRLATCVVGIISSLLVYAYLQERIMALPL
                     TTDAAGQPVFFRDSLFLVLQNRLYAALAAVFVLLWQGDRSGMRPQAPLYKYASVSLSN
                     VVATWAQYSALAWVSMPTQTLGKCAKMIPVLVWGSIMSGKRYTLSDYGVAAAVAAGCT
                     LFLLAGNIQAKYSAEQNSLYGLVLMVVYLAFDGFTSTFQEKLFRGYPMSTYNQMLFVN
                     LTSACISFLGVASSGRLAADLQLCWQYPRLFIDASVLSAAAVIAQFFITYTIKEFGAL
                     VYATVMTTRQILTILLSNLFFAHGLTVQQWCGAAIVFSALYLKSYTQQMSRRATKPAA
                     APLDNDNGPASEESKAFHVAAVALPQTAQECRALAH"
     gene            complement(<195979..>198108)
                     /locus_tag="CYME_CML086C"
                     /db_xref="GeneID:16994803"
     mRNA            complement(<195979..>198108)
                     /locus_tag="CYME_CML086C"
                     /product="probable signal recognition particle targeting
                     component SRP68"
                     /transcript_id="XM_005536682.1"
                     /db_xref="GeneID:16994803"
     CDS             complement(195979..198108)
                     /locus_tag="CYME_CML086C"
                     /codon_start=1
                     /product="probable signal recognition particle targeting
                     component SRP68"
                     /protein_id="XP_005536739.1"
                     /db_xref="GeneID:16994803"
                     /translation="MQSETGPLPETKSRRLRGSGSSERKRQQTARSGVKRVAPVPALR
                     KNKDLVGASQQPEHGRGLQGAWAILWYLHRVQERHGGELSDYCGYAQYCTRRLRSLRV
                     RLAYTCSLSRRSSQYAQARIDVNIIRDYAGNDRRFIEIGVLEAERAWAQAMDAKEQLL
                     AMVSRLDTAADTNRPIATELPSLVDTKQRRAQRLRRYYRRRLRRAALLAERLAYAAVA
                     ARSQLSSWTLTELVAYACWLWSLFYGERHRLGPGALHRIGTAAQLYRTLYDCMAGIEA
                     TLSAPLTQRIQQVYRQRAQELERTARACETRVDSENVPHPHAWPDIALVQRLQAQLLS
                     TRTKLENMPPELVHERYSISTLSAGETTTLLPMPTQTVDWCGHQVRVPHLTLAWLESG
                     RPAQRTLTGDGTSGSASVATTGAIPTSTSKQQAVSLLELLAKAEHYEAKRTQKAVRLL
                     ESVQRHLESLVAERPTDDELRLVTAFWRYRKALLLLKRCYRRQQYDKALVWVQEISDL
                     FGIDEQLLEATQVAAAFLQLAQKQHQMERCWSEWEASSSQLQGDTGAQQGLVQVYGLA
                     VQLLGLVAELRARVAVTAPAPSRERRELLSAVALDDNALTETDTKARALKVRASVFYS
                     LAEAGIAERLERTTIAEKPLSSRCYLEEHPIDLLTPDEIARMPPAFRAMVCKPFVLDL
                     AFQQIKYPELPERRDARRGLLNRLFGR"
     gene            <198286..>199503
                     /locus_tag="CYME_CML087C"
                     /db_xref="GeneID:16994780"
     mRNA            <198286..>199503
                     /locus_tag="CYME_CML087C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536683.1"
                     /db_xref="GeneID:16994780"
     CDS             198286..199503
                     /locus_tag="CYME_CML087C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536740.1"
                     /db_xref="GeneID:16994780"
                     /translation="MLSNEYQYNLEFFQYKLHATGVQAICRDVYGGQDYLPTLLAERY
                     GSEGSSVASNDPCVERYYVLCRSKPSAVHREAVADAEDTIDRVDAPLVAAVGGYFLLS
                     PGHYWIQGVRVAAAQRGKGLGLGITSAVVRALEQLGKNSQQTLHLWSCTITDNKPMRR
                     IFRKLGFVEFQRCWLWPSPTFMQILRRIDERIASAPNHVRETFATMLKATRWETPAEE
                     SSEPCIIDASTDQRVSMQPESFWETVPSPASAFEALTRHRLCVPLYYWCLPPEALEKG
                     AISVDWLWIGQYKGEDRALGWIFVYREPLIQTSDPTVAGVIASSCKVLLSAVQHLNRM
                     FPRFRTVMDTSLFPSNECRIPEGFRRWSAASQMVNVYRKLELKNAESEARSDCVGQRP
                     GAFACLTPQCAAE"
     gene            complement(<200902..>201825)
                     /locus_tag="CYME_CML088C"
                     /db_xref="GeneID:16994794"
     mRNA            complement(<200902..>201825)
                     /locus_tag="CYME_CML088C"
                     /product="similar to chaperone grpE"
                     /transcript_id="XM_005536684.1"
                     /db_xref="GeneID:16994794"
     CDS             complement(200902..201825)
                     /locus_tag="CYME_CML088C"
                     /codon_start=1
                     /product="similar to chaperone grpE"
                     /protein_id="XP_005536741.1"
                     /db_xref="GeneID:16994794"
                     /translation="MLGQRSRFAVALIGRLGSVRTRRGSALGFEHRSGTVHWRRICSD
                     SRKSTADQVFGYDETAKGGSAAGTNGADTGSQGPATAKPTPGASGDQNTQQSTGTPDA
                     QERVQRLEGLLQEKEQEIATLRDRAIRLLAEMENVRMIARRDVEAARKYSISSFAKEL
                     LDVADNLNRALAAVPRQQLEVSSSSNSTGAGGAVSAAESAKLASLLTALYEGVSATER
                     ELQRTLQKFGIERYGEIGEPFNPEVHQAVFEAPAPVADSATSEQSGAAKPSPSLPDGA
                     ILHVLKAGYRIHDRVLRPAEVGVVKNVSPST"
     gene            202058..203728
                     /locus_tag="CYME_CML089T"
                     /db_xref="GeneID:16994795"
     misc_RNA        202058..203728
                     /locus_tag="CYME_CML089T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461409.1"
                     /db_xref="GeneID:16994795"
     gene            <204668..>206218
                     /locus_tag="CYME_CML090C"
                     /db_xref="GeneID:16994792"
     mRNA            <204668..>206218
                     /locus_tag="CYME_CML090C"
                     /product="probable DegP protease precursor"
                     /transcript_id="XM_005536685.1"
                     /db_xref="GeneID:16994792"
     CDS             204668..206218
                     /locus_tag="CYME_CML090C"
                     /codon_start=1
                     /product="probable DegP protease precursor"
                     /protein_id="XP_005536742.1"
                     /db_xref="GeneID:16994792"
                     /translation="MQAAAALSSSQNGPTEAQGVLVGHPVLQEAPIEASVESQLEQLA
                     KREDVTASRVYYAARSAVVHISSMESLRAAARRGFRKLWPPFPYGPESPDDEDDTEDE
                     DASAARAAEPSEPEPKRGLPEPPLASPHERPEEEWILRGTGTGFCFDADLHIVTNAHV
                     VAGASRYWVRFISGDQVPAQVLGLDSEHDIAVLQPRWEGASSDQSAPLRELAALPSDA
                     PRTLSNAVASRWSQGANLTVRKRLLETIQPLRFGDSTKLLVGQRVFAIGNPFSLEHTL
                     TAGILSGVGREVASRRSGGIPMFGLLQTDAALNAGNSGGPLLDSNGCVIGMNCAIASP
                     SGAFAGVGFAIPIHTVRRVAEEILTRGRASRPGLGVTFAPTALTRRLGIRRGVLILNV
                     LPDGPAARAGLRPTRRLERLYLGDVILSVDNHPVNDAVDVMRILQQKRVGDTVKLAVA
                     NASEILALQGGTQAWSDKLPPAMNRAHPSPSEEEAIREKWKGLRVREVTVQLADIPRR
                     AWRIASKL"
     misc_feature    complement(205711..207402)
                     /note="possible transcribed region"
     gene            <206925..>207254
                     /locus_tag="CYME_CML092C"
                     /db_xref="GeneID:16994784"
     mRNA            <206925..>207254
                     /locus_tag="CYME_CML092C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536686.1"
                     /db_xref="GeneID:16994784"
     CDS             206925..207254
                     /locus_tag="CYME_CML092C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536743.1"
                     /db_xref="GeneID:16994784"
                     /translation="MPRGVDKEHLPTKVCEVCGRPFTWRKKWARCWNQVSVCSKRCQQ
                     ERRHQKRQEKASDADGSVSTFSSVASQGARALALAALRFAIVVGCRQGSSAGRTLGWC
                     PWRLGIH"
     gene            complement(<207408..>210011)
                     /locus_tag="CYME_CML093C"
                     /db_xref="GeneID:16994785"
     mRNA            complement(<207408..>210011)
                     /locus_tag="CYME_CML093C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536687.1"
                     /db_xref="GeneID:16994785"
     CDS             complement(207408..210011)
                     /locus_tag="CYME_CML093C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536744.1"
                     /db_xref="GeneID:16994785"
                     /translation="MDAPKPGEWSNTIPSLNRVSPELGSASEREPTSTGTAATGRNFW
                     NRSCYPSRLENNQFVFLDTGLLFECLGDFEKARVMYSQIAKPILSGTSPERLRMLETD
                     IGAQLALVRLCLIDYRRGHLEETQQRLELLLETCPRFRLGWLALAKALLLRHKIPGAF
                     AAYQRCMELDPESAKDPLVWTGIGILYQLYGQLEEAAEAYKVTQRLLPVNDEFRDVAL
                     FYLATLKCAARDYDAALALFTQALEYRVEERSAALLMTKKTRHSGNAVENDQPSTLRI
                     GNETAPLSTANRRATSFTTDTSAARGNGPLLPSGSNNGRQRESAATKMVLGMAQKEYE
                     TLERQRLFRARRALLDLVLDEELSALSDGRTWCEIGHVYMLCQNLAEARKAFENALIA
                     DPGDVDALQQLSWTLILLNEVPIALEHLRRCVQLDPNRAHSWYLLGRAYALSEQHLEA
                     CNAYQQAVLREPNNASYWCSIGVLYYQAQQYSDAADAYMRAIRLNPGLAEVWFDLGIL
                     YENYGQFADACSAYHRAMSLNPHNISYLERYRAMCSTLQAGEAVTSAPGRSAPKTTGQ
                     AILPSAPAAQGLSYPPDSRRQDTFPPLHRTYPAHAQIPAQVTSRRDAAYPETRTLGER
                     AFSGQAPGVMGMVPTQPEPWAETLHRLDAGGGGGGGSAEAAVPGTEQISAGMSRAHQL
                     PSVASKLMTKDPGPPNQVNPLLRSAAGLDRREGIADADTLAAATTAADASWAPSLSVA
                     ATVQQPSTGPQAIAGAYRLETGQPRGTPAVQVTVTASNEPVETNRSLPKISLEKCPIE
                     NTIERNKRLIILSEKKSRTISHEEATNPPSGDQNLAPESAGSTTKVALVQRQPTPDST
                     DTEPTDAETSS"
     gene            211070..212633
                     /locus_tag="CYME_CML094T"
                     /db_xref="GeneID:16994796"
     misc_RNA        211070..212633
                     /locus_tag="CYME_CML094T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461410.1"
                     /db_xref="GeneID:16994796"
     gene            <212975..>214573
                     /locus_tag="CYME_CML095C"
                     /db_xref="GeneID:16994790"
     mRNA            <212975..>214573
                     /locus_tag="CYME_CML095C"
                     /product="similar to leucine carboxyl methyltransferase"
                     /transcript_id="XM_005536688.1"
                     /db_xref="GeneID:16994790"
     CDS             212975..214573
                     /locus_tag="CYME_CML095C"
                     /codon_start=1
                     /product="similar to leucine carboxyl methyltransferase"
                     /protein_id="XP_005536745.1"
                     /db_xref="GeneID:16994790"
                     /translation="MTSAGSRASTDEDVGLERLLGPVQRTCYDAWLSKCLAARCGFFE
                     DAYIALLDPIQRLAADSATSCPQRRGERQRLPCQHGGLSAAISDGSQRHASIPTVDRG
                     GKPSGSSAPHPGRGKAFREAAGPDFASSSYSACGDVDDGEGTHLNAAGHQTLVGGQRN
                     GHNGAGTAQLLSLGQRVPRSLRVNSSGLDAVLLHGTYARVMALRHIMDTVLERLRLKA
                     GASHQPPMLQLLSLGAGLDSMPFWLLERSRQASVAASSSHREVPLPQVRYHELDTEQV
                     ASLKALCIRRQAALARAIQAPVADVQARGAGSADAYAGVAVAGAQAPDVASKVQVVLE
                     TPVYALIAADLCSGRSVLGAALERLQRHGGMRREPSFTLILLECVLAYLSPADTVNVL
                     EALREQFANHPALLVCYDPIGLDDAFGRHMQQRLEERGAPLQGLNCRATLDEAVRNLE
                     SLFAPGAASKHPGRGMDMMEVYQRLRDDACERSRIERIVALDEVEELRLLMRHYGLIW
                     VSNEHAEVFDFFKPSRFQGSAVDA"
     gene            complement(214521..216166)
                     /locus_tag="CYME_CML096T"
                     /db_xref="GeneID:16994791"
     misc_RNA        complement(214521..216166)
                     /locus_tag="CYME_CML096T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461411.1"
                     /db_xref="GeneID:16994791"
     gene            <216347..>219889
                     /locus_tag="CYME_CML097C"
                     /db_xref="GeneID:16994808"
     mRNA            <216347..>219889
                     /locus_tag="CYME_CML097C"
                     /product="similar to nucleotide excision repair complex
                     subunit XPC"
                     /transcript_id="XM_005536689.1"
                     /db_xref="GeneID:16994808"
     CDS             216347..219889
                     /locus_tag="CYME_CML097C"
                     /codon_start=1
                     /product="similar to nucleotide excision repair complex
                     subunit XPC"
                     /protein_id="XP_005536746.1"
                     /db_xref="GeneID:16994808"
                     /translation="MTSGQGGGGSATPEESSVVGTLQTASNDAVQRTLDRATKRTRRT
                     DAANAAAAPQAPTRIVREARRAALEALKRLNVADVEVAEESPDTKPPRRTVPTTALQE
                     NPRALSPAADLEKDIEWESAWTEGAAEQPSPVQTKDQLEVVLELDEEGTDSASGVSRS
                     QADSTGSDADHRAAKRRRGSLATKRKMTKTFSAAERANALRIHRIHLLCMLASSLTFD
                     RLSSAATIQARALSLVPCEVIERFDRIPEDALRETSSSLAEALTYFVVWFASNYRQSS
                     FPCEVCCPDESGYSVPVPRTPHTRLEHAMLHGLGGEQELVALACAMLRALLGRLNFQS
                     QARPEGKRVQSAPVPDGSTVLLKRYGLVRFVAGPNIIGRKPEHLELVDQGSGLPTWQA
                     RLSAILEHWFPPAPADVPPSKKQCPLEPPLNRKRPGKPLRNSRSSHGLQQKHAMQAHG
                     VEAQPPAVHSKASTLDADTGEASLPRRALESPQVRQRDVHHQQQQAGRGLSTSKTQRT
                     RQNWLTRDSKRTASALESAERYSNPRGNTRSTYLWAYQIQSAFLAPWRVGVNISPQVA
                     HRRTAESSDRSSQARKTGRLWSLSVPGRWNLTNADPYRVPQYWLEVWDPTQQHWIHLD
                     PMRCLVDDPLAVTVLPWWTRTTRPLPRSAATGQRDRHLNPSKTRSLKGDVSNEPREED
                     DGDGNRIQRPKRRSSRLRPDATYNEMDGRSGDRSQSESDTASSELETPELPTNRWKRE
                     RAERVVPYIFALEHGFGRDVTRRYTTRFQPVLEARSLDGHRYWTEEVLPMLSPFQPRT
                     HLIETEHDAIDDDAFRERSTLWNALDNLEQNEFWGLHEAEPIPRSISALKNHPAFVLE
                     EHLKKYEAIHPKLAIGNIQRIQPNGRIQTIPVYRRRDVHLLHTRERWFRECRIVRESE
                     LPYKIVQSFMSRFRQRREERRRERRQQAPEELEDSSTATAGPTELFGIWQTDPMPRPR
                     AENGIVPRCGLRGNIELWTPNHLPLGTTHVDLPFAAMFARRLGFDFVPAMVGFEVRAC
                     GFVPAIRGVVVCTENAAALTDACEAEIKRRRERAEKRMREDALRRWRQLIRTIVAKER
                     LRKRYGGFQVQDTNATFSSRKAGKQTSSSSAAEPAKRERVPAATAAGADDDADQRAAH
                     EHEWVFVGASNSQDALGRKQCALCGLCVTYESLL"
     gene            complement(<221873..>222502)
                     /locus_tag="CYME_CML098C"
                     /db_xref="GeneID:16994809"
     mRNA            complement(<221873..>222502)
                     /locus_tag="CYME_CML098C"
                     /product="cytochrome c oxidase subunit Vb"
                     /transcript_id="XM_005536690.1"
                     /db_xref="GeneID:16994809"
     CDS             complement(221873..222502)
                     /locus_tag="CYME_CML098C"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit Vb"
                     /protein_id="XP_005536747.1"
                     /db_xref="GeneID:16994809"
                     /translation="MQRFLVCGGLDALLRRTLARATSTSTRWRNLEILDVPVHKDKTF
                     PQGYWFWWRSSGLLVPGGRTRRSALQPSVPCCASIATKASGSSASLSPPRASAAMDTS
                     NDEATDLQPPVRGAPPGAMPTAEDQATGLERLELEYPDLFKHNEVIRGPFGTMDAPVM
                     VESAYNSRIVGCTGPAAPNDHDLYWLEVRKDQPAVCPLCEQVFTLKQVT"
     gene            223934..225943
                     /locus_tag="CYME_CML099T"
                     /db_xref="GeneID:16994804"
     misc_RNA        223934..225943
                     /locus_tag="CYME_CML099T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461412.1"
                     /db_xref="GeneID:16994804"
     gene            complement(<225142..>226827)
                     /locus_tag="CYME_CML100C"
                     /db_xref="GeneID:16994805"
     mRNA            complement(<225142..>226827)
                     /locus_tag="CYME_CML100C"
                     /product="nuclear receptor co-repressor/HDAC3 complex
                     subunit"
                     /transcript_id="XM_005536691.1"
                     /db_xref="GeneID:16994805"
     CDS             complement(225142..226827)
                     /locus_tag="CYME_CML100C"
                     /codon_start=1
                     /product="nuclear receptor co-repressor/HDAC3 complex
                     subunit"
                     /protein_id="XP_005536748.1"
                     /db_xref="GeneID:16994805"
                     /translation="MSNTITSEEVNYLVFRYLLESGYTHSAFTFGHEALVLENDFDAT
                     GVPPGALLGFLQRGVSYAEIEAHVARLHAERVKRSTSCEENGALAPETVSSADKKDAR
                     TPVVVNLADVHRALVNRPKRRRNVVAVEAPARRSATGPDTAAAPETLYTVHDSEVTVL
                     YGHTAEVFAIAWNPVHEYLLASGSGDATARIWAVPAGPSGRTAVAPPLELRHQSSEER
                     QPRGSPTLSSGTDEVTVNSTSGAPLAPGNARQRRAPSRDVTALDWSSDGHHLATASYD
                     GAARVWSSTGALERMFTVHVGPVLSLKWNSTGKRLATSSVDHSVAIWDTFSGRMEQQV
                     QLHRAPVLDVDWQSEDTLASSGSDKMIYVWRVGEPKPLRVFCGHQDEVNSIKWDPTGT
                     LLASASDDCTVKIWRPIRQSGTSVSLASRTSNGQNVSSSSDYLVQDYTDHTKEVYTVR
                     WSPGTNHYLASASFDSTVRIWEPAHGAAKATLTLARHFGPVFSIAFSPCGQYLASGSS
                     DRNMLIWSLREGGKLIRVLRCQGGIFEVAWNATGSKVAAALSNGTVAITDLRM"
     gene            <227123..>228469
                     /locus_tag="CYME_CML101C"
                     /db_xref="GeneID:16994800"
     mRNA            <227123..>228469
                     /locus_tag="CYME_CML101C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005536692.1"
                     /db_xref="GeneID:16994800"
     CDS             227123..228469
                     /locus_tag="CYME_CML101C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005536749.1"
                     /db_xref="GeneID:16994800"
                     /translation="MDPGKSTGATSGTLSAVLVLKDGTDKVFNLHGFRVCGARNCKQL
                     FCGRLGRCPFHAAQFLAADDWQRDQLDLSEPRAAQGPEAVDAVAVAPREQLVCRSGAT
                     ASTAVGTLRQSDKGELAGAPGSRGSAAETSARPTVGEYSLSQGRGADYLSEDARRCAL
                     KSGAAVILIAGGREGREEELCGPAALRFWEAWRATSHAEPSLKRARFKRAWSLQEHAR
                     FLEALRIYGKGKWKDIAAYVGTRSAAQCQSHAQKFYDRAFVQLGSQTDSGASCLGTTL
                     CAPSRTSRKRSIHDMRDPHAIHLELARQRQAQQHRAERDARRTAAQRRKLLDAEATRM
                     EAQLRSHLDAFVREHAEQLPTKRIASNMRRSVQKCIQDWKHKHLEEASETATAREESS
                     VVDAASDDELVPLVFMVPEEAMPAGSHVVLLRKPIVLKQSSPSTNVAAESSSLPFP"
     gene            <228878..>230689
                     /locus_tag="CYME_CML102C"
                     /db_xref="GeneID:16994801"
     mRNA            <228878..>230689
                     /locus_tag="CYME_CML102C"
                     /product="histone acetyltransferase HAC108/MYST"
                     /transcript_id="XM_005536693.1"
                     /db_xref="GeneID:16994801"
     CDS             228878..230689
                     /locus_tag="CYME_CML102C"
                     /codon_start=1
                     /product="histone acetyltransferase HAC108/MYST"
                     /protein_id="XP_005536750.1"
                     /db_xref="GeneID:16994801"
                     /translation="MPLGRTRSESSPNSLVTENETVGNQPEGNRGGVARVTRRALRRS
                     ATAGVATNSTGTAESANALSECSIPGETSFEHGTLREPGQRSSDSSLERATPTAASDL
                     ELASDTSDESALRRERSERHRIQRSHAVSSSLVATEYDAVGGKAGNTPRSTLSPQASA
                     SSVSDEALDADLSKHVDLGRIPLPRNLQLIAQSQILHEPHLGSIVDVRYNDELQQHEY
                     YIHFDGWNKRLDEWLTIEHFDLSDLSERLREHYRRERASQARRRSRSSATASSGKRLR
                     KAEHATAADVASSTAAAAAAAALGNESRADQQQKAASGTSAGADLPADVVTRVKNLHS
                     IVIGRWEMETWYYSPLPPEYRNLRTLYVCEFTLKFFRTRDGLERHLARNTRWCPPGRE
                     IYRKDHLAVFEVDGARNHFYCQNICYISKLFLDHKTLYYDVDPFLFYVLCEIDDWGYH
                     FVGYFSKEKASEENYNVACILTLPPYQRKGYGKFLIALSYELSRREGIRGSPEKPLSD
                     LGLLGYRSYWSQILIDLLMKATGPLSIEDIADRTMMKTEDIIGTLRALDLVHYHEGQH
                     VIDLRRVEHMDLGNRGMPFDPQYLRWSPPVERKRRKS"
     gene            complement(<231288..>231737)
                     /locus_tag="CYME_CML343C"
                     /db_xref="GeneID:16994810"
     mRNA            complement(<231288..>231737)
                     /locus_tag="CYME_CML343C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536694.1"
                     /db_xref="GeneID:16994810"
     CDS             complement(231288..231737)
                     /locus_tag="CYME_CML343C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536751.1"
                     /db_xref="GeneID:16994810"
                     /translation="MAGSVTDDRSRVLEENGLWETFETLRRARLPSSCLGHVADLTEV
                     LALPFRPHCRAGSLLEVALQLEAHAGVPLAAFDPQLLQSIRLSELLPEGSLSGADKPS
                     TGSDTTELASLAVWQPAWLEERQQPEYAPLLKTRRRRLRQLERHTQA"
     gene            <232158..>237194
                     /locus_tag="CYME_CML103C"
                     /db_xref="GeneID:16994757"
     mRNA            <232158..>237194
                     /locus_tag="CYME_CML103C"
                     /product="similar to splicing factor 3b subunit 3"
                     /transcript_id="XM_005536695.1"
                     /db_xref="GeneID:16994757"
     CDS             232158..237194
                     /locus_tag="CYME_CML103C"
                     /codon_start=1
                     /product="similar to splicing factor 3b subunit 3"
                     /protein_id="XP_005536752.1"
                     /db_xref="GeneID:16994757"
                     /translation="MAEPLALFALDLQQPSALVAATSGYFTQEEPTGTRDLVLVRQSG
                     SYGATIECWAYNAELGKLQRVQATSAAFAEASNGVTFAHIWHVAPVRSWSGPDHLLVV
                     SDSGTLSLLKWCGSEAVSAGSIRASLRPWCVEQAAAADADVTYDIGWKCVSSAVFSKP
                     GARASRPGAFLAIDEQSQACALASLDGSICAFALPQHTSEASTASKAGHRYSGKKRNP
                     AGTVLSRSATSVQTSRENPVRRSSRRRKRPLGADAASSVSSVEAGAMHPGSQRAASDR
                     RASRRDKLTEGTSTHFTDDNDDDDDDDDDDDDDSDDDDDDDDHDDDTNARLGDGAPSG
                     DADEDGHEDPGRTTRGFSAPIEWSTEDRMALGVGTCFGLVALPWSRAENESLFVMLMD
                     RSLSTATVAPGPDRRLLLLLVDRNAQTVHAKAMSSPLDPSAYGIYALSDGMLLIVSRS
                     TVEVWCFRGTPEANANEEPSSGFSANAGTFSCLAKLPHRALLTRRSSTRDGAHDITVR
                     NALFDSAHLQANGEPSGSVLITAAALWEAACSREQLCVLLGDEDGYLFRLTIVLRPVE
                     DGIQSEALSVRMLGRFHAPVSALCFLGGDDIAAAAVFVTLEQGDHAVVLLDRPQLQAG
                     KRDSLPVASALPDTSSDGTSASRTEHLAGLDDAMSNSNNTLSIVDTIPGHHPVIMSLL
                     LRTDRCCQAEAAQTGCLPTWQLLGASATADPNETPLRIFVPMRDTVALAQSPVDGRAQ
                     RVFALPPLLQRSTTEPAATLPPESVSDTATVALLVLSFTQQTRVFRFQSLALHEEHTL
                     GFEHNTSTVHAALLCSDWSRSACCWVQVHSHGVRLIGAASSDSRSASVVDVYTASTQQ
                     PIVAADSTLSQVLLLLADGQLVYLVASDTDSDSDKQSKVRGNASPPAMELGFGPRSAL
                     QSAAAANAPTEAPPRIPPSPTSRAVACCLVPLDNPSWSSYLVYVEAGASPVLRICQVP
                     ERATHAPVQCLYSVLLPQLPTGIAAVHTAGTASLVDLWAGLEDGTLLRVEAVDVAELQ
                     MTTERGTPRLHRYHLGAAAGLRLRRVLVPPALGTEALLVLGSSSWLIPLSSSSSSSLW
                     THPYPIHAGQLLDAASFPLPQMCSTVDPETHSEAVAVFPAATAIAALSEQGRTLEFLS
                     FAADDSSSNLLTIRPVSKPQPADAAASGTTVSRKVVRKLCWIFPNELAAIAISTEGER
                     GPQVQLQLVQVPGSERVASQHLSSSDMESHAFWQHLRLDGGVRIAGAPAWGGIRVTSM
                     ISVDLPSLSLPSSDTKNEQQLHAAGRMPVALLVAVAPPAAEAETAPESGDVARAFLLT
                     YLVERQAASDAPWKLVLTERLSFPESIGDLSRVGRHLVVAHGNRLALYTHTRCGWRPL
                     TVSKRALASPIVALTAHEALCRIFVASLHHGISLFKYYVQENRLVLVAEDMQRRWIHR
                     LQLLDADTVVAADKFGSIAVLRLPVESSAAIEGDPSYGRLAERYGASPESARSFVARL
                     MPECSVHVGSVVTSLHVFGYGAATDPDATPASAPRSWTEAEAILYGTVSGGFGMLIPF
                     RTRAEWDIVQRLERELHLFWAKCCAPGHTMDATHTRNLLHASVLRFQGRIEPTRHVVN
                     GHLCGLFALLDPETQRSIAARVLGLQEPSTPSEEQRALTLLLSTLHRLYARVLWPLGH
                     EVQAAPLHAT"
     gene            complement(<237865..>239442)
                     /locus_tag="CYME_CML104C"
                     /db_xref="GeneID:16994824"
     mRNA            complement(<237865..>239442)
                     /locus_tag="CYME_CML104C"
                     /product="similar to nuclear prelamin A recognition
                     factor"
                     /transcript_id="XM_005536696.1"
                     /db_xref="GeneID:16994824"
     CDS             complement(237865..239442)
                     /locus_tag="CYME_CML104C"
                     /codon_start=1
                     /product="similar to nuclear prelamin A recognition
                     factor"
                     /protein_id="XP_005536753.1"
                     /db_xref="GeneID:16994824"
                     /translation="MPRDTQQSRFSTGLRVTDLDDFLPSSTACVLPLQGGLPPPGSVA
                     APVYSHNAHDANGETNTPVARVTLSDCLSCSGCITSAETVLLATHSVDNFVTACSQSA
                     DAFGAVVVAPAVVASLASVWKLAEIESVLERIQTIFDKFGAFAVVLNSVGRCLSVLET
                     CAQAVERLQPDQNDGSGAQQPLFASACPGWTFYVEKTQPHLVSCLATAKSPQAMMQLL
                     VRHELGEHAWTVSIAPCYDKKLESQRDAKDSEHVFVLTATEVLELAERAPPHMPNDAR
                     RQLRISQQVSALTKFRGAWWATFGGLSGGYAVEVFRYVAQYVFKHRVSDAVLEPAAVR
                     ERNPDLRQLLLYQHRSSGDFVVNFRPVIADDDLQLRYSVATAYGFRNIQNIVRQYKHT
                     GRCNWNFVEVMACPGGCGNGNGLWVVQDTPTSTPVSAESVAPVANRVFAQRTRQERIQ
                     EMERSLQRLPCYHVDELPQLRELWATLREAEPQSLRFEFCGFNDRQQQEATYRQQDGD
                     IKSQVTVSERHRLVHQW"
     misc_feature    239411..240814
                     /note="possible transcribed region"
     gene            <241217..>241513
                     /locus_tag="CYME_CML106C"
                     /db_xref="GeneID:16994815"
     mRNA            <241217..>241513
                     /locus_tag="CYME_CML106C"
                     /product="60S ribosomal protein L36"
                     /transcript_id="XM_005536697.1"
                     /db_xref="GeneID:16994815"
     CDS             241217..241513
                     /locus_tag="CYME_CML106C"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_005536754.1"
                     /db_xref="GeneID:16994815"
                     /translation="MSLVSEGVAVGKQKGHQVTKRVLPVRPAQRKGQLSKRTQFVRAL
                     IREVVGFAPYERRIMELLRIGKDKRALKFAKRRLGTQTRAKRKISELADALRRR"
     gene            complement(<241538..>242941)
                     /locus_tag="CYME_CML107C"
                     /db_xref="GeneID:16994816"
     mRNA            complement(<241538..>242941)
                     /locus_tag="CYME_CML107C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536698.1"
                     /db_xref="GeneID:16994816"
     CDS             complement(241538..242941)
                     /locus_tag="CYME_CML107C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536755.1"
                     /db_xref="GeneID:16994816"
                     /translation="MQDAMVTGRGFARESAPGEPNALSEGTAFARGSTCTRHAERLCC
                     GRECRRGRATRHRRKCGQIGIPRRMRTIASGKVATKLRCIEAKLERVYAIVQSLKTLF
                     LREQREDPLYSAASRGCQRQYRRSVACSEQHSITCTDSPGSGTRGDSAAAATDAAVPQ
                     CRRSEADPVRHSTEEEEERLTLECAARPFGCTGRYRRRVHPLKATYESEYRVPGVTAC
                     SLPDADALCCDKIDSVQFGEMNGECLREFTAHGDDVSKHTPLPSLRAAAPSSTWFTVA
                     PMADSSPRATPDPPSASAGSRSCLEHVAQAERQLCATAYQTPARLGTANTRAIGIRQP
                     QMHFTELGGERVPRAIPAEDQPQPADVGRPDAQLTKRELAQQQTTYQRAEAAPTTSPN
                     ARKSADEDSTCRCPSCKAFFTTLAGSYPPDMQREIQRCSRRARKITTTKGPRTPPTPK
                     FWRQIEFSSSEESPTRL"
     gene            complement(242673..249465)
                     /locus_tag="CYME_CML109T"
                     /db_xref="GeneID:16994537"
     misc_RNA        complement(242673..249465)
                     /locus_tag="CYME_CML109T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461413.1"
                     /db_xref="GeneID:16994537"
     gene            <243150..>245291
                     /locus_tag="CYME_CML108C"
                     /db_xref="GeneID:16994542"
     mRNA            <243150..>245291
                     /locus_tag="CYME_CML108C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536699.1"
                     /db_xref="GeneID:16994542"
     CDS             243150..245291
                     /locus_tag="CYME_CML108C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536756.1"
                     /db_xref="GeneID:16994542"
                     /translation="MKPEMSKSIVRLVSDLERNCRALDAAQVTQTLRRKRARSLCRYV
                     AGSGYLLPTQGLELAELDATAHTWPDRDEAYEARRPWRHQLQRQGSVLFADYMEQVGW
                     ARLLDQCLCGRSAATSEPLDAEARAVRERRRVRWLRNLPLQSAAERAVSSDSAQQATD
                     ATLAYALAYHPGTEVVAVGDQGGRVRLIDVDRTVQIASEENGPIGVSRERALYVESEN
                     LVAFWNSCESNRAVFDVAWLPGATTNASGLAAAYASGVVDIVDVSTCSALGHKNRQRG
                     WNRDWRYFQDYGGSEAPSPPVRVARLCGHHGAVRSIAPLPEDGGRIISTCGRDGNIFV
                     YDLRSCRRLASSSSTALSGDNKTRNALLPVRAVQLGHFRNPAARRLVERGVASRADLL
                     APSPDRAIASVVWLGPDPSALLSAGATDGLLKVWDLRQTWSTCPLLSPEFEGGSLRAH
                     RRLAKPVTTVQLAPGNGIAHAHLQHSCRRLAVATLRPGAPERGTVFILDPLQLGNARL
                     SNGVVQSIQAPLWSHYTRVRPSPDGAYVAFGSGCDLIVADLGNLPAAHWELPAQVAGS
                     DASPDRDDRFVRIACTGEVTALDWSSRCDGRIASVADLEPVKITQWTMAAAAAAALHE
                     QRSPSVMSYASRGERRYRSHADRHASGDAEPSRSGRGAHDQASERVRRPIPCQCCEQI
                     DVEPERLVTRLPCPRCMHERFCPVPRVRRSR"
     gene            <249594..>250055
                     /locus_tag="CYME_CML110C"
                     /db_xref="GeneID:16994541"
     mRNA            <249594..>250055
                     /locus_tag="CYME_CML110C"
                     /product="nucleoside-diphosphate kinase"
                     /transcript_id="XM_005536700.1"
                     /db_xref="GeneID:16994541"
     CDS             249594..250055
                     /locus_tag="CYME_CML110C"
                     /codon_start=1
                     /product="nucleoside-diphosphate kinase"
                     /protein_id="XP_005536757.1"
                     /db_xref="GeneID:16994541"
                     /translation="MEETTFIMIKPDGVQRRLVAPIIARFENRGLTLVAIKMVNTSEA
                     LIDQHYAELVNKPFYPGLKQYMLSGPVIAMVWKGKAAAALGRAIVGATNPKESAPGTI
                     RGDFCNDVGRNVIHASDSVESAKREIALWFKPEELVHYVPCDLGWVYENVS"
     gene            complement(<251474..>251782)
                     /locus_tag="CYME_CML111C"
                     /db_xref="GeneID:16994535"
     mRNA            complement(<251474..>251782)
                     /locus_tag="CYME_CML111C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536701.1"
                     /db_xref="GeneID:16994535"
     CDS             complement(251474..251782)
                     /locus_tag="CYME_CML111C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536758.1"
                     /db_xref="GeneID:16994535"
                     /translation="MSRQRSNKRARKRRERGPELDVIHKELRERGPFAAETEADWDLP
                     GLGQFRCVVCSRYFISRNALDEHSVSKPHKRREKLLELEAPYTVGEARWAAGLGPAPF
                     "
     gene            <252035..>252820
                     /locus_tag="CYME_CML112C"
                     /db_xref="GeneID:16994536"
     mRNA            <252035..>252820
                     /locus_tag="CYME_CML112C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536702.1"
                     /db_xref="GeneID:16994536"
     CDS             252035..252820
                     /locus_tag="CYME_CML112C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536759.1"
                     /db_xref="GeneID:16994536"
                     /translation="MSSTVVRPQASLGTRGETRRLMREVERAARYGELRRWRKEWVTI
                     GNVRCYAWVHITEEETTKPEENGSERETADEQASSEATPMDDNPQARAAESVMTANVA
                     YTSQKRHRDMLEQSSGVGGPARREQSLSSSVSSTVGGDVDIAETGETSAQLSERTTTG
                     NARIAAGVEELNIASAPDALGFGLRSETAVSGFDDAHRQLPEHVAASVSSSGRCPRVS
                     SQSEVPSPNSPEMHPIAEIKFGGSSESGAKDTANDEPMLLDGE"
     gene            complement(<253607..>254947)
                     /locus_tag="CYME_CML113C"
                     /db_xref="GeneID:16994546"
     mRNA            complement(<253607..>254947)
                     /locus_tag="CYME_CML113C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536703.1"
                     /db_xref="GeneID:16994546"
     CDS             complement(253607..254947)
                     /locus_tag="CYME_CML113C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536760.1"
                     /db_xref="GeneID:16994546"
                     /translation="MFVFATTSAHRRTYQPLPTGFHGSFLWTRNCVFTTAPLRLASQQ
                     LRPDLLRIRASAAAPSSPAPSPAPDASQDNQERPDSTAFVDQRIPVSILTGFLGSGKS
                     TLLNRILANQQGKRYAVIENEFGEVGIDDELVKSHILLEGGDEIFEMNNGCLCCTVRS
                     DLVRILRRLLTRSTKYDGILIETTGMADPTPVVQTFFLDETLADFLRLDGVITVVDGK
                     HLAMHLDPRHGVRRETVEQIAFADRLLLNKIDLVTPAQLREAEETLRALNRTAPIIRC
                     VRAEVPIDELLNMRAFDLERITERDPFFLAMEKTSSEDDHDHHDHHDHHDHHDDHGEA
                     APVNGHASHVHDHTIRSVGICEPGDLDVDRLNEWLGGFLSERGEDIFRMKGILSIAGT
                     DRRFIFQGVHMLFESMASEPWGTDPRINRLVFIGRNLDRQAIQEAFRACLVPPS"
     misc_feature    254803..255316
                     /note="possible transcribed region"
     gene            complement(<257009..>257617)
                     /locus_tag="CYME_CML115C"
                     /db_xref="GeneID:16994550"
     mRNA            complement(<257009..>257617)
                     /locus_tag="CYME_CML115C"
                     /product="similar to diphosphoinositol polyphosphate
                     phosphohydrolase"
                     /transcript_id="XM_005536704.1"
                     /db_xref="GeneID:16994550"
     CDS             complement(257009..257617)
                     /locus_tag="CYME_CML115C"
                     /codon_start=1
                     /product="similar to diphosphoinositol polyphosphate
                     phosphohydrolase"
                     /protein_id="XP_005536761.1"
                     /db_xref="GeneID:16994550"
                     /translation="MGGSGRKVAGCVPTRPVASSAVAEPVAGASARPCDRYEVLLVRS
                     KYDPRVWLFPKGGVKRKESPKEAAVRETREEAGVEGTVLAKLGTWRPWSGEQHTMFLM
                     LVELERRPGDPLWQESRERPRRWFSFADAERQLEATRGKRPELLDMLRTARKALADYE
                     EEQARAREKEQKKLLKREQKRLGKLVEAALADTCDDPGCTST"
     gene            <258490..>259878
                     /locus_tag="CYME_CML116C"
                     /db_xref="GeneID:16994551"
     mRNA            <258490..>259878
                     /locus_tag="CYME_CML116C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536705.1"
                     /db_xref="GeneID:16994551"
     CDS             258490..259878
                     /locus_tag="CYME_CML116C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536762.1"
                     /db_xref="GeneID:16994551"
                     /translation="MQSFTVDGLESVLNDGSKFAFVLSNPRCSLVSQSVQLERAQLTR
                     RPIRRRRCVLKINSLAQLLFASSWAAYGFRELERRLEGRLVTAGARRPVHAGGVGVPP
                     SFAGSQYQTVVVWLREGENLRLHDNPVIEKALALSREGASTPDAGRSSGPDQSSWLPT
                     RLLPIFIETPWDKHGRLRTWRQQKQVRECVQFLGEALHQTGSGLVWVRVSDTHLTRLE
                     DMANLRTAALVETLASLELHSLTAVTYPCGGTRLQGLEEEILVQRLGSSTDADAAANA
                     LQRRAMCRAIRLVSVQDTANTLFALARLPFSIAKMPDDCDAFAQALDTLGEPEPSQHA
                     PVSLPPLPREALDSPFYYNPEIVSGKPPMVDSPDAHQPFHEQFVLEALEAYAKSETPL
                     VMIADDTIQTRSQGILGVAMELGCLSPRRFWHAIREHLPTTSIRRQCAWFDIILHDFV
                     RLLTWKRGIHPA"
     gene            complement(<260055..>260573)
                     /locus_tag="CYME_CML117C"
                     /db_xref="GeneID:16994558"
     mRNA            complement(<260055..>260573)
                     /locus_tag="CYME_CML117C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536706.1"
                     /db_xref="GeneID:16994558"
     CDS             complement(260055..260573)
                     /locus_tag="CYME_CML117C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536763.1"
                     /db_xref="GeneID:16994558"
                     /translation="MRSNALPFANSLSFPPARQTLSSADWAASSWRALAFQPVRMVAP
                     NGNTDRPRNVLGGPLAPCCFQPRTGFYRDGYCATGPEDIGSHTVCARVTAEFLAFTAS
                     RGNDLSTPALQFGFPGLRPGDKWCLCASRWKEAYDAGVAPPVILEACHENALRVVSLA
                     LLREHAMDQRHQ"
     gene            <262803..>264743
                     /locus_tag="CYME_CML118C"
                     /db_xref="GeneID:16994561"
     mRNA            <262803..>264743
                     /locus_tag="CYME_CML118C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536707.1"
                     /db_xref="GeneID:16994561"
     CDS             262803..264743
                     /locus_tag="CYME_CML118C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536764.1"
                     /db_xref="GeneID:16994561"
                     /translation="MNHDPRKNSLHSIRRHGGEVSPVRLDTRQQSRTRFLRPVRRWYV
                     WLGLPLLGLALLCVRWCPSYKIGNLLDDHQDLRIISYAYRESSPHELRNLEFFLRHGV
                     YADPKSLFFIIVNGGTCTPCESADAKRPNVHVLRRENYGYDFGAHGHLLNQLEIQGQL
                     QRLKRLYCINASVRGPFLPKFFRDRPWTAAFDSLMRGNVAAVGASLVCLPKQDAGGPG
                     ARLEGFAFALSAEGMLAARRAGVFRSYPSKRDAILYGEFGLTRALFQAGLSVDTLMTK
                     YQRIWNASNELVTCNRNVFPSRHGAVDGVDLHPYETLFMKTQWMMSYPYVLLYSEWMD
                     HPDAPELPDIHRYYHFQHDDQVHPIEPPRVASPLIGDKKLVLVIWDTPNSSVEWENIE
                     HLLASIRLSDSIDYLLVIRDGQVAARVREKRVDRLPNVRIVSEIRSSLNSLCMQGLTI
                     LRTNSRYLAYNFFVFITQHARGPVGVWSSNDQWIVSLEEHLRTKQVGLLFSFIHLSGE
                     MLQPDPSFFCMDHRGLHLLLRGSVCDRTDVAGTLLGMKRVASDVLGRSIGFSSLQPGT
                     PVLQNTASLMEPNLRQIFSRPLTELSSEELSDLIFVPVATINKQDSDSERIIAERLRE
                     LPGPFSTKLSTQVATNTTSMIS"
     gene            complement(<265262..>266215)
                     /locus_tag="CYME_CML119C"
                     /db_xref="GeneID:16994562"
     mRNA            complement(<265262..>266215)
                     /locus_tag="CYME_CML119C"
                     /product="NAD-dependent deacetylase sirtuin 2"
                     /transcript_id="XM_005536708.1"
                     /db_xref="GeneID:16994562"
     CDS             complement(265262..266215)
                     /locus_tag="CYME_CML119C"
                     /codon_start=1
                     /product="NAD-dependent deacetylase sirtuin 2"
                     /protein_id="XP_005536765.1"
                     /db_xref="GeneID:16994562"
                     /translation="MWVANFWQWVCQSAPRADGRRQSFTQLEDVATALTRRDRTPRVL
                     VILGAGVSTAAGIPDFRSPTTGLYARLETKGQLDASRVFDIDYFRTQPQAFYSLAHEL
                     LRETGGCLQPTRAHWFVRCLAERGYLVRCYTQNVDGLERLAGIPESLLVEAHGTMQRA
                     HCTAPGCGAAYDAKLLLRQVVSGEAVAAPPRCSRCQAGYVKLAIIFFGEKLPWRVFRS
                     LMTDLWRCNLCLIMGTSLTVAPVRWIPEQLPKRTPRILLNRSPSGSIGRRPLDLWIAD
                     DAQHSVERLVDLCGWREQMDTLAASPASLSDLLPVRFGERS"
     gene            <267150..>269462
                     /locus_tag="CYME_CML120C"
                     /db_xref="GeneID:16994540"
     mRNA            <267150..>269462
                     /locus_tag="CYME_CML120C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536709.1"
                     /db_xref="GeneID:16994540"
     CDS             267150..269462
                     /locus_tag="CYME_CML120C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536766.1"
                     /db_xref="GeneID:16994540"
                     /translation="MGEAVARSTNAAQQDLLPSDGTTRARVLQSESAQTRSSISEKLL
                     HMTLRKGVRWYPKALLHKTDEPPSQPEGELAPKRTTKLSLFERFRDLWSKCSLKEQQV
                     GMCILYKVRVLRLEPLEGRSVPPPLFQALRVGSKDVDGGDAGSHVQRSLWPSTLWRIC
                     LVAIWDTSLLVMEGVDSIILAMPVVAPALDWGQFDSGRDADGRLRTLPLSVCQLISDQ
                     AGPGSLHEDFIGASTELEDEKKASGSPILVLETPFLGLVLQFSCEAERSRFAAEFDAK
                     KRAAMRCVQLYHSAVRFVECLWLRYRWRTLVDASAVRFERFRGRRDRSFATSTKPMPA
                     VVVAERFQALYRAVQARKLRARLAVAWQVARQKGMNVRIEGQCHVGASLVTKAWLKAG
                     RAQVQWLRAGHCDSGPDSSNRADPIPGANGRVYTCSGEDLSHALIARWIVCSPRTGET
                     IDQFEVQTRPVTISASSKEGLLLQRLFQLPQCRVRCVYHQLGDQQSTTLKDNETYLMV
                     LRSDDICLYPQEPERESRDSAENSCQRPLSVSTGADVAGPCLLRFPYRALYTSSDVFV
                     PASGPLLLVADLTHHIYLVLAARSFAERNVLICIIQQLVRTAAPSVHVMMPPAGIARF
                     ALQAAEAAQRLTASSPMRRQHQPQQPQKQAPQVIRQSDAEDSDSEPCPSFESSGLWDA
                     PMLRISRDDPEMRREGRSMELARAGWQALGRGFAGLMHTGKTIASRTSSEQFRSLASR
                     TRANDTSQRVRAAIRKLYQEHVRGPQTRVS"
     misc_feature    complement(268765..270458)
                     /note="possible transcribed region"
     gene            <270949..>273114
                     /locus_tag="CYME_CML121C"
                     /db_xref="GeneID:16994758"
     mRNA            <270949..>273114
                     /locus_tag="CYME_CML121C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536710.1"
                     /db_xref="GeneID:16994758"
     CDS             270949..273114
                     /locus_tag="CYME_CML121C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536767.1"
                     /db_xref="GeneID:16994758"
                     /translation="MAACKLETFEPDWDGHGLWCIFADGSLSLALVQKDSGLPVPRLH
                     LDAKLVTQGCRLAAFPNGCFVAERSGRVAAYVLDVADAIKAKKLVKACCMVVENGRTP
                     QVLSVAVCPQQPRTGNLRLALLYVSGAPDPVIYAAHWDVPTARGRPQTQVWQRWREAP
                     ILDGFLGVDDGYTWLLCADGYLLVLDQQLRICKRFELPSAAPWDRMRPDTPSQRLVLG
                     SATGSILCCSVMLTRSNSLDAHNVSDSMNGLELASRVICNRESGAGTLADTSTRLLSD
                     FCGARGFVLAGFSDGTCELRSEAFDVELQGERAGAYWSWRQEPVQMLRVDRQQTRIWA
                     WCPGAAILLCWNASCLPVVASHGARDGSSVAASRETTTMSAFESQRQRMPTDFVVSAS
                     KVVTASDWRRTSMHHTHETGSGADERSTPPMHTGSERERHDTRQLASAAEASPRSGCT
                     LSPEPFQCLQELATILDTQRAAISTSLATLDRRLQQLEGAPRLQRHPRASTAADAAAS
                     AQQSEQLPGACCGPSDEYSLSWNAMALVIRDLRLTLTELRIQYEAQCQTVYRSIDALR
                     SGNSIAGPNSVPVSGARSPTEALGQSESTVLQLERSLLLPLQQSRHLQHEHDELFQEL
                     LLENEALRNRMRELNEALETVAAANQALRREHAQQARQLADIQAERCRLVQQLRSAVR
                     AARFFSETRPERAESELREPICVVHGSTKTATSREDSFP"
     gene            complement(<273697..>275289)
                     /locus_tag="CYME_CML122C"
                     /db_xref="GeneID:16994544"
     mRNA            complement(<273697..>275289)
                     /locus_tag="CYME_CML122C"
                     /product="similar to oxysterol binding protein"
                     /transcript_id="XM_005536711.1"
                     /db_xref="GeneID:16994544"
     CDS             complement(273697..275289)
                     /locus_tag="CYME_CML122C"
                     /codon_start=1
                     /product="similar to oxysterol binding protein"
                     /protein_id="XP_005536768.1"
                     /db_xref="GeneID:16994544"
                     /translation="MDSTVRVPVDDVRTRGHSRSLERFLTASDWREVLAALEADGNLL
                     DSSDSGEELTAETLETEDLSQTLTEFLDAADEPLSDSDLANLSGAGAFIASPFPRPGS
                     CSPDADADASVSDADRLPLVTQTPETPAEVSESWSATERALYERGFRRDERITTSLSA
                     TVEQTPISIVQIAKQVLRNLKAGELLPSISLPAWLLEPLSATEKVALAMRYGELLAAW
                     ATEPDPFERFLKGMQYFLSGLPNQCSLRKPFNPVLGETFMCAFPHREASHGITSLFCE
                     QVSHHPPRTAMHMRNSRLGVRIHTVMEPRPSFGGNSLKIEMAGHALMELTHAQDVEQY
                     ILTRPAMVFSGILGVGKQQLECIGKCIFHCPKLGFLAKFDFSGVSLAGLRGSEHAVEG
                     KLYVHEQKRYRFYGRWDDCIYLKDLTNGETRLLYNAGDVYERCRIQVWIPPEPQQPPK
                     FARTVWRATADALLRNDFERATVEKRRVEACERELRSLREQTGETWQPQFFELDPLTG
                     IYIFNDKHRHFVEMDPEDLDAI"
     misc_feature    275471..278245
                     /note="possible transcribed region"
     gene            <280243..>280554
                     /locus_tag="CYME_CML124C"
                     /db_xref="GeneID:16994554"
     mRNA            <280243..>280554
                     /locus_tag="CYME_CML124C"
                     /product="similar to dual-specificity protein phosphatase"
                     /transcript_id="XM_005536712.1"
                     /db_xref="GeneID:16994554"
     CDS             280243..280554
                     /locus_tag="CYME_CML124C"
                     /codon_start=1
                     /product="similar to dual-specificity protein phosphatase"
                     /protein_id="XP_005536769.1"
                     /db_xref="GeneID:16994554"
                     /translation="MGLYYCKRCGEVLFSAKDLVGHSNGRDQQSGTCTSLFTEPLDWV
                     DAVGRNQGRIYCQRCTFCVGRFCWSGMPCSCGEWVRPAFQFHSARIEVRGVVKLVPKQ
                     H"
     gene            complement(<280529..>281473)
                     /locus_tag="CYME_CML125C"
                     /db_xref="GeneID:16994555"
     mRNA            complement(<280529..>281473)
                     /locus_tag="CYME_CML125C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536713.1"
                     /db_xref="GeneID:16994555"
     CDS             complement(280529..281473)
                     /locus_tag="CYME_CML125C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536770.1"
                     /db_xref="GeneID:16994555"
                     /translation="MLAPAVPLPRETTGISSGGGAFQSRTGFGGLGPPRDAARAGLDL
                     PGAGRSTTYNNAQQEQQQQQQQQPSWRIINRLLGQAGFQALPLSGGLQDAPSDAAVRA
                     AFAQVLAEYERRGMLLQSLLSESPPADSRTRVAEAALMEMEQALLKSNRQVAWLKSKL
                     LKYRAYIERKRRERREQQQQQQEQQQQQQQRQREQPERQSQQEQRVGGSLQPQARAPQ
                     REGTIDSQIDWHQELRQLVTDLQIMLQVPDYRLLPERIRQLQREAENAIWLAEFADCV
                     RSIVEEVLGPESHLSEEQVLDELEKWAVERVSAASEPA"
     gene            complement(<283576..>284715)
                     /locus_tag="CYME_CML126C"
                     /db_xref="GeneID:16994559"
     mRNA            complement(<283576..>284715)
                     /locus_tag="CYME_CML126C"
                     /product="similar to indole-3-glycerol phosphate synthase"
                     /transcript_id="XM_005536714.1"
                     /db_xref="GeneID:16994559"
     CDS             complement(283576..284715)
                     /locus_tag="CYME_CML126C"
                     /codon_start=1
                     /product="similar to indole-3-glycerol phosphate synthase"
                     /protein_id="XP_005536771.1"
                     /db_xref="GeneID:16994559"
                     /translation="MNTLQHRASPAFAVTSAGLVGARPARKAHRHCVTLCPTDPKGVG
                     ACFRIRFHKRTCSLRAGQERGTLMMTEPLAAQQEELVDWLPAGALEKDVMRKFEYVRD
                     ELSNREPLSFRLSYMSEAPSRDIRAKLRRRRGRLSVVVDLKRRSATSEPAREFHALNM
                     YAAAEILSDLRAEIPLGSKFGLDGIMVSVDSELYDQDCASLSDFARHWRYFHREDPST
                     APPIIYKDIIVHELQLAEAAEAGAKAACLVAGACLPDLEKLLNAAYILGMEVLVEVHT
                     EEELQYAFEAGAGIYVFTDVDRARRRVVKGRAVDLMDKYRVDLRNAGAVCLGSGRIET
                     LEQVEQLRDVGADGIVIGGKLMASIARGDVEALASVLHSLLVADL"
     gene            <285037..>289542
                     /locus_tag="CYME_CML127C"
                     /db_xref="GeneID:16994560"
     mRNA            <285037..>289542
                     /locus_tag="CYME_CML127C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536715.1"
                     /db_xref="GeneID:16994560"
     CDS             285037..289542
                     /locus_tag="CYME_CML127C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536772.1"
                     /db_xref="GeneID:16994560"
                     /translation="MPYFVQGSARTYVAVATSGTGTPASTAGSPVSLDLGPRSWHAYR
                     GQNGEDNCPVHRRNEAGAVCSEQSAPTHATDAVPDSIWSRLLWKAPTTATRRRTGEET
                     SGSVFGAFLASGSDQRTPWQSAAALALFSETLLLVASTDAMSIWLAERILQPVSHFTD
                     QELQLSRYGRIRQALWGPSCPSRLSGIGLSASVALLTEKGIVLLLTLSAKDAPASPEE
                     ALRPWWKLADDDAAVEVDDWRPDKADGGAISGIQPSAEARNTSQAQPLDESLHTDHIR
                     CTWTLALEHVASVALSVAKEDASLTSHALAMTACPAGVIVASASGWVECISWNASTIW
                     KVEIFGETLTDEQLLLEDISISSREVHVHYDQQLRLGVLCFQQQWLVLLQLDCGGYCR
                     PHCAAPSVRFYRYPGLCCVALEPRHGLVGLGMADGSVRVHHLESMALESVCSGAPGQQ
                     HAAQVTRRVRSLSWAPDGEAFALAWDERGLAIWSRHGCRLFSSSSWIGPQSQSQSQKR
                     LSAVAVPATPEQDPLRVRSVHWHPTGLSIFVQFAGEAPNANAALFGVLPLLRLTGEFG
                     GSSVWEGNRIYPTACAVTDDAVGIVSIQRECADYRTLGAQVAQLLLQQCAEGVVHGRR
                     STATGWHWMTLDEAYLRRAWPIRHVAWQAASSFLAVSGTSGVALWNPQRRRWRWTEPT
                     VRGAAGICIGLAWLGPFLLTIWREDAPYELLKEERFRYYAPTNVLAQIDDADSRMSAR
                     KTSSYTLRVFHRSKLGEERLSKPLRFRHRPLKIDVLESGIVWVYNSDSVMRVYRFSWE
                     QRRPWSSSVDWRFVHSLPLRVDYGIQQTSVDGEWLESFRVLPSRVLSQGGETEHAFLL
                     PFGAWPGSILLSKPHRAATETAESLASSRADQPFSTQHSPPSADSGSMTSPLDASREH
                     SALSQAPDGIPRSMLLVLGSRGTLFIVDPLTQAEDVLASAVIRYWFTADLRKRHSVPQ
                     PALWVSTANGVYAMSSARFTLRHCIEFDAETFLCGMMSSIDALVGVTATRVRYWDLAD
                     LDGQPFLYEASLKAWPVLPMILKLLLEDGADDLGVTHVALRNAQQPQFMDALEWLLYR
                     TAVAESKPKGDDQEQLSLRVVRMLRKFGEYEDIVVHCARKTEAYKWPSLFALVGEPTA
                     LLEQCFLSGRLRTAACLLIVLQELHGLQASAFQALRLFQAALSCEDDALARELMGYLA
                     RISADEVMSSGSCSAREHASAHIPQGGAARSEKRDHTAGQSASRAGKVSGQLVESGVD
                     HQFFRMAETSLFTYATELLWRFELYRLCVLAERLGFSLTEWLRRNSTSHREFRDLYLG
                     ITSARQQFRVGTPSSAAVQRAILDIQHAREKQHVLLSELEATRRRLQALNPSLEHAAK
                     NVQKTAAAVDHCRNDRDDHGNDVGTGTDHTTGMRCRHDFAADAATALAISIPSLIYLK
                     RLAQAAYDVDYPSLGLILDTLLLHGQRIYLVLQSHPHYQEPYLLALRKFDEPSMSALL
                     GALQQAL"
     gene            complement(<290972..>293230)
                     /locus_tag="CYME_CML128C"
                     /db_xref="GeneID:16994532"
     mRNA            complement(<290972..>293230)
                     /locus_tag="CYME_CML128C"
                     /product="tRNA nucleotidyltransferase"
                     /transcript_id="XM_005536716.1"
                     /db_xref="GeneID:16994532"
     CDS             complement(290972..293230)
                     /locus_tag="CYME_CML128C"
                     /codon_start=1
                     /product="tRNA nucleotidyltransferase"
                     /protein_id="XP_005536773.1"
                     /db_xref="GeneID:16994532"
                     /translation="MHSALGRALQRLESGTDSSGSRGRLARAIIQRAQTPLALQQASG
                     NSVWTSPKRGVSRFTETLTSQLVPRRPETPLNPQQVSGNISWPRTKHSEYRSEETHAV
                     ATTRVLRGLPTRVVPFISSVSLRNAQHQHHRQHQQQHQQRQVLSLPKQTPRVVAWVFR
                     DTAFSIPVHRETHTTQCCFLIPGFRNLSLHNLPRKRLLCSSIATRSAHRFRKTWLQLR
                     CLAAFENQTRPMQRVSGTERNLNRPLLVQIELSSIEQQIFSLLLEVNTSYRLGCTLRV
                     AGGWVRDKLLGICADQIDLDIALDNMLGREFAERVDAFLAERGQKQGSVHVIRVNPAQ
                     SKHLETARMRLFDHWIDFVNLRKESYAADSRIPSMAIGTPEEDAFRRDLTINTLFYNI
                     NTKQVEDWTRMGLTDLAAGLIRTPLPPLTTFLEDPLRALRAVRFASRFGFTVVPEVLE
                     AASSPRVREALLSKVSRERIATELELMLGGPQPVMALSLLFDMGLAKCLFPLPPSIPE
                     SAYPDRWTELALTRVQRLERFGSVWLKEGIELWQQDGTRQMLLLGACLSPLFDISYVI
                     KRDQRCSVVFYILHDALRVQQQKKKAILSMLSACSKIRTLVLQPLAWNERSCRVEVGL
                     LIRSLGSWWQAALLLQLALDERLDSGASMASAAASTESTASETPIVQQYLVFRDKIKE
                     TGLDRACELQPLLDGHAVRRLLPGLPVGPLLGEIMEFQIEEQLANPALTPTECASLLQ
                     KRYQAYRENKRN"
     gene            <293890..>294501
                     /locus_tag="CYME_CML129C"
                     /db_xref="GeneID:16994530"
     mRNA            <293890..>294501
                     /locus_tag="CYME_CML129C"
                     /product="similar to v-SNARE protein of ER-Golgi docking
                     complex"
                     /transcript_id="XM_005536717.1"
                     /db_xref="GeneID:16994530"
     CDS             293890..294501
                     /locus_tag="CYME_CML129C"
                     /codon_start=1
                     /product="similar to v-SNARE protein of ER-Golgi docking
                     complex"
                     /protein_id="XP_005536774.1"
                     /db_xref="GeneID:16994530"
                     /translation="MRLYALTILRRRSDETEPTLLSAAYELSDFNYFQRSSVREFAAF
                     FAKLIAKRVTLGERLSVDHENYVCYAYARVNGVIAVALCDAEYPQRVAFSLLGQVLDE
                     FRRTFPESQYLQVPAEAIQVREFPYLADRLQRYQNPVEADPLMRIEKDLDETKSTLHQ
                     TIDSILERGVKLDQLVDKSNDLSLQSKMFYRTARKQNSCCNLS"
     gene            complement(<296459..>297238)
                     /locus_tag="CYME_CML130C"
                     /db_xref="GeneID:16994531"
     mRNA            complement(<296459..>297238)
                     /locus_tag="CYME_CML130C"
                     /product="similar to transcription initiation factor TFIIE
                     beta subunit"
                     /transcript_id="XM_005536718.1"
                     /db_xref="GeneID:16994531"
     CDS             complement(296459..297238)
                     /locus_tag="CYME_CML130C"
                     /codon_start=1
                     /product="similar to transcription initiation factor TFIIE
                     beta subunit"
                     /protein_id="XP_005536775.1"
                     /db_xref="GeneID:16994531"
                     /translation="MTQLTRTPLPGDGDINPPAAGEVVAGPFSSEPLGAQLHKVLRYL
                     KKELRPVSPEEIEEALQIRLQRDSELWVNLVGNPRVLLESDGRWRWRSKYYLRNRDDL
                     LNLLKTSVEGIPVSELQDSYRDALRDIRELAYERNPPLILAFRPSEHTKEVILFPNDP
                     TLYVRISEQVRKLWQSIPIPDSSVVYDYLLQRGLKQGSNHEAVRAALAPTGAQRPPQL
                     KRRARPGARSSGSSSTRRIRLTNVHLEGTGIDLSRDYEPSS"
     gene            <297701..>299698
                     /locus_tag="CYME_CML131C"
                     /db_xref="GeneID:16994525"
     mRNA            <297701..>299698
                     /locus_tag="CYME_CML131C"
                     /product="ATPases of the AAA+ class"
                     /transcript_id="XM_005536719.1"
                     /db_xref="GeneID:16994525"
     CDS             297701..299698
                     /locus_tag="CYME_CML131C"
                     /codon_start=1
                     /product="ATPases of the AAA+ class"
                     /protein_id="XP_005536776.1"
                     /db_xref="GeneID:16994525"
                     /translation="MRWLSSGWQRLVHSAFSRRFGSVSGKTGKVAASRLPVLAATVTT
                     LSLSYYWVQRERLVSRQWFLTNLVDVPSAKIGYPVRASWSEGPDTNAAAVHSWRLLEE
                     KLRREEQRLHGPSPTFQIYTAADGKRSVTFTLRLDDPKPQQPHVRRAAPGDDLLAAFA
                     TVLEALQELQKSTTDKQPGKDETPAYAVSVSAQSSATSTTVTARCPEGQMLHVFLPHV
                     GSFAAELCYSKPADQGALSDQEITALVEAYRIVARGLSSAGLEFATGNGDRASSAASG
                     GAPPSKRPWRRSRDDVSVRIVQEKLEAMGVDVYLPSAFRPREGADEEPPAAIDWTTLA
                     GYDDIKQHIEASLVLPLRHHEVYDAVAKGTRRIFSPNRPRAVLFAGPPGCGKTSTARI
                     IAEQAGVPFIHVTLEAVVSRYYGASEKQLSSIFDLALELGGGAILFIDEVDALGTSRD
                     RSDMHEATRRTLSVLLRRLDGLHQDTGKRLRMRSSLYDEQPFGPPTSLAPPPLGSTEY
                     AATDADGWFVVVAATNRMQDLDPALLSRFDVVLEFPLPDFETRLSIYEMYAKQLKPDD
                     VRKLAAATEGFSPRAIHDSCLAAERLWAAGIIRGEHARNSLPDVNAYLAALELRSERS
                     YPGASSGRAPRPGLCDGPSSDAAQYIHMPNCRYTPQAVDQV"
     misc_feature    complement(301465..303053)
                     /note="repetitive element"
     gene            <304557..>306482
                     /locus_tag="CYME_CML133C"
                     /db_xref="GeneID:16994526"
     mRNA            <304557..>306482
                     /locus_tag="CYME_CML133C"
                     /product="26S proteasome regulatory subunit RPN3"
                     /transcript_id="XM_005536720.1"
                     /db_xref="GeneID:16994526"
     CDS             304557..306482
                     /locus_tag="CYME_CML133C"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN3"
                     /protein_id="XP_005536777.1"
                     /db_xref="GeneID:16994526"
                     /translation="MNVFEEEIARAVALTERAVLTREPRLIARVLRSLGKLRRCWNGR
                     LFEHRTKKLEALVASEIIAVDLFPEDAEALKEEQRKKQRARQTSSTGAEQTGTDSTKT
                     GQKTGTPDEASETPVEETNGKSERELGAVQRFEYAVKDPVLAAQHAHAALRRLLERLE
                     QGDPSAHNAVLLEDVDAALEPLLSRNQRAAAAAKGLGVVQPLAATRSEASMILSNGVS
                     TDSQPNETAAAGLTKQNANARQMSGVSWHALQPESLVLLHLLVVYYLLDAHGDHKLQL
                     RAVDCADRLISLLDRSPRRHTMDEIAARCYYAFTLAYECVGRLSECQPRLLKAYRTAC
                     VRRDHAGQAVLLNQLLRSYVLERRYAQADQLYNRAPFPDIRSNSQLARYFYYIGRVKA
                     IQLDYTEAFRCLNNALRKAPQHMATAFRITILRLLVLVQLLMGEIPELQVFLGERYAP
                     DAAVFRRAMYPYLQIANAVRRGDLQRFQQVLEENATCYEQDGNGYLVRRLRHNVIKTG
                     LARIVAAYARIPLKEVQEILGLDDSSSTENVVAKAIRDRVIRANIDRDQQCLVSASQT
                     DQYQGREPARMFHERIQFCMDLHEEVLRAMRFPDDKRNEANLEILREMQRDEAKIEQA
                     LAEGAEPGDEDDTDDIL"
     gene            307789..309757
                     /locus_tag="CYME_CML134T"
                     /db_xref="GeneID:16994527"
     misc_RNA        307789..309757
                     /locus_tag="CYME_CML134T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461414.1"
                     /db_xref="GeneID:16994527"
     gene            complement(<310185..>312326)
                     /locus_tag="CYME_CML135C"
                     /db_xref="GeneID:16994528"
     mRNA            complement(<310185..>312326)
                     /locus_tag="CYME_CML135C"
                     /product="probable CCR4-NOT transcription complex, subunit
                     3"
                     /transcript_id="XM_005536721.1"
                     /db_xref="GeneID:16994528"
     CDS             complement(310185..312326)
                     /locus_tag="CYME_CML135C"
                     /codon_start=1
                     /product="probable CCR4-NOT transcription complex, subunit
                     3"
                     /protein_id="XP_005536778.1"
                     /db_xref="GeneID:16994528"
                     /translation="MATNRKLQAEIDRTLKKVEEGLDLFNEIWDKVYAAQNLAQRDKF
                     EADLKSQIKKLQRLRDQIKVWQADPSIKDKSKIDVARKKIEEKMEAFKVCERETKTKA
                     FSKEGLAQDRADPLEKSKNEVREWVRDCIEKLKVQIEEREADIEASVSSAKKKKIDHM
                     AVDALRAKIARHQYHIEMLERILRALDNDAADCDDVNEIRDSVEYYVEANTEDGFLED
                     EGIYDALTLEVPVEIQVSHIPKPKEDTEHAPESKPSEAENAERKESEAKRKSEDDGRR
                     PRDSSTPGAAGVAQTPVEDSRRKNSDVSESKRPPSEQENNKAAASKEDLSIGGALGSD
                     GGASGGPGRPRSTAGPVTSAWANQQQPVTVLLSKQSAAPQTPTPTDPSTLLGSFGLQS
                     TPQMPTSVQRLPPGRDTHANALAAVMVSKVDNADRGSLESNSRTSAGATVATAATPFR
                     SPYPSKSGDQMNSRTCAPEGSAVSMNVSSLAAGLGASVPLAQQFGHLQGSRGDAFATA
                     ATASMAPEDPGRDASERSGLEAALLAGDAALVDSDPIASRTLLTALRQLEEGALYLTA
                     PSANGTNPGIGASRQNKSAAAPLQREQVRYEPRNPFPVHGSFPQSPLAALDSPELYER
                     LDPDTLFFIFFFPQNPRHQLFAALELKRHAWRFHKRYLTWFQRHEEPRFTTDDYESGS
                     YVYFDHQMWCQRVRQDFLFSYADLEDELPVV"
     gene            <314478..>316076
                     /locus_tag="CYME_CML136C"
                     /db_xref="GeneID:16994529"
     mRNA            <314478..>316076
                     /locus_tag="CYME_CML136C"
                     /product="similar to leucine carboxyl methyltransferase"
                     /transcript_id="XM_005536722.1"
                     /db_xref="GeneID:16994529"
     CDS             314478..316076
                     /locus_tag="CYME_CML136C"
                     /codon_start=1
                     /product="similar to leucine carboxyl methyltransferase"
                     /protein_id="XP_005536779.1"
                     /db_xref="GeneID:16994529"
                     /translation="MTSAGSRASTDEDVGLERLLGPVQRTCYDAWLSKCLAARCGFFE
                     DAYIALLDPIQRLAADSATSCPQGRGERQRLPCQHGGLSAAISDGSQRHASIPTVDRG
                     GKPSGSSAPHPGRGKAFREAAGPDFASSPYSACGDVDDGEGTCLNAAGHQTLVGGQRN
                     GHNGAGTAQLLSLGQRVPRSLRVNSSGLDAVLLHGTYARVMALRHIMDTVLERLRLKA
                     GASHQPPMLQLLSLGAGLDSMPFWLLERSRQASVAASSSHREVPLPQVRYHELDTEQV
                     ASLKALCIRRQAALARAIQAPVADVQARGAGSADAYAGVAVAGAQAPDVAANVQVVLE
                     TPVYALIAADLCSGRSVLGAALERLRRHGGMRREPSFTLILLECVLAYLSPADTVNVL
                     EALREQFANHPALLVCYDPIGLDDAFGRHMQQRLEERGAPLQGLNCRATLDEAVRNLE
                     SLFAPGAASKHPGRGMDMMEVYQRLRDDACERSRLERIVALDEVEELRLLMRHYGLIW
                     VSNEHAEVFDFFKPSRFQGSAVDA"
     gene            <319276..>321054
                     /locus_tag="CYME_CML137C"
                     /db_xref="GeneID:16994553"
     mRNA            <319276..>321054
                     /locus_tag="CYME_CML137C"
                     /product="ATP-dependent RNA helicase"
                     /transcript_id="XM_005536723.1"
                     /db_xref="GeneID:16994553"
     CDS             319276..321054
                     /locus_tag="CYME_CML137C"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_005536780.1"
                     /db_xref="GeneID:16994553"
                     /translation="MCSGATSEENDGHIMEQDSSAAVGGNESATSAQLHGIPVVYLAT
                     DDQARFATADLRIQSVPGVPQELADTLERDYAITHLFPFQKEVLAYIRSTALTHSGDV
                     LLGAPTGSGKTLIYALAVLLDLYSSASLFCVRALVVLPTRELARQVEGIFRTLTASAK
                     LSARVAVLSLLRERVPRSDLLNRQAVCITTPGRLVEALDRHELLLADLRWLVIDEADR
                     LFRQSYQNWLERLLQRIDCARRVLDPPLRRLRKLLFSATQTRDATHLAALRLHHPVYL
                     LCHASTEGARQPSKLRRGLMDQVPAGLTLCSLRFLSEEDKLRFLLRLIVCGPDILATL
                     RDPSDQSSRPDHNRMLIFVKSVETTHRLCRFVQLASNWLWLRHYPSPVSTRDRGPRLL
                     AEEISKQVSESARAATLERFQRGTTQWLICSDVMARGMDIAEASHVVNFDVPAHPTTY
                     LHRVGRVARAGRPGTALTFLLRNQVGYFQSEIIARVRNDTQKDLGIIRAEHIVPDLRR
                     EPFGFGVEHILRGTALILELEQQALVAPHQPLSLVISAYVREQVVDEPVNEVTEMRAG
                     KSVKRMKRALSIIALQNWCDKSETFA"
     gene            complement(<324894..>325535)
                     /locus_tag="CYME_CML138C"
                     /db_xref="GeneID:16994533"
     mRNA            complement(<324894..>325535)
                     /locus_tag="CYME_CML138C"
                     /product="similar to farnesyltransferase alpha subunit"
                     /transcript_id="XM_005536724.1"
                     /db_xref="GeneID:16994533"
     CDS             complement(324894..325535)
                     /locus_tag="CYME_CML138C"
                     /codon_start=1
                     /product="similar to farnesyltransferase alpha subunit"
                     /protein_id="XP_005536781.1"
                     /db_xref="GeneID:16994533"
                     /translation="MRIRGVERVQRARDRIADAGLEPVLQLNPADYTAWEIARELGED
                     DLAKADQWCRRFPKNYQVWHHRRVLLIRRLTECEALEASALSALGAEELDRLDALLTD
                     PENAKNYHLYSHRQWLIRNPQLINEDLLWREWNSTTVRELERDPLNNSAWQHRWAVLT
                     ELRRRGCFHLERDAFAEDLVERVRCQPAADYVSACRACLAEKCASASFPERCG"
     misc_feature    325707..327028
                     /note="possible transcribed region"
     gene            <332466..>332669
                     /locus_tag="CYME_CML139C"
                     /db_xref="GeneID:16994754"
     mRNA            <332466..>332669
                     /locus_tag="CYME_CML139C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536725.1"
                     /db_xref="GeneID:16994754"
     CDS             332466..332669
                     /locus_tag="CYME_CML139C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536782.1"
                     /db_xref="GeneID:16994754"
                     /translation="MRTVLFLRGQAVRTWSHASQSRVLNWWNLRMPTDGNPTLTTDAC
                     VPERTSPDHTRSCARRFPCFIYA"
     gene            complement(<332779..>334194)
                     /locus_tag="CYME_CML140C"
                     /db_xref="GeneID:16994524"
     mRNA            complement(<332779..>334194)
                     /locus_tag="CYME_CML140C"
                     /product="RNA helicase"
                     /transcript_id="XM_005536726.1"
                     /db_xref="GeneID:16994524"
     CDS             complement(332779..334194)
                     /locus_tag="CYME_CML140C"
                     /codon_start=1
                     /product="RNA helicase"
                     /protein_id="XP_005536783.1"
                     /db_xref="GeneID:16994524"
                     /translation="MQRTAAPGWVVEQLRGPETRAGSQQLPSGAAAPVGVVPPGEQRI
                     MHPQTRQFVGLGGGVGPAAAPSQVEDWRRNLQAPPKDTRYRTEDVTATRGNSFEDYYL
                     RRELLMGLFEMGWERPSPVQEAAVPVALAGRDVLARAKNGTGKTGAFLIPILERLDTK
                     KNAIQALVLVPTRELALQTAAVAKALGKRLDGLQVMTTTGGTSLRDDILRLEQIVHIL
                     IGTPGRVLDLAEKGIAKLNECKMCALDEGDKLLSPEFTPVIEQIVTKQLPPDRQLMLF
                     SATFPISVKGFRDRHLRKPYELNLMEELTLRGITQYYAFVDEGRKIHCLNTLFSKLRI
                     NQSIIFCNSVSRVELLAKKITELGYSCYYIHAKMPQYQRARVFHDFRNGACRNLVSSD
                     LFTRGIDVQAVNVVVNFDFPKNAETYLHRVGRSGRYGHRGLAISLVTQDDRLNLYRIE
                     HELGTKIAPIPPAVDESLYCA"
     misc_feature    334413..336077
                     /note="possible transcribed region"
     gene            <336951..>355013
                     /locus_tag="CYME_CML142C"
                     /db_xref="GeneID:16994523"
     mRNA            <336951..>355013
                     /locus_tag="CYME_CML142C"
                     /product="similar to vacuolar protein sorting 13"
                     /transcript_id="XM_005536727.1"
                     /db_xref="GeneID:16994523"
     CDS             336951..355013
                     /locus_tag="CYME_CML142C"
                     /codon_start=1
                     /product="similar to vacuolar protein sorting 13"
                     /protein_id="XP_005536784.1"
                     /db_xref="GeneID:16994523"
                     /translation="MLAHFVAELLSGTLGQYVKIDERQISVGIWSGQLELHELQLVPE
                     AVQVLFERACGSAPFHVRSGYIGRVCVEVPWKTLSWSQPLRIQIEDVCVQLAALPPDS
                     CSTEAATRSQRMQLAELATDASLREAQLRAWLMVLREAASEAENEIAARLASAARALA
                     VDPKSNNTNISGWRKRLLRQVVANMQVQVGNIWVIFGMDASESGSCTSRGVQRSATGD
                     ADNRCTNGSGASAAAASEDPARSRLGTVLEPREVDAGTRGVNAPAPESKQSNAAAETD
                     APFSVQCNECAPEITHEASEDSFTNVLDIEAKAGSTPIGGQRSENIHVDRTDGKSVRG
                     AARRPDQRSDELLELASALLDVEYSPDATTRAVTPEAHSSSTEQGRCDALHPVARNLS
                     YAVPPEPDARPDDFLDAFSAVAQDARTTPASCRAAAGAQAVHPHQSQEHIIALHLYLK
                     AFEIAPIVDASGAPDTSTVDSDVLAKRVAFSGLMLLAACGLNELNRPLLSHEPPTSSQ
                     LSDVWGLFEQVRTQSQSAEASAMLSLVLAPLEITMHLRLTGGLLSLTNSDPRSVSQLN
                     IHISAVKWHLERELLEQLSQVIHRWTRCAPLNRSRGASSPRTRWYDTLEAIRPGFWLR
                     QRSSKMRRPEIVRRRRKEREQYVTTRYQSLLNRLLSPSDPLWAHIERKETNPELLTLL
                     EHKLNLETILFYRHLADLQVLWRLRSAWPASTAPAAAAYPGAPPDTSTHPMRDRRGEA
                     LTQVTCPVDSTRMLGDALHHVPAAIAAADARAQGTRNAAAAAAAAAAAAPAGLSTVAG
                     SGSDGAAGVHPRSAASDRPDESSRWPLRLMKRLRLAWASTARPPASGTVVRDTIHSRI
                     SDVEASTDAEHRSGGNADCTAHFSSATAAKATGALPSDVATRACVGMVAVNRSTSTLW
                     MPSVSPWHVARWAELCGYDYPPVTSADVLTFACSTAMWPLSGSHGMCTDRSDMPGALA
                     AARRASNEYSLPPATAEEGAEPSATETASTTGRLWELTIRLEMFQGELWEAAANGTGL
                     ILTAQGLEGTFRAPDTGNLRLQTCHLDFIQGKERWVLLQWQQSTCSTLESLYSNRSHA
                     AVEPAPRGVKAAATTSAAPVGSLGPEPEAETASSAAAEAEALSTARTDAGPVLQVRMQ
                     RRRLPPLDAFRESGVLGGSSVQDGGENFSSSSSSSSSAETPNDATPTTNESWKRALQV
                     SRGIFAAELLEEPDLRVAGGWAESAMLTPKSSWLFQVVLQAPELRLYGQAPLVEWIQR
                     WRLLGRSLVSLEETSRRRFRCRRASRVQPHVEMKPWIDVTCRIERPSLSVWEAKPRAA
                     LPEKPLLRLSIESVTLESGASAQATSKIAAKSMENSSAAPLNCQEAALSSAATGLGSR
                     RQEWRCVFEALLLQHRHQHPDQSLLTLTRVAVSWLNRGAHTAATRTTHPFGSFSLPMF
                     SSSPSSWRVSGRSGTDVDGGIVDTCFLVLETWQIHLTPAALEALETTALSLRCAQSVS
                     TSGCAMTTISQTPTSTAARHAAEHPEKQAESQTSRSIHSRGWRASAQRTGLSLNALSG
                     TQRRRRRTHINAQLARGKVYLHLLDNQATTISAYECILEPVRLRADLDVAIPESTWLS
                     GQHTGALNRVARVRESDHKLHVYWELDTAGLCFLGPVRSGYLRLEGMHCSGAWRDSRE
                     HPGSGVLEVGIQLRTLATNMNGEDGYRLAGAFRRRCGLERSDTVEAFPTEANWSQQQQ
                     QQQQQDLQRSASGQVLANKRAPRRQLERQPMHGSEASLTSASVAALGATRELYSSPQK
                     VSMAARGASSGAAASIGSSSTTPGAYADTIPREDEVEDGEYQDTDVAGSSLFRFIQIR
                     CDVTDMVRVHGSKQEAPVVRLEARGFTRMQMNLALAPSMPALVRVAGCLQGADLIYMG
                     KDANQTLVLGRFQPKASSDSSWDDRWQAQELWLANAPLPCDDDPEDAAGTPPHPNAPE
                     AAAAGASRDLKIPNSPADRDSTALWTRARSMPARDAEPGSAAAFATAPSPCSATDAEA
                     ESVHRLEQTDLHQGNAPATSTGMLTIAADLEHQFMETEHLVPSLSWRFVQQTGARTAL
                     VHLGKLDGVYLHGYWKRLIPEVDAFLQSFVPDGPPSMPSIIEVRLHRPLLRFPAGLAC
                     SADEANALHLRCGGTLTFRRRTCPKETQGNRAPAATEATCSAGVVEVEQPLVHSSSSS
                     SSSMLVDTVQQPLAQQEPNQRGADAGALVASDNIDNDDDNDDDSVPWHLESFTDLELV
                     TVHLGGDLHQIGSVEHCRLWITEDEDTGCSRFALQCTGDVETCICEADYGPFWYIVWN
                     NLNSDVPCQEWGMRNPAGAGFVPSGTAERGEPSLSSSPASQLPHSTTSNGNAFESTWT
                     NAAELLDPLLYRLEVFLPCWQGFCSHGDNPSDESTRLVWFQLNEVHLSADLWGSGAYA
                     TFFSATSLRIEDARSLMKAVSPLWPLVRDAPGLIEASRTSDKHRQSARQSSLSPVPDM
                     SEEARARCSRLLLRYRRQAPDQRGDQLTHIAMDLRYLEMLPVAQVLRSLSFLATPFGK
                     FEAMSSPVPTLASCRRRVERTQAVVTCSDCSVVFPATLAALTSQEQDVMEAQGDVMLT
                     CTWQTNPSQFHYEMFLDHFRLCMKRYDPCQSRIPPHDNRLVSGVRTTSTPGASDSETN
                     ADGCVLQAATLTSTSANSNTSAVPDAVGAETGTGVGGGTLAPSVELVYPCAIRMMYID
                     TGDPEIPPQFDLSAAMLLMRFSQQDLVLIAQIVEAYRQHPHEVTDWERLLWHDEAAGA
                     AGARPPRTGSAHAAVEPGAIEHATPLQTRLASSMSHTEGRVLSALALESTPGPAVGNE
                     AASQPLTALNVAASGTGRHPGRNDDDDDDDDEHGSTPGTSRRSTEATENPSKVPASTL
                     PEATNLETASAWHRWVSGRTRSLPTISPEVIEAALRSAEAPSGTDAASTLQATWRRRA
                     GRMHRRLETISGAMPAAAATATTTTTTTTTTGATSAIHPESATKHTSNTTDKSSSTTK
                     TKTRIEARSSAERLGEAAQASSTPRAAAGATSSSTSAPATRVRSLRITIQVDTLVCML
                     LHEDAWSQPPSASMRPGGRSWYQAVIANEVNASESPMVSYLPTVVLYGAFSVQSREPA
                     VSDAQGALCIDIFNDYLGAWEPLVEHCAGCLQWNEQELPLTGEVSELGAAVRSTGASA
                     DTGTAAPSAGLRPRHRLWHLVVADALEMNISEAFLPALDRLAKAVEQIVHDWRALATQ
                     PKAGPETPTSTVHSPSMALLPVSEAALVTRCVSSEMDHQEAPEDVGIAAAAATTTTTS
                     AAAPRKIDVQEAGEYAAASGRNKTSRDNGDAPDRTEAAAESSSHSVWLPETRQQPNAG
                     PGVRRHPRPTLAALVIHNCTGLPLLIESKALRTRKLALSSMAVEVRLTDLYTDTNLES
                     SEHFQAWRSHLTKMLDTLRASAAKNVLFPGSASSDELAKSTASGDGARATRKRSPDMR
                     VNRNAAPEPMGTGLFRPLAAGLADCVLRIAGFHPVRVNTCHFGTQTYTLEPDTSASGL
                     ELTAASAECLRSCTLIWELGVLNGAITGVARSLLRFTNQLQVPLQIRYEMATPAAALI
                     DWSRSLHPGAVADSPRVALLAPGESWSPPLLARLDRLQVRPWCRRWCLPVPATQSSAS
                     QGAADDPRIETSGHLSADQSLDTSITSSFGDSEATWSAPLPDVSTLRMLVAESYQRRK
                     RMRTVGAAASASTAGGAAEVLMAQQRSSLLTLQGARLGSLPFHVDLIPRISSYARFSP
                     MQHDWVDLCFRAPLVLANLLPIAVVIRLHRAGSSTPLWTSGILAAGQSAAVHITRSLN
                     GLFFSVALVHLINTNSALASDLAVQRNAPISRECDDAPDETADSRYSTDSERVDAECI
                     WSEPIRLPPKWPCEGSFLCPRVFDWTMLTFEGTWETPALDPHAVTVPVASQRLQLSAS
                     CWLQNRSDCALCIDPGFVGDRLPTRGLTQRRKASALRQHARERSSGADSIMSAKASID
                     SESTAAACAPDERFILLNAWIEGQVPEPYLPLAVQSFRLAVIEQQLGTWSDPIFVRDL
                     DQVQVLNLPERVLVLSSRPVSDPFGNSLVLSIHNVARIVNRTPLPFEYVQTLQHLHVE
                     TLLEGRPSATVGQVHSLDPGASAALHWELADMERHGVLRIRPAGDALPAVAKAGTRVS
                     AGDAAGGLLQRTSARVKAHTPSASAAADAATCSQQQQQQQRRRRHSPAAARVPEDADS
                     PAAASGRAPSPWLWSCGIPIGMTGHYALKLYRPDTLHQYIAKLSLQPSPDGVWMVILD
                     PEDPEHPPMRLQNICTRYAVAYRQLDASRRFWLLRPGYAARYAWDNPFTFPKSRRLLL
                     EVEETRFALALDGLGECVAVLPLGPHCPSLQVAISLDGPTKVITLYDDREIFHLFRQG
                     IVADALLVARAAAQATGRAQAATAPVPVALSHRRPWLMRQQRRSSLRWFRRYGFVRPS
                     WPEENEVDSDAFQHLDFFFELERIGVSFLTMEPAELAYLTCHRLRGGYTTDYKGCALE
                     VGIERIELDDQRSSCVHPKVLRVQPQRLRPSHAAESTTSAKDDSAAASTRPAAAAAAA
                     AAAAAAGTRTAVPREPADARPSLSRGRVSAAEEALYPALYLSFELGAPYSGDVWNVRF
                     GYVALQTIELCLEEGFIRAAWPFLQLLVANDVDEPEHAVTRDISTVPPASASEPGRQI
                     YFEYLLVNPLTLRVSFFISPIASQSAEQDVPPYARSVPSVQLTPLNEIHGSRFRAGNA
                     TTGAGLEFDTPDANSPSTRDATQQQQQQQQQQQQQQQQRAQPAPSHPASDGALVLAPE
                     RSSVETAPAGNRQASPERSRQHSRALDRGRDASDTFSASASAAVQHSLSRRIGSGTGA
                     LAGGHVLHTGSEQSVRLGGGGNRSVRGYRTILRPLLAALGTVEDASLSARALLLEHYL
                     DSVGHWLEFIQEFYLLQFRASQLQLLASSDLLGNPTRLLDSVAEGVSEIFETPRQATS
                     SYDLLLRLSRANMGLFTNSVRGLFRTVSAVSASLSRGLTAMTGDSQYIQKREERRRDA
                     PSSVAGGLRKGLVSFGYEMRTAVTGLVREPYRGAQAGSVSRGIRRALVQAVIRPANGF
                     LDLIMHPAASLGARPHYQRLPAGRRVRPPRCFGPGLRLVPYCFEDAQGNDLLWRLLVR
                     KATSSASDPYPNLEFYVGMVRVSASAIYEAAPPQSSTAAATRAFALERLPLGPRYGVV
                     LVSTESIYGLVVHSERPSKFQSIWQVPWSEVVQVVESLPASPAVVKVLHSAAPSYHRF
                     WQRIRNRYAMERVQRLSEELEKRQERVKATKAAATPATPRTAALARSQRSAAVQQLRI
                     ECASIAQRDELLQMLRQVFCTVARGRLLTSQASMAPPSPGCTFRLDAAGKRETESRPS
                     TDALSIATVADQHERSTLYSSGSAKPRAANTNVSNFKSGLPPVASTSAPPLVRSGRVE
                     SEPDAPEPGSISAGIADVMSSENAHGLSASSGRSDGESLSPVVRVSACATASVAGPER
                     GVAAECSAQPPIETPTWYALDSSQPPLPLAESTGGTGVASGVVGVPVANTMGCVIENR
                     SDTTFVLVWQYLDGGFFLQEAPPTIYAQSRAKFVIYRAAQPPKRRSPLRRQRQRQLEQ
                     HLPATSFESAAIATGAFAAPGAVRGSSDVAPDMPRSSDTALVPEQHLRARQVQRQRRR
                     DQLGLRKLSGIILYALADPDDQQAIYDERRWITLEFGVSRRAVPRAHVRCPPPMVSTL
                     LFQRAASALQMLCVLEAMETPTKTDRSTASLPTSGALSSSAADAAGRASTSSERSLRW
                     RKRSPAARRERLQNARIVASEAAVQSHHDAASVLSSTSSDSDDIDVERSVLESYEPST
                     IMGPPESHSMATRVAASDDPVLPAPASREPEASRPRSRSHSRPGERLRSWLRRRGAAG
                     ASATVPSRLDKLANTQSAREGTATAGLSLTASQALTTAASPDCTALNYEKGVGEREPD
                     LQRQCDRALQATAAVEETEADEANARAPEGCTIRVAAEVHSDSEDGYLDAPLALEDAD
                     PM"
     gene            complement(<355824..>356858)
                     /locus_tag="CYME_CML143C"
                     /db_xref="GeneID:16994556"
     mRNA            complement(<355824..>356858)
                     /locus_tag="CYME_CML143C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536728.1"
                     /db_xref="GeneID:16994556"
     CDS             complement(355824..356858)
                     /locus_tag="CYME_CML143C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536785.1"
                     /db_xref="GeneID:16994556"
                     /translation="MPQKPRLGKHSSRTRRFRGLLLLLAVACAGLCGRLLWPWPKAEH
                     WDALCHHRPSVLLEPYAFANLAICIVTCTSDNRHYCDDPKRHVALVESQLRTWAADAL
                     RFGANVLIASDAPWPAWATPLPASVDYQWFSVPKPSCLRLGFERGRPREGVFRPESNR
                     TRQVLGYAWKELPSTIQFFLKIDDDAYLRPHRIFPLLQHLDPARPLYLGSVRTFWGAL
                     DPVHAEAANASQDRRAAPSILEYAMGGAGYVLSRALVATLVSRFQSCRLYNGEDKDLA
                     ACVRACPDAEILNVAGFWYGPPETAPPQQRDSMISFHKLNRAADMVRIHKSFGMHANC
                     ARVDSGGDFV"
     gene            <357781..>358935
                     /locus_tag="CYME_CML144C"
                     /db_xref="GeneID:16994557"
     mRNA            <357781..>358935
                     /locus_tag="CYME_CML144C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536729.1"
                     /db_xref="GeneID:16994557"
     CDS             357781..358935
                     /locus_tag="CYME_CML144C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536786.1"
                     /db_xref="GeneID:16994557"
                     /translation="MELKGFNLRLLRERFRPEARRCAVASASDHRVIFAGSVHEGFAA
                     SNPYVIGFACHLILYLHSERYETMFVALSASIFSARTRENCRSFATHQYRYRLRRFST
                     SHSSLGVVCARLATDWERALPPRRLVGDWELKRELGRPDMDLRVLVGLRQESRNESIF
                     GVLIGVVTLAAFAPALAQASSVQGAQQLQNVAAVVSLGGMGAWAFDTLALQGRVAAWL
                     QKRWLTDPKRIAVHEAGHVLLSHVLGYELENYSLGQDRTNLLAGKTGVVLTEGLRAPT
                     SGPVSASESFALLSVAGIAAEAIFFGDAEGGMEDLATLSRYFRRTEPFLNADTQASVR
                     WAMLAALRICNMHRAELEQIAEALLLGKSVKECAEIIFRECPKPLAELAQ"
     gene            complement(<360345..>361424)
                     /locus_tag="CYME_CML145C"
                     /db_xref="GeneID:16994604"
     mRNA            complement(<360345..>361424)
                     /locus_tag="CYME_CML145C"
                     /product="mannose-1-phosphate guanylyltransferase"
                     /transcript_id="XM_005536730.1"
                     /db_xref="GeneID:16994604"
     CDS             complement(360345..361424)
                     /locus_tag="CYME_CML145C"
                     /codon_start=1
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="XP_005536787.1"
                     /db_xref="GeneID:16994604"
                     /translation="MKALILVGGYGTRLRPLTLSHPKPLVEFCNKAMVMHQIEALAKV
                     SVTEVILAVSYQPHVMDDFLQREQKKLGIKITVSRETEPMGTAGPLKLAQPLLGDSEP
                     FFVFNSDVTCDYPLAAMIAAHQRHGGKATILLTKVDEPSKFGIVLYDAETMQVKAFRE
                     KPTEWVGNMANAGVYLLSPSVLEYIELRPMSIEREVFPALAADGALYAHELSGYWADI
                     GQPKDYLRGMSLHLQSLRLRGSPELAAGPMFIGNVLVDTTAQIGKDCRIGPDVVIGAG
                     CIIEEGVRIKSSTLLPGSRVKSHTWIANSIIGWGSTIGSWVRIENTSVLGEDVAVKDE
                     VCVNGGVILPHKSVTEHILEPRIVM"
     gene            <363403..>365196
                     /locus_tag="CYME_CML146C"
                     /db_xref="GeneID:16994609"
     mRNA            <363403..>365196
                     /locus_tag="CYME_CML146C"
                     /product="branched-chain alpha-keto acid dihydrolipoyl
                     acyltransferase, E2 subunit:"
                     /transcript_id="XM_005536731.1"
                     /db_xref="GeneID:16994609"
     CDS             363403..365196
                     /locus_tag="CYME_CML146C"
                     /codon_start=1
                     /product="branched-chain alpha-keto acid dihydrolipoyl
                     acyltransferase, E2 subunit:"
                     /protein_id="XP_005536788.1"
                     /db_xref="GeneID:16994609"
                     /translation="MTTFWRCGTFRRPVNALWNVSVRAKSPRQRQLFPVDELQGALRG
                     RSVAPRALEPAYLAALRVFRSMGPLPVSILLPSSVATTPKSVLDKDRILSRYCSCPAG
                     ERDRGVSIDPRWTPFVLTDIGEGIVEVEILRWHVQEGDYVRPFDALVDVQSDKATVEI
                     TSRFQGVVRHIPHRVGELAKVGEALCFIEVSDDAPSAETLTQAPDKLANTGVESVTTA
                     GTNAGASAEPAVRTPGELNHDEVSSSQTPYRKRVRTTPALRGLARERGIDLAKVTPSG
                     PGRRILPSDIELFLGAQQERGAPALSEQNTPAALGLSNATTKPEVGGTAVGSGSAGWR
                     KALMQRDRPTLGEHVTAVPIRGLRRAMAKSLAAAAVVPHLVYGEEATVDRLIDLRREL
                     TSFGEHRLGGKLTYMPFFIKATSVALEGFPILNATLDNVQDPKNILYQRDHNISIAID
                     TPDGLIVPNIKKVQQLSVFDIAQELRRLQELAHAGKLNQDDLSGGTFALSNIGSIGGI
                     HASPVIMVPQVAISALGRIRRVPRFASDQPTAMNERYTPGSLVVYPAHVMTIVVAADH
                     RIIDGATVANFCARWKLAIESPTALLLGNGP"
     gene            complement(<365323..>365700)
                     /locus_tag="CYME_CML147C"
                     /db_xref="GeneID:16994610"
     mRNA            complement(<365323..>365700)
                     /locus_tag="CYME_CML147C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536732.1"
                     /db_xref="GeneID:16994610"
     CDS             complement(365323..365700)
                     /locus_tag="CYME_CML147C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536789.1"
                     /db_xref="GeneID:16994610"
                     /translation="MQWGRRWSLRLVEAFQSRRGLALFWLTILGGGILKFKWSHAWYQ
                     QEIDRVRRDIIRLEGELAAITGAHSQPAVVERVLAETSSFEEPVEPARSPQASTDTAA
                     QAGPPSKAITDSNGQGDAPYSFS"
     gene            complement(<367809..>369302)
                     /locus_tag="CYME_CML148C"
                     /db_xref="GeneID:16994614"
     mRNA            complement(<367809..>369302)
                     /locus_tag="CYME_CML148C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536733.1"
                     /db_xref="GeneID:16994614"
     CDS             complement(367809..369302)
                     /locus_tag="CYME_CML148C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536790.1"
                     /db_xref="GeneID:16994614"
                     /translation="MEWDCWEQVPKHRAEQFQNICAALGLVIANHEGPECPTVQLFPT
                     CTWIHLHGRACTGKTKTLAAVRAMLERSEPSVGWLHVDCRTLVSGEQFMAAVAREVYA
                     IAGARELSVPEPPARWNLPLFMHTLLELLERLEERDVFLVLHLEGIEWLRGLDDFSRI
                     LASLRRLSFFADRCRGATTTGALLRWSVLVESRLPPSRLFDPVESSYAPDWTLYFPPY
                     DRAALRDILLQHCAFANAVQPREAERPQTPESSGRDLCADAFVDTLLDVCHDLTNDLN
                     ELSYWSDVLYPKYAKAWRPRPGHAASLAGAYSACLPYFRQAVAGVYARSTKQSKECIE
                     KMNALHGQRTWREMLATESRLSNALVLAGYLAAHIPPSHDRKLFEKAAGGVAGRKRRR
                     GPRVHEETGRKTRSFSLERLQRLLEAISERSMDAELRESDSLIRWSTTPPTGAVLAGL
                     IGQGFFSSVTQARSAERQRLRCYVSRELAEHVARKFDMNLSEYISET"
     gene            <370480..>370737
                     /locus_tag="CYME_CML149C"
                     /db_xref="GeneID:16994611"
     mRNA            <370480..>370737
                     /locus_tag="CYME_CML149C"
                     /product="mitochondrial ribosomal protein L30 precursor"
                     /transcript_id="XM_005536734.1"
                     /db_xref="GeneID:16994611"
     CDS             370480..370737
                     /locus_tag="CYME_CML149C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L30 precursor"
                     /protein_id="XP_005536791.1"
                     /db_xref="GeneID:16994611"
                     /translation="MRSLPDTKLLVTLRRSLRGVPERQRRILEALGLRRINQTVLHED
                     GPVTWGAVRKLIHLVELERVAAAEAAQRRRQKNGVPPSPHL"
     gene            complement(<370895..>374692)
                     /locus_tag="CYME_CML150C"
                     /db_xref="GeneID:16994612"
     mRNA            complement(<370895..>374692)
                     /locus_tag="CYME_CML150C"
                     /product="probable eukaryotic translation initiation
                     factor eIF-5B"
                     /transcript_id="XM_005536735.1"
                     /db_xref="GeneID:16994612"
     CDS             complement(370895..374692)
                     /locus_tag="CYME_CML150C"
                     /codon_start=1
                     /product="probable eukaryotic translation initiation
                     factor eIF-5B"
                     /protein_id="XP_005536792.1"
                     /db_xref="GeneID:16994612"
                     /translation="MEPDIEMPVAVKGGKKAKKKKSGAPALPALDGEDSTFNVTDHRQ
                     SLGNEGVTTLSLDASRGKRNKESLSDLKTETVHRPERGRRGVSRELPRPADVDEDLGI
                     GESAPGNSIFAAFSALGLSDEGNSDADDAQSSDSTRSSHRRSGRTGDNTSLNGSRSPA
                     SGALAVPQDFRNAIGTSSGTEISGTTSKEKNYARAGAVPSTWTPTDALRNTTTKRSSS
                     AKKGNTGVSHEEDAEIEAILAELEAVEEESTKTKSSKKQKRKAKKATQKEIDDQDASF
                     EELLAAEAAERHDASDLASRQADEAQHGEQVVSAGGDAPRVQERPAAQESPGASPVSD
                     PKNRHTSQAGTVVDQTQSLSDQSAAEERIAEAQIEDRNHVGEAQSQQLTAAQKKRLKK
                     KQKEASKKAEAVAESSELPSSAPSNASKAIVRRILAEQQRRAEEEERRRQEEEDRLAR
                     ERERQQREEEEARQREEERRQKKEAERARREQLRREGKLLSKSERQRKQRVEAFIQLS
                     MASGAIAAATLPQEATKRSKRVYDDRKKKPRPKDPTGTDSEQTTSTGVKAAAQVAATA
                     SDSTKTVAAASDARVAAVPDSFEAHLTDAFSDSGSGEDEHVLSLASESGVDDDAEQKE
                     AISGKVRFSEPARVQPSGPALSAEERRQLAVRQRLADEAAARTAASADRLRSPIICIL
                     GHVDTGKTKLLDKIRHTHVQEGEAGGITQQIGATYFPIEAVRQEAAKVNPELTYRIPS
                     LLIIDTPGHESFTNLRSRGSSLCDIAILVVDIMHGLEQQTLESIELLKMRKTPFIVAL
                     NKVDRLYGWKPCPMAPIRQALEENPSTAAEFERRVRETKTAFAEIGFNAELYWENTDY
                     RRNLSLVPTSAISGEGIPDLLMLLVQLPQRLLVERLKFIDFVYCTVLEVKVIDGLGTT
                     IDVVLTGGALHEADTIVVCGLDGPIVTTIRALLTPHPMKELRVKGQYIHHKRIEAAQG
                     VKISAEGLEKAVAGTQMFVARNPDEIEYLKEEVMADLSTTLAAVDTSGVGVYVQASTL
                     GSLEALLEFLRKDAKIPVSGVNIGPVHKRDVVRASTMLEHRPEYAVILAFDVKVEREA
                     REEAENLGVQIFTADIIYHLFDHFRKYMEQVKERKKRDAEVDIVFPVCATILPDSIFN
                     KRDPLILGVRIDEGILRCGSSLVAVHEETSRMVDIGRVLSIESNKKSVTQARRGDLVA
                     IKVSSRQTSHVMYGRQFDHTFKLYSRITRKAIDLLKELYRDELTKDDWQLVLKLKKMF
                     GVL"
     misc_feature    complement(374697..377701)
                     /note="repetitive element"
     gene            <382484..>384073
                     /locus_tag="CYME_CML152C"
                     /db_xref="GeneID:16994597"
     mRNA            <382484..>384073
                     /locus_tag="CYME_CML152C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536736.1"
                     /db_xref="GeneID:16994597"
     CDS             382484..384073
                     /locus_tag="CYME_CML152C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536793.1"
                     /db_xref="GeneID:16994597"
                     /translation="MCTRCLPEQHCVRGMQSGDMPSCSVAEQYGSAMWQHAIPATSLC
                     SCGALLQSKRPRLWYPQPSAAQESDFIVEYMGEVIGPTELARRKRDHALERHVYFMTL
                     DQSTFLDASRKGTWGRFLNHSCEPNCHTQKWLVLGKVRVGIFASRDIAAGEELTFDYR
                     MERRAAAAAAPEETSLLQRVSPRRDLDLNESDASVPIRCLCQAASCSGWISGGPYASA
                     LDEQQAMDAVEHRRAASLQRITEQIAGIRKALGPRQAAQTAKWVTASAADRIHTLAVA
                     TLSRAQETAKCFDTFAAKRRNWTRWDAELLWEVSVPWQSQQQGDIDDKYAEAYRTHRK
                     EPENCPHFAELYARAQKFWEARDSASVSAASPANHWVVIALQQSIRALLNTAIGQPGS
                     YHRIWRIVNAGFTLLDQQRRVHVVNGPASIAHVPDDRFLELYCESEQTLRVERGERGQ
                     LQVYGPVATLQEYLAKNVPEIQAQRFLWHPGGRSCFRISAGMQSQASGAVWYHNIEPV
                     DVDWSLAQYLEECERMAAAQV"
     gene            complement(<388682..>389467)
                     /locus_tag="CYME_CML153C"
                     /db_xref="GeneID:16994598"
     mRNA            complement(<388682..>389467)
                     /locus_tag="CYME_CML153C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536737.1"
                     /db_xref="GeneID:16994598"
     CDS             complement(388682..389467)
                     /locus_tag="CYME_CML153C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536794.1"
                     /db_xref="GeneID:16994598"
                     /translation="MFWKKKAPPITQEEYQSRLNSRSELVRGKLETIEKELFRCRQQM
                     RTAPKGSAAYRTAEARALLCLKHRKMLENQMGVYTNQTLTMDQVQFANENLRMARESE
                     QQMRVSRKQLAKQLKHTNVDRLEDAAYELADVLQDTDEVQEVLGRSYHVDAEFDDVEL
                     LAELDSLESEMAQDQMMRTEKGSVPVYLQDHEEPVEESSRNAPWLGESKWSPEMELAT
                     RAPPVPRDPLPRSTVAGEAASGRSHAPQANEDELASLRRSMAV"
     gene            complement(390402..392196)
                     /locus_tag="CYME_CML154T"
                     /db_xref="GeneID:16994599"
     misc_RNA        complement(390402..392196)
                     /locus_tag="CYME_CML154T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461415.1"
                     /db_xref="GeneID:16994599"
     gene            complement(<392817..>393584)
                     /locus_tag="CYME_CML155C"
                     /db_xref="GeneID:16994600"
     mRNA            complement(<392817..>393584)
                     /locus_tag="CYME_CML155C"
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /transcript_id="XM_005536738.1"
                     /db_xref="GeneID:16994600"
     CDS             complement(392817..393584)
                     /locus_tag="CYME_CML155C"
                     /codon_start=1
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="XP_005536795.1"
                     /db_xref="GeneID:16994600"
                     /translation="MTSLGFATPPFVGKYGGRQSGYEGWHNRSFLHGGERSCAKRTFR
                     VRESRSSSARIYMMPVGVPKVAFRVPGGTQAEWVDIYNRMYRERIIFLGSELDDELAN
                     QIIAVMLYLDSEDNTKPIYLYINSPGGSVVAGLAVYDTMRHIKSEVVTINVGLAASMS
                     SFLLAAGEKGKRFALPHSRVMIHQPLGGAQGQASDLKVEAEQILRIRDALTYEYSKMT
                     GQPYEKLIRDMSRDNFMSAQEAVEYGLIDRVIEGKAQ"
     gene            <395732..>397432
                     /locus_tag="CYME_CML156C"
                     /db_xref="GeneID:16994601"
     mRNA            <395732..>397432
                     /locus_tag="CYME_CML156C"
                     /product="similar to ATP-dependent RNA helicase"
                     /transcript_id="XM_005536739.1"
                     /db_xref="GeneID:16994601"
     CDS             395732..397432
                     /locus_tag="CYME_CML156C"
                     /codon_start=1
                     /product="similar to ATP-dependent RNA helicase"
                     /protein_id="XP_005536796.1"
                     /db_xref="GeneID:16994601"
                     /translation="MTWAFLGFLAPLPAWRCDHHKTIGAGSCNSLHTGGAHCSRLRRA
                     ALVRVPGLINPAPSLWYAKRRSCRRSERSAPLNLTSSFASLGVFPELVTALDAVGIQT
                     PTAIQTRAVPAILGGASVIIGSATGSGKTLAYLLPIVQRLKSEEQQVVSEMQTEEAAE
                     MMRRGRHPLRRPGAPRALVITPTRELAEQVLGVCKHLSHYIKIRAASGLGVRRIVRAQ
                     LEEQPVDILITTSGRLLQLLDEQLIRLRSVQTVVLDEVDTLLLDEGGFHDDIRQIMGK
                     ARNTQQFIAVGATHPTAAQKLYREFCPGAKPITVDLHQTPSNLRQRFIRVSGANGKTD
                     EILALLKEETHKKTRLLSGGRVMVFCNTVDSCRFLDYFLQEHGFTTANYHGDIPKDRR
                     EEEFQAFVRGERQILVCTDIAARGLDYDHKIDQVILFDFPRTAIDYLHRAGRTARGPS
                     GTGTVTSLVTKKDLPLASFIEDATRIVGVDLVQYCETKMREAVKRDEKPTNVNASNAP
                     RSGTRPGSRTRPGPGARPGPGARPGPGARPGPGARSGPGARPGPGARPGPGARSGPPK
                     "
     gene            complement(<399696..>401582)
                     /locus_tag="CYME_CML157C"
                     /db_xref="GeneID:16994596"
     mRNA            complement(<399696..>401582)
                     /locus_tag="CYME_CML157C"
                     /product="similar to psbB mRNA maturation factor Mbb1"
                     /transcript_id="XM_005536740.1"
                     /db_xref="GeneID:16994596"
     CDS             complement(399696..401582)
                     /locus_tag="CYME_CML157C"
                     /codon_start=1
                     /product="similar to psbB mRNA maturation factor Mbb1"
                     /protein_id="XP_005536797.1"
                     /db_xref="GeneID:16994596"
                     /translation="MSLAEHQFLGRSSSLDNANFSRSSSSLGFINALVRRDAGQGSCP
                     HWQSKALGLGGENGFTPASCVPRTCRRKISFPILGRFCRRSSLLLAAGPVTAVNDAAH
                     PDLDASGEAGPAASSQPLVRAELTLQPVAPSRESITVARKLESSRLVSEALAAERSGH
                     WQVAVARYEQALVLCPSEGKVWMLLARGWERQRHFDQARNTLRRGIQSNPGNPFLIQA
                     LADLEKLLRNWERARKLFAQTLEVEPKFLSAYNSWAMMEDELGNVQRAYELLVRGLRL
                     DPSSTRLLRSLAVLEDKYGRSKFARNLLDKALENEHENVHLLHAVGVLEFKQGNPAKA
                     RASFLKAISADPSFMQAYLSLAQMEEYLGNISAARQAYIKGLAEARARPQPSNIQLDG
                     VGGPVALWQAYARLEEKCKNLRSARRVYAEAVARFPSDVRLHCEYAKLELRLGNLKTA
                     RNLLSRAIEVDDGYPYAYQYLGLVEQADMRIDAARNIYSRGIERCSAANSESRYPIDT
                     ASLYHSWALMEWKCGDVTSARNLFERGLKVDRSAGWLWASYARFEADLGNDDLAQHYY
                     ARAVNASPKDPAIWNSWAAFERRRCNQERADTYAKRALELRRFDQTRGMDPIRPLARR
                     RFKA"
     misc_feature    complement(402452..403760)
                     /note="possible transcribed region"
     gene            403034..404777
                     /locus_tag="CYME_CML159T"
                     /db_xref="GeneID:16994593"
     misc_RNA        403034..404777
                     /locus_tag="CYME_CML159T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461416.1"
                     /db_xref="GeneID:16994593"
     gene            <405619..>406110
                     /locus_tag="CYME_CML160C"
                     /db_xref="GeneID:16994590"
     mRNA            <405619..>406110
                     /locus_tag="CYME_CML160C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536741.1"
                     /db_xref="GeneID:16994590"
     CDS             405619..406110
                     /locus_tag="CYME_CML160C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536798.1"
                     /db_xref="GeneID:16994590"
                     /translation="MPLDNAAPTVHQVDRSTRKWPPAPGTPFTAQVFEAIRDIRDPEH
                     PNTLEELAVVTPESVSESSRRRFLLVSFTPTVPHCSLAALIGLCIRQRLVDLGLSPTC
                     VSALPEVGKSPYALRLKVLVTPDTHVHWQEITKQLNDKERVLAALENAQLSSMVRGCM
                     PLP"
     gene            complement(<407066..>407638)
                     /locus_tag="CYME_CML161C"
                     /db_xref="GeneID:16994591"
     mRNA            complement(<407066..>407638)
                     /locus_tag="CYME_CML161C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536742.1"
                     /db_xref="GeneID:16994591"
     CDS             complement(407066..407638)
                     /locus_tag="CYME_CML161C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536799.1"
                     /db_xref="GeneID:16994591"
                     /translation="MAPVPGFPDDLISLCRHVEREIICYLVAQHRFTPCTAAEWLVAV
                     ASCGALLGTALGLITPNKTFLAEQGKSILFLTLVTGCTVFAWLVVLFRIERWSFRGCK
                     TSRPPRSDRMSLFFRFDRVPQYATEFRVRFRMIVSGRAPRETVWTSDITRFFSNEGKF
                     LEECFYMELEQATSSFLSKSSNGTEPECTR"
     gene            <408695..>409342
                     /locus_tag="CYME_CML162C"
                     /db_xref="GeneID:16994587"
     mRNA            <408695..>409342
                     /locus_tag="CYME_CML162C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536743.1"
                     /db_xref="GeneID:16994587"
     CDS             408695..409342
                     /locus_tag="CYME_CML162C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536800.1"
                     /db_xref="GeneID:16994587"
                     /translation="MRAGTVTFVASLGSLRNFGTFAVAGPKQAAPRRNSSEARVWLRR
                     SPSERRVPKFLVRASSQEDKDTGKAGDRGSFGSNEEAASGVGKPQGRNNLQPSLDLGF
                     SSEYLTFLDSVELPESFPSYSHWLNLPKGRPECEQCRGAGEILCPVCEGKGYYALEIL
                     GTVSAGQCGMCRGTKKCPCPTCKEHIYLAMSDHGAFSRKGSETSTDEQVSRFGVS"
     gene            complement(<409565..>410407)
                     /locus_tag="CYME_CML163C"
                     /db_xref="GeneID:16994588"
     mRNA            complement(<409565..>410407)
                     /locus_tag="CYME_CML163C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536744.1"
                     /db_xref="GeneID:16994588"
     CDS             complement(409565..410407)
                     /locus_tag="CYME_CML163C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536801.1"
                     /db_xref="GeneID:16994588"
                     /translation="MDVSAHLAEPGGQCELPESRTERPRTEPQTGGHSNSIATAENQK
                     SPNADRQEAPRCTKAFAGTETSSGNLDGEAPVDSWVSVEAPTSEVDEKPALIRRTVEQ
                     SPVLCVKMAGHENVETPLYLHSSSSQPKLSSAETTRVGLYRTRFPNMNRVRVHASKAL
                     GRWSKFIAEELRSGSLVNEYSAWVTTVLVCTLLVYLLTITISILYAVLCAALTVLVSC
                     AGAITAAFVWIALLLMVSIPIFVIVLVSLLAATTGIFALKVGLDGIKSNTDQIEDDDD
                     PQDL"
     gene            complement(<411226..>414315)
                     /locus_tag="CYME_CML164C"
                     /db_xref="GeneID:16994584"
     mRNA            complement(<411226..>414315)
                     /locus_tag="CYME_CML164C"
                     /product="DNA mismatch repair protein MutS, chloroplast
                     precursor"
                     /transcript_id="XM_005536745.1"
                     /db_xref="GeneID:16994584"
     CDS             complement(411226..414315)
                     /locus_tag="CYME_CML164C"
                     /codon_start=1
                     /product="DNA mismatch repair protein MutS, chloroplast
                     precursor"
                     /protein_id="XP_005536802.1"
                     /db_xref="GeneID:16994584"
                     /translation="MYIVESSSVISARNWNQTSSTGVSYCQSCQALDAVENRRAKLRA
                     SFTLLKTRFCASARIRGYVAGSIYSFSKLHVRCSSVDSGEHGVSQERVHARPNAAFLA
                     DVDSVPAAATTAGAAMGVTGENLGQTVVSRESNTASLGMEQVEQVSLVMESTAELLEF
                     GRVLECLSSLALTQTGRQRLLSRGLMIHLLSLTKQQSERLMQLTAEVVTIERRTPTSP
                     FEVLKRLPDVEGLIQRLHKKGNLEGEELLRIANFVQVAANLKKASAECLMDSSSASPD
                     AYMSSPAFDSTSCTNQMHTEPLAVQKCSAELQSILDRVQPVSAAASEIFATLDETGRP
                     RETASDELRVVRTQLQRIKERIKDELQRIIQSKGDALQDRTPTTRYDRQVLAVKATHK
                     RRIPGIVHDYSNTGSTVFVEPHAIVELNSELRRLSRRESAIERDIWNQLSKRLHAASV
                     RLSSTFEALIDIDFSVARARYARHIGASLVRFAADSEMPVDIRGACHPLLLWRSLKSM
                     ESVVPIDFHLRGIASAAILTGANAGGKTLAAKTLGLIVLMAKSGIPIPRRHADPNMSP
                     TTLLDEDVTVPYFDRVLADIGDEQSLEQNLSTFSGHIRRIGEILQCATADSLVLLDEL
                     GAGTDPAEGAALGIALVRYLVEKKNVRFVFVTTHHSELKTLFFMEPSRYENVSVEFDT
                     DRLEPTYRLLWGVAGRSYALLVARRLGLDHDILQEAENLLERSVGVGSSPDSLPLSPG
                     SGSSSPQNMSRLMEQVEKIRVEQLQNLERARQEAREMERMRQEHEKRLAGLERHRKEA
                     IEEVKRALEAELEQVRQELREALQRLRRNEMASSEGNTLANTLEAKVAEATMALAGLE
                     RDDDREINPETVDTNDYVMVPKLGSSPLRVTQKLPDGRIRVALGNLTATIAVQEVVSV
                     QRPTEASTTMATERSPRRRVEAEKPASGLSSPVLVRTDRNTVDLRGMRAHEVESALDS
                     AIDRSVQMGSLWIIHGHGSGRLKSVVREYLRGHPHVDSFQEASPSDGGSGVTVAVLR"
     gene            <414618..>415046
                     /locus_tag="CYME_CML165C"
                     /db_xref="GeneID:16994585"
     mRNA            <414618..>415046
                     /locus_tag="CYME_CML165C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536746.1"
                     /db_xref="GeneID:16994585"
     CDS             414618..415046
                     /locus_tag="CYME_CML165C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536803.1"
                     /db_xref="GeneID:16994585"
                     /translation="MGSRTPATGTALFDSVLRLAREKSLAKWPDTEIRKAVSWALLAA
                     NEAGRTGSEHGYPELDALLRAWLEENPSWQSEFLERLHTVLCDPNVSHACAQPPRSRQ
                     TSNSFEEYASNLCVTLLATRLSKNVLNNQVSLVLDPSHIK"
     gene            <416447..>417523
                     /locus_tag="CYME_CML166C"
                     /db_xref="GeneID:16994586"
     mRNA            <416447..>417523
                     /locus_tag="CYME_CML166C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536747.1"
                     /db_xref="GeneID:16994586"
     CDS             416447..417523
                     /locus_tag="CYME_CML166C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536804.1"
                     /db_xref="GeneID:16994586"
                     /translation="MSFQSSVLQNSREDISENAVRARSSSVGSEGGRTSQTVLGVARL
                     RKVAVQQVSRIWHAGRWQNLPDFTRLLLIALVSTYCLSWYPPFTQFFSFTPAETLAGL
                     RIWNVVTYGFVEVHALHLFLTLLVLVTVGRSLEEVWRGSESPGGSTERLLELAMYVLF
                     ITAFASVLSFVITFGAFLWWKLRPEYLFASSAGFYAGNVALLVAYARYRPEQTFPSLG
                     TLARFVPVRTFPLMYVNTIVSLVPLVPTLWLSGLVTICAFVGSWGYFRFAKKFQLPTP
                     EVAGAPAEFPLYMLLPEFVMHILQRVGIMRGACGDPGTTSLEDGSTEQRDDSARRRAT
                     AASLLDQHLYRSATNQDAVSPTNV"
     gene            complement(<418416..>420017)
                     /locus_tag="CYME_CML167C"
                     /db_xref="GeneID:16994583"
     mRNA            complement(<418416..>420017)
                     /locus_tag="CYME_CML167C"
                     /product="GMP synthase, glutamine-hydrolysing"
                     /transcript_id="XM_005536748.1"
                     /db_xref="GeneID:16994583"
     CDS             complement(418416..420017)
                     /locus_tag="CYME_CML167C"
                     /codon_start=1
                     /product="GMP synthase, glutamine-hydrolysing"
                     /protein_id="XP_005536805.1"
                     /db_xref="GeneID:16994583"
                     /translation="MTEPLENSIHAGHDLLVVLDFGSQYAHLIVRRLRDIGFYSELHP
                     YDVGPERLMELKPKGLILSGGPASVYESDSPHLDARIFSLGIPILGICYGMQEIAYQL
                     GGKVECGDKREYGHATLQVVEDPADGGALFHGLKTSCSVWMSHGDRVISLPEGFYPIA
                     RTENCNYAAVYGQPNAHASVLAPIYGLQFHPEVSHSEHGTEVLANFCRAVCGCRGDWY
                     MEAFLEEAIRTIREQTGEHALVVGALSGGVDSTVAALLVSRAIGDRFRGIFVDNGLLR
                     KNEATDVMAMLRDQMHVQVDCINASTHFLDALAGVTDPEEKRKTIGNQFIKVFEEQAR
                     KISADFLLQGTLYPDVIESISHKGPSATIKTHHNVGGLPQRMRLKLIEPLRYLFKDEV
                     RKLGLVLGLPAEVVYRHPFPGPGLAIRVLGEITSERLNKLREADAIFLHELRRAGLYE
                     QIGQAFAVLLSSKAVGVMGDFRTYEEVIALRAVATSDYMTADWYPLPFEVLRRISLRI
                     VNEVSGVNRIVYDVTSKPPGTIEWE"
     gene            <422065..>423408
                     /locus_tag="CYME_CML168C"
                     /db_xref="GeneID:16994566"
     mRNA            <422065..>423408
                     /locus_tag="CYME_CML168C"
                     /product="branched-chain alpha-keto acid decarboxylase E1
                     beta subunit"
                     /transcript_id="XM_005536749.1"
                     /db_xref="GeneID:16994566"
     CDS             422065..423408
                     /locus_tag="CYME_CML168C"
                     /codon_start=1
                     /product="branched-chain alpha-keto acid decarboxylase E1
                     beta subunit"
                     /protein_id="XP_005536806.1"
                     /db_xref="GeneID:16994566"
                     /translation="MLRYLRVLCLRDWLLDHTVAWRQYARVRRSLPLTVTFTPLQIGL
                     PCASFATRGDRVWSSTIRKRTFSTENESSPSTTDVAPGPAVGDRAQRSTTPSLYPGGG
                     DKLSGSVSNSAGVVKATEETLRQMNLFTAINSALSCALESNPKVLVFGEDVAFGGVFR
                     CTSQLQKRFGRQRVFNTPLTEQGIVGFAAGLAAMGYRPVAEIQFADYIYPAFDQIVNE
                     IAKYRYRSGGQFNCGGVVIRAPYGAVGHGGHYHSQSPEAYFLHTAGIKVVIPRDPFTA
                     KGLLLQSIAEDDPVIFFEPKALYRAAQAEVPLSKYVLPLGRAEIVRPGTDITLVAYGA
                     QVRVLLEAAQVVAREDKIEAEVIDIQTILPWDEATVCESVARTGRCIVSHEAPLTGGV
                     GAEVAARIQEECFLDLESPVMRVCGYDMPFPLVHEKNYLPSAEKVVQCIRDCLNY"
     gene            complement(422720..424458)
                     /locus_tag="CYME_CML169T"
                     /db_xref="GeneID:16994567"
     misc_RNA        complement(422720..424458)
                     /locus_tag="CYME_CML169T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461417.1"
                     /db_xref="GeneID:16994567"
     gene            <424752..>426359
                     /locus_tag="CYME_CML170C"
                     /db_xref="GeneID:16994577"
     mRNA            <424752..>426359
                     /locus_tag="CYME_CML170C"
                     /product="similar to phosphoribosylanthranilate
                     transferase"
                     /transcript_id="XM_005536750.1"
                     /db_xref="GeneID:16994577"
     CDS             424752..426359
                     /locus_tag="CYME_CML170C"
                     /codon_start=1
                     /product="similar to phosphoribosylanthranilate
                     transferase"
                     /protein_id="XP_005536807.1"
                     /db_xref="GeneID:16994577"
                     /translation="MWAFWSGAELLAVKKRAREAARPLQCCVRGSALQEGIKAVAIGK
                     HGAKPVPESILEPLKVELERVEHQLQVFKRQGPNMAADDPASSLNIEQVARRASFLAS
                     LFLKYELLPAEAQLLQHCIPKSTASLRLGRERCDCFASDVLQTLCTNLLPESKAFRLG
                     VKLLSAQVLSREEAMELASIVLSCNANTMESPAVDITDVVSFRALTMHTMRVRHETSD
                     ELLGMAEAANSAMSPSFRPHQSSTQSRPPQRYVQLAEPFDGFERPGCLLTTPIIAWHL
                     QERWGIANVVGAMGDSPGPKYGPNLKSVALELSRALGPHSTAVNFAQNLDDIFKGSRA
                     GSRCFNLVDQAVICPALYDLLPLRRSIVKRPGWSTVEKFVGCAPEQCSVLIASAFHPP
                     YTKRMIEVSMGLGLSGAIIIRKGIEGTLSIAPDSNFIELACCARRADHTYEQIELKVQ
                     PSVERVKTSSPANATVSATLTAAENARLLRNYYQSRTSCGDEQFDRIIQATLACVDAG
                     MQWLMEHIHEQGLAGEASSSVPPCAGG"
     gene            <426918..>428120
                     /locus_tag="CYME_CML171C"
                     /db_xref="GeneID:16994578"
     mRNA            <426918..>428120
                     /locus_tag="CYME_CML171C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536751.1"
                     /db_xref="GeneID:16994578"
     CDS             426918..428120
                     /locus_tag="CYME_CML171C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536808.1"
                     /db_xref="GeneID:16994578"
                     /translation="MGSTVSDSEPAPQAILRGHTSPVTALCLLGHSERALKSAKPRSG
                     VWEDAPTINWPRIVVSGDSRGNLLVWDLDLEQVIANQKQSTEAPLLSIEAATDEPNLL
                     ITHSRDGCVRVIQMDQLSSSVADMRHAAGEMLEPFPMSRGRVLFRGEPHGFCRPGIIE
                     FAASDRILIATSGGKNHESIYLWDARVSSEKPVGKLCREGTLEARRSSSTTAGGDGIS
                     ALCLCMKALPAERTLLAGYEDNHMCAWDYRGRSDLPVAEVPVFRHAQPLLALDSIRPL
                     AVDGSERFYTLATSGFHGQVAMMRYAPATACFETTAQLTVANAAISELAYRPSDTRIL
                     VGGCSDHGVRVLSAKSPYRKLALLRKHRGAVRCLRFADFGSVFATGADDSAIAIWTIY
                     DTSFISNA"
     gene            complement(<428100..>430271)
                     /locus_tag="CYME_CML172C"
                     /db_xref="GeneID:16994565"
     mRNA            complement(<428100..>430271)
                     /locus_tag="CYME_CML172C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536752.1"
                     /db_xref="GeneID:16994565"
     CDS             complement(428100..430271)
                     /locus_tag="CYME_CML172C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536809.1"
                     /db_xref="GeneID:16994565"
                     /translation="MLGFRLGSLRLFLGLILLLQLYGFLGNIFEKHLALAHDQQKTAA
                     EHRFTENASRSSAASLPAQVRDSFFTVLQISDIHLDYQNVDALDNFKTIVFDAIPFVA
                     PDVVIVTGDITNAKRRRGLGHFSEQRVDEWSQYSEIVQRARVEGIIPAETAWIDLPGN
                     HDMFGVPSRLAGTNRYYGQHCQLYHSLANVSCLQPRFSWFSFHNGSYAVMRVDAVPEP
                     SLHRPLNFFGDLSRLRGDQREDLELGALNQGIDSAFVFVAAHYPSSFINTELDLHSTL
                     GKAAKNRPLVYLSGHLHTLMGLCPRLYSVVPRKRLLDLELADLRYERRFRVIIASSTM
                     GALGFRDFSLRTGTKPERNEVPPWLLVWMRAPVFFADSEISRKPHDYANSELYFVIWF
                     RSRACSSPDFEVTVDGVPVGRASRYCPPSRRFCLYTIGKNLMREVAGRDVRVSLQRIN
                     NSPDELLCGPDTVTEILSFLDDAQSIVNVPQEGRASNLCRLILFLNMPHFFRVMTLLI
                     GCAALVVLSAALVLMRKCGLHPEPSYGAVHQHPSQVRHGETLRRMKLCAKQLAISLTL
                     ALFWFFLGPWILSNRMTDNFGGIVFLWTVYLPRHGRIGPNADLFWLYGIQAAALMLML
                     TLNYLLLLWRMEGIIGRPPNKVPILSRRASGLAIAVTSVTALLVHLHNLLSLHGAFGV
                     LASIVSPVGAPFSALSSNALSRLAHLHRLMQRHASLSIGNK"
     gene            <431550..>432203
                     /locus_tag="CYME_CML173C"
                     /db_xref="GeneID:16994568"
     mRNA            <431550..>432203
                     /locus_tag="CYME_CML173C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536753.1"
                     /db_xref="GeneID:16994568"
     CDS             431550..432203
                     /locus_tag="CYME_CML173C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536810.1"
                     /db_xref="GeneID:16994568"
                     /translation="MRVTGELQPAPLDSQTKDDTPSAVSPQTPAQSAFGAHEQREAPP
                     IKRKRFRNSSVRSSSKGEQGAPLSELHMLEKGKRELEEKLARIERQIYDMETSYLEDT
                     WIHGNVARGWETLMRKGSRLRDGADASARGSAASHPRTRKILDNDRIFSRSSATSPVG
                     RAHGVRHPNAVGLAGDGLSRDNRRGVPSRQKKRRPTVLGVPSIRIPLNIAENSPASS"
     gene            complement(431820..433844)
                     /locus_tag="CYME_CML174T"
                     /db_xref="GeneID:16994569"
     misc_RNA        complement(431820..433844)
                     /locus_tag="CYME_CML174T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461418.1"
                     /db_xref="GeneID:16994569"
     gene            complement(<434384..>435949)
                     /locus_tag="CYME_CML175C"
                     /db_xref="GeneID:16994572"
     mRNA            complement(<434384..>435949)
                     /locus_tag="CYME_CML175C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536754.1"
                     /db_xref="GeneID:16994572"
     CDS             complement(434384..435949)
                     /locus_tag="CYME_CML175C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536811.1"
                     /db_xref="GeneID:16994572"
                     /translation="MGSGKEAQRNEVQGPVFWSEVDLGEEPIPVPEQALDPECSRSSG
                     FTVVNATDFFRNDACSNVETEEVGWISASRRLRSRSGSVWRRLRNRLWQSEDGELQFR
                     GGEPAEPLAERTATPGSAKQSQNSAHHSRWHVLRTFKSSGELLDWEEYQGKLAQEWEQ
                     DIIPNWEKRLKSKRIRSLIFEGIPSNVRGQAWPRLIGNAMQIAPGLFDVLCEQAKRTR
                     RALHHQDATIGQADGDLGGAGGEAETLLTHQKERMDGGICPAAQKAIVLDLPRTFPQL
                     GFFHAEGSPFQSELRRLLEAYAHFRPEFGYSQGMSYLAAALLLYLDAPTAFCCFANIL
                     SKSRCLSSFYKMQNPEVQAYLLLQQRLVFSENPVLAAHFDAIGIESDMYIISWIMSLY
                     CRVLPLDDALRIWDAFFLLGDAFLFKAALAILRVLQDCLLRGNFEDCAYTLSHLPETV
                     TATSIFAEVRQVRFSRKRFAEIFEECLVVAAQNSAKTPSKQRTPSRIRHQNDPDDGAG
                     ECATPRLPDAAPR"
     gene            <438187..>439911
                     /locus_tag="CYME_CML176C"
                     /db_xref="GeneID:16994573"
     mRNA            <438187..>439911
                     /locus_tag="CYME_CML176C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536755.1"
                     /db_xref="GeneID:16994573"
     CDS             438187..439911
                     /locus_tag="CYME_CML176C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536812.1"
                     /db_xref="GeneID:16994573"
                     /translation="MGNVGSSARQRRRTAAGILAGSHESQATVCGSLFAACLGLETRS
                     SLGHSPGQECGAGSSTPRFADGTKIERRLVGKFTSPTGLYSRELWDERKVRRLILHNR
                     LAPRFPGAEFPVRVVVEDGVKRINMEGKGLCPEYIQHEMVSALEECPICFLYYPCLNT
                     TLCCHRGICTECFLQLRPQRVVAHTTTSSCPFCKHELMEIVFHGARSEKEMDQLYEEE
                     SRVREAMEQARARQEAEAAERRLELRRMRVEHCISTLRAVVAAAVHERFAQWLNFGGD
                     SLHEASRPQSDADWRASLPEPPEDLQDFMNISTARKKICTSLRRTKSSPVITSRTGIS
                     DHIEHSYERHLALAQAHGWRGKDPLHNRTGTFKSEQPRGEPNSETQPATCNHSELQIL
                     PLETVPNQYTSSRRPSLSSPGVYASSSLNTVPDSSRAQDSDVLTQQMRRFAPDASPGQ
                     VAISTDPERWNYKRRRSARCVSVSSSAELLLTVNLMCHNTSESGATGRNRRNEQSDTC
                     ELPASAFLRRWTGSSRDLYFAWEQEELALLHDMEARGLLDWAEETDITYEELLLIEAI
                     RRSLLGNT"
     gene            complement(<445021..>445749)
                     /locus_tag="CYME_CML177C"
                     /db_xref="GeneID:16994574"
     mRNA            complement(<445021..>445749)
                     /locus_tag="CYME_CML177C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536756.1"
                     /db_xref="GeneID:16994574"
     CDS             complement(445021..445749)
                     /locus_tag="CYME_CML177C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536813.1"
                     /db_xref="GeneID:16994574"
                     /translation="MNCQAYGVYLTPKELEGQNLIVRERCLQLPSARKAAQGARFRVC
                     LWEVRLDDKVDKPWRLFGLYRAELGKGSWLLVCSRQAERIESSNALDGKAGLNAAAGY
                     TVLDGSLQLLVPQDPVLLLFSSIEDFFSEDTPQPWSQFVDALQHSSWLFEYLHEDVVA
                     RLLLDNGATNQREDSDGKRLPKLYYFSEKKALAFLLKKFSSVCAVLGGLGETEKLQNA
                     LQIVTHMAGSNWAERLASIVGREV"
     gene            <445944..>446885
                     /locus_tag="CYME_CML178C"
                     /db_xref="GeneID:16994570"
     mRNA            <445944..>446885
                     /locus_tag="CYME_CML178C"
                     /product="probable long chain fatty acid elongation enzyme
                     Elo1p"
                     /transcript_id="XM_005536757.1"
                     /db_xref="GeneID:16994570"
     CDS             445944..446885
                     /locus_tag="CYME_CML178C"
                     /codon_start=1
                     /product="probable long chain fatty acid elongation enzyme
                     Elo1p"
                     /protein_id="XP_005536814.1"
                     /db_xref="GeneID:16994570"
                     /translation="MQSKRHIVQDSQSAASSRAKALRCSSLALLQPNTFFYMVQEEYY
                     SVARALRSVLASGTLDGARDFRFRYGESALSVWYVPILTCVLYYVFQRGIQQYMKERT
                     APKLKQLLFVYNMTMSFGSAALFAALTKLLWSRWQSLSFHDMICSKQMHEDGRVQLLY
                     WMNYFFKYIELADTLFLAIRKRKIIFLHSYHHAATLVLCWSQLVEHSAVQWVVIDLNL
                     FVHIIMYYYYAVSALGIKPWWRRYLTKLQISQFVIDLTACGYAYGYYVVYGWGSCYGT
                     VTGAYMGIGILFSYLLLFIKFYIETYKGSKSATKLKV"
     gene            <449673..>450878
                     /locus_tag="CYME_CML179C"
                     /db_xref="GeneID:16994571"
     mRNA            <449673..>450878
                     /locus_tag="CYME_CML179C"
                     /product="lipoic acid synthetase"
                     /transcript_id="XM_005536758.1"
                     /db_xref="GeneID:16994571"
     CDS             449673..450878
                     /locus_tag="CYME_CML179C"
                     /codon_start=1
                     /product="lipoic acid synthetase"
                     /protein_id="XP_005536815.1"
                     /db_xref="GeneID:16994571"
                     /translation="MAVGTRWFILSRKLSGLPPQRPRLEALRALLQSETPAFELATDV
                     PAQASDQLECSKPHRVDAYAVQKKPEWLQVRPAGDHKSVAEYRRLYRAVRDLNLHTVC
                     EEARCPNIGECWGGGTATIMLMGDTCTRGCRFCSIKTSRSPPPLDPAEPENVSSTISR
                     WGLRYVVLTSVDRDDLTDGGAAHIASTVKLLKQRVPSILVETLTPDFGGSTSAVHTVV
                     ESGVDVFAHNIETVERLQHVVRDRRAGYKQSLYVLEQAKAHPQRGKEIVTKSSIMLGV
                     GETRAEVKQSMMDLLNAGVQILTLGQYLRPSRKNMKVEEWIHPDEFEEWKHEGEKLGF
                     LYVASGPLVRSSYRAGEFFIESLFRKEHKQSASRGSTSWEKNIGSGTVAEAERQYQEN
                     LSQRPSPVA"
     gene            <451287..>451928
                     /locus_tag="CYME_CML180C"
                     /db_xref="GeneID:16994613"
     mRNA            <451287..>451928
                     /locus_tag="CYME_CML180C"
                     /product="similar to 3'-5' exoribonuclease CSL4"
                     /transcript_id="XM_005536759.1"
                     /db_xref="GeneID:16994613"
     CDS             451287..451928
                     /locus_tag="CYME_CML180C"
                     /codon_start=1
                     /product="similar to 3'-5' exoribonuclease CSL4"
                     /protein_id="XP_005536816.1"
                     /db_xref="GeneID:16994613"
                     /translation="MSAQERLTCRNHETIQSHLGTRIALRKARGFTVLCKTQYSSAYM
                     SHRSAFFVLPGEVTGNAEELAYNASGVFYKWDLELRSLYAGVLTCSEQCATSAKAAQR
                     LATVQCDLENPRGDQKASALIPRPGKRVIAVVLRVNRRQATALILHVGTVPAKSEFIG
                     VVRQQDIQEDNWDSVRVYDHLQPGDLIAAVVLSDLEQKHYYLRVASMPFLIRR"
     gene            complement(<452361..>453548)
                     /locus_tag="CYME_CML181C"
                     /db_xref="GeneID:16994602"
     mRNA            complement(<452361..>453548)
                     /locus_tag="CYME_CML181C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536760.1"
                     /db_xref="GeneID:16994602"
     CDS             complement(452361..453548)
                     /locus_tag="CYME_CML181C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536817.1"
                     /db_xref="GeneID:16994602"
                     /translation="MDNRTVRATQSTPLVRQRGCLAEKPTPSRSSKGLRLLSVSFCRK
                     LRLLGFATYARIADELVEEFLGSDVVQGQTLERTSAANLEGILHEVSPARKDRLACVV
                     AHEASPLRNGRTIASPRYGEDGYTDERNCAERTLRRRIYDIFNVLLATGTIEKGENGS
                     VHWRGIPGERIDPRYTEIRRLRLRVEELRASIQTKQEIARDLAEQQAAFMNLITRNSQ
                     EKSCETLDKDICPDGLPSHKRFPAGNGASAFGQEETTSLDQNHEAQHELMESELHAGY
                     TLWDENSNTSGTKRVRALRLSENRMVPEDASVSKGTDGIRVQYPFVVLRTGVKANIGL
                     ETNETRSSLTLGMSEPFSVFSDGDSVTLLKLHERGPYSTNQMLRISRESAARNISLRT
                     ASV"
     gene            <456391..>458376
                     /locus_tag="CYME_CML182C"
                     /db_xref="GeneID:16994603"
     mRNA            <456391..>458376
                     /locus_tag="CYME_CML182C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536761.1"
                     /db_xref="GeneID:16994603"
     CDS             456391..458376
                     /locus_tag="CYME_CML182C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536818.1"
                     /db_xref="GeneID:16994603"
                     /translation="MAHPVSLHWLRRTDDVALHRDAINSVVSVQSSESQPQDELLLSE
                     SRAGATASTLGTSSKPSLAEVSTGIKPQTNIQRDSLRLPETEREYEKRSRSSQWANGD
                     LSFPERECPTVEVKPRFRRRIIFGERRQYAFFQDALFPALSDAPETRGAMADSPSADT
                     PKPASLESCSERGNGAALHKTRDSCDVVPAFRESICLGADANRLSAVSGDSLKLEDDS
                     NQKHFSLDSSLGPNSRAALSDEISFPGARTHSSEALQLELNKSAENAECSTIYVYLYP
                     DGYSFSETGYPRFSFDGNSDRILFCLDQGVLPSSFEFRAPKRADSINNVRDAVILDYT
                     RPKPKKFHITLRPDYLNICLAIAESPYARELRQADRVLQLEAELLKLLHVLDDLEPRL
                     DHQTLSSHTESAQVLNFARTARQHVEVTFTRSLPLLRLFLTKRMNRNRRSRGKANIDL
                     ASQMLLLVAGNENLNRYRRTRMRSVTGLPRQTSSLELKTPADIAGAQPLRRPSFSNVI
                     GRLLRQLRFVLHRASATTIQPKSNEAPAVTNADEPSGQLDTPTASDRNARPASRSGEP
                     RIVCLLDIIVRPQRGCECVIRRGQEKNRDLDILRIPVGSERNAHIFANQFRRLMRGEG
                     FVCEQDLTLPSENRVTGEDNASETPAADASALRLTNE"
     gene            complement(<458555..>459709)
                     /locus_tag="CYME_CML183C"
                     /db_xref="GeneID:16994589"
     mRNA            complement(<458555..>459709)
                     /locus_tag="CYME_CML183C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536762.1"
                     /db_xref="GeneID:16994589"
     CDS             complement(458555..459709)
                     /locus_tag="CYME_CML183C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536819.1"
                     /db_xref="GeneID:16994589"
                     /translation="MLSFFCLLALPNQQRPLLHAPAFAGACPRVSSFVGDWCKQEPRN
                     CLQSSNRCARRAFKNSLRIEASDTRAKTVLVSGGSGFVGRALVRKLLGSGKAVTLLAR
                     DTEKARKTFNYKVEAIYFEATAADAPAKEVVEAVAGSDAIINLAGEPISEGRWTAERK
                     RRILESRVNGTLQLVRAVHHADRKPKVLISTSAVGYYGTSEVETFDEDSPSIGTDFLA
                     SVAKKWEAAAQDAGIRTVINRFGIVLGPDGGALSRMLPLFNLFIGGTIGSGRQWISWI
                     HIQDLVNIIMHELESPDFQGVYNVTAPTPVQFQKFCDSLARALKRPNWLPVPSFTLQL
                     ILGEAAELVLQGQRVLPKRLLQSGLKFQYQEIQPALDEIAASWKLPVRSA"
     gene            complement(<465464..>466636)
                     /locus_tag="CYME_CML184C"
                     /db_xref="GeneID:16994581"
     mRNA            complement(<465464..>466636)
                     /locus_tag="CYME_CML184C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536763.1"
                     /db_xref="GeneID:16994581"
     CDS             complement(465464..466636)
                     /locus_tag="CYME_CML184C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536820.1"
                     /db_xref="GeneID:16994581"
                     /translation="MNTEERASNANGHKLIESVYLAIRLALDDAAFSAREVFVNDSEL
                     SSALETLRVARTQLGCHGEYSALEDVPTWRLQSFILFPFYIAILADKLLERKGFGELS
                     ERNTYAERRGACAEVRQLYQQYLKLVQGCLWLGPFGLDSPFLESIRNLTSEELGAELP
                     MGVREAKINFTRNLRRLCDLVRNFSKRICMKGSMHEKTAFEALPFPLLPTDVHSDTEE
                     EQRNLVLRFIAVAAEWAFIRGYELGREMSALEALASQYEQSVKEVRADEKHACDAETL
                     GRRKPKIVYIDNHCSRTRYFENAHAFRRFLQGRTITSEEPPTKLPFGDCCLAHIHRDE
                     HNSQPEPQKKPLETDLNDTHGARDTQLEDQIIAAKRKWDLFKDDHRRGEGNRYRRG"
     gene            <466758..>468290
                     /locus_tag="CYME_CML185C"
                     /db_xref="GeneID:16994582"
     mRNA            <466758..>468290
                     /locus_tag="CYME_CML185C"
                     /product="serine protease"
                     /transcript_id="XM_005536764.1"
                     /db_xref="GeneID:16994582"
     CDS             466758..468290
                     /locus_tag="CYME_CML185C"
                     /codon_start=1
                     /product="serine protease"
                     /protein_id="XP_005536821.1"
                     /db_xref="GeneID:16994582"
                     /translation="MRSRNATPPCFVQKLFRFSRKCTSFQQCASVQIVKREAPGSRVV
                     VALAFNYHNCQAAPHVGSEFRQGEVAQRIVKYRTSDGGERAVSVRIFGKAKENKQQHV
                     EPPSQQPLQKLPTQQQEQKPEATASDFTAQNRRLSSSFVTKAVKLVGPAVVRIDTERV
                     VQLPADPVLEDPLFRYFFGDEFQRQLPKERTERGQGSGFFISSDGLLLTNAHVVAKAS
                     KVTVTLIDGRSYPGKVVGTDDLLDLAVIRIDTHSEKVPTAPLGSSGELQVGDWVIALG
                     NPVGLDNTVTLGIVSSLNRSSAEVGIPDKKINFIQTDAAINPGNSGGPLVNEFGEVVG
                     ISTAIRPNAEGIGFAIPIDTAKAVLDMLAKGEKVQHPFIGIQMVTLTPELAKQNNQDP
                     NALALIPEVSGVLVLKVLPKTPAAESGLRRFDVILAVNGNAISNARDIQKIVDSSRVG
                     QELKIRVLRGVDGKTIDISIRTADMTQFRLEEEKKLSPEEGQEAPPGIVPMPRHRRFS
                     IP"
     gene            complement(<468502..>469329)
                     /locus_tag="CYME_CML186C"
                     /db_xref="GeneID:16994605"
     mRNA            complement(<468502..>469329)
                     /locus_tag="CYME_CML186C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536765.1"
                     /db_xref="GeneID:16994605"
     CDS             complement(468502..469329)
                     /locus_tag="CYME_CML186C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536822.1"
                     /db_xref="GeneID:16994605"
                     /translation="MRYSGEALGHSKASATSTQVCLDALRRAEAPRAAMSSLNGGTGA
                     GGRFTTVEELSTVLRSQEAMCGAKLHEFLEEQCTRKRNDLEHNLAKLKVLDLGRAASD
                     LVSALGVSEERGMPLVALLLCVDEHESHLERSCALCQELASFSELTALFSERLLLWLV
                     GVRSAKQCSQLHELLAAHALPVMLCFASRDQKVALVETVAYTDGLPARFSESLYEFCD
                     LYVPLLRQAQSGRSAPDLFSFMDHEGFWIRQCPTPDLLTESILAEEQRIARMDQSSL"
     gene            469405..471642
                     /locus_tag="CYME_CML187T"
                     /db_xref="GeneID:16994607"
     misc_RNA        469405..471642
                     /locus_tag="CYME_CML187T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461419.1"
                     /db_xref="GeneID:16994607"
     gene            <473462..>473749
                     /locus_tag="CYME_CML188C"
                     /db_xref="GeneID:16994608"
     mRNA            <473462..>473749
                     /locus_tag="CYME_CML188C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536766.1"
                     /db_xref="GeneID:16994608"
     CDS             473462..473749
                     /locus_tag="CYME_CML188C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536823.1"
                     /db_xref="GeneID:16994608"
                     /translation="MVDSRESEDAGESPLENYTPNRPTLDKFKKNPLVPAGALLTAIV
                     LAGGITAFQRGNVIWSQRMMRARVAAQGATLLILAASVGAFRGGPSPQSTK"
     gene            complement(<474049..>475143)
                     /locus_tag="CYME_CML189C"
                     /db_xref="GeneID:16994641"
     mRNA            complement(<474049..>475143)
                     /locus_tag="CYME_CML189C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536767.1"
                     /db_xref="GeneID:16994641"
     CDS             complement(474049..475143)
                     /locus_tag="CYME_CML189C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536824.1"
                     /db_xref="GeneID:16994641"
                     /translation="MWSLPVPLASNSRLAERRKLASHATVTEATRELFLVRKRKAHGF
                     EAVRGKGPAIVRSAAQHKRSFYLRSSFDLPKLSTFQFDESNGIELVLERSETLTLPGT
                     PEVYVLYLALLDSKQATSGKRFQGWNKRQDHNFDKDLISTESRRATGRADEFSAPATE
                     RLLPLFLEDKLERDMIVLSIVHTEPPAAFAEREPRSRMSAGSFSIQMRLKLLQYLWRS
                     RDVFTEVKSIYKLMQARESSEIRESNLLFSALLNAIRSKRLQGAHALFLDLIRQRLQS
                     DILQVVLAPVSRRNPEQLRAYVCLELRSSQRQPWFVRMRGSDGAVFAFLAGCPLKIDR
                     DVWEYASISTRSIPLGDSVVFPMNRNAPAR"
     gene            complement(<477213..>478895)
                     /locus_tag="CYME_CML190C"
                     /db_xref="GeneID:16994642"
     mRNA            complement(<477213..>478895)
                     /locus_tag="CYME_CML190C"
                     /product="cell division cycle protein cdc23"
                     /transcript_id="XM_005536768.1"
                     /db_xref="GeneID:16994642"
     CDS             complement(477213..478895)
                     /locus_tag="CYME_CML190C"
                     /codon_start=1
                     /product="cell division cycle protein cdc23"
                     /protein_id="XP_005536825.1"
                     /db_xref="GeneID:16994642"
                     /translation="MTSEVDVALAVLRQVHTEQKYRELKEALRESLDRGLVLSARWLG
                     ELVASLGRKLEPQLLDNDAETVGTKRGESDLFFYGKALFDAREYLRAASILEACTSKL
                     GRFLRWYSLFLHGEKRKEEMLLEVSPAGCAAPCKPQNTLAASIVQEMDKAVQSDASLP
                     EDAYICWLRGTALKACGCRKEALCAFIEALQRKPHLWAAWTALHELGEDYSSIISALR
                     TLLETGKAWMFAFFLVMQSGTFSGETSIIPVLQALSSEFPDSVTLLHLLAHAHFSAHD
                     FETAAELCRRLRELDPYFLDAVDLYSNILFVQEDQATLSTLARDCVQIDKYRAETCCV
                     VGNYFALRQNHEKAVQYFRRALTLNRSYTTAWILMGHEFLEMRNTSAAVEAYRRAIDL
                     DPADFRPYYGLGQTYELLHMPHYALYYFEKAATLRPCDDRMWAAVSQALQDIGRLDDA
                     VRCLEKALTWNPDNWSYAKRAGDLFWETGQYDSAAKHYATYLEIRRALRAPHATIDTD
                     EADVVVRMMTYLRQRGELKLANEYLEYMTAVESAEKRETMRKLACDASDPAL"
     gene            <479112..>480413
                     /locus_tag="CYME_CML191C"
                     /db_xref="GeneID:16994633"
     mRNA            <479112..>480413
                     /locus_tag="CYME_CML191C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536769.1"
                     /db_xref="GeneID:16994633"
     CDS             479112..480413
                     /locus_tag="CYME_CML191C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536826.1"
                     /db_xref="GeneID:16994633"
                     /translation="MEDMGSFLTVDEACRAVSGPRSFLKRLRTILSAEVALLKALVKS
                     PFEKRLVSLRDGAFINTLVLNEHQTEKPVLVLAHGWGSGLGFFAKNLDALAGAYRIYC
                     FDWIGSGGSSRPKFDTSMNVAESEDFFLRRFDEWTKRVGLENEKFILAGHSLGGYLAA
                     VYALQHPERLRGLALISPFGVPDGKESQKRSTTTVSSHPTGAQAPRLTMIATASEATP
                     NNLQSEPANDSHPTASADRLPTKYRVLRGVLRTFWKLNVTPQRILRWTSTASTSWSHD
                     LISKYISRRFASSITSVRERQLLADYLYAISVAPGSAEYAIKTLMHPGAWARAPLMDR
                     LTALSPTVPVVFLYGANDWMDPDAARTLIDKARELGNGNMCLQIVPNAGHYLFIDNPQ
                     KFNEIFLQALSRQILGSAVVCADVTNTQRSISSSVLNSSKA"
     gene            complement(<480323..>485791)
                     /locus_tag="CYME_CML192C"
                     /db_xref="GeneID:16994636"
     mRNA            complement(<480323..>485791)
                     /locus_tag="CYME_CML192C"
                     /product="U5 small nuclear ribonucleoprotein 200 kDa
                     helicase"
                     /transcript_id="XM_005536770.1"
                     /db_xref="GeneID:16994636"
     CDS             complement(480323..485791)
                     /locus_tag="CYME_CML192C"
                     /codon_start=1
                     /product="U5 small nuclear ribonucleoprotein 200 kDa
                     helicase"
                     /protein_id="XP_005536827.1"
                     /db_xref="GeneID:16994636"
                     /translation="MPQEPELASIEVSPPTPGESSHFMEAILQDTPEYRVICAAAVRR
                     KAALPVVSADLFSGTCSEQSAARSALGQVGDASEWSEMIIQRPETTESALLNDRSFAV
                     DDLAGYMKPAFQHIASLNPVQSSVLARALRMHGNVLVCAPTGSGKTDIAVALILRTLF
                     EECGGELQEFKCVYIAPMRALVGELQRSLSARLRTYGILVTECTGEQRLSHRDLWRSH
                     ILVTTPEKWDVLTRRANERPLLRFLKIVIIDEIHVLDDPKRGPVLERCVARLHHETAL
                     FGYRVRLVGLSATLPNYDDVAVFIRARLHEGVFVFSERERPCPLELRLVALRHRVGLL
                     SKTRFDQLMNHALWFQVKKFAVQQMEQVLVFVHERADTLKTAHWLLNAADGENAPILQ
                     RRETEWLSPSIREHFKNFGEILATVKKGIGVHHAGLPREIRHLMEQLFLQGSLRIMIS
                     TATLAWGVNLPANVVVIKGTQYYDSEEGQTVQLAPLHVLQMLGRAGRYPFHQRGVGVI
                     ITTEPEAPLYAAVVAHKAPIESHLIPQLADSLLAEVAGGSLSTVEEAAEWLKYTFLFV
                     RMLRNPSLEWMPHFASKRPADGEDVSLWGVRLRLCHSVAKELARNELLRYGENLEMTV
                     TARGNVASAFMLPYDTLRTIEAYLHPTGALPELIHLLAVASPALRNLSLPRESESREL
                     RRFSWRLLIPLWDPDRDLKISALLQAAVLPTGLSSSPALSQDCSSILEESQRMLRAVH
                     ALSATLGMAVPMRLSLLLAKKLEHQQTRILQGALRGGSSNDQSGSTSSGMQPRKTHNS
                     KGQPEQHSETEALRCFSPSVGDWMPPAVLCSALGRQQCAVRSWIAFESALLPVSADTL
                     RFECRIALQDSSCIDSTEALWVSLEDATGERAFFAARLVLREAKYHLVGCCSVPPWQR
                     TSVAFWRIAAEEHLVDDFLQAECLRDLPWPVDDNRIAPEIGRFVFHDFSRLAAACETL
                     IPGYLKMVMDCAPGQRPGVLFAIPFRPERIRCLAACLTVAREKRLVCYVSPHRSHREV
                     FRQLVQSCKLRCAELSIDPQWHRKLSCADDDEHEARFLIGDPKHFASLVHSMQSEQLR
                     VQAPLWLLDDLESVSWDPSYEFLLMNLARAEQVLFSEHFQNVDQVLRWLGLDPSRMLQ
                     FEWQPPGEASPLITTADEALLNRPRLVAKRFWRAFRRIAPPRGPQFVAVCAVMRDALL
                     LGAELARQSPYRSECPARLAASLTAAERALLERGIWLPTRSTSYETGAPPGHTNVRVV
                     VIEIGELLLLPSDGNEYAFAFMVGNGFAQASSRPRENLFRWSCRYFARICRGPVSVLV
                     PPHLEGLMQLPANWPPVIDSVADLFWELFIVHQVARGTLQTAEQVAELMSRTLYRYRY
                     LQHTAARPLCEVISLGSELDRIALMTRLVTEKLISECNLLRIRNDGRFDCRDVVAPRL
                     AFCFGIEVQTARTILDRFSGRVITRSALLDMFAETLVSELGPGWLPRDLASSDEAGRP
                     HSLWPIRGPKARPKKVQPVLFVRTLLIWLLRSPPTSQFCWRRLLEELSGAWERLLPAL
                     VFTGLARLCWSAFRQFHKITRTLSFELMVSGSPLRSREQSHLTKPADDLDDAVGEEPD
                     GRIAQIEHHMGAEYRERCTSYLHQMDHEQHEQHEQHEQHERQADLGNEPHRIERRARG
                     RHLQAKLAAAAGMVDSGGSIQSRNDACFHLHPRQGGSLRVQQAIQQGTRRKRVIDVHC
                     IDIALGQRTEKPVDEHMYRKRHAWLVVRDAGSDTVVYANRVFYRFGLQRFCLKIPEVA
                     ACKPTKLSVHAFDEFSTDEEMERCVLVTSAQTTADPSI"
     gene            <486685..>487500
                     /locus_tag="CYME_CML193C"
                     /db_xref="GeneID:16994637"
     mRNA            <486685..>487500
                     /locus_tag="CYME_CML193C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536771.1"
                     /db_xref="GeneID:16994637"
     CDS             486685..487500
                     /locus_tag="CYME_CML193C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536828.1"
                     /db_xref="GeneID:16994637"
                     /translation="MVHVSDQVVYLMETTGLPLSVICFLGHLFVFHLGCFLFEVMDQS
                     GWLLDYKEFRGDQRRYWALLPQVCFNQFFILLPSMYLCEKLGVAFDSIDSRQQQLRQT
                     IWHYLFYAVWMTIGHDIFFYLGHRFLLHSSWGYQLLQHDLHHSTKASIALSSMYMAPS
                     DYVLEICVPYLVPLCMLKADAAFHFVAIALGSLGGMYEHSGYNFCPYFPGLSTMAHGM
                     HHTRYNCSFSDGVGSSNLMDGLFRTSYECVYPKWSGKKSIRESKDAQCTYGLN"
     gene            <490187..>492034
                     /locus_tag="CYME_CML194C"
                     /db_xref="GeneID:16994629"
     mRNA            <490187..>492034
                     /locus_tag="CYME_CML194C"
                     /product="phosphoribosylaminoimidazolecarboxamide
                     formyltransferase / IMP cyclohydrolase"
                     /transcript_id="XM_005536772.1"
                     /db_xref="GeneID:16994629"
     CDS             490187..492034
                     /locus_tag="CYME_CML194C"
                     /codon_start=1
                     /product="phosphoribosylaminoimidazolecarboxamide
                     formyltransferase / IMP cyclohydrolase"
                     /protein_id="XP_005536829.1"
                     /db_xref="GeneID:16994629"
                     /translation="MRHDAGLALPFVTTVNHLFAADHTAPKLRSGLACARLSGPADHR
                     RRRCSLSPRAARTRAPSFGRHASMDLGQPSDTKTEDSLGKDKAEKGLQKIRRALVSVS
                     DKASLREFAQFLVGHNVEIISTGGTAEKLRGYDVPVIDVSEYTSFPEILDGRVKTLVP
                     KIHGGILGVRGNASHEEAMKLHSIEYIDLVVVNLYPFEETVRNDGSYEACIENIDIGG
                     PTLIRAAAKNHASVTVVTDVHQYSDVMADMNDHDGCTTLSLRKRLAAVAFSLCASYDS
                     SIAAWFMEGLGKPFPDRITISGRLKQRLRYGENPHQPAAFYMDMRGTICPGVATAEQV
                     QGKELSYNNILDTDAAFRLVSEFTEPACAIIKHSNPCGCATGVSTEDAYLRALACDPI
                     SAFGGIVALNRKIDKAVAEQITKAFTEVVIAPDASAEALEVLSEKKATRVLLTGAMPD
                     PRAQLQSFRSVMGGFLVQALDTKMVTTEELKIVTKRTPTENEMRDLLFAWKVCKHVKS
                     NAIVYARDGATVGIGAGQMSRVDASRIAAWKAQEASRQAEEDTSRTAGSVVASDAFFP
                     FVDGLVAAADAGATAVIQPGGSKRDAEVIAAADERGIAMVFTGIRHFLH"
     gene            complement(<493264..>493803)
                     /locus_tag="CYME_CML195C"
                     /db_xref="GeneID:16994631"
     mRNA            complement(<493264..>493803)
                     /locus_tag="CYME_CML195C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536773.1"
                     /db_xref="GeneID:16994631"
     CDS             complement(493264..493803)
                     /locus_tag="CYME_CML195C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536830.1"
                     /db_xref="GeneID:16994631"
                     /translation="MDRRFVFWPSMHTAEMLTVKNRTQGARVKAMPFLVQRVRLLTPM
                     LPCQEQGYLSVNQMLERRPCDPSLRVPISSRQGPTTAPLLECIQRSRHAARLCAMPLA
                     SATCAGLVQTVPGTLSKMMRCSNVPRILATALATYLKRYQDDRQSLMPFPALPSDHDS
                     GSLQKNLLETPFVSASYRR"
     gene            complement(<494140..>494688)
                     /locus_tag="CYME_CML196C"
                     /db_xref="GeneID:16994632"
     mRNA            complement(<494140..>494688)
                     /locus_tag="CYME_CML196C"
                     /product="60S ribosomal protein L11"
                     /transcript_id="XM_005536774.1"
                     /db_xref="GeneID:16994632"
     CDS             complement(494140..494688)
                     /locus_tag="CYME_CML196C"
                     /codon_start=1
                     /product="60S ribosomal protein L11"
                     /protein_id="XP_005536831.1"
                     /db_xref="GeneID:16994632"
                     /translation="MVNPKKLENPMRELRVDKLVINCCVGSSGDPLTKACRVLQQLTA
                     TEENPDGQAVVTSRARLTIRQFGIRRGERISAHVTIRGQKALDLLERGLRVREYELHE
                     SNFSDTGCFGFGIQEHIDLGLKYDPATGIFGMDFVVVLKRRGARVARRRRCRSTVGPL
                     QRVSKEDAIRFFQAQYDGIVHR"
     gene            complement(<496958..>499285)
                     /locus_tag="CYME_CML197C"
                     /db_xref="GeneID:16994638"
     mRNA            complement(<496958..>499285)
                     /locus_tag="CYME_CML197C"
                     /product="probable long-chain fatty acid coenzyme A
                     ligase"
                     /transcript_id="XM_005536775.1"
                     /db_xref="GeneID:16994638"
     CDS             complement(496958..499285)
                     /locus_tag="CYME_CML197C"
                     /codon_start=1
                     /product="probable long-chain fatty acid coenzyme A
                     ligase"
                     /protein_id="XP_005536832.1"
                     /db_xref="GeneID:16994638"
                     /translation="MVMKHFRTSDVPSDSGYAFVTPAASPTPGPAPMRSLSSNLHLGV
                     QGNCEQHGNDTLASLWLQPRAQNTFQTPQGSASRSYNMAHRVTRERTLGKVEDSKKPN
                     NAAPFLAGIFTQNPEGSPSDSFLSPGLQGEQPPQLALTQEETRTKTLLNLFFDNAHGI
                     RRNCADSAALASKEGDGWVSISWKEYGRLVCQIANGLRQCGFEAGDHAAILGSNSPRW
                     LIADLAVMCLAGCTTGLYPNDLAEQVAFVCENFRAKVVFVDSEMQYAKLLDTAEMLGE
                     LQLVVLMNDTTREVSPRCGRKPHWKNISWSELLKKGRRHFESAATNIERQARAILPSA
                     ICMTVYTSGTTGKPKGACYRHRNLYFIAEEISRCVGSNGGDITLSFLPLCHIAERIQG
                     ELLAIYDANAVYFAESFATVKNNLAEVRPTLFLCVPRVWEKFASALKQRFASEALLRR
                     AVISQALRNGASIGECRNSIRGQRPAIWTTVQWRLYQKHIIGKILTLLGLDRCHTFAS
                     GAAPLNPEISRFFRSIGIDIAELYGQSESTGVIALTPKGAIKPGTAGLPLRGIQVVLG
                     ADGEILAKGDNVFAGYYNDARGTAQVIDNAGFLHTGDVGSFDEDGYLVVTDRLKDLIK
                     TSGGKFIAPQPTEARLKTFDGIAQVVVIGDGKPYCTALITLDEGALPALTSKIGIEST
                     ESRPDILSRDKRIIDVIQHYIDEVNATLPSYATIKYFRILPTELTVEGGELTPTLKVK
                     RRVVQEKYAHVIDEMYVSGERATAKASGNALRVAP"
     gene            <500925..>502268
                     /locus_tag="CYME_CML198C"
                     /db_xref="GeneID:16994639"
     mRNA            <500925..>502268
                     /locus_tag="CYME_CML198C"
                     /product="ribosomal large subunit pseudouridine synthase
                     C"
                     /transcript_id="XM_005536776.1"
                     /db_xref="GeneID:16994639"
     CDS             500925..502268
                     /locus_tag="CYME_CML198C"
                     /codon_start=1
                     /product="ribosomal large subunit pseudouridine synthase
                     C"
                     /protein_id="XP_005536833.1"
                     /db_xref="GeneID:16994639"
                     /translation="MRVVLHQAGRTKVNVHSAARHWKRSYRSRPGAGHWGNSIDRKKL
                     FSEQNRRSSNQCMSLAGDLPRVQAYTSSKLWRATYTVVLSAERDASASAAKLAAFSNA
                     CSDSTLLKLDCLDASETYLADEPELRRAVEVERGQRATTLESYYTKHWEWSGAKHLHV
                     AEGPEFSTQRDGLPCAHAASLPADWQVQPPRKLFEDDEFIAYSKPAGVLSSTVLYMAM
                     MSESPEHRQSAQAWRLANRLDRDTSGILLFGKTPLANQVCNALTTRRSGSLEKLYIAN
                     LHQVQWKHMQHDDQMPPMFQVGCVLRVISGHGTTRRGLHRLYPLECVGQRLHDRMRRP
                     VRIAETWFRIENRTPLKSENSLVGDLEAHPAMLYRVLCAPVTGRTHQIRLHAHALGMP
                     VHGDVRYGSLSDLQGTNCHHLHAVALAFTTSEGRKIYIEAESPAWLDFSGEVEHP"
     misc_feature    505148..507697
                     /note="repetitive element"
     gene            <508436..>509071
                     /locus_tag="CYME_CML200C"
                     /db_xref="GeneID:16994640"
     mRNA            <508436..>509071
                     /locus_tag="CYME_CML200C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536777.1"
                     /db_xref="GeneID:16994640"
     CDS             508436..509071
                     /locus_tag="CYME_CML200C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536834.1"
                     /db_xref="GeneID:16994640"
                     /translation="MSRDNQGLQPQSHSTAFCVFAPWPRNRSAAGTQRDLRVGCQRWP
                     RFSAGGVSISAEHAQRERTLRSLKMADIGRKGPGKIGGKPAEFAPGTGAGAPGGDESG
                     EREREGGGVAVITKTKPAVREKEKTAKEPMWRVLLHNDNIHTFDYVTHTLVKVVKTLT
                     RYKAHRITVHAHKAGVATVTTTWKQLAEEYCQGLQREGLTSSIMPDHSGTQ"
     gene            complement(<509085..>509357)
                     /locus_tag="CYME_CML201C"
                     /db_xref="GeneID:16994626"
     mRNA            complement(<509085..>509357)
                     /locus_tag="CYME_CML201C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536778.1"
                     /db_xref="GeneID:16994626"
     CDS             complement(509085..509357)
                     /locus_tag="CYME_CML201C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536835.1"
                     /db_xref="GeneID:16994626"
                     /translation="MRLLRHEALSLYRESLRTCKAFTWQHPSGKAWREILAETLRKEF
                     EAGRLETQPDRILELLVNGREALRKTQELLVQKQRELQKRQSLSSN"
     gene            <509989..>510573
                     /locus_tag="CYME_CML202C"
                     /db_xref="GeneID:16994624"
     mRNA            <509989..>510573
                     /locus_tag="CYME_CML202C"
                     /product="similar to SR family splicing factor SC35"
                     /transcript_id="XM_005536779.1"
                     /db_xref="GeneID:16994624"
     CDS             509989..510573
                     /locus_tag="CYME_CML202C"
                     /codon_start=1
                     /product="similar to SR family splicing factor SC35"
                     /protein_id="XP_005536836.1"
                     /db_xref="GeneID:16994624"
                     /translation="MSGNEALSSAPPSSTGDGAHGGDSLSHTAKDSPSGATLIGETTE
                     QGAAKPKSSRPFPNRPSESELQNSVGLMVRNIPFGTRQEDLLELFRPYGDVIDIFIPW
                     DRQLRRIRGFAFVRLQTLEQAEAAIAALDGSTMRERIIAVKRAEYERGEGPVSQHAGA
                     SDGRRGQSRRPRRSDGRSTRRRRPRSRSFEGGNT"
     gene            complement(<512542..>513720)
                     /locus_tag="CYME_CML203C"
                     /db_xref="GeneID:16994625"
     mRNA            complement(<512542..>513720)
                     /locus_tag="CYME_CML203C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536780.1"
                     /db_xref="GeneID:16994625"
     CDS             complement(512542..513720)
                     /locus_tag="CYME_CML203C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536837.1"
                     /db_xref="GeneID:16994625"
                     /translation="MSSQSEEQLDQRRLSQQAQKPFRTSHRAPAGDFPQSTRLQLIPS
                     TPQARPDMQRGAEPLQRSSPVKTLHPSERQVQSLSLTDTAVPGTVSHAGQEKLHLEAS
                     SAQRAAPGGACTVAYGAEPADRARSESCVQPYGQAAGRAALETTVANAALCVSRGIGP
                     LCAFAVNEAMDYSKKALEIKNIEREVELCCSEIQKAVEDAVLLVRNSFHSQLIRMPRK
                     LRATRLCALFTAEELQTIGYVLEGTDRGSTVETCVTQPTASQSSSSGTRKHAKQSSRA
                     ARALRIAAPGTTSLSSRRRAVQASAVTEATRHTDSEHGESQGAAVSAPQAPAELETAL
                     RHMLEQLLAKQKQVIGDGADHVPNLLLDMLREKVFRDAERAEQVSPRWTPDLASAPAR
                     "
     gene            <513489..>514514
                     /locus_tag="CYME_CML204C"
                     /db_xref="GeneID:16994621"
     mRNA            <513489..>514514
                     /locus_tag="CYME_CML204C"
                     /product="prephenate dehydratase PDT"
                     /transcript_id="XM_005536781.1"
                     /db_xref="GeneID:16994621"
     CDS             513489..514514
                     /locus_tag="CYME_CML204C"
                     /codon_start=1
                     /product="prephenate dehydratase PDT"
                     /protein_id="XP_005536838.1"
                     /db_xref="GeneID:16994621"
                     /translation="MIELVVHSDGVSSPDWNAGEVPLRVAYQGEPGAYSESAAIEYFG
                     ENLQLVPCETFEKVFELVEKDGADRAVLPIENSLAGTIHRNYDLLLQHQLHIVGEVDF
                     CVRHYLLALEGVELKDVRVVQSHPMALAQCEKFLSENGLTREVALDTAGSARLLRDKG
                     YRDRAAIAGARAAQIYALNILREDIEDEPENFTRFLILARTPCAAPPLGVPAKTSIAF
                     SLINTPGALFKALSVFALRDIDLTKIESRHLRSLRHLRSRESAQLRASSTNGRSDTLA
                     SIASRGVSDNADVENVPDRRRWEYLFYLDISASLADTKTNNALNHLAEITTFIRVLGS
                     YRRHLAE"
     gene            <515630..>517705
                     /locus_tag="CYME_CML205C"
                     /db_xref="GeneID:16994622"
     mRNA            <515630..>517705
                     /locus_tag="CYME_CML205C"
                     /product="dnaK-type molecular chaperone, mitochondrial
                     precursor"
                     /transcript_id="XM_005536782.1"
                     /db_xref="GeneID:16994622"
     CDS             515630..517705
                     /locus_tag="CYME_CML205C"
                     /codon_start=1
                     /product="dnaK-type molecular chaperone, mitochondrial
                     precursor"
                     /protein_id="XP_005536839.1"
                     /db_xref="GeneID:16994622"
                     /translation="MLRFLLRAGARALHRAPALATLKVPEPVVELRQPSLLPQRRLRS
                     TGAVQGDVVGIDLGTTNSCVAIMEGKAPRVIENAEGQRTTPSVVAFTSSGERLVGIAA
                     KRQAVTNPENTIFAAKRLIGRRYEDPEVQRDVKIMPYKIVRADNGDAWVEAQGNRYSP
                     AQIGAFVLQKMKETAESFLGRTVNNAVITVPAYFNDAQRQATKDAGRIAGLNVLRIIN
                     EPTAAALAYGLDKADEGRVVAVYDLGGGTFDVSILEISGGVFEVKATNGDTHLGGEDF
                     DNVLLNHLVSEFKKDQGIDLSRDRLALQRLREAAEKAKVELSSTMQTEINLPFITADA
                     SGPKHMNMKLTRAKFESLVDHLVQRTLEPMKLCLKDAGMSAKDISDVLLVGGMTRVPA
                     VQRLVQDFFGRAPNKSVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGIETLGG
                     VFTKLIPRNSTIPTKKSQVFSTAADNQTQVGIKVLQGERPMAAENKLLGQFDLVGIPP
                     APRGVPQIEVIFDIDANGILHVSAVDKGTGKRNEVVITSSGGLSNEEIEKMIKDAEMH
                     AEEDRRRQAAVEAKNEADSLLYTTERTLSEHRAKLSATDVETVEKAAQDLRAVLEKDA
                     TAADTIREKTKVLQQAAMRIGEAIYRASQASQSTQQAQQSQSETPEAEFKDVNQDSDE
                     KKQQGKGGS"
     misc_feature    complement(515759..518343)
                     /note="pseudo-gene of NAD-specific glutamate
                     dehydrogenase"
     gene            <519608..>520315
                     /locus_tag="CYME_CML207C"
                     /db_xref="GeneID:16994619"
     mRNA            <519608..>520315
                     /locus_tag="CYME_CML207C"
                     /product="retroelement"
                     /transcript_id="XM_005536783.1"
                     /db_xref="GeneID:16994619"
     CDS             519608..520315
                     /locus_tag="CYME_CML207C"
                     /codon_start=1
                     /product="retroelement"
                     /protein_id="XP_005536840.1"
                     /db_xref="GeneID:16994619"
                     /translation="MILVTPEDGTTGTPSIPDELDTSLGKRLLELIQRMFEEAYIPDV
                     WRTAEVVPILKKDSHTYTDMNIYRTMRLIPSIMKLLCAMLTNRIQRRLEERKFFAPEQ
                     AGFRSREECMSHALTLIEVAQRRFISDQQPAYVCFIDFQKALDPVPHEALFLKMQRAG
                     VSGKCLAFFRALYADSWMRIQLGDCSRTPSIRIHRGLRRGDPTSPLLFKIFINDLLNI
                     CRQYGLEVPWIDCGDAR"
     misc_feature    522389..524215
                     /note="repetitive element"
     gene            <524890..>526959
                     /locus_tag="CYME_CML209C"
                     /db_xref="GeneID:16994620"
     mRNA            <524890..>526959
                     /locus_tag="CYME_CML209C"
                     /product="glycerol-3-phosphate dehydrogenase"
                     /transcript_id="XM_005536784.1"
                     /db_xref="GeneID:16994620"
     CDS             524890..526959
                     /locus_tag="CYME_CML209C"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="XP_005536841.1"
                     /db_xref="GeneID:16994620"
                     /translation="MMPCVRMRRSFSKIALCSAAAFVSSATVLLLGGYDSRWYTPLVA
                     RAHSASVASVDHGPLPVLETPPRRHAQLRVLKESGMRYESVQKRKAEAGGDGSSKEAM
                     SAVVPSALPEDGLFDILVVGGGATGSGVALDATLRGLRVALVERNDFASGTSSRSTKL
                     IHGGVRYLEKAFFRADPAQLKLVFEALHERAIMLRQAPHLTQPLPTILPCYKWWEIPF
                     YWAGLKAYDFLAIAGNGALYMSKFLSAAEARRQFPTLSARRGRDGATLKGSIVYYDGQ
                     MDDARFNVTLAVTAALHGAVIANHTEVSGLIKDASTGKVIGATVRDRFTGEEFPVYAR
                     VIVNATGPFADRIRAMDEGPEALGPQRMIVPSSGVHVTLPSYYSPEGMGLIVPKTRDG
                     RVVFMLPWLGSTIAGTTDSSTEITDMPRPHEAEIEFILDALRDYLNVEVRRKDVQSAW
                     SGIRPLAIDPKAKDTQNILREHTVHVSGSGLLTIAGGKWTTYRKMAQDTVDTAIKVAM
                     LESRVKHKCLTEKVILTGGHTYDPSYFAFLTQHYERVKYSVSKGAKLQTTTLDVDIAQ
                     HLARAYGDQAYKICDIASREDAGYGKRIAHGYPYIEAEVVYAAENEYCETAQDFLARR
                     SRLAFLNARAAKEALPRIAEILAEIHGWSRTRLQTEMKEAMEFLETFESGRTTGEVGE
                     QVEAVAA"
     gene            <530274..>531413
                     /locus_tag="CYME_CML210C"
                     /db_xref="GeneID:16994606"
     mRNA            <530274..>531413
                     /locus_tag="CYME_CML210C"
                     /product="biotin synthetase"
                     /transcript_id="XM_005536785.1"
                     /db_xref="GeneID:16994606"
     CDS             530274..531413
                     /locus_tag="CYME_CML210C"
                     /codon_start=1
                     /product="biotin synthetase"
                     /protein_id="XP_005536842.1"
                     /db_xref="GeneID:16994606"
                     /translation="MQPKGLLRIYRKFCTTVTSPVGSTASTVPNWEKVVTDALDPHVQ
                     VRSDWSRRDVEETYWQPLHQLIFQAAAVHRVAFKANQVQKCTLLSIKTGGCPETCKYC
                     SQSAAYKTDVKAEPLMQVEEVLREARLAKERGSTRFCMGAAWRGPAQVGPRQFQRVLD
                     MVQGVRALGLEVCATLGLLNAEQAKALKEAGLTAYNHNLDTSREFYSTIISSRSFEDR
                     LATIRHVRAAGIQVCCGGILGLGESHADRISLLQTLATMQPHPESVPVNMLVPSKGTP
                     LESSQPIPFWDLCRMIATARILMPASMVRLSAGRISLSEAEQMICFMAGANSIFTGEK
                     LLTTPNNDLTEDDAMFRRLGFEGKPPFVETRRIPSSAKPQISLSQ"
     gene            complement(<531815..>533587)
                     /locus_tag="CYME_CML211C"
                     /db_xref="GeneID:16994615"
     mRNA            complement(<531815..>533587)
                     /locus_tag="CYME_CML211C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536786.1"
                     /db_xref="GeneID:16994615"
     CDS             complement(531815..533587)
                     /locus_tag="CYME_CML211C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536843.1"
                     /db_xref="GeneID:16994615"
                     /translation="MENDNRSQAQKEPDNAAAAAAAGTSTHRARKRKQRRGGQESSER
                     GQSTGPSRQRQRGSFTSVVGFLAVVWLLREARRWDRNRRERRRSEAVSDDQASANVSS
                     ASQDVSAAYPSDSSELLATSSESLSGSAGQPRPSWRETIALQSDALVGERRPSVPESD
                     ASTAGKELVPETFPERSTGLQVDASGSALRHSAAVENESQDTGFGSQGKEETWESTSK
                     SRLVSVIESEQQSISLLRQGDGDASVTLTEVEQRSMALEWTKHGTSDSLDESTRASNL
                     LSASLFSSSAWQEPPAANVSAGRDAALEASRERVIVTNEFNEPLRVVTRAEMRRENLW
                     HRATYVLVLNPERDRIYIQKRTPTKDIHPGMYDAAAGGVVQAGESYEESARRELAEEL
                     GLDLALEPVGPIRYESDLTRVFGQVYVAIFDPFEEPRQRIRPQAEEVEFVELVSIDDV
                     MSQSGGRIFTEDTLIALRTFIEKQEANNSSKMIAAASETSESRLPANAESTVRQEVND
                     GESVHSSENRTWSSSPDPSGNVTSASTTESPHASVGDTANPLRLPDISVNRSTSPPIE
                     SFINDLDSTTFEESALRQRMASHQ"
     misc_feature    533732..535101
                     /note="possible transcribed region"
     gene            <534936..>537191
                     /locus_tag="CYME_CML213C"
                     /db_xref="GeneID:16994634"
     mRNA            <534936..>537191
                     /locus_tag="CYME_CML213C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536787.1"
                     /db_xref="GeneID:16994634"
     CDS             534936..537191
                     /locus_tag="CYME_CML213C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536844.1"
                     /db_xref="GeneID:16994634"
                     /translation="MVKLPTLRRSIRDQVRRLRSLQRSESVCDANRLKALESFMDAVE
                     AADVEMLFRKGDWDMVIFALNDIIWNAPLEVAARGASVLSRTNRRLLAVHGALHEQPP
                     GRALTTPILVAERSERLTRLAAFARTRVLTLPVLIRRLFRAVLDAPAANSEACTLLQN
                     AVFSCLSTNCGTQDAQHSQISLSSRLSQLIYSLVCFAYEVDQASLDVLLDHVCAIWRS
                     VATEPSGWNAPLPWMLEAPSSITDAFWASSAPCLERQCDMATASVHAVLAALLSDMKL
                     AADAQRRLLYRIHSMIQELRAARDSFHVAPVSSIPYASEWFFEALTTRLVDEPQLVCL
                     ILSKLCGFEDDNPDTSAMLLVSQTQMRCLVRTITLRHLLRQAEACEAAARILLLLLSS
                     SVVVKNLEACDFALCIFVACLMLSDARNYPGVHQSRSVAATNGLEDRTTVQGENWRHQ
                     YGDLLLSALVSVFGDTQLRPVLLFNMLHYRCSKAMIRFLGTGGEINIRDAFAVSVLRD
                     EQHIAAQVQAALGQTRERLESLFAEEPVPEYNEAFPQIRSALHAAASAVEQGVRSACT
                     ASAIMKQGEAGAGCVSISSVSEATRPSMASWAWTAALSVYAREYQDAAPHFADASHAS
                     DFSCSPADVYAALNTLHGLLAEEIVIEARKATDAAWRYERLRIQKAAELEILRKLLDE
                     ADAAKRELEQSTQCPVCFERLHAPSALVPCGHVLCKSCFVTLTTTLEEHLCPTCRQVF
                     DPISALRIHLN"
     gene            complement(<537360..>538472)
                     /locus_tag="CYME_CML214C"
                     /db_xref="GeneID:16994635"
     mRNA            complement(<537360..>538472)
                     /locus_tag="CYME_CML214C"
                     /product="ornithine carbamoyltransferase"
                     /transcript_id="XM_005536788.1"
                     /db_xref="GeneID:16994635"
     CDS             complement(537360..538472)
                     /locus_tag="CYME_CML214C"
                     /codon_start=1
                     /product="ornithine carbamoyltransferase"
                     /protein_id="XP_005536845.1"
                     /db_xref="GeneID:16994635"
                     /translation="MTVLGFITTSALLSTQSFPHKCLVVPVGYRTRRQILTPRGAQRV
                     SRASSLSLACRDTKGTVHALPGGKRHFLAITDWIPEEIMSTLQLARDLKEGKVFSGAK
                     PLAGLTLAMIFAKPSARTRISFETGFYRLGGHALLLGDEIGIGKREATKDIARVVSRF
                     NDIIMARLYAHEDLLELAAYASVPVINGLTDWNHPCQIMADALTIMECRGSLENQRVV
                     YIGDGNNIVHSWLEMACCIPFEFICCCPPGFEPNADLVRRARAAGRSRVEIIHDPQIA
                     VLGANVIYTDVWASMGQKDQIAERERAFAGYQISMELLEATGVSDTIFMHCLPAERGR
                     EVTDQVMECAQSVVFQQAENRMHAQNAIMLRCLGVV"
     gene            540918..542789
                     /locus_tag="CYME_CML215T"
                     /db_xref="GeneID:16994630"
     misc_RNA        540918..542789
                     /locus_tag="CYME_CML215T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461420.1"
                     /db_xref="GeneID:16994630"
     gene            543110..546340
                     /locus_tag="CYME_CML216T"
                     /db_xref="GeneID:16994643"
     misc_RNA        543110..546340
                     /locus_tag="CYME_CML216T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461421.1"
                     /db_xref="GeneID:16994643"
     gene            complement(<545967..>549023)
                     /locus_tag="CYME_CML217C"
                     /db_xref="GeneID:16994644"
     mRNA            complement(<545967..>549023)
                     /locus_tag="CYME_CML217C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536789.1"
                     /db_xref="GeneID:16994644"
     CDS             complement(545967..549023)
                     /locus_tag="CYME_CML217C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536846.1"
                     /db_xref="GeneID:16994644"
                     /translation="MQRGLGSTATLLRARELGIRAHFEPSPSGRYCEPLWPVRATHPG
                     TTEAAVGASRAFLYRLALCSVWDGHTGCVNALCWNDSGTLCLSGSDDTRIALWNLNYQ
                     HLNEDGELWLPNARSTTRRGPLEPNDYERYLAAEDEPRAAPGVSPERWRQRPLLTFQT
                     GHSANIFDVRFVPFTGDRVIVSCAGDHEIRVCDLERRCIRTVCCHTGRVKKLAVDPQN
                     PQVILSCSEDGTVRQFDLREAHRHRCRPTLRHSRDTRRCQNILLDVNEIDWRRIHASF
                     QEQAFDSEHERTYRLRQLSPQRNLLITEPSIELYSLKLHPLDSNRFVVAGTNEFVQLY
                     DRRMLSQLRGPVRVYAPLERRTVAEQHRQEREAYRQVLLERERRAARVRRRNLRRLVN
                     PAGHVYEDTDPDDAGGGLVDTEPILGRLGRMLLQEMYESVSITGVAFSRDGSQLLASY
                     AHDAIYLFDTEPKKGSFLCGGGGGGGGSGGDYEAPSERPAETIVDAMDQRSSRVELHQ
                     QQQQQPIVASNAPLFADDSSERTSIPHDLQSEGVSRPITRRRAHSLRIQTQASHSDRV
                     IQADSMSAQAHTASQPQPMTSTTLSEHSEVSISHAIRPTGSVTGSRSLPPDCIRATAT
                     SGEQAESSLSRLDGATDLGVGPPGRDAVLQVAERNMQSFAGTADEPAGSRPETHSLVS
                     RLSAPPAAMASHPSVRTSVDVSSANRPRVLRRGSSEPQEYEAAESMQVRGQMRSTLAV
                     DGATSPADEELEPPGDWTRVPRWLTTRCSPDGSYVRCFLGHRNAITIKEVNFYGPNDE
                     YVISGSDDGRVYIWDRYTGDLIQVFLADRDVVNCVEKHPYEPYLVTCGIDATIKLWRP
                     EAPMPRRIRDLSRIVHEASTYHRQEGRPRNELRGAWLDMYELFYINLEPIVGVAPQTR
                     PNDPAEQAGSVHSLSEEEEEEDEEEDSANSGSSADEIDASGESDIEASRVRRAASSAP
                     ETRLELEMTARDPLLERLLPARDRQFEQPRHASRFRNTNTDESDAT"
     gene            <549371..>549904
                     /locus_tag="CYME_CML218C"
                     /db_xref="GeneID:16994645"
     mRNA            <549371..>549904
                     /locus_tag="CYME_CML218C"
                     /product="similar to N-terminal acetyltransferase complex
                     ARD1 subunit"
                     /transcript_id="XM_005536790.1"
                     /db_xref="GeneID:16994645"
     CDS             549371..549904
                     /locus_tag="CYME_CML218C"
                     /codon_start=1
                     /product="similar to N-terminal acetyltransferase complex
                     ARD1 subunit"
                     /protein_id="XP_005536847.1"
                     /db_xref="GeneID:16994645"
                     /translation="MTTLRKFVATDLFNFNLINLDRFTETYNLGFYGYYFTRWPWLQR
                     VVVAPDGTLAAYILGKVEGSGRMLHGHISAVTVAPEYRRLGVARALLQFLEQVSEQHA
                     GAFFIDLFVRVSNRTAVDMYQRLGYAIYRTVVGYYADSEDAYDMRKPCPSRDPTGSCL
                     VCARNRRRVRPHELEFD"
     gene            complement(<550173..>551366)
                     /locus_tag="CYME_CML219C"
                     /db_xref="GeneID:16994670"
     mRNA            complement(<550173..>551366)
                     /locus_tag="CYME_CML219C"
                     /product="similar to cyclin E2"
                     /transcript_id="XM_005536791.1"
                     /db_xref="GeneID:16994670"
     CDS             complement(550173..551366)
                     /locus_tag="CYME_CML219C"
                     /codon_start=1
                     /product="similar to cyclin E2"
                     /protein_id="XP_005536848.1"
                     /db_xref="GeneID:16994670"
                     /translation="MLVETKGSEWDDAGLVFFERERRVRFLYANVAERFCFPQQYAFY
                     RGQVVEWMLDAGEVLRLERSTVHSAVSCFDEYFARNKGVSCNVWQLLASACILVAAKC
                     EETESDPAVLHKLHALNAGFYSKSAIVRMEQELLRILEWDVVRVSAIPFIYYFMEIDM
                     TSTMDTPMHDGWVCLSGKQGSEPARSKGVSTQADRRQGRSPLAYALLAESLRFADIAL
                     RASSIALSYRPSVVAAASILCASHQLPGSIEAGLRLGQFLSDAASDVQACLAGIEDLC
                     QHQVSRRPILSSVKSSQSPRSVMELAAYLERTAASQENISGDAHEDSYLLSSESLFFD
                     RTFYPSGAPKKRPRLCMPPPVVPFRGGGDGDHETSGLGLSSSSSALVPEEVDVMCSEE
                     LDDAL"
     misc_feature    553087..554874
                     /note="repetitive element"
     gene            <556176..>556733
                     /locus_tag="CYME_CML221C"
                     /db_xref="GeneID:16994664"
     mRNA            <556176..>556733
                     /locus_tag="CYME_CML221C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536792.1"
                     /db_xref="GeneID:16994664"
     CDS             556176..556733
                     /locus_tag="CYME_CML221C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536849.1"
                     /db_xref="GeneID:16994664"
                     /translation="MGLIFHVVVLIAEGISLAFLGFSLLVGIQALTGLAEEFPTSSKR
                     LLRALALLVLLLQVLLLAIDGLPPVPVAVGCLAHYTYYLWTWKDNFVRVRVRQLLLIS
                     TVVLFLVSNVVWAQTLWHFYDPWIYSHRMTSDVASWREGLLARNTFTAAHIMFICVWL
                     LPLSLLLVFGSRERDAENSFARDQS"
     gene            complement(<557102..>558589)
                     /locus_tag="CYME_CML222C"
                     /db_xref="GeneID:16994665"
     mRNA            complement(<557102..>558589)
                     /locus_tag="CYME_CML222C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536793.1"
                     /db_xref="GeneID:16994665"
     CDS             complement(557102..558589)
                     /locus_tag="CYME_CML222C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536850.1"
                     /db_xref="GeneID:16994665"
                     /translation="MELERAMLVLPAEAFQVNLRNHKRLCDRKAEQLRTLLSQLGDAG
                     DSATVASVLEELSKEIDEFRTALESWDRKDQEQISNLRQRLRILLTEAGLDTQMLDLA
                     QESAQTPAFARYQVTDSDAKDTTERAREPAMDSGQCDLSQREVSTDATQHRLLRFLVD
                     FMLRQGYLETARRAIERWGLAPFVDMGVFEAIVPVVVGLRANRATEALQYCAENRRRL
                     SRLGSSLELNLRVQEFIELCRAREVNAAVLYARKHFNGLLASKPDADADPRALEEYAL
                     VKRCVTLLAYPPETSCEPYRRLYDPKRWDTLIEKFLSTHFELNMLPSVPLLDLLIEPG
                     LAALKTRKCKPYTLETNPATRAGRASQGPTSIEGPVGHARHQEVSMSTGDAERGQLAS
                     SAFDEHVSALGDRARLCPTCAYPFNALAKDLPYSSHTHSILLCRVTGKLMDEHNPPIV
                     LPNGNVYSAEAVDLLTEQRPDGRFVRDPATGHEFSRDICRKVFIM"
     gene            <560305..>561681
                     /locus_tag="CYME_CML223C"
                     /db_xref="GeneID:16994663"
     mRNA            <560305..>561681
                     /locus_tag="CYME_CML223C"
                     /product="GDP dissociation inhibitor"
                     /transcript_id="XM_005536794.1"
                     /db_xref="GeneID:16994663"
     CDS             560305..561681
                     /locus_tag="CYME_CML223C"
                     /codon_start=1
                     /product="GDP dissociation inhibitor"
                     /protein_id="XP_005536851.1"
                     /db_xref="GeneID:16994663"
                     /translation="MTSGSNPAEAVESSVLADGTYDVVITGTGLTECILSGLLSKRGF
                     KVLHIDRNPYYGGACASLDLQQMWKKFCLSGSIPEELGSAREYNIDLIPKFILATGKL
                     VRILVYTGATRYLDFKLVDGSFVHTGDRPHRVPSTPMDALRSSLFSLLEKNRCRQFFG
                     FVQSYDPEQVTQRGPDPRTMTMRALYDYFGLQETTRTLIGHAIALYTNDAYLEWPALP
                     TIERIKVYAQSVARYGSSPYIYPMYGLGELPQAFARLSAVHGGVYMLRTDVETILTDT
                     ETGRVCGIRTPDGREARCRFVVGDPSYFPDLVHRVGRIIRCYCILRAAPAHIREASSC
                     QVIVLHRAVAAERRNDIYVLVLNSAHRVAAPDRYIALVSTVMETADAEQEIEAGLAIL
                     GGEANILARFLTVDDVFEPIHDGRECGIFVSRSYDATTHFESTTEDVLDLYRRIVGEE
                     LMFDDKPV"
     gene            complement(<562824..>563678)
                     /locus_tag="CYME_CML224C"
                     /db_xref="GeneID:16994661"
     mRNA            complement(<562824..>563678)
                     /locus_tag="CYME_CML224C"
                     /product="similar to flightless-I protein"
                     /transcript_id="XM_005536795.1"
                     /db_xref="GeneID:16994661"
     CDS             complement(562824..563678)
                     /locus_tag="CYME_CML224C"
                     /codon_start=1
                     /product="similar to flightless-I protein"
                     /protein_id="XP_005536852.1"
                     /db_xref="GeneID:16994661"
                     /translation="MNHAIELQRAGCTKDVVDDRRCLAAETRRKLERSVGDKLGIVDL
                     SGLCLVDVELLEVWREFRCLENEVCPDTPPCPVWYLNLAHNRLQHFPSWLIEEVGETL
                     RVLDLSNNHLASPLDGLELARLPELEVLSLAHNPQVQALPQTLITGLACTHPIRVIDL
                     SYTGLKRIIGLCSMHTSNIRVVKLEYCDLEELPDSIRLWHRLWSLDLRGNARLRQLPL
                     GIQVIAPSLRRLDVEGCEFMEKPLPARVRRALGGKHGVRTLVEWLGVQASSSSPSDAM
                     QRDASSCV"
     gene            <563944..>565245
                     /locus_tag="CYME_CML225C"
                     /db_xref="GeneID:16994662"
     mRNA            <563944..>565245
                     /locus_tag="CYME_CML225C"
                     /product="probable 8-amino-7-oxononanoate synthase"
                     /transcript_id="XM_005536796.1"
                     /db_xref="GeneID:16994662"
     CDS             563944..565245
                     /locus_tag="CYME_CML225C"
                     /codon_start=1
                     /product="probable 8-amino-7-oxononanoate synthase"
                     /protein_id="XP_005536853.1"
                     /db_xref="GeneID:16994662"
                     /translation="MTRQKLLEELELRLQERKRRGLWRALRSPGEAGAQDPAYEFASN
                     DYLSFARSPELEELTAKLVEEARWSGSLRNGSGGSRLLTGDSGFAHAVEKQIAHFHEA
                     EACLLFNSGYDCNLGVFSCIAAAGRDVVLVDERVHASIHDGCRLSRARTVRRFRHNDL
                     TDLRESLSTLRKALGDECWIFVGVESCYSMDGDLLARPGELLDMCGAFGALLIVDEAH
                     SVGVHGPDGRGLLHPYRAHPALLARVVTFGKAFGLHGAAVLGAQPLLQYLLNYARPLI
                     YSTSLPLHSLCAVSAAYRLMATETAAHRRKLLWEAVRMFHSLTRDLRSRCPQLPPPLV
                     NRESPIQAIIIPGNENCVFVANELRQRGFDARPIRYPTVERGAERIRVVLHAHNTPEA
                     INAFVQALIDIVGQLPSAMCDARGTHQSGAPLRPALLNARL"
     misc_feature    complement(566913..568040)
                     /note="possible transcribed region"
     gene            <568574..>570181
                     /locus_tag="CYME_CML226C"
                     /db_xref="GeneID:16994755"
     mRNA            <568574..>570181
                     /locus_tag="CYME_CML226C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536797.1"
                     /db_xref="GeneID:16994755"
     CDS             568574..570181
                     /locus_tag="CYME_CML226C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536854.1"
                     /db_xref="GeneID:16994755"
                     /translation="MFGRQRLLLWAYAHSPSNGKHARGRSESQLCPSSSPEVRAIRSR
                     FLGCSRSAHSWLSTKLVRQRQRWRPGLTELSASSTADASDNSRRPRGSGRLIRRLALI
                     SDVHIFDPEGIGQESVTNFMNLRLLGLLNIWLLRGPERFSERILRAALRDMQEHMHVD
                     HLILAGDITNLSLECEFSRAAGAFAHFAANDPQRITAVPGNHDLYNNFEALRRPTLFS
                     KYFGQYARSDVPRPSYAWNLVNGMSGRSQGLLRRLYGERKMMKQRARLARLGEPLWDG
                     GRLSTAVLEEPTDVDVPQQTTRFTPSDTTPSSTTEQNADNKGGEFPFIQLRGDVLFIG
                     LNTALPGTAQGEVGASQWKLLRTMMDSPLGRKLRDRAQLRVMVLHHPAQDPDVRGLPL
                     IRDIGHDLKDWAEIPPIAKAYNIDLVVHGHNHVPYIGWLKDAPNTLVLEGGSGTLIDL
                     KHPERMARYTVFELDETGRIARIVARVWNHAYYDSICSLLGRPEPLPCDVFRTVEIAI
                     PSHWNLERWDTSRPQPRKRTLFRGLPL"
     gene            complement(<570987..>572360)
                     /locus_tag="CYME_CML227C"
                     /db_xref="GeneID:16994652"
     mRNA            complement(<570987..>572360)
                     /locus_tag="CYME_CML227C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536798.1"
                     /db_xref="GeneID:16994652"
     CDS             complement(570987..572360)
                     /locus_tag="CYME_CML227C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536855.1"
                     /db_xref="GeneID:16994652"
                     /translation="MFLAQKAPGFRMACLQRTQGVQRRARSGRLRRERQSRPAVLTVL
                     SSAASHRILVVGGSGRVGSAVTEHLVKKAYQLGVAPSVRIDLGSRDRERGQAAAQRLR
                     QRLASDVERSAVQDHVQLDWSEYRPETLVEILRPYDLVIHTAGPFQNREEKAGRLLDA
                     CIRAGVAYQDVADDMHHAEWCRKRYASAAKQSKISAWISTGIYPGVSNLMAADLLDQM
                     TDLLGERAAPSKFGIAFSYFTAGSGGAGATILSATYLLLAEPVYTVENGEIRWRPAFS
                     DPQRIDFGPACGGHRTAYLLNLPEVRSAHIVHGVGHVEARFGTAPALWNGLMWCMARY
                     LRPEILRKRMTGITVASLPLVRLVDMLVGARTAVRVDCWYQDVVSGPASRTHFLYVHD
                     RLTDAVGECTAAFSLARLFPDRLGVDVPYESGVWYPEEVFRTRASRRALFGLVQPSAL
                     SWIRTGM"
     gene            <574240..>577278
                     /locus_tag="CYME_CML228C"
                     /db_xref="GeneID:16994653"
     mRNA            <574240..>577278
                     /locus_tag="CYME_CML228C"
                     /product="similar to serine/threonine kinase KIN82"
                     /transcript_id="XM_005536799.1"
                     /db_xref="GeneID:16994653"
     CDS             574240..577278
                     /locus_tag="CYME_CML228C"
                     /codon_start=1
                     /product="similar to serine/threonine kinase KIN82"
                     /protein_id="XP_005536856.1"
                     /db_xref="GeneID:16994653"
                     /translation="MASAAGKNQRAPHSLGRAEVVPVTGTAGRVPVPQPGQDARPPVE
                     HRDSPARYPWVGPASRPAAGGRMAQAAQPPKPNMDLCREALQLRILRSHVALCSGWVE
                     AKKSSEPVPVPTRPLPRDSSGSLSVTSAVSERTPSQGDDEKVDRHKLRREFSSPDLGE
                     FNNLSVEQRSVPHRPLLPEFAHAGSRKLQSARQQGDSGGVAIASVQSSTSDGSQASVD
                     AASHSEQEASPSPAERRPHEFDHTQRDQAITKTSKNETSRQAVSKMGTKPAASTGRGG
                     TPPAPSHREKGAERDKGRVAKTFSKLLIPRKLSLESLAKKMTFGLVRKKPQREPWQLL
                     WAEVRAGLLIFYQCDKAKSRGMPCPYAIVPLLGCTVYSRTVDLCRSEKEQGACAITYQ
                     AGAGVSSSSGTDSSVASECPCRSAYDAVSQYYARAGKSGQSGNDTNDDGPLVLQLEPN
                     SEFLHRSNETSHNPQFRSIRMRFQTVEELFHWHHVLSLYSSHRVVTRADFDLICLLGR
                     GAFGRVALARDLHGSGALVSIKFIDKRMIFSSRDKLRRMVDERLILQAVTGKPYFVRL
                     LYAFETGDSLCMVNDFCEGGDLFHFLSAFAVYRERQYRAREEAGEKIDWDRFRRIRRS
                     LPLPVARFIAAEILAALEFLHRADIVYRDLKPENVLIDNQGHICLTDFGLARVLEAVP
                     AHAGSAATLSGDGDLDAAHHIKPGRHAISDVSSPSSSSSSTSSSTTASPDNSFAAALD
                     GTANDDDDDNAAPEGKHPSSGNGNETAYVRQRASSFCGTKSYISPEMLKTRARLLHGY
                     GFSVDIWAYGVLLYDMLVGRPPFYSSDRERSFALTMTARLSIPDFVDETSADFLMRLL
                     EKNERKRIGCRSAFATDFDEIKRHPFFAGIDWNLVEQRRLPVPQEIMDVLQLGPDAAQ
                     KANVDPSSVEWIVRNFDRRFTESDMDSLIAALNRSFDESSHPLGVGSAVQVSTKQSDP
                     SAARRNRAGSIPGFMFTYEVAATGGAPLSRVRTADSKAAA"
     gene            complement(578688..580236)
                     /locus_tag="CYME_CML229T"
                     /db_xref="GeneID:16994654"
     misc_RNA        complement(578688..580236)
                     /locus_tag="CYME_CML229T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461422.1"
                     /db_xref="GeneID:16994654"
     gene            <581366..>582781
                     /locus_tag="CYME_CML230C"
                     /db_xref="GeneID:16994655"
     mRNA            <581366..>582781
                     /locus_tag="CYME_CML230C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536800.1"
                     /db_xref="GeneID:16994655"
     CDS             581366..582781
                     /locus_tag="CYME_CML230C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536857.1"
                     /db_xref="GeneID:16994655"
                     /translation="MAIGCMEQTRKRRRTGCFHTLGFDWRQALATAFMPPEPRGFSAA
                     ACQRATRWQTVQPRARRRTLSERRLQMLYVSRREFLWQLAAGAATLGFHSVKKPVAPA
                     ASNSAPPAPVNGRLAPLGAIFDTMIGSFLPPRPERLLSRRIRHKGARSVLLVGETHTD
                     RQHHRVQLALLDSFVKHVRGQRNESIAGAPIAIGMEHFYRQHQVHLDRYIAGKIELRQ
                     LLAITRFELTFGYSAQLWQDILEYARENRIQVVGLNTPFELVQLVAHYGLDHLPERLY
                     EVLPRDMDVHGNAAHRERFIQRMKALGVEAHGPLINDEAALQRMYESQVLWDEYMSES
                     AALWLERNPRGHLCIFAGNGHVEGRVGIPDRLTRRSGRPTFTVVPYTVPFQSDGWPDI
                     PHPGNRDVGDWLWYLPVGSGGAESDESDPKSQRQQRFGERFGYRIARSTESDMRLMGR
                     GAARTIQRGTQTKSVDEPDWV"
     gene            complement(<583684..>584631)
                     /locus_tag="CYME_CML231C"
                     /db_xref="GeneID:16994656"
     mRNA            complement(<583684..>584631)
                     /locus_tag="CYME_CML231C"
                     /product="similar to multidrug resistance protein"
                     /transcript_id="XM_005536801.1"
                     /db_xref="GeneID:16994656"
     CDS             complement(583684..584631)
                     /locus_tag="CYME_CML231C"
                     /codon_start=1
                     /product="similar to multidrug resistance protein"
                     /protein_id="XP_005536858.1"
                     /db_xref="GeneID:16994656"
                     /translation="MNLYGGCSTQRAWLSRYLRLPPATTVFSRLIGHAPLQLRDLTQG
                     AAVSGPFQKRVLAGVTAVVLSSAVKGGVGKSTVAVGLASALQQGLGLRCGILDADIYG
                     PSVLHLLRASVTQASRDRNPKTSRPLVPLVTESGLKVFGLAALQKRATEALVWRGPVA
                     TRAVQQLLFDVDWAPLDILVVDTPPGTGDVLLTLAQQLKVQGAILVTTPPQLVEVQVR
                     RGLEALARLSIPVLGIVENMAYVECSRCQHKEEVFGAPEQRAAALAQAASVQVLAHLP
                     LNKTLCEAADQGRMAQDTAVQTMFSDLAVQVATLLGFPV"
     gene            complement(<585689..>593560)
                     /locus_tag="CYME_CML232C"
                     /db_xref="GeneID:16994657"
     mRNA            complement(<585689..>593560)
                     /locus_tag="CYME_CML232C"
                     /product="RIM15-like serine/threonine kinase"
                     /transcript_id="XM_005536802.1"
                     /db_xref="GeneID:16994657"
     CDS             complement(585689..593560)
                     /locus_tag="CYME_CML232C"
                     /codon_start=1
                     /product="RIM15-like serine/threonine kinase"
                     /protein_id="XP_005536859.1"
                     /db_xref="GeneID:16994657"
                     /translation="MRAGANESERAHVDEPVHVPGSECACVDTGAQASDVPVADPVSD
                     AATERQVQSLQSALTAVGVSVPVERPQTTAQLLAERYALDLRRNSGWSSDSSGLEGYL
                     AGAESREDSWMLSNETIKHASSTPVSVDNVAALQAAVEADGFPAATGDVPVFARLQQL
                     ADHDGDGDDDDDDDDEAESTGRARMSDQTTRIERRKASGERRRSEAFAKSQRLLVSDA
                     RCEAPSSDSEPADAHIVSASLPTELRSNQDVMLLRMEPPESTSLAGCDPHRLRYRYSH
                     RRQYRESEHDAHQHHQYHYHHRQEHEKVPQNRWEIPVASAWRRMIGAGGVAATSWSTA
                     GTGWLGPSDQATTPTLQWHQVRLMEGHTQAGRRTTRRLHRTASWASPIGTGAAPATAA
                     ASGGNAYSALLAGALGYFAVSGNVSTIRGRLQAIKKETDHELAQFMAQCEAELQQGQE
                     TPELSKAVRRMMDIASAVLATSADALLAETFVSRGHSTVIAFSGNLHEYVNELQRMRM
                     HVSFVSWTHRSSPVIHLLFTLSRLTRFLEAAAERIEFRAESNSQRGSGTRRTRMSQST
                     GKGFGSEHIDPADAAHASSWSSGTADERFIEPGTQLSTATVAAGRISLKSSLSNHVAE
                     PAAGAQRAVEDSYAAAYYERTEPTSEAQRALEDSNAAARVHEPAPWAKPQPSIAVARD
                     AWTFPPRRCVSSVCLSSMETRPRSPPNLANSDVHLFTSIRPRQHARETGAQGVAQATT
                     MRLGVERDPNRIAVLAPATHLEKSEADTTQLRAEPDDDDDDDKSRHTQRLTEPSSSQT
                     LVHSGSSNAPGLQAAASEATQRSTPAERPSLPAGVLATLLTGKTQAQRGYSSDTVALA
                     ARNEAIHVHPVRAMRALQTTGREGNLSLRVHGPFDVSNLSEKGAPAAENNTNNNNNNN
                     ETNELAKVRTTEADAGGLHRPENTTAKLIQLPAARSQTPVSLQTAMPPSPCSGAEFIS
                     NEDEEAIEKDADAVEENEEVTDPYAYLICRICEEVYPCEIFEEHTKCCAARARAAVLI
                     AACDKQLEKLGRHGARAATSSAFTEAPAGDVSTASVDSAQQALLSRVAKLCLYAAAVE
                     PSESCTRISSFVPADLDDLENQSYEQVRSCLRLRTDSDMASFRPNLEENVARAKLEAV
                     RSRLEHALQACQAATANTTSSTISRWCLALVERAHCLVSQKLEALSMIPAVFEPAIVA
                     ADDGSLESGALTSDLRRARPAEDVSCRTSEDAAADDDHAGAGASAGAVVDDDSARNCD
                     IAAAAAAAATVEPCDHVHWKTRDAADSASPCDAERGLVSEDVHRGGDIRFGNAAKTDT
                     GVAFAEAAHSSDTGSSRRRRRRHHLQDALCEAHGASQSRKQGQHRSDSSSSRLRSSGG
                     AEVSPSRQSLRVGASPHLHPAVPSIRDFDILKPISRGAFGRVYLASKKTTGDLYAIKV
                     FQKSELVRKNLVRRVRAERDILATIQNPFVVRFIWSFESARKLFLVMEFLPGGDLFSL
                     LSNLGYLDEDVARQYVAEIVLALEYLHQAGIVHRDLKPDNILIDRDGHIKLTDFGLSK
                     QGALDLPHSSPASTRASLSPGTDTLWQRALSPAGFVARSAKAPVSGLSAISGATKPRY
                     DTSVGAGAIAGAGTGPQQMHGASGVPSSQLCMDSMSVSVMSGSGSEVRTQRGSSTVPL
                     QRDVDMRLVDTTTSSVQAGTRTAGRQNTLTASDARGQFSAAASTGGSGYAGPFESHTG
                     HLWANGVRGVRSPSPQTLATESQSGSPVGGTTVVAPVEPPLGTPDYLAPELLLGTGHG
                     FAVDWWALGVVLFELLVGIPAFHASSVRGIFSNILSGRIQWPDDVDEAMSAEARDLIQ
                     RLLEPDPSKRLGARGAAEVKAHPFFRDVDFEHVRNQPPAFVPQFAAADDTSYFSSRKA
                     VGSLSPDDESTQKLMRTLSEHGLGDVERAEALPLLVTASKSHVASVPLSLSSSSRMRV
                     PETRTAAIASSEALHASEPRWSDVAAHPEMRQGGQSVHASEPRWSDVAAHLEMRQGGQ
                     KVMMRWCATADCWPRENPTDGDWRSADEGTAACGMHCSTYGKVCSTEPLATSSSACCY
                     GVSRAPAAPGGIREPAPRSSPCAASGALDLGIPALPAVSHDAERPVLSSSSVREQSAI
                     DTTCEHNESVLVAERACRWSDGTALAGVSMEPLSRSGAETMPQRLLHAVNAENSSLSD
                     QIVVSGITTSSQATDSAEGIEDQVRDAPCADGLYRHRPGWSLSYTVPEHELDADKTQR
                     ISADCSIAHTTRTQGQETLSEATSIAGTGDVSTDSDGALGRATQIVAVPDSPHAVGVS
                     GNTGAAASAMPSEPAGTQSETSHPEMDWKQTEVPSWSSSATCSTETGWRRVDMRTLRN
                     RRQRSREQLLQHCLRRRAPTRGWLSETERDPSVSTSADEQNRERSASVCTSPSVLRSS
                     NVRLRGSDATSVAVVAATTPTRNVWNTSDGMLLFEDSSSDSNLCSEGDIENDDDDDDD
                     DDFNNNNNNAVDPFRRATLARSNIGREGSAPVQASAGVSSSERPPEASYSDPNVNLAK
                     SGRRARYKANRPSSSESQCVLTLADPAFSDFSFRNLDSLEAMNLDMARVSRARSATSG
                     RSSSVPSRRHPVASSSDSASQTSRSGL"
     misc_feature    594970..595952
                     /note="repetitive element"
     gene            <596488..>598275
                     /locus_tag="CYME_CML234C"
                     /db_xref="GeneID:16994658"
     mRNA            <596488..>598275
                     /locus_tag="CYME_CML234C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536803.1"
                     /db_xref="GeneID:16994658"
     CDS             596488..598275
                     /locus_tag="CYME_CML234C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536860.1"
                     /db_xref="GeneID:16994658"
                     /translation="MPQLDSFTGRRLVFRAPLLTITALYKEHSTRKALQGVAVAGGGG
                     SQTRSGVPNGLWFVSLHQLGCDSETENLLYLALEETPCYVHAVPGPGYWLVIIVAAAC
                     VEFVTISTDTTAHTQQRGRIAAPARNRISPSETRNVSTGLVWRWIGAAGPWLAGIDED
                     DEARVWLLHWPSARRFAEQKHLNDSPNAPSLQALYQSIRLPAGFQFDTSNADAPLWAY
                     FRIDGMDRLSSGALSSDGSWLAITGLAADTEDAAAAAAAAVLQHGTKSDQRTHRISGQ
                     APRDARSSARLALVILPLYGAECTDALGASAPKPVREHPPAPRGNMLILASKARYRHH
                     HRCYEACRSQLQRGRRHRPRARLAPPSSPGPCVFLDAHTLITTFWDGDDASTTFALWQ
                     CGSSSRDARHREDWNLRRTWKLPQAQPVTAMDWFAPNPSSTTPAQIGVLAVALVNGHV
                     QAWIVEVPFGCTTRAPLMCSSWIHDSGRMTGQVQRFSRRWLRAGAAPRLVHGLPASAL
                     LVLPVAEHRSSAVDDLVASEQSRSWLLFSTSTDGTLLCIELRQAFARTLQRRALRSLM
                     FYVFVLGIVRLLMSPWARQDVIRHVSAIE"
     misc_feature    598509..600422
                     /note="possible transcribed region"
     gene            complement(<598633..>603816)
                     /locus_tag="CYME_CML236C"
                     /db_xref="GeneID:16994646"
     mRNA            complement(<598633..>603816)
                     /locus_tag="CYME_CML236C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536804.1"
                     /db_xref="GeneID:16994646"
     CDS             complement(598633..603816)
                     /locus_tag="CYME_CML236C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536861.1"
                     /db_xref="GeneID:16994646"
                     /translation="MTGTFDAEALRIIEDPESASNQELRQVWASAFRAGNVAALERLV
                     YIRRKGLEYERLAKVADLLAEKKRYDALFQLCYQYPHVLKEVSLSRTMPVLLRYCTGS
                     AEANQPAAQRMDVLTQVVATASERALAPSEIPRDTWTTCMTQAIDMEEPGVVRILRNA
                     PVKRLHEPLFLAEMLLRAYHRTMRYKDTGNFVASEAPSARVTDEDMVRALLAPATPSV
                     PSDSPATATDLDTSALDDQAHDKGFQERVLDALTCVLCPVPPLMLEWFVEVHHEHAAD
                     WLFTHYHFDIQSLPYTQFTLSTRVWLWNRAAAARSPVMFDGIIRACTHDEKQVRPEAA
                     NGLYALLLQLQHRADLHLVADLLANAGYVSSLLVLYETVQKMDPAIQRSMESQLADQT
                     LFCLFESSWKTGASESVRNVCAEILERFRGRQGALQIDPSQFDTVCAQCMRWAVQHPA
                     PSLLHVLRTFPFAAAHNAHLLGMLCCELLKTEKKLEFSAMPLKPDALDQNLIVQLVQQ
                     LLATPSTCLHEQVVTSSGEREDGVSLPADASFDSALQKVFQECALQSANLLQWAAHHH
                     VIRLGQLLLRNEQHALFQSAERGEPTLLRILLAQERNQEPYRKYPQLWDWTLQEALCR
                     VIPSANLSCVRLLLEHATIDTSRKDQSAAQILAVLSDADAFRLVDACAEQGDEELARQ
                     LLLVKQRRLRNITELSVNLAKAARLGQFPLLFSVHRLVCEALYDDKYGTGLETTDLAH
                     TCMELFQQLSDVDLRELARIAAMHGDLAVLHDAIRLFFREFATDTSSRDELLIELLRL
                     AVQYGHVQLVGFLGARYPSVLHRAPEACIGQNTVLIYHNRMEEGITRDKAAALLTELL
                     NVRAPVANSTREHAGTVAPNAGSATDAVAGHEQKHGSRRASQVSRGRYGLDASSVSSM
                     DDDSSRASKRISDGLPSPATFFPGERIRAFDERSPAGAPSDDASFVRITITTPQHQHQ
                     HQHQHQQSPARMFGTEPHQQEACSVSVNSAGAASSARIQHASLQRQSAGNASNEATPA
                     YLLRGLGSIRQPLLVQMLNWSVRERYAILLQLLLQLGLAISQANLNELLLCAVEGNDL
                     NTMDAFLEAVTRSQRNESVHPVVLDPTADILVRALVLGNTEMALRLLRLNRSISVYRR
                     KLAMKERTQLLLLAAAEGKAELVKLCIRDLDVDVNATDKDGFSALQLALRPLHPERLL
                     PLDTSAIGEQVPMASLQRIQTVIELIERGAKLQLLDEFDLFLVLRALAHAQDSVVAAL
                     MRITEFPDDDHDDHDHEPGCLRRFVQSPLGVRILRESISMLQPVVTGMSPTFSARSGT
                     HEQPRSDRSKFQREPDIRGIRGNARRRVPLHSDASLDHAARHEDAAYAVARFLVMYEE
                     TLLLHMSVREQWQFLFAAVATGDRAALQKLRGSVFAEAFDPTAWNDVHGRTLLDVAAT
                     LEDVQVAEAVMVALTEPFVVAPSVEILVESSDSIAHTSASTGGTSKGDTDAEADADAD
                     ADADAGAGSLSAAVDPSTPAMRNGTPTGSAAAVHAARAPAFTAPLTTPTERRVFYPEG
                     DADTSQGAHLSPAPRSTCSRSDLGSDLDQERTALPASVRHPTEATRQSASQKDNAERG
                     PVVVTNASPEIPPDTTSETSDLAAEQARREALSAPGSPLSLAPPDSSLSSSSLLLSSA
                     GVDASAPIAGGTGSGTSAARTAFAHSTATSNVAPKAMVLERTGRSAHEAGPPTTETQL
                     A"
     gene            complement(<605073..>605510)
                     /locus_tag="CYME_CML237C"
                     /db_xref="GeneID:16994647"
     mRNA            complement(<605073..>605510)
                     /locus_tag="CYME_CML237C"
                     /product="similar to ABI3-interacting protein 3"
                     /transcript_id="XM_005536805.1"
                     /db_xref="GeneID:16994647"
     CDS             complement(605073..605510)
                     /locus_tag="CYME_CML237C"
                     /codon_start=1
                     /product="similar to ABI3-interacting protein 3"
                     /protein_id="XP_005536862.1"
                     /db_xref="GeneID:16994647"
                     /translation="MAKVDVTSDDLQEICTFNRLLHERNELSARIAVEESELQGLDDA
                     EEELMLGLGDDMENPETDASEERGTEDTPSDSLATAELRVGSAFFRVPQTFVEHQLTI
                     RRSRLNDSLEKHREQRASVIRTMSELKKRLYGKFGSAINLEES"
     misc_feature    complement(606646..607337)
                     /note="possible transcribed region"
     gene            <607302..>608177
                     /locus_tag="CYME_CML239C"
                     /db_xref="GeneID:16994649"
     mRNA            <607302..>608177
                     /locus_tag="CYME_CML239C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536806.1"
                     /db_xref="GeneID:16994649"
     CDS             607302..608177
                     /locus_tag="CYME_CML239C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536863.1"
                     /db_xref="GeneID:16994649"
                     /translation="MLNFTTSAVLVTRTWRRRCTGCQQAPSVAYRKSTCFGVAGVRLC
                     AESSPPTPAGAASLERSAGAGTETADGGVSGSGQGFTPSITADNESQYYATRLVVTCR
                     DRKGLLSDLTDALKSIGLQIRRAVARTKDGIASDEFFVTRDGSQLSDTDLDAVEQALQ
                     PVMGTSGPTCPVPQNTERRLPAPQSPVRFVDHNRGVHVYVDNHASQHYTTITVNAPDR
                     PNLLNEIIDVLHELELNITFACLSTYADENKYRHDIFHVTTMSGEQVDAVLRDEIMNT
                     LYFLLTSRESDEQSF"
     gene            complement(<609301..>611028)
                     /locus_tag="CYME_CML240C"
                     /db_xref="GeneID:16994650"
     mRNA            complement(<609301..>611028)
                     /locus_tag="CYME_CML240C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536807.1"
                     /db_xref="GeneID:16994650"
     CDS             complement(609301..611028)
                     /locus_tag="CYME_CML240C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536864.1"
                     /db_xref="GeneID:16994650"
                     /translation="MQKVLCGVCLEPFTPSDPPLTCEACGLVVHAPCYGYPAFPFPGR
                     SVPSVSQHVHPTNENPQKRHRKVHRSPLVDQTPITGGSCTKPAWLGLAWNCAVCWDTR
                     RSTAEPSSVDAVFPDNYQDARTENNCDLEFSSSPVDSRKKRDPSTAVGPGVGTHGESP
                     RCLAEPPFECVLCPIRDYRLAMKPIIEANALNAASELPHVERYVHVICALADPRLEPT
                     EPWECLDAFRCCQDAVKSEDRASLGKETSTAEGIALSAHTPQHVSRQVLDETPNHDSC
                     LSKQCTLCETAGGLRFCCWVPLQKNSEPDDDHHVPCPVVFHPMCALLAGWWRPEPRFV
                     SRGRLRVSCPRHAIFEQRTPVPWMRGYPSTPKPGDEHHLAAFRDLVESLYVPAASSMD
                     TRTLLHSIQVHMLPQPFACLQAAMTESSTSPLTSETQSRIRKVLLPYTDQMQVAIILQ
                     IAEDLGLEPRITLRFLASHMKTPELLQWLLLDPAVLALHASDATSSSSTSTASQSRQE
                     RPVRAHQSPETLMTPAPLEDMYLRIWARLYHWEPREPFPQHCGWVRTLQRPLYSEAQL
                     LLERVRPEQ"
     misc_feature    612673..615817
                     /note="repetitive element"
     gene            <615840..>616871
                     /locus_tag="CYME_CML242C"
                     /db_xref="GeneID:16994651"
     mRNA            <615840..>616871
                     /locus_tag="CYME_CML242C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536808.1"
                     /db_xref="GeneID:16994651"
     CDS             615840..616871
                     /locus_tag="CYME_CML242C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536865.1"
                     /db_xref="GeneID:16994651"
                     /translation="MSQLDDTHDLLNMGDAGSGSKESDSALRRGGDVSGGKAAPVNGA
                     VAASESDNASSSSAALRNSSASFREGPPGRPPLLSQRFTVARQHLPGQLHEILMWRNK
                     YRSGLAFALGNLFFYFTTFGELSIITVFSMIVFWIVLLGSCLVLLSRALAYLTSASPV
                     PGASPVGTTAPTRRLLNRETAERLTESTMKTVNGLENLLRDAAHCRDWQLTVKVLLGS
                     YLIGKLGPLFLNMYMGWLIFLSVMTLPKVYEWKQRDIDDLIREIQPVLQSKLYEAEAL
                     IKNHISSVLSQIPPKVHEYSEMLRAQLRALTGASDRARSSSSRPPFSAGTSAATSSSM
                     TTSAETKED"
     gene            <617575..>619191
                     /locus_tag="CYME_CML243C"
                     /db_xref="GeneID:16994667"
     mRNA            <617575..>619191
                     /locus_tag="CYME_CML243C"
                     /product="IMP dehydrogenase"
                     /transcript_id="XM_005536809.1"
                     /db_xref="GeneID:16994667"
     CDS             617575..619191
                     /locus_tag="CYME_CML243C"
                     /codon_start=1
                     /product="IMP dehydrogenase"
                     /protein_id="XP_005536866.1"
                     /db_xref="GeneID:16994667"
                     /translation="MGDFLLNGNPKSPVERKLASSPVQKAKPLPPCPFNEQELFYCSD
                     GASAAEVFENSTVGYAYNDIILLPGHIYFSSDDVSLETRISRRIALKTPLVSSPMDTV
                     TESAMAIHMALHGGLGVIHYNNTIREQKKEVDRVKRFENGFITDPKTLSPEHTIADAR
                     AIKARYGFMGIPITENGAMYSRLLGIVTNRDIEFIRDPNTKLGDVMTRDLVTAPEGIG
                     LDEAYAIVKESKKGKLPIVNERHELVGLVARTDILKNRDFPNATKDRVGKKLLCGAAI
                     GTRLEDRERLDALVEVGVDLIVLDSSQGDSVFQLEMLRYIKNKYSHLEVVCGNVVTTT
                     QAYHLLKAGADGLRIGMGCGSICTTQEVMACGRPQATAVYQVSKFAREHGVPTIADGG
                     VSSIGHIIKGLACGASCVMMGSMLAGTEEAPGEYFYKDGVRLKKYRGMGSAEAMQKGS
                     AVRYFSEDDRIFVAQGVSGAVVDKGSLRRYLPYLINGIKHGFQDLGVPSLEELHNRLY
                     NGRLRFQVRTLAGQLEGAVHSLYTYERSAV"
     gene            complement(<620891..>622480)
                     /locus_tag="CYME_CML244C"
                     /db_xref="GeneID:16994682"
     mRNA            complement(<620891..>622480)
                     /locus_tag="CYME_CML244C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536810.1"
                     /db_xref="GeneID:16994682"
     CDS             complement(620891..622480)
                     /locus_tag="CYME_CML244C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536867.1"
                     /db_xref="GeneID:16994682"
                     /translation="MAATEDSQNETLALFKNIAALDDNEVARAILSAHNWNIERAVDA
                     FLTRGVEGALQPPNRTGSLEFASTSDTSGTTPDASELSSAPVSGQLHASRLSESQPLT
                     PALAETSTPERALQPALAQATPSGVLGHLRRLLALPFQALRMVLAWCASLVTRIMGID
                     RYYRYAGRSRAVGAAAVAELEENLRTRYGMTIRYPTIYHGTFKEALEHSTQRCKLVLL
                     YLHSEIHHATDRFVREILSDESFIQFVNENFVFYAASVNRSPEAVELASYFTPAGYPY
                     LAVVFASRRWPLGQLIDLRVLSDLDRSMRGGRDAPITATDVLLWLQNVLLEYGDALRT
                     AHTMRERRRSAQRLREEQDREFQEALAADQAAERARREFEQRAREEAAEQDQRRRERM
                     AMLDRKRAALGPEPEPGEHVVTVLLRLPDGKSTQRRFELSRSFRDLFDWAETSADIDF
                     DRFELTTNFPKRAYSPASHSAMTLAEAGFKQRVALLVTEIGWTRALPDASGKADVSDG
                     NGNVEQKHLEQGNSSESKKQV"
     gene            <624102..>627551
                     /locus_tag="CYME_CML245C"
                     /db_xref="GeneID:16994683"
     mRNA            <624102..>627551
                     /locus_tag="CYME_CML245C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536811.1"
                     /db_xref="GeneID:16994683"
     CDS             624102..627551
                     /locus_tag="CYME_CML245C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536868.1"
                     /db_xref="GeneID:16994683"
                     /translation="MQIPENTDHVQLELEARRRPGRPPVHVWVDLPDELLSPEQKRKK
                     RAILLRRARQQRLYERRKLLRAGIVSTPSEKAVIPPSCEHAAGAPPASRSQAQAERID
                     GEPRSMSADSGQFSGRANVESGVEDTWTAELSYTNAPSGARKNLEGQKIFAGRPQLLP
                     TPGHMGFRTTDTQKRNWEGAFPDGNKPSGIRLEPMRGALACSKPSLNAPHDTDGAHID
                     SRYPDASLMKHAKDGVFVAQPTPLEGGSYPCYRGAWEGPSREALRIHPVTSCALTSAG
                     APGYVSAYGEITAAQLVPSYVMPAAALMGIKQGAPAIAGKASVHIGKAALPSVVPASP
                     GTYGESRGIREPQQTPGMTGSVLVMSPVTPPDLDVKHLEMSSSQAWITKGSNERHGQS
                     YLTRPTVQGLRTDQISVEGQGRGTNICDANGMLLKAGHQGAHQETLHRTKAEAEVWGD
                     VSTPRLLESRVRTAGTLRNISTADMRVFQPDALLKLYHSVSDFEQRLFVRLTLPPACI
                     DEELVAVLVSDEENPSVLKESDESASGSGGRHLEENATGQEQSHKHEAGKRRAIASAL
                     SVFVDHGLLRRASSCYIANASWREFVQSVVANDPEQVAHVSREVRERFCAESCDAQRR
                     FVVWILDRFIRDAPALPNGLHFDDQVGSCIQAWFAESKNLLAALAFASAQRSRALSQL
                     LIRGYSVMRMCISPEVRVNYLRQALALLHRTPDSESIYESSDAASSGLASERQQCMLV
                     KYMPQSEEEALLLQLLGASLVDMLHVEEAEQPLCQALRYFIGALARQLGVSDATIEKI
                     DDLCLDEEIALIQSGFCAGGNAPSKKPAPQATELTRKCQARMALLRLDMLLELYQRKA
                     ADQTSDVSYVTSEPRSVSASQSPSAASEASPRWKEDTACAVHQQNASNPRELLQCCVV
                     SLLLLSLRIGLEGSRSEACDLLYMCLHILHALGFSRSTHAAATLLSLAGTYLTSGQLM
                     RARDVCHRALDVLREGSFTHTPVYADALGMVGAIELIEGLHPAAAEHFSAALKVLDSW
                     LDTYGGLPHEHCLNSPDDVQYLPLQHCQELHLWLSIGLARTCRAQQQHEAAERIASAA
                     MTCWRRIVAVAAVDAAPTPKPCVSLGAANASIPSPSSSAYMEAVSLLPPVFQDFGNLR
                     HIY"
     gene            <629315..>631216
                     /locus_tag="CYME_CML246C"
                     /db_xref="GeneID:16994684"
     mRNA            <629315..>631216
                     /locus_tag="CYME_CML246C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005536812.1"
                     /db_xref="GeneID:16994684"
     CDS             629315..631216
                     /locus_tag="CYME_CML246C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005536869.1"
                     /db_xref="GeneID:16994684"
                     /translation="MEATLRRLRNRGAADIAHPSQAGTENHPTPAALRVRRVIIRWSS
                     GARLAMGSDACYGRWELHIKRNRRILLQGSGVDKCSSEKASQVKSSPGSMASRATEAP
                     REQPSTAADARNPRNPVETSGVSWAAVQDADVGTHKKESKTAGTAAETGGSCEPLTPP
                     KTVGSKRHHSPMVAVKARIPPSGAGEAELSAPEIPQAPVDRASGDGRNFPDGVTWSAL
                     YTRLLQAMQRTREFEVQLSLAKSDLMRLQTEWLQAVWTRRHAASLELVTGVSETGVSW
                     EVPARTSVPAGAGPAQLFSTTGMHANASIGTIPDTRTASHGVWLTIPDAPAVPLQSAA
                     PTSSLTRTLPCGSNLQSDSIDSSSCLYQGSEAKPGVHACNCSTASSRTFGEHDTPSAS
                     ESEKFYPQHPTADAHSTEQISLPPAASTTPKTSGSNQSRRRRCRRRHRQSSPVPGTSR
                     YWTEAEHKLFLEALKIYGHRNLKAISAHVGTRNPTQVRTHVQKYFMRLTREALRLEDT
                     RRTSVQPSMQSATSATSSRGDGASAPFGSTEQLPAPGIELRCSGACAQPHALMPCEPA
                     QAPASAASTSYTEETPSDYRARNQEHGSSVPGEIEEHPRETRRQPFNSVPDTCGVHLL
                     SLVAQENML"
     gene            <633337..>634125
                     /locus_tag="CYME_CML247C"
                     /db_xref="GeneID:16994678"
     mRNA            <633337..>634125
                     /locus_tag="CYME_CML247C"
                     /product="riboflavin synthase alpha chain"
                     /transcript_id="XM_005536813.1"
                     /db_xref="GeneID:16994678"
     CDS             633337..634125
                     /locus_tag="CYME_CML247C"
                     /codon_start=1
                     /product="riboflavin synthase alpha chain"
                     /protein_id="XP_005536870.1"
                     /db_xref="GeneID:16994678"
                     /translation="MHCVQKLGFVPHLFDVHRAGATGRKQSAAACTAIRKRTRKQVQA
                     LFTGLVEELGTIVQRTETQREPPAVELSIRAPGIFPSLKLGDSVAVNGACLTVASLLP
                     QPAFQVTLAPETLRRTSLGQLGLGDQVNLERSMAADGRFGGHIVQGHVDTTGEVLDVR
                     LEGDALWYTVRVPRSAASMGSALQPDCFLYVVPKGFIAVDGVSLTVCDVNDRERTFTF
                     MLVPYTQEHVTLPGRRPGDLVNLEMDIIGKYVQRLVESRLSAVR"
     gene            complement(634293..637547)
                     /locus_tag="CYME_CML248T"
                     /db_xref="GeneID:16994679"
     misc_RNA        complement(634293..637547)
                     /locus_tag="CYME_CML248T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461423.1"
                     /db_xref="GeneID:16994679"
     gene            <636234..>637442
                     /locus_tag="CYME_CML249C"
                     /db_xref="GeneID:16994676"
     mRNA            <636234..>637442
                     /locus_tag="CYME_CML249C"
                     /product="probable 8-oxoguanine-DNA-glycosylase"
                     /transcript_id="XM_005536814.1"
                     /db_xref="GeneID:16994676"
     CDS             636234..637442
                     /locus_tag="CYME_CML249C"
                     /codon_start=1
                     /product="probable 8-oxoguanine-DNA-glycosylase"
                     /protein_id="XP_005536871.1"
                     /db_xref="GeneID:16994676"
                     /translation="MTRKRVEATVGFATTIISASVVRSESKLRAKRRLSKIALALRGS
                     VASLGEAGPPHKTCFSPWYAIAVPVEELDLPLCLEAGQTFRWKQRENGLWCGVHAELA
                     WNLYRPDATTLRYCYAPATVDPVRARLVLQDFLRLSDDAPSLVSLYEDWSSSDPHFRS
                     VAPFFQGTRVLRQDPVECLFSFLCSSNNHIRRISGMVEFLARRYGRAIGSVPAGLADD
                     EYYAFPSVAELAAQASVAELRANGFGYRAEFVVNTAKELESRGGNSYLRGLRSRENKD
                     EVIRELVTLPGVGRKVASCIALLSLDCAHEVPVDTHVWQLTLRHYAPDWRTKSLTEKR
                     HEEIGALFRERFGPLCGWAHQVLFIADLDAFQDRLPEALRAERTLARKRTRAAISARK
                     PATPPAQRSE"
     gene            <638071..>640410
                     /locus_tag="CYME_CML250C"
                     /db_xref="GeneID:16994677"
     mRNA            <638071..>640410
                     /locus_tag="CYME_CML250C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536815.1"
                     /db_xref="GeneID:16994677"
     CDS             638071..640410
                     /locus_tag="CYME_CML250C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536872.1"
                     /db_xref="GeneID:16994677"
                     /translation="MPSALDALAEAAVLQSIESNNASVSSDVKKPVVWVDPQRTSDVT
                     RECTTSNAASTGGSGLASSDGTATAVNSDLNQRETSRVPERTVVDAEQQQHQQIIGTL
                     CQLRNESIQKFDSDSYARQKHSYSEKQCTTDADSTGQSFLAQVKQEPPRDANAAVCMQ
                     SNRERALQAALAFGFRDKDGEITRCPCGSSAYQGFMLACESCGVWQHGKCMGIRRAAD
                     APDQYFCELCRPDLVRQQCVIYVSSATEPSKKKKSSRGKRPATEKANSTDSKSTSGRS
                     GASAATAPAGSFAANDHDKPETNTSAASVMQRTSESTDVSSMTNHCADDGRPAVWSSV
                     DGKKPDDIDSGSGKTETSALLETEHNSPRRSRHTAPKTTTPALSPPVQSRTDPQTPSL
                     LFPQSPGGSLSREERKLQHILQQFQRMEAEEERRRRREAEQHNVHVERSPGEGNRGTS
                     GCGSATDSSTAMTTATTGVHVERAPVSPRKSARSEHEAKRARGPARVGRNPGAPSPGQ
                     GLVTHHWEETETTSSNERIESHERPSSPTRQSERSPTVASAGSAAAAPEHPNSASVEL
                     PGSKRGATRGHLASASESDSNAGNPVHLRIPLPASLSASLLGNIYVTCAPTDATPGDT
                     YSSSSSMQIAAPRASPLARGSWLSFQPKQSSPEGGGFLPSDPAAETPHSARFGKKLWL
                     LHQHYREQLACLVDHSASSSSSSISSSTSTGSSAGPSVAPTLDSLPDHLEHLRIRVQQ
                     ASRYPDDILYAFLPVKKKTAAAFRLADHPVTVPAPDSLS"
     gene            complement(638653..641059)
                     /locus_tag="CYME_CML251T"
                     /db_xref="GeneID:16994680"
     misc_RNA        complement(638653..641059)
                     /locus_tag="CYME_CML251T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461424.1"
                     /db_xref="GeneID:16994680"
     gene            <641015..>644239
                     /locus_tag="CYME_CML252C"
                     /db_xref="GeneID:16994672"
     mRNA            <641015..>644239
                     /locus_tag="CYME_CML252C"
                     /product="probable peroxisomal biogenesis factor 6"
                     /transcript_id="XM_005536816.1"
                     /db_xref="GeneID:16994672"
     CDS             641015..644239
                     /locus_tag="CYME_CML252C"
                     /codon_start=1
                     /product="probable peroxisomal biogenesis factor 6"
                     /protein_id="XP_005536873.1"
                     /db_xref="GeneID:16994672"
                     /translation="MNDALYFLYQHTSSFEKLTDYEPAVLVEASPLEPYQTLAPADVE
                     LDFAVLVPEACARLWGWPRNTLVSVNGKHWAYVELVESEVQHSTQPAQVWLTQPLWWT
                     LHHSDDDDEVPCPTTRRCWLSLRQAARYEPIRWRLGSVPATRVVAEAVPRAKRVRVAV
                     INDGRIRDLDAEVASALVQAAFRRFITERAPHRPLLLKVGDVLAVPLPAFAEPERQAQ
                     TRADSSEVPCRAAAPGTEFVQHSLTSWFESIHRPVFYTRVMAVDADDDAAASVSTSSL
                     QKIVSDLGAAVDADRTRLLQEAHLPGQTVYPLRNRWHLRARAWERMLFEQALEPLNKL
                     KQVLDASLAWMRSPGSESSSKRGAPGPPLSVLAVLVYGNRPLQTLWTCLQELNAWGMH
                     LCEIDCALLMPAGVADRTPASASNSRATATLDPWQTLLAHLRLAEERWRDAWPAVLFL
                     SRFDVLVRLVSPGALEQGVNVEVQRALLATLRRLLGDRTWYIDTASVGSSSTKPPLTR
                     SVSGVVHHGMRSETVSGQVRRWLVFVDVSATTLTPADLPASLRGLLTAALETPPVTRL
                     EVVRALERTLVHELGTSIPFGDAFRRRLGAALADIQTWRESEALALLRRLAGRLQVAS
                     VNGTPAPGDIEQYITLVADSARFFQRMRMAVTVGIPSVPQVRWTDIGGLEAAKEEVRT
                     LLGSGPGFSSSSSSAAAAAAGRRLPRRSGILFYGPPGTGKTLLAKAIASACGCAFISV
                     KGPELMNMYIGESERNIREIFTRARQSAPCVIFFDELDSIAPRRGAGSDSGGVSDRMV
                     AQLLAEIDACQMSSRPGRLASVATVLGAAVDDAAAAAAAVDTSASRPTAAVFVLGATN
                     RPDLLDPALLRPGRFERLVYIGAPSTMAEKLQVLEALTSKFQLAPDVDLQQVLASAPP
                     VLTGADLYGLAAQAWVRAAKRTLAESTLGNAYRDLMKRLVGDSDQRGSSEAASNGATT
                     ATAAAAETTGDAATSTRLSTTSANGSEPVSSVADASSETVTPLVIVRQEDLLEAALQA
                     TSSVSSTDLQRYRELFERFTTSNRNDVASWDGNLDAVTATATQP"
     gene            complement(<646396..>651027)
                     /locus_tag="CYME_CML253C"
                     /db_xref="GeneID:16994673"
     mRNA            complement(<646396..>651027)
                     /locus_tag="CYME_CML253C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536817.1"
                     /db_xref="GeneID:16994673"
     CDS             complement(646396..651027)
                     /locus_tag="CYME_CML253C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536874.1"
                     /db_xref="GeneID:16994673"
                     /translation="MESHSNECEKLHPGEPSRWLILERAARSRSRSLAPAQPCVVCFV
                     RVLADEHHRGAATRLQYALDWLELLESPAGLDGTLGMSQGSMAAAAAAAATATALGEA
                     LAYLIHGIATAVAAGSAELAPNPPPMEQATQRALKPSSRQRALTTSLLQVLCQITSRA
                     FDLHNAMSGCCVTSKCTQQISRARPEGDASTLETVYLVGVAHHCASLDGVWHEMRAFL
                     QFFVAVAQCREKAGQPLVAMQQCRFGYRAAVTGPVSDSASWRERLGTVCRDAFEALLA
                     FLDHELLLQCSQDRETAIEAANATTRVLYTMRLLMQALGAYMSPETALSCCTRLMQLV
                     SHRALRCACSADAANVLSMSSVMCQRIAKVQPRMHSENLFVGWRRVALSAPWSDFLKR
                     CIAQPYFLELNLLALRSLRGMLQVLGRVLAAAVRSADENAVLWEDAEALRISGFADYV
                     VECICCDGAVLEKKSGDRQLPADAGIAVQPGASLAYGDAARGPAGQTWASPLSSRRWT
                     QDAPQPGRLVTSDSSQLRLRACFQVCAVLPSEELSSRSTLLFTLCCHHASKLLDEHGC
                     RAPGWSISRGVHQQQSRFLLELLTVLRKLVKTTGIPCHEQVIRQFAALVSDLSQQRQR
                     AGIGCSAPIRHALRGMFGALAQRLRIAECTRCPAADQERVFASCLLQQLQRGIGADQG
                     RSLLETLYACDKFRDLVESAAQVASAASGSAALARSFIVETLPTCVLHRAAVEASGFA
                     DTGTVTALDASGEQGPSPAASTRHREHQRRVRERHATGRMPAVDDDDDDQHDDIVDDD
                     GDGGAGGDVGGDDDDNNNNHVFSCAQTSVAPRLWCWWLIRIWPILQPLGKNLEECHRL
                     IRAAQHPILLWRISFLALHTEPSRTELLPAIASVLHSLMRCLCNLPCIRYEAVLPVVC
                     SEDEARTPRRVLLHDDDDDDASTGDAASSFVTGEALVESLAAMRTLLGYTAASSPSVP
                     CTPLAWYAQVQRTLLEKRARQAVRSVLAQPTGSQRFHKCFAGRQPELFDWLDALSVSR
                     MPETSADLFPGTEVRGQSAQTTWKDNVIFLWMHWAGSRLPVNLVSWLLEQVPLHEWMM
                     ATSSEATEAVSESWRVHAIAAAIRQRAAPWRHWRQVLLLTLRTNDRARFVQFADAWFR
                     SLPGQCPNASETQALMDAIHRSQVLPWLLSGLHASLDRPGAPDARPLQVPDTLHRQDY
                     ARRMALVRVAGALLWDELRQRVRRAAHPAGTSQLVSSRSDLAAHLCELAASEYALGPA
                     DLLSALSAMQALALTLVQTDADAGDAAERASAYLGHMGRSVASWLQQVSGQDHDARSP
                     CQELVLVGCLGFVAIIGAASTVRRASTLHALRVVTGAVAGGEPAASPWCFWLRILWNA
                     PPFSRVQLLALWILYIFLRWRVLSVENAQDLVLLHGLGCWLYTEREAAMMHVRDADSE
                     SSQSTEEAIPWAAEFLALIGVLSAALVQVLESGTGRDANLDAMQRASATSLRLLTTSP
                     GDESAASAGTGDGWTKQELASTVSHRLLWHVAALVESPLHVIRDAERRK"
     gene            <654021..>654272
                     /locus_tag="CYME_CML254C"
                     /db_xref="GeneID:16994668"
     mRNA            <654021..>654272
                     /locus_tag="CYME_CML254C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536818.1"
                     /db_xref="GeneID:16994668"
     CDS             654021..654272
                     /locus_tag="CYME_CML254C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536875.1"
                     /db_xref="GeneID:16994668"
                     /translation="MLARQPTRLRLEPLDLETLDRVIQRRHEERAIPERATRDLAPAE
                     QDRTLASGRASVSAGPPGVGGKLLPRGAGLTTRQRIGLE"
     gene            complement(<654496..>656616)
                     /locus_tag="CYME_CML255C"
                     /db_xref="GeneID:16994669"
     mRNA            complement(<654496..>656616)
                     /locus_tag="CYME_CML255C"
                     /product="similar to inositolphosphorylceramide synthase"
                     /transcript_id="XM_005536819.1"
                     /db_xref="GeneID:16994669"
     CDS             complement(654496..656616)
                     /locus_tag="CYME_CML255C"
                     /codon_start=1
                     /product="similar to inositolphosphorylceramide synthase"
                     /protein_id="XP_005536876.1"
                     /db_xref="GeneID:16994669"
                     /translation="MDAQEAQNDYVVTQLDDSERAQPFGTAQSAAANEATGSFRHIEV
                     AVAAAAAAPRHARSASLPSTIVDLSTDWRPPSRNRNPSNAEARQQLVGRTRYPSLGTL
                     SSVQTGNLLASGGEPFSESFSSRTAPEKEQELYTGRRRSQSLWSERFVHGSESRIRAT
                     ERGRESSVWNNFRLLGYRLARFVFFPPERSPCSVSYTSSTSGGSGSDSEPRPSRKRGS
                     RKRRSGHSGRSFSFDDDGKALHSKTELQSGTLVLSKADSMLSMSSFVEGSASSTPEAV
                     YDASSSSDAEANEHSSARHSELEMRFLPAATEGNPDLESVQSNARFCVYDANEERFSP
                     SGETRLYRAWNSCTTAVGRAADHCTRLLQTVFRGVSTQPPLREELAMRSSLSAKAVFL
                     LRTVLWYLWPVIAWLSVFNFFDVIPSAWKPKYIHVRWIPILESYLLYPHRWFFFGYDH
                     GRGASFLDFLAAFPYTVHAGLPFAFIALLILRRTPARRILQFGRLLGLVSLLGVLTHL
                     FVPTAPPWYYEKFGFRPPDYTMKGDPALLDRIDDAFGIHFYRTMYATAGKVVFGTFPS
                     LHAAWPYLMASFEPQQGRFLWAYTLWVWWAALYLQHHYLLDLIGGALYVEVVYAIAGR
                     LADTESESVPDKALYSDAPAEGAYQPLEMPQASTYASRRGWLPSEAPWPFTARPLTPS
                     RGPGTSRPQRRYRSSSQASSIDLV"
     gene            complement(<659314..>660435)
                     /locus_tag="CYME_CML256C"
                     /db_xref="GeneID:16994671"
     mRNA            complement(<659314..>660435)
                     /locus_tag="CYME_CML256C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536820.1"
                     /db_xref="GeneID:16994671"
     CDS             complement(659314..660435)
                     /locus_tag="CYME_CML256C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536877.1"
                     /db_xref="GeneID:16994671"
                     /translation="MAGVESAVSTNLRFCRICHEEQVLPGGDAAPLASKAEETKQQLL
                     RTWSFILVRGFVQFTRRVHCGALRLLLKLVRQLRRLRRKLGFGATCGEVETKDELRPY
                     EKEALDDVRGTVENSPQVDMESLSDPKTLIAPCRCTGTLKYVHQGCLRKWLRRQPDPN
                     CWRCEICGLRYASQVQFRPAYEFLFQWPLRRDKSAGSDLDDAAEDDWFVASSDWDAPS
                     LQASANNADWEYLAANQENQTPSFMVWILRGWQALTQAQRQDPAIASRWLHWLHIIYI
                     GLFSRHIFRQGQELAHLVKQTAALEPLSRALYRGSHAVRSVVEANALVALRTALIAHY
                     LIFLAVDVRFLYRQFKLWRSATARILILNYTESEAPSRG"
     gene            <660994..>663123
                     /locus_tag="CYME_CML257C"
                     /db_xref="GeneID:16994674"
     mRNA            <660994..>663123
                     /locus_tag="CYME_CML257C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536821.1"
                     /db_xref="GeneID:16994674"
     CDS             660994..663123
                     /locus_tag="CYME_CML257C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536878.1"
                     /db_xref="GeneID:16994674"
                     /translation="MSFRPDQLNPNDEWVQALQALLLRSHRGVVVRFHDADQEQRRLF
                     VHIESGRAWLAENAAAVTGELDATANESETFLRDQFHLICTSVAEEDSLDLLVHVRTA
                     DHLATLGIACQHENATPFVVAPPRQKLEQFAENAAVRLRVRREQKSQPQILFSLTSLD
                     GRYALAKAPSKADPTRSKGCIGLERVSLGGVVIDAAGSQARTSEARSMALGFTVKMDT
                     YWIERECYRTVWKRSQLVWLSKHAAHCLSADAAKTSWVDVAPAQVAWIRVAVMLRYWP
                     QRVPIMLRNGAVGGKPLEGAWYGVGTNHSLSLWLDASPVVCLRDESSASKPHSCWQVG
                     VGHETVSAPAVFRIVWRERQQRGSCFFELCCVSDGARPANDGIALYLGIDKRTKRLVL
                     KHRPRQWEAFELDTVQREEPQAGSDADTTITPGAAPASGARGLEEAYFAGARRTLQRE
                     RTQHASSPADAVQRREKARTLAQRRARIMDSVAQALAAREAARSVAAPADHTAAGARR
                     RGVVADDRSAAAAPAMPSEETSIEAPHESGAQPQTVQGAMSSGPAPSQVRCAACHGAI
                     VGQYVRALSQSYHPGCFACSICRRALAPETKFRTSIGNPLCEACYAEHVAPRCARCKA
                     PITDVVVTALERKWHRGCLWCVRCGQPLCHEGSSGSNTFYLYPGQPDQPHCESCVRGK
                     DREQSGRRTLPSLGGGMPSGTGSFRLG"
     gene            complement(<664189..>664917)
                     /locus_tag="CYME_CML258C"
                     /db_xref="GeneID:16994675"
     mRNA            complement(<664189..>664917)
                     /locus_tag="CYME_CML258C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536822.1"
                     /db_xref="GeneID:16994675"
     CDS             complement(664189..664917)
                     /locus_tag="CYME_CML258C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536879.1"
                     /db_xref="GeneID:16994675"
                     /translation="MAFDIEDAVAARLDDWRHSDQLESLVVAEAPQREAKRLRTKATV
                     GSPTRANELQPHARTGREPKHSSSPSGNATAMGLGSDKHTRAGLPKPAVCNRGALSTQ
                     GRFDKRAAKDRSASSPKCSPEISIWSTSQTIKCEQESYGVPGRRAARAGTHRAASRQE
                     TARTYDSIAELLAETRKDIGELVKHGRHSRKRIDWFAYRGPMIPRKILCGLRAKQKER
                     ERRAKALARAAGLGGTRHRSRRKS"
     misc_feature    665008..665466
                     /note="possible transcribed region"
     gene            <668317..>669753
                     /locus_tag="CYME_CML259C"
                     /db_xref="GeneID:16994756"
     mRNA            <668317..>669753
                     /locus_tag="CYME_CML259C"
                     /product="eukaryotic polypeptide chain release factor 3"
                     /transcript_id="XM_005536823.1"
                     /db_xref="GeneID:16994756"
     CDS             668317..669753
                     /locus_tag="CYME_CML259C"
                     /codon_start=1
                     /product="eukaryotic polypeptide chain release factor 3"
                     /protein_id="XP_005536880.1"
                     /db_xref="GeneID:16994756"
                     /translation="MAASQVAERVQELHLDDNGRGPGSESPERVRNLNIVFIGHVDAG
                     KSTLCGHLLYLTGNLDERTLEKYEKEAKSKGRESWKFAWALDLTEQERSKGKTTDYGV
                     ASFRTATKHITIIDAPGHKAYVPAMISGTGQADVAILVISARKGEFEAGFERGGQTRE
                     HAMLAKTAGVRQLIVVINKMDEPTVQWSEERFREICDKLAPFLKQIGYRPQEVSWVPV
                     SGFTGENLREPVHPSTCAWYKGGSLLQVLDALKLPPRPLDMPVRMTVVDRFRDMGVCI
                     LGRVEAGTIRSGDRLLLMPPRLVVHVTSITMDAEEVPLAEPGDNVKLLVKGVEEDDIH
                     SGQVLCAENDPVEATTTFDGQVMLVEHKSILTAGYRCIAHIQAAAVEVVFERLLAEVD
                     RRTNQIVKKHPKFVRPGSTFIARLSVAQPVCVTAFKEFAPLGRFMLRDEGTTIGAGVV
                     LRIPSQRAKSETNAVVYPDTNKTGADGP"
     gene            <671210..>674611
                     /locus_tag="CYME_CML260C"
                     /db_xref="GeneID:16994617"
     mRNA            <671210..>674611
                     /locus_tag="CYME_CML260C"
                     /product="similar to ATPase with chaperone activity"
                     /transcript_id="XM_005536824.1"
                     /db_xref="GeneID:16994617"
     CDS             671210..674611
                     /locus_tag="CYME_CML260C"
                     /codon_start=1
                     /product="similar to ATPase with chaperone activity"
                     /protein_id="XP_005536881.1"
                     /db_xref="GeneID:16994617"
                     /translation="MLSRLGTSRGGSSGAGARTLPKLSPSPQALPRHSVQRCGCSCCG
                     EQHYSPELMLVDVNVAALGSRERSQGWLPKEHSSACLGGFVGPCWNVKGAPRGASNST
                     GAQYTCTGQLRSSLCAHALHASREQCMGGRGRASLSCASLVGGRSRRAELFTRCPGAA
                     GRLRSTGRFPPRLLPAGQLMDSGARSMYAQATGGAKGHPMNGDVPREPASPNDKRIES
                     EGELNTDAIAKADAANEHKRGRPATPQRSPKAPENATGKGGKRKDREVFTALEAFGLV
                     PSRRRDDQPQMRRGRKTKSGWIFTIISEALLGSKGAPLKREEKQQLVALESRLVSMVR
                     ELSASPPLSQPAEDIRQAWLILDRIRSLVFYADVLNDTYVASFILALKGVVSSALLLG
                     MGTDFLEQSASEHHGMNAERDAPGGRLLSSVATRARNTRKRRSQRNDDPRRPELVSRM
                     NDQLVEEILASGDTIDNHWLAPLDSKWASAPWKTPFMQFYRNLTELRVKQGQTWEGHI
                     LDLTLHPTNIFAQSLQRSRGLNNAASSTDPNMDAENASLNDQEMIPGLQVVPSGDAVS
                     EAELTEQSTASEASWYDLDGRTIAAMVRQDLDILQSLCAWSLHRLARCIALSLMGLTE
                     DELEHLYQQLTFNSKQSAQGESSEHTAFDAAESLVVLLAREAPSTISLLENGLVAHHP
                     VPRAVVADALEQSLRSLLFKSALSAVGAAGIPQHRWSQFYPLIAKRIRLRGDGILGQY
                     FMLYYSNREQCFRPVESADTVRLDDLVGYDEIKQAFIQNIKYFIAGHYAHHTLLIGAH
                     GTGKSALVKAAAAEFYRMGLRLVQLDSGYFGAAQGLGTLPIVRIQKSRAKSRLTEQDI
                     PFGTLGLMHDMQGIAKEAVNHPHLRFLLFIDDVPLDERDPRLVALRGIMSGGLLTLPK
                     NLIIVATCSSSVSGPDLFALSVTSTEEDFIQSGKYRFRRRLRVVPYVDLYEFFSGLSD
                     ETIIFLDRFGMVLTFNSPSKSKYLDFVRSALERYGSTARRIPWQTLRRRALVYARMRC
                     SFSARTARHFIAAVEDEQRFMHASAPMMPSADSLATMRISDPDNDDDDEEEEDDDEDE
                     EEEEDFEDEALYDDDDDDDDDDDDDDDDDDDDDDDDDDDDGKRGA"
     gene            complement(<676080..>676529)
                     /locus_tag="CYME_CML261C"
                     /db_xref="GeneID:16994618"
     mRNA            complement(<676080..>676529)
                     /locus_tag="CYME_CML261C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536825.1"
                     /db_xref="GeneID:16994618"
     CDS             complement(676080..676529)
                     /locus_tag="CYME_CML261C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536882.1"
                     /db_xref="GeneID:16994618"
                     /translation="MQRVRASLQSIDFLTWSILESRVFRVSMLLFQGNAWMQKVVSLY
                     GPERTRHSPMMMTCGQVRAQRSQKPSRQIIDFVRETNRTLFMAIEETAFDSVIVLIRV
                     CAPRGCGRLCLHARASWASMIVIAAIASSGERVTASHEGTQSSLSLL"
     gene            <677283..>679067
                     /locus_tag="CYME_CML262C"
                     /db_xref="GeneID:16994711"
     mRNA            <677283..>679067
                     /locus_tag="CYME_CML262C"
                     /product="probable metal ion transporter"
                     /transcript_id="XM_005536826.1"
                     /db_xref="GeneID:16994711"
     CDS             677283..679067
                     /locus_tag="CYME_CML262C"
                     /codon_start=1
                     /product="probable metal ion transporter"
                     /protein_id="XP_005536883.1"
                     /db_xref="GeneID:16994711"
                     /translation="MSGETIECMPSAELQQLPGSVTCSDSPVKAPDSDDSEIGQTPAD
                     MVPKSKPLAKADPSPVQHSFRARCKAWLKELLRFAGPGWLICIALIDPGNYEGDIQAG
                     AGYQYALIWIIWWATIAEICIQALTIRLGLYARRDLGQACRETYPRWVTIALWILSEI
                     GMMATDLLQVIGFGVATEILFGIPLYAGVLLSFATTLLLLSTQYVSFRLLEIIVIVLV
                     FIMSITFFIQWGMVDTDGAALLRGWVVPSIPSGSALILLSQIGASVSPHNVFLQSALV
                     QTRTVDRTKKALRSATMFNIIEMTIPMMLAFVVNLAVIALAAQGFYNSPAVDVNPNDI
                     TLRDTCKLIHRVYANSGAGCILFGISLLASAQSATISATYAGQIVMEGFLNIRLPLWL
                     RNLTTRTITIVPGLFIAIFAGNNGSGLALLISSSILSGVIPFLIVPLLKFTNSAACMG
                     PYRNSWYVRWPMWTLTLAIIAANLYLIAGAGGNRTLRQALSSGGPGSTAGIVFTVIIG
                     LLYVGFLVYLMLRPVGIVGDAYDIDDGVMGLVESGFETHVRMEPKPVPNEPTRPEPAF
                     LPPDAHSAEDAPLGKNFSEQSLSEDASS"
     gene            <682820..>683281
                     /locus_tag="CYME_CML263C"
                     /db_xref="GeneID:16994709"
     mRNA            <682820..>683281
                     /locus_tag="CYME_CML263C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536827.1"
                     /db_xref="GeneID:16994709"
     CDS             682820..683281
                     /locus_tag="CYME_CML263C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536884.1"
                     /db_xref="GeneID:16994709"
                     /translation="MDDAQRTEYARRMRRLLSPPEILMPDGEIDQEFFLPARFRPSKE
                     RYFAHEDREALAQALVCHGFGNWEAMRVDSRPFGLRLRQWTVEDLENAAKQLVGCADI
                     GRYLGWQPANAAAIVQELEQNRANGLARGTWDSVRHWLNPALAASNAEQPS"
     gene            complement(<683722..>684801)
                     /locus_tag="CYME_CML264C"
                     /db_xref="GeneID:16994710"
     mRNA            complement(<683722..>684801)
                     /locus_tag="CYME_CML264C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536828.1"
                     /db_xref="GeneID:16994710"
     CDS             complement(683722..684801)
                     /locus_tag="CYME_CML264C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536885.1"
                     /db_xref="GeneID:16994710"
                     /translation="MSSSREMVAAPVSMALHLSLSFVQQATRLFITSHQRLSASGVCQ
                     SVQTIRRSCPQNRNISCPPRRGLQRNALLWHLDPDSGERGALVVSLSSERQGAGTGAG
                     TGEHGGATATESANNSKCARGVPPQSVLFRQVLRHDGWKELAAVAELRTLVFSPYAAD
                     PWFFARRKEELYNCMRSRLEINPGRNHTFVLVPRDPNAWTDAGADLPAKGIIGTADVT
                     EYPNPCEDDGLWFGPGYLFPFLLSADRTKTRRVAKESTAGEALEETRKPGSVYISGLA
                     IAPGFRRRGLGRFVLWEIERWTQRRYCEAMYLHVERHNVAGVRLYETFGFRPVQEREI
                     AQLWKKRTGEREHLLMCKPLELVTS"
     gene            <686895..>687620
                     /locus_tag="CYME_CML265C"
                     /db_xref="GeneID:16994706"
     mRNA            <686895..>687620
                     /locus_tag="CYME_CML265C"
                     /product="uracil phosphoribosyltransferase"
                     /transcript_id="XM_005536829.1"
                     /db_xref="GeneID:16994706"
     CDS             686895..687620
                     /locus_tag="CYME_CML265C"
                     /codon_start=1
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="XP_005536886.1"
                     /db_xref="GeneID:16994706"
                     /translation="MLSGGTETRVDLVPQTPQLIALYTVIRDRRTSRGEFVFYADRII
                     RLLLEHALNHIPLVPRSVVTRLGVKFDGLAYHEKICGVSIVRAGEAFENGLRQIARAV
                     RVGKILIQKRESGQARLISVRLPRDVSQRWILVMDPMLATGDTAKTAIQVLVKAGVPL
                     ERILFVSMFACPEGIQAVLDAFPRVTLVTGAIDAGLTADKFITPGLGDFGDLYFGTCE
                     DDREPSFTDSERGSFDWLAHAEV"
     gene            <690588..>691301
                     /locus_tag="CYME_CML266C"
                     /db_xref="GeneID:16994697"
     mRNA            <690588..>691301
                     /locus_tag="CYME_CML266C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536830.1"
                     /db_xref="GeneID:16994697"
     CDS             690588..691301
                     /locus_tag="CYME_CML266C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536887.1"
                     /db_xref="GeneID:16994697"
                     /translation="MPELSPASIINSVERVPLCPPGLTLVPEYLSPSVESRLATYFRE
                     EASQHWIRLSNRRVILYGLHFVSNGSGHRCYTRVIPDLIRQLAEQLVADGYQNQVANH
                     ILVNEYRVGQGIMPHEDGPAFLPNAAIISLLSGTVLDFYSKELTARSKPVASVYLPPR
                     SLCMITEEAYTSYLHGIAERNADEGVPRSDRISLTFRYTAQLPEATREAAANQAPQAE
                     ALSHSSKEKRILQFLQRRK"
     gene            <692890..>695049
                     /locus_tag="CYME_CML267C"
                     /db_xref="GeneID:16994698"
     mRNA            <692890..>695049
                     /locus_tag="CYME_CML267C"
                     /product="probable CLC-type chloride channel"
                     /transcript_id="XM_005536831.1"
                     /db_xref="GeneID:16994698"
     CDS             692890..695049
                     /locus_tag="CYME_CML267C"
                     /codon_start=1
                     /product="probable CLC-type chloride channel"
                     /protein_id="XP_005536888.1"
                     /db_xref="GeneID:16994698"
                     /translation="MLPPVAFLPQPVRPGTRSKRKPEARVKRQKRALRRRVPCQSSLT
                     PSRSQAPKALFPGDVEAWLRAAAKRRQRLQSPDSGVLLVLAALVGAGTGLGVTLFKTA
                     IRGVSDFGYGDTVAGALLPFVGSLNLIAVPTMGGACVSFLKLRFGALDGGIEAMLRSM
                     EKNERFQSAGAIVKAIAAVFTLGSGCSLGPEGPSVEIGASVARLIPQWASERLQWRLS
                     SERLRQLFACGCAAGVAAGFNAPFAGVLFANEIAQRAGGNHTESGTGASTTPALLVAS
                     ALSSLVARLGLGERPAFSIPNYDLRNPLLELPLYLGLGFLAGLASLGFRKALLLGQNL
                     YQCTGLRRIPVAWRPLCGGLLNGMVGFVFPQILFFGYDMLDALLADTNFSIPLLAGLL
                     FLKPLMTAASLGSGLVGGTFAPALFVGANLGALYCKSIECAGNALLAIVFKTLGATTA
                     TALSGSIPIAGPPAYAMVGMAAVLAGMFRAPLTGCLLLFEMTRDYRIILPLMAGVGVS
                     TWIADDTRQQVRASPSAYATKRNEGPSPLYLGLRPDAEFRSVAACLSVRDGLSPLKPV
                     FLDAQCSVSVALERFRPLEHGCILVTTTMPVEQIQGLVTVRDLLRAKSEFGALQGITL
                     GEICSTDFESISLEEPLVRALEILESNSAPLLPVVVGTTTEERGRSEQPNGAYESPSR
                     MKISPSMVCGFVDLTSIERAVQFSRLQMAAREPDGPS"
     gene            complement(<696116..>697774)
                     /locus_tag="CYME_CML268C"
                     /db_xref="GeneID:16994703"
     mRNA            complement(<696116..>697774)
                     /locus_tag="CYME_CML268C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536832.1"
                     /db_xref="GeneID:16994703"
     CDS             complement(696116..697774)
                     /locus_tag="CYME_CML268C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536889.1"
                     /db_xref="GeneID:16994703"
                     /translation="MTRVASPTRHVRQQDAATVLKKSQKRKLGAAMSKLKQAQAVQSS
                     AKVQRDALDDPSANVMLLFEELRQKATPLERKQHLIDQVLAQLEPKLGLYARRHDISR
                     VVEIALKHGSSEQRSRIWNALEPSLQRLPETRYGRHVVQALFQYATGEQRRALIAALR
                     ETLVRLAMTQDGADWVDHVYQTIANGRERTSMLMHMLLERDRGLHQLLVGSRDQEVRS
                     GDNALDQLLGFVEEPFHQRLVACCRRQVEQILDKPRALSNALVHDLIWTMLSSSRVPF
                     SEKQELGQELATRALYLYHTNNGSLALMQMVQLGDAKLRKECAKSFREVLSEVWTNKY
                     GHRVILTLLAWTDDTVMLSKTLVRPMIPYFDALFAAAQNSGTPALIYAHVALLFLLAG
                     ETTRYFHPVFYRMVWNPYRSDQEVHRPKKDPQTRREEMLAVIAPALFQLVHTHGLSLL
                     CDYRNSPRMGALCIEVCKHWQQHGETERIREWFQHILREAPWHASDAHTQRQRHEFLH
                     QVLVLSKLFPEQIFPPLKAHASQLAELVNTNERAARLHGALQSS"
     misc_feature    698117..700478
                     /note="possible transcribed region"
     gene            complement(<699000..>702020)
                     /locus_tag="CYME_CML270C"
                     /db_xref="GeneID:16994696"
     mRNA            complement(<699000..>702020)
                     /locus_tag="CYME_CML270C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536833.1"
                     /db_xref="GeneID:16994696"
     CDS             complement(699000..702020)
                     /locus_tag="CYME_CML270C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536890.1"
                     /db_xref="GeneID:16994696"
                     /translation="MSSSAGPAGSDEAVDGAFPSVSFLALCESVAEFGYVALRDLVEF
                     LTERRPNETDAAANNVLVIETSQRERHRLLRLLTLCRWLHHNFATMRTAQRCVITAEW
                     LANRYERAGADVLWSLYQQTRSEPLFASALDIHAAATVSTTSSYDRLPLVLHRLRTGN
                     VQALAAPAIQVLGYRTYLLLRTASATMHVRLRFHRDFERNNRQALVRISDQSMPGWEA
                     LVGLRPQRMTVALPTWSANAPQSTDWDWFIWKLTLDQGTAYAALAARILEERYQLLCR
                     KQQLSDMLSKTRYFIGCLVSCISVELYEPLRIASLAKSVEVLSNTNSRQKASPLGGTA
                     TSSTSATIRVQRLDASPGRFRILYWPSAVKPPNADAFVMAENRWWYGITLQCTHLTVP
                     PTPEWLWDPSLRLQVPLYGYVRVEHQPPLPVHKCIPHEVCSEGDGVALVAAARRARST
                     ALLQALVSERSIFGVVHHLHPTVVRLVPRGDSGIALRLQVHEPDGLVALSIDGGSVLE
                     QIRNLRSFMEPAMPAWLRPETWPVWLPIPEQRRRVHSRLEALYHAALHDQVWVVAQLH
                     KQVPFLVYLLPEATRSQLALKLTSGSYFVPVHRVLAALLEHDTAETVRAKSIRIMAYV
                     VDTLRRLEFLTTTLLEQGVLANTVAIDSTTWSGALALVRGHVDRLSVPVSLKSLDVLE
                     IQASWLHLEVASLKRSPWSLEVDIAPDLFDCCLDTSAVDGEYLDVRMIVTESPVSSPG
                     AGSSAQVPAQAQRSAAVADPERRRHLILQYPQATAAYVQRSRWDLTRAAKMAMLLRDS
                     SLQRMPIRRTGSFSRLERLCPARFLVRLGTEVQLVITYRCDTQPHGYMVAFRHSRSAP
                     EFAIRIVEQVLNAQPCYTVLYGLLERTLPLALAAAAAFHGLAARYRFLSALRLRVAFV
                     AGNASSRPASTAHYVLELDAKEGNGLVRITDVGAQAARSSGAAPVAPLPHWRHVSDTW
                     TQRTGTSSDDSSFRVPLGELEQVLRMLLPTSTLV"
     gene            703311..705596
                     /locus_tag="CYME_CML271T"
                     /db_xref="GeneID:16994692"
     misc_RNA        703311..705596
                     /locus_tag="CYME_CML271T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461425.1"
                     /db_xref="GeneID:16994692"
     gene            complement(<705241..>706134)
                     /locus_tag="CYME_CML272C"
                     /db_xref="GeneID:16994693"
     mRNA            complement(<705241..>706134)
                     /locus_tag="CYME_CML272C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536834.1"
                     /db_xref="GeneID:16994693"
     CDS             complement(705241..706134)
                     /locus_tag="CYME_CML272C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536891.1"
                     /db_xref="GeneID:16994693"
                     /translation="MPRDRARRLARVERRALLLAERRKRRREAKARRKQRALQGEEPL
                     QRPRTLESTRVYRPELDWEQEPPFGEEDIRAVLRGERRPRVLLTTSVQPTGRQIYDLI
                     GDLLFLFPGSVYRERDQRTLEELCKAGIDQGFTDLWVIVQGKGLSLRYLQHVRLPDGP
                     VYLYRLSSVVCSESIPHRGTPTPLPVEVVTCNFQTNLGRHIERSLSALFPHEGTPQSR
                     QVVLVRNQRDYIFLRFYRYIFEASRDPEAAERVRVRTQELGPRFTLKLLSVRYPIDRS
                     RVAFSWRRSRVVNTGKRVFAL"
     gene            <706331..>707038
                     /locus_tag="CYME_CML273C"
                     /db_xref="GeneID:16994688"
     mRNA            <706331..>707038
                     /locus_tag="CYME_CML273C"
                     /product="20S core proteasome subunit alpha 2"
                     /transcript_id="XM_005536835.1"
                     /db_xref="GeneID:16994688"
     CDS             706331..707038
                     /locus_tag="CYME_CML273C"
                     /codon_start=1
                     /product="20S core proteasome subunit alpha 2"
                     /protein_id="XP_005536892.1"
                     /db_xref="GeneID:16994688"
                     /translation="MADSASSFSLTVFSSSGKLNQLEYALKAVQAGATALGIRAKNGC
                     VIATEKRLPSALADARTIRKVEAITAEIGAVYAGMGPDYRIMVKKARNAAQKYYQVYR
                     ESIPVHQLVREVATVMQEFTQSGGVRPFGMSMLIAGHDEEGPQLAQVDPSGSFFFWKA
                     TAIGKNMVNAKTFLEKRYQDDVELEDAIHMAILTLKEGFDGKMMEHNIEIGVVGAERR
                     FRALTPAEIRDYLGEVE"
     gene            complement(<708043..>709869)
                     /locus_tag="CYME_CML274C"
                     /db_xref="GeneID:16994689"
     mRNA            complement(<708043..>709869)
                     /locus_tag="CYME_CML274C"
                     /product="betaine aldehyde dehydrogenase"
                     /transcript_id="XM_005536836.1"
                     /db_xref="GeneID:16994689"
     CDS             complement(708043..709869)
                     /locus_tag="CYME_CML274C"
                     /codon_start=1
                     /product="betaine aldehyde dehydrogenase"
                     /protein_id="XP_005536893.1"
                     /db_xref="GeneID:16994689"
                     /translation="MHLDQPIHALPLTSGSVIAALVSALLGLILTRWLCKRGEHVPCV
                     TLGLPDLTEDGLFLIPVTADDQPGKPICCRKKTEADRCHRCAAAATGRLLGWVLDQSA
                     ADVRARVQVASDAQQLWRETSFAERRRVLRALRKAILANRESILQASVLETGKTFVDA
                     YLGELLTTLEKIRWLLREGERALAPEYRSVGPLTMHKRAWVQFEPLGVIAAIAPWNYP
                     FHNLMNPILAALFAGNAIVVKSSEYSSWCSVYYVELVRHVLRACKHPSELVQLVTGGA
                     SAGEALVVDKGVAKVFFTGSTRVGRQVAMAAAEQLKPCVLELGGKDAFIVCDDADLEQ
                     ALDIAMRGVFQNSGQNCVGIERILVQRPSYERFVAEMQVRVQSLRIGVDLGAMTMGEA
                     SLRELESLINDAVKDGARLLCGGKRAGRSYWEPTLLTDVPLHSRIMQNEVFGPVMIIT
                     PFDGDAEAIRIVNGSAYGLGSSVFSADRKRAAMIRNKLLVGMVNENDFGVNYLCQSLP
                     FGGTKDSGSDRFAGIEGLRACCLMKSVTQDRFWMLRTRIPKPLQYPVHHAAVDVIDAL
                     MRVIYMEDSIWGRALALRDFMLSGFRCATSITRASGAAGIEH"
     misc_feature    complement(709876..713105)
                     /note="repetitive element"
     gene            <714392..>716002
                     /locus_tag="CYME_CML276C"
                     /db_xref="GeneID:16994686"
     mRNA            <714392..>716002
                     /locus_tag="CYME_CML276C"
                     /product="chaperonin containing TCP1, subunit 5"
                     /transcript_id="XM_005536837.1"
                     /db_xref="GeneID:16994686"
     CDS             714392..716002
                     /locus_tag="CYME_CML276C"
                     /codon_start=1
                     /product="chaperonin containing TCP1, subunit 5"
                     /protein_id="XP_005536894.1"
                     /db_xref="GeneID:16994686"
                     /translation="MSLVFDEYGRPFIIFKDQDRKVRTKGLEAIRANVAAATAVSRTL
                     RSSLGPNGMDKLLVSADGDVTVTNDGATILKEMNVSNEVAKLMVDLASAQDDEIGDGT
                     TGVVVLAGALLEQAQQLLDRGMHPSRISDGFDRACAIAVDHLEKIAQVMEHTKADTSQ
                     LVRAAVTALNSKVVKRHSEALAHVCVKAVLAVADLERRDVNLDLIKIEGKVGGRLEDT
                     IFVDGIVIDKDMSHPQMPKQITDAKICILTTPFEPPKPKTKHRLEISSVEQYRELQHA
                     EQEYFTNMVKRVKDSGANLVICQWGFDDEANSLLYQNGICAVRWVGGVEIELIAMATG
                     GRIIPRFEEITPEKLGHAASVRELHFGTTHDKVIVIEGCRSTRAVTILVRGGNKMVLE
                     ETKRSLHDALCVVRNLIRDQRVVCGGGASEIAGAIAVAEAADCCLGPEQYAMRAFAEA
                     LDSIPIALAENSGLSPIETLSSVRARQIAERKPYYGIDCLGIGTMDMREQNVYETLES
                     KKQQFQLATQLCKMILKIDDMLQPNSLS"
     gene            complement(<716229..>717632)
                     /locus_tag="CYME_CML277C"
                     /db_xref="GeneID:16994687"
     mRNA            complement(<716229..>717632)
                     /locus_tag="CYME_CML277C"
                     /product="similar to heat shock transcription factor"
                     /transcript_id="XM_005536838.1"
                     /db_xref="GeneID:16994687"
     CDS             complement(716229..717632)
                     /locus_tag="CYME_CML277C"
                     /codon_start=1
                     /product="similar to heat shock transcription factor"
                     /protein_id="XP_005536895.1"
                     /db_xref="GeneID:16994687"
                     /translation="MTESVTNSVHGEAASRPPRDSSELSSIEAAWEKALMPPFVTKLR
                     AMVDDPATDDLISWRDDGLSFQVHLPSEFARTVLPRYFKHSNFTSFARQLNQYGFRKL
                     DSDHFVFGNRYFVRDHPEWLSKVTRRRPSRTLVRKESSPPHTAALEIGNYGFGPDSSV
                     SAPDVELLRRDKKLLLQELLASRHRQIELERKLRYSEQRIQQLESSVEQMKQFIYQSF
                     QLLLQQHGIKLDERKRKRLMNVPTEPVAGTAGRSIGSIEYKGDTGELMTDSVVESYPP
                     SSPPLQGQQPQSLTPTSQSLVLRNAHPESIELIRNLMAQLQMANMALRNTANPTVAVV
                     STSSDAERDTGLPSGEAPAWDESSNTAVNRQLQPDGPPAMPTDIADSRPKGPSILLLD
                     DENEPNPGMDTEAATESMHPGAGAPEEDFDLSQYVNVEDLLDVAGTESMTLPPGQDAD
                     MLAEEVRRLLEDTPEQD"
     misc_feature    718557..721124
                     /note="repetitive element"
     gene            <721158..>722084
                     /locus_tag="CYME_CML279C"
                     /db_xref="GeneID:16994685"
     mRNA            <721158..>722084
                     /locus_tag="CYME_CML279C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536839.1"
                     /db_xref="GeneID:16994685"
     CDS             721158..722084
                     /locus_tag="CYME_CML279C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536896.1"
                     /db_xref="GeneID:16994685"
                     /translation="MATSVSESELQLLPHWLSCIHAKRSTWTCSQDYARFVRLLRDIS
                     LELYVARNQPNVLVQLARYGSACTRVVNDLITVWSVPLLHESVSRAVIRFLVVCQTGS
                     GPEQVKRRALAWARHLLRLAVSPAINATFIDEGLGSARVVDELCTVIGAMGCQARIPA
                     ELGVLIPSLIQGACCADLVAALVPTIAAMLESQATSPAWRHAVRCAFTWEDAETKYCA
                     FRDGLSATLQNMLLAADAQLLCQCLQSPEALLKTPLDHLSERFDHIRLFLRLQHGADP
                     DTKASADDVNTVSTQNQSGPDLATTPRAGTMT"
     gene            complement(<722595..>723026)
                     /locus_tag="CYME_CML280C"
                     /db_xref="GeneID:16994704"
     mRNA            complement(<722595..>723026)
                     /locus_tag="CYME_CML280C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536840.1"
                     /db_xref="GeneID:16994704"
     CDS             complement(722595..723026)
                     /locus_tag="CYME_CML280C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536897.1"
                     /db_xref="GeneID:16994704"
                     /translation="MPIYTVFIINRSGGLIYSAQFQGSQVHPLNECLRLASTLHSVQQ
                     ISRQVSPVDILDDIGLTSLEAKTFRLRLYQPLTGIQFVAIATPEVTDEILLGILRRLH
                     LLYADYALKNPFYVQDMPIRCKLFDIHFMKLMKPYIANPVE"
     misc_feature    724504..727535
                     /note="repetitive element"
     gene            <727711..>729546
                     /locus_tag="CYME_CML282C"
                     /db_xref="GeneID:16994705"
     mRNA            <727711..>729546
                     /locus_tag="CYME_CML282C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536841.1"
                     /db_xref="GeneID:16994705"
     CDS             727711..729546
                     /locus_tag="CYME_CML282C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536898.1"
                     /db_xref="GeneID:16994705"
                     /translation="MEGDLHAASQEVSVTGARPPTSRRQRAPTASEPGSTPPEHHTAS
                     QSNVRAYRETLTPLPLGQLNSSSFQPGSGMGAAKHAASAAGFSAPNVGRSPHGVGTVN
                     GTIDRGLYAGATPTLNMYGGGYVGSGGMLLSPTLLVAAAAAAARSTSSSPHRSMVDSS
                     SPTLILAANHKNNMNRISTGISPHTNAYHLGANIPPQSGDGSAVAGSAPVPESSNSTP
                     FWIDDTNFDANGYIYASMSNPYGYGGGDSATVPGAGPYSGVSISPLPGFSIGSPYRSL
                     VPGTPHATMMWPAQHPTGTSVIQTSADLERDPRDTGTKQRMDRGLLPPCPSPDRKLIS
                     AWNRAQRREKMERERAQKRSLEQMRARKGSASSTSQREYERVSDTSPKTACAFPSEPF
                     EDSSGDTCEQPSVRIASEHSREDHSSAATSSAIQRHQSSWVPSQPSIRADQSNSHETS
                     GRAPSTRETRAQRNREAARRSRLKVKRLIADLEERNAAYAHLLRERENEIERLRRENA
                     TLQEQVAQCTAIRDVAGEASAEAPPSIPKHVLDPPVITRGTSKATTRSDDSPSRLVSS
                     EHEHLSALASVARDAQGAPPGTVNRSTSSGDVSAFAQLQEPASVL"
     misc_feature    729977..732492
                     /note="repetitive element"
     gene            complement(<734297..>735820)
                     /locus_tag="CYME_CML284C"
                     /db_xref="GeneID:16994681"
     mRNA            complement(<734297..>735820)
                     /locus_tag="CYME_CML284C"
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase"
                     /transcript_id="XM_005536842.1"
                     /db_xref="GeneID:16994681"
     CDS             complement(734297..735820)
                     /locus_tag="CYME_CML284C"
                     /codon_start=1
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase"
                     /protein_id="XP_005536899.1"
                     /db_xref="GeneID:16994681"
                     /translation="MSAPQSAFVSTVLLSGASCRTGSFLPLLEAGAARKRSAAAALHA
                     QQRRVRGARLPLCAKVVGPARPTAPIPKPKDALSDQSGLVNLDLTGSIPRRKTRAVRV
                     GDVYIGGGNPVVVQSMINEDTLDIEGCVASIRRLHEAGCEVVRLTVPSMAHAHAVGFI
                     KQRLRETYRDVPLVADVHHNGMNIALEVAKHVDKVRINPGLYVFEKPDPNRTEYSRAD
                     FEAAAQKLKETLKPLILSLREQDKAMRIGVNHGSLSERMLFTYGDTPEGMVESALECI
                     RVCRELDFHNLVISMKASKVPVMMAAYRLLAKRLDQESMDYPIHLGVTEAGDGEYGRI
                     KSSIGIGGLLAEGIGDTIRVSLTEDPVKEIPVCYGILQALGLRRTMVEYVACPSCGRT
                     LFNIEEVLHKVRDATKHMPGLSIAVMGCIVNGPGEMADADYGYVGKTPGKISLYRGRE
                     EIRTVPENQGVAELIKLMKEDGVWVDPPASPNASTEPKHDGSSKPATASRQPQASSV"
     gene            <737305..>737916
                     /locus_tag="CYME_CML285C"
                     /db_xref="GeneID:16994714"
     mRNA            <737305..>737916
                     /locus_tag="CYME_CML285C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536843.1"
                     /db_xref="GeneID:16994714"
     CDS             737305..737916
                     /locus_tag="CYME_CML285C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536900.1"
                     /db_xref="GeneID:16994714"
                     /translation="MKKALALLLVGMMATAGVAQASEVMENEGAVFEEAPLETTEHMY
                     YQDNKKPFYVNNQPSYKPKYKNYYQKKNFYQKQTYIYTKQPIYTKQPIYTKQPIETKQ
                     PIYKKQPIYTKQPIYTKQPQYEKSYQPQYKQKEVKTYIPLKEQKQQQVYQKQNNYQAE
                     KEYYALKKQYKGEQQKKYQNEKKKPYLSKKKFYGEENNNQYYW"
     gene            738478..740614
                     /locus_tag="CYME_CML286T"
                     /db_xref="GeneID:16994715"
     misc_RNA        738478..740614
                     /locus_tag="CYME_CML286T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461426.1"
                     /db_xref="GeneID:16994715"
     gene            complement(<739531..>743928)
                     /locus_tag="CYME_CML287C"
                     /db_xref="GeneID:16994712"
     mRNA            complement(<739531..>743928)
                     /locus_tag="CYME_CML287C"
                     /product="helicase-like protein"
                     /transcript_id="XM_005536844.1"
                     /db_xref="GeneID:16994712"
     CDS             complement(739531..743928)
                     /locus_tag="CYME_CML287C"
                     /codon_start=1
                     /product="helicase-like protein"
                     /protein_id="XP_005536901.1"
                     /db_xref="GeneID:16994712"
                     /translation="MRTKQARPRRRPYTNEGVVQTETTQVAPRRLEAKRPRSLAPAQA
                     CTETWLDIEPAAAADSNWFAVGMLDGLGQHQVETFTDSAVLHLRASENVPALSGSQTC
                     WSLRFVSTGCAGADCKPPMRARKRKAPDDAEQPEAVSLGPVPAALVESVTRLCQRKIL
                     TLAPIPEPIPSFLVLVHRERCLAASLRQEVLRRDLHQVLSWWHPQVALAEARLQPTAA
                     YAPANVGWCFRSARGVVNVQVAPRAADERSLWGEAPWVYEAMRRLPSDVDAVPEASPG
                     APHGAASRPLVSPEVPGLRPRLRPYQCRAVTWMLERERHGIAWESLAPVCIPDTRGGG
                     EYAPLLFHALESVATAASTSGIDTIPEHLVYGGMLCDEMGLGKTVELLACILLERAQR
                     PVAGNASGQSDDHIPEDGCVRQSKRVCCECGRFQNKPLVHALIVGRARKRYFCEDCAE
                     LLHSDTPLPSKSTLIVCPSIILRQWESEIRKHVEDASLDVVVYQGLHRETYQRLRRLR
                     RADVVLTTYDALRADVNRAHENILRPRSLRYEKRYRVAPTPLTRIEWERVCLDEAQMI
                     RGGVAAAAAMALQLHAHKRWCITGTPVRRSVDDLESLVRFLRFEPFCEPEIWRKWLIR
                     PCERNGSGASLRLAQLIRALAWRSQKADVWMELNLPPQFEIMQNLSLGPVERHYYNRQ
                     HETCVSFVQHLLNARVAKYLEEPGSLLKSASRRGYGLVRSVLHHLKVLRQACCHPRLA
                     PGGFGGSSTGTGLEANMMTMDQVLDVLIQRARLECEEAQRSLVASLNGLAAIAWLRGQ
                     PADAVRLYRAVLQRAQEPKQANFVEIDPLQRYHVLVNLAQVLEKHPAERLDFGVTLRD
                     DCLRSDADALREAYLRERREQVQNARRQLQRLSSELERCAHAAPVRLWWMTALDAIER
                     ADCGQWLLDRLEEDGIVRQLLGGTQTLSLKALRYALVRSFDALEQSRRTLLDRLLSLP
                     GNGDAEPSEAEVRASGTCRQCREDMLGEPCRHCESEDLFDAYERCLFAVRTRLVNASK
                     APDATTGDRLRRAAAVITEGDGGVRLASELERALRFIAAALRRLDADADTGVLGESAA
                     KEWERFALLKKEFTHAHVYFRAQKDYLGALDELIMAATRITLRAPGEQVSESERRYRI
                     LEAEIESTALALELDRRLAEEQSDRKKGQLVYLQRLKSSCVEDLAAKRQEPCPICYRQ
                     LGSELVLLPCGHCFCIECTSSYLEARVYRQHSRSLPCPLCREVCNTREVSFIQTGAAS
                     SQSAMAPIKGSFGAKIEAVVRDLLFIQEYATRQVAERGPVPDATHRCVVFSLWSELLQ
                     ILSAALERNNIPHVIGDVEAFRGRREPMCALLLPIRIGANGLNLVEARHVFLLEPLLD
                     PAAELQAIGRVHRIGQTCCTYVHRYVVQGTVEEQVQAISASHVWQQQQQQQQHQSTGQ
                     CRARPPADMLDTHALTLADLRSMFEPAGR"
     misc_feature    744009..748239
                     /note="possible transcribed region"
     gene            <749874..>750929
                     /locus_tag="CYME_CML289C"
                     /db_xref="GeneID:16994700"
     mRNA            <749874..>750929
                     /locus_tag="CYME_CML289C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536845.1"
                     /db_xref="GeneID:16994700"
     CDS             749874..750929
                     /locus_tag="CYME_CML289C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536902.1"
                     /db_xref="GeneID:16994700"
                     /translation="MTSTELKTPVQPRRVEFAKQPLSNGTELDRLPLVEAPDSAERAP
                     FATAVGPASTARTSLGVGMQHGHDASTLGLSSSRTPARNTSNTSAADWSVEGTPSAPE
                     TRSWHRNWGGYGRFQRQRLSPLDSGYSTGPSVRSAGGRAPPNTSWLDTETPVSSRLGA
                     GAETTGPALARGLFTPGLRTTLDADRSSPLQESELACWVTVFGFAPGQQSQVLRELRS
                     FGPVLEHRLRKGNWMHVRYESPLQAQAACSRSSRLLNDVTMIGIVPCTEPETILHEYA
                     HKALSDRVQSAQRAPATTLLSQTASSMESGQKSWISAPNRSQYPETELGTGDKPALPP
                     APKRSLLGRLVDTMLNW"
     gene            complement(<751393..>752589)
                     /locus_tag="CYME_CML290C"
                     /db_xref="GeneID:16994701"
     mRNA            complement(<751393..>752589)
                     /locus_tag="CYME_CML290C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536846.1"
                     /db_xref="GeneID:16994701"
     CDS             complement(751393..752589)
                     /locus_tag="CYME_CML290C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536903.1"
                     /db_xref="GeneID:16994701"
                     /translation="MIEGVCPFDLGLRQPGEWASHANCWIGWPERPDNWRLGAAPAQR
                     AVAQVVAAIAELEPVTVVCSASAFIQACALLVDHPSSPGQCAQYPVRVVELSTDDCWL
                     RDTGAVFVCGAEPENAAQGAGVHFDFNAWGGAQGNCYAACSLDQLVAKKMLLLERLPR
                     FWCPMVLEGGSISVDGEGTALTTAECLLNPNRNPTYSQNDIEKQLRAYLGITKVIWLP
                     YGIEGDVDTSGHVDNMAVFIAPAKVALHWDPADHRCQAAHRVLAQSVDALGRSLEVVL
                     VPAPPALYRQPDEVPQVQPHQPHPEHADTSEPGASDSDSYQRRAGERLAASYVNFYRA
                     NGGIIMPGFGLPESDEAARAALQKALPQIQVVQVPVAREILLGGGNIHCLTQQQPVIS
                     EPIPWR"
     misc_feature    752998..753836
                     /note="possible transcribed region"
     gene            complement(<754472..>754852)
                     /locus_tag="CYME_CML292C"
                     /db_xref="GeneID:16994745"
     mRNA            complement(<754472..>754852)
                     /locus_tag="CYME_CML292C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536847.1"
                     /db_xref="GeneID:16994745"
     CDS             complement(754472..754852)
                     /locus_tag="CYME_CML292C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536904.1"
                     /db_xref="GeneID:16994745"
                     /translation="MLPQLYRTLSRRLRQVTRDCELRSVRQQALRACFKDCSARFESL
                     SERAVPSSMPTPSPAIADEVLRWQSAVDELSQLHERYDIACVDKTDDTARGWQQTMRE
                     LAAARCALRMPSRAHPERTRSATD"
     gene            <755335..>756807
                     /locus_tag="CYME_CML293C"
                     /db_xref="GeneID:16994741"
     mRNA            <755335..>756807
                     /locus_tag="CYME_CML293C"
                     /product="probable chaperone protein DnaJ"
                     /transcript_id="XM_005536848.1"
                     /db_xref="GeneID:16994741"
     CDS             755335..756807
                     /locus_tag="CYME_CML293C"
                     /codon_start=1
                     /product="probable chaperone protein DnaJ"
                     /protein_id="XP_005536905.1"
                     /db_xref="GeneID:16994741"
                     /translation="MQRLGLRLTETLAKQIRRSFHFSPELQCLRQVRTSPSSGVLPLD
                     AVPARPNAVWSAPVGTLQSLQRCACQGRTHTRSLSVVSTSAAGSTAVAAAPRDPYEVL
                     GVPRNATLAEIKKAYYRLAKEHHPDSGGDKSKFAEINAAYELLSDEKKRKQYDRYGFR
                     EDGEGASASGFEYAPGSGAEDILRQFREFFGSMADETASGAGPMGSGFGFFARGADVE
                     VPLVLSFMEAARGTEKTVQVSAAVECRACRGTGSSGGRTEWSPCAQCGGTGQESYQRG
                     FFAFQSTCRRCGGSGRRLRNPCSTCTGSGVTPGLRRVAVRVPAGVDSGYSLRVSGKGE
                     AAPHGGTPGDLYVRIQVEDDPYFHREGPHLHVVAPISFADAALGGAVRVRTLDGEAEV
                     KIPPGTQPDDVRVMRAKGLPRPGIGTAERGNQYVHFRLRVPTSLTSRERELIEELRQI
                     EQQRRGNRPSEAAYDSDANEEAGSKNFFRRLKSLFATGGA"
     gene            <760682..>761821
                     /locus_tag="CYME_CML294C"
                     /db_xref="GeneID:16994742"
     mRNA            <760682..>761821
                     /locus_tag="CYME_CML294C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536849.1"
                     /db_xref="GeneID:16994742"
     CDS             760682..761821
                     /locus_tag="CYME_CML294C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536906.1"
                     /db_xref="GeneID:16994742"
                     /translation="MVLHQLRKLSWEHGFGNFHQYQVLLHRRTCTAPRRAAFLASCPR
                     CPENLSASERGCLLASRGDGSTCNPLALERRHWFRTCKTRLRALSMHQERGEADSRAR
                     RSQGQNRRRSQRSTPAALPAQGTRVARHAAATLRPDQARLFVAFEAPVAFTEAASSAQ
                     QFLLDNWSINTGVASETDGSKVPALPPVRWTSPDSWHITLHFIGTTARERIPEVLDRL
                     NALAKQHHQVTLMITTVAALPPLTSQKPLRVLCLELEEVVDRDEMRTLSSFVAGLADQ
                     LAPFHLDTAAVDLQGIPRQTQYRPSNASPKPYMPHLTLGRVKDWASSASRARLRQLVQ
                     HASAGAWKPSEGSTVRFTQFKLYESVWDQTNGPPSYKPIATFELG"
     misc_feature    complement(760844..762327)
                     /note="possible transcribed region"
     gene            <762442..>764001
                     /locus_tag="CYME_CML296C"
                     /db_xref="GeneID:16994739"
     mRNA            <762442..>764001
                     /locus_tag="CYME_CML296C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536850.1"
                     /db_xref="GeneID:16994739"
     CDS             762442..764001
                     /locus_tag="CYME_CML296C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536907.1"
                     /db_xref="GeneID:16994739"
                     /translation="MSVVILHVYDLSGGLAATWSPVLLGVQIEAIYHTGVVVHQREYY
                     FGGGIQQGAPGQTPYGRPWRALPLGETFVDVETLHDFLVGISGRYRIETYDLLTNNCN
                     HFADELCRFLVGKGIPSDILQLPRRVLDTPLGPLLRQLMRPVEFEPASSNLSLPGGSG
                     LPPATSQPESGQPRTRDASRPLETTDARAFPARSSETALLAADARPHEHASVIGNDAV
                     SSSSTAFMAGPEASGHEQQQPGLVRDLSSGEATAGGGASHVLPLRGSLGTSLPFSRTP
                     CCCRQAVRQMQVDVLSQGQAQMTLAREIAKVAEQGTTELLQWLCSCCSQCAGCRAWMV
                     ADHALFWQIIAKSWHTDGRSTELRLLLDILATLLQDETSARLLLATDTDPEWIRWLVH
                     ALDPIPHTERQVWVQAGQTLQTLGRAIHQLVAPSEQEHLTALLLWEFMEDLEVWGPAL
                     QSEDEIGVILMQFLEDLFRESPISVELGRSMGLLQALNGFLPASSCMRLRHLLDESAT
                     VGNYENEHQIS"
     gene            complement(<766088..>766855)
                     /locus_tag="CYME_CML297C"
                     /db_xref="GeneID:16994740"
     mRNA            complement(<766088..>766855)
                     /locus_tag="CYME_CML297C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536851.1"
                     /db_xref="GeneID:16994740"
     CDS             complement(766088..766855)
                     /locus_tag="CYME_CML297C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536908.1"
                     /db_xref="GeneID:16994740"
                     /translation="MAERLRLEQAQPYPSPRAEPDTRFPEGTTQPGTRAVPPGKSPGL
                     GRAPLPTLPGNRLRDSERPDFLERLMSRLERQRQRPRTAHHHLDFYIRVAESKQRCRV
                     ELKKTLAVYSWLALKPAVFFRPLHNQPWDEPRWSLRLDVKLKRIVKVRLLPLTENFWE
                     ASIDIPVSRWQTDVQVRYRQDTMSFRKPEQAWRLTIRRAPFRLRLFFGTDHPSSIDYT
                     YRYVGHEMSATTFRGAWRFDVNPQYMAQYSAELKRRF"
     misc_feature    complement(766526..768210)
                     /note="possible transcribed region"
     gene            <768794..>770140
                     /locus_tag="CYME_CML299C"
                     /db_xref="GeneID:16994737"
     mRNA            <768794..>770140
                     /locus_tag="CYME_CML299C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536852.1"
                     /db_xref="GeneID:16994737"
     CDS             768794..770140
                     /locus_tag="CYME_CML299C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536909.1"
                     /db_xref="GeneID:16994737"
                     /translation="MIGNALSQGRKLWIFGGTRRERHEAVRRAAAELGVRLCWLSAPQ
                     CVEKGLQTCLRRIAAELAQQPGALVIMDWERIAAWYRLYGERFHIDSFPDEFGTSSPG
                     TATEEVLIMRLGAFVGVVSSAVIVTCATLVPIALRWFEPAALLPLNVYGASWSDQGNQ
                     DTVNSHALQNAAGGELRYSGLWLRMYRDNNGALARIRRMLLPTTTELATWRRFGVAMP
                     RCVLVHGPPASGKTALVYAFADLAAERGIPCHLITRSNLYSGYLGETERELRQLFRPV
                     SAEVGARRPILCFDDIDLFFSCGRSQGAQQTTDDALATTDRFTSRLLGTLLSEIDGAL
                     ESNTKDNLSAKLLLTATELDALDAALLRPGRCDACIALASTGAPEPRSIRPSRLETRT
                     CQASGTAERAPGADTSPRTTLWRVRAQRLASWERLLGSTGQAHDVPDEKVGAENVL"
     gene            <771910..>773865
                     /locus_tag="CYME_CML300C"
                     /db_xref="GeneID:16994707"
     mRNA            <771910..>773865
                     /locus_tag="CYME_CML300C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536853.1"
                     /db_xref="GeneID:16994707"
     CDS             771910..773865
                     /locus_tag="CYME_CML300C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536910.1"
                     /db_xref="GeneID:16994707"
                     /translation="MSLDGTTGELSSGGQAHGTAQVQPVHLELSAYYGLAPPATGTDT
                     SQATTPGAGHSPGGTRRATAALTTTDASQPSRQLVQEVLARASIGELLSEAQAFQVQA
                     LDAETALQRAALRLFEDYDEAARWCFAQGQVLAELRRSLQESQRGLEVVSDLCNKFSD
                     HSEDLQDALDTLEKKLRLLQLIRVTGFAVPMFQAQLAQGDIEAVAERYALLQEALLSL
                     GALHRAFDRLYSRLKLQIGLQLERALREGLEKYVQLRWTQVWQRASTAELSAVAEASS
                     DATLLSCTRIEAALQRAHGQQRNSLVDQVRTLLSQVLGLERTVPASLWEPVITSMLNP
                     LYALVEEADPVAAPGLVSDWLPRWLERFRETIALDPSPAALEALCKAVAAMPSVWRRT
                     LASALPALLEQSLNERLAAEVVPLWREMLLLLAEVPWSPPLYHRIQSQGEQLVTLLEQ
                     HLEQAPASFQVLFEHFGEDPSESAASHPLAGATAETVPLVHRSAAPAVDALAQALYGR
                     LVSEVWLSVQGGSPLAVAFLLLAVLGGRFLADPAIEQAHMNRYMRLRALQATHELLEH
                     GLESTKVSALGEQLARESAVASALVTTGRKRTRARRTPSDLQPRSLDLAVPPEQIRKR
                     VEACVRYWQRYAVVATKPFSNGSAAAG"
     gene            complement(774094..776148)
                     /locus_tag="CYME_CML301T"
                     /db_xref="GeneID:16994708"
     misc_RNA        complement(774094..776148)
                     /locus_tag="CYME_CML301T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461427.1"
                     /db_xref="GeneID:16994708"
     gene            <777222..>778487
                     /locus_tag="CYME_CML302C"
                     /db_xref="GeneID:16994731"
     mRNA            <777222..>778487
                     /locus_tag="CYME_CML302C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536854.1"
                     /db_xref="GeneID:16994731"
     CDS             777222..778487
                     /locus_tag="CYME_CML302C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536911.1"
                     /db_xref="GeneID:16994731"
                     /translation="MSHFPSATTDGSPQQRPRSGTRVGEQPPANIFLYAPRMRTELPD
                     PPMDLKLLPVLRSERVLGTASATESSAESIGASSEPSSAAAAAAAALASKAVELWEEE
                     RSALERLAVCVEGMRPAGGMWLLELAAAFADTLDVATAPGVNPQTTALPWTYRPLQGA
                     AAELVRNESALAAVYAPVASESNENRVDQSSLARSLEHVALGANAMEAALPGLSARNA
                     QWMRPPQYDEFLSLKAGGAPEVSGVLRPEAMAHSTAEGDAKVHDSLNAAALAADALAI
                     EAEFEAATQLDENLAALKYPHPSPEKRASGGERLRAIKSFPIVPDEQLWEEPCGLLSF
                     LEVPMTWQTHPMTYGVAQVDSTVPTLVFFGENLTDATEAQTPVDRFAYQLDTPESARE
                     LAGFVCLHFSGNSACLAPVSFRVRPQLHA"
     misc_feature    complement(777726..778388)
                     /note="possible transcribed region"
     gene            complement(<778921..>779262)
                     /locus_tag="CYME_CML304C"
                     /db_xref="GeneID:16994734"
     mRNA            complement(<778921..>779262)
                     /locus_tag="CYME_CML304C"
                     /product="60S ribosomal protein L35A"
                     /transcript_id="XM_005536855.1"
                     /db_xref="GeneID:16994734"
     CDS             complement(778921..779262)
                     /locus_tag="CYME_CML304C"
                     /codon_start=1
                     /product="60S ribosomal protein L35A"
                     /protein_id="XP_005536912.1"
                     /db_xref="GeneID:16994734"
                     /translation="MGQQPVRVYCKGVILGYRRSQRRQYPNQTRIQIEGVRTRDETTF
                     YAGKRVAYVYKAKRARTTTRGRVTRYRCIWGRIIAPHGSSGCVRAKFATNLPPSAIGK
                     AVRVMLYPSRV"
     gene            <779665..>780102
                     /locus_tag="CYME_CML305C"
                     /db_xref="GeneID:16994735"
     mRNA            <779665..>780102
                     /locus_tag="CYME_CML305C"
                     /product="60S ribosomal protein L27"
                     /transcript_id="XM_005536856.1"
                     /db_xref="GeneID:16994735"
     CDS             779665..780102
                     /locus_tag="CYME_CML305C"
                     /codon_start=1
                     /product="60S ribosomal protein L27"
                     /protein_id="XP_005536913.1"
                     /db_xref="GeneID:16994735"
                     /translation="MVKFIKPGKAVIVTSGRQAGHKAIIVRCYDEGGSTRKFNHALVV
                     GVERYPLRVTREMSEKRIAKRCRIRPFVKFVNYVHMLPTRYNVDFYDELRQVLPETLG
                     LGTADDPWTTLESRRSCRIAVKKILEQKYLTGKYRWFFTKLRF"
     gene            complement(779919..781848)
                     /locus_tag="CYME_CML306T"
                     /db_xref="GeneID:16994726"
     misc_RNA        complement(779919..781848)
                     /locus_tag="CYME_CML306T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461428.1"
                     /db_xref="GeneID:16994726"
     gene            <782544..>783623
                     /locus_tag="CYME_CML307C"
                     /db_xref="GeneID:16994727"
     mRNA            <782544..>783623
                     /locus_tag="CYME_CML307C"
                     /product="replication factor C subunit 4"
                     /transcript_id="XM_005536857.1"
                     /db_xref="GeneID:16994727"
     CDS             782544..783623
                     /locus_tag="CYME_CML307C"
                     /codon_start=1
                     /product="replication factor C subunit 4"
                     /protein_id="XP_005536914.1"
                     /db_xref="GeneID:16994727"
                     /translation="MARGDDHATQPWVEKYRPRRLDDVTQQHETIRALKQLLYGSGGS
                     SLTEKVASLPHLLFYGPPGTGKTTTALALCRELFQNITNRETLQNRVLELNASDERGI
                     RVVREKIKRFAQSSIEESVDAQVPGFKIVILDEADAITADAQTALRRTIEVHSRTTRF
                     VLICNYLSRVIPPLASRCAKFRFKALEDGAVIARLEHIARTEGMGPLPPEASRLLAKA
                     AAGDLRRAVNLLQSCADWARSADGSQRVLEPEMVSEAACMVPASVVERFYDICVSRNE
                     PVTACFEVLRGGYPVDELLRQTLELLLLDSGTPPAQVQMNDLQRSAIALHMACAEKYL
                     CDGATEAVQLLAFVANCRSVLQASS"
     gene            complement(<783573..>783977)
                     /locus_tag="CYME_CML308C"
                     /db_xref="GeneID:16994728"
     mRNA            complement(<783573..>783977)
                     /locus_tag="CYME_CML308C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536858.1"
                     /db_xref="GeneID:16994728"
     CDS             complement(783573..783977)
                     /locus_tag="CYME_CML308C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536915.1"
                     /db_xref="GeneID:16994728"
                     /translation="MQALLQGCHSSSKIHRSMFSENSYAGAVSRSLLSCQIRYPPMLW
                     PCVSAVLQVNGLQAVFLKWSAREAALWARPCCKLSRGTDSCSGIANRRHNNMSEMWRP
                     PRDSMAHARRSVEATRSRRCLQDASAVGNECQ"
     gene            complement(<784276..>785010)
                     /locus_tag="CYME_CML309C"
                     /db_xref="GeneID:16994729"
     mRNA            complement(<784276..>785010)
                     /locus_tag="CYME_CML309C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536859.1"
                     /db_xref="GeneID:16994729"
     CDS             complement(784276..785010)
                     /locus_tag="CYME_CML309C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536916.1"
                     /db_xref="GeneID:16994729"
                     /translation="MSEHKRHVKSMLLREARERVGSAFVLQAQLLSRWVQCSGDGVTR
                     ARVQPLDTRALGARRRNRQNGTHCHFAIRRLYMQKKPKTKARRRSAPAGRVKDGTEAD
                     GAPQWTSPPEALEHTSSALPLVVAERMQRRMVVFAGVPFLLGLSAFGVFFFLKYRYDV
                     VVIPPVVGYATLGLFGVSLFGLTYGIMSASWDAGRRGSLLGWDEAQRNLLNTIDAFWR
                     ARSRERLDDLDSTKDDAHTERPRRKP"
     gene            <785400..>785957
                     /locus_tag="CYME_CML310C"
                     /db_xref="GeneID:16994730"
     mRNA            <785400..>785957
                     /locus_tag="CYME_CML310C"
                     /product="BTF3-like transcription factor"
                     /transcript_id="XM_005536860.1"
                     /db_xref="GeneID:16994730"
     CDS             785400..785957
                     /locus_tag="CYME_CML310C"
                     /codon_start=1
                     /product="BTF3-like transcription factor"
                     /protein_id="XP_005536917.1"
                     /db_xref="GeneID:16994730"
                     /translation="MSGGGGGGGGGDAPDAIAVGNEAATVNRERLLRLQRLSEQVRMG
                     GKGSMRRKKKATGVRPGATDDKKLQAVIKRLALSQIPQIDEINMFKDDGTVLTFALPK
                     LQANISANTYVLSGSAPQQRRLEELLDDVGVLSQLGPENLAHIQQLMQQLSTQEKQSD
                     DVPQVPDADFEAVATQAADTTASSA"
     gene            complement(<787680..>789506)
                     /locus_tag="CYME_CML311C"
                     /db_xref="GeneID:16994720"
     mRNA            complement(<787680..>789506)
                     /locus_tag="CYME_CML311C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536861.1"
                     /db_xref="GeneID:16994720"
     CDS             complement(787680..789506)
                     /locus_tag="CYME_CML311C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536918.1"
                     /db_xref="GeneID:16994720"
                     /translation="MFYAQQVLTRKGPLAKIWLAATFQSKLTKAQVFTTDIVNACQQI
                     AAPEIPMALRLSACLLLGVSRIHQKQTGYVLEEASDALTKLQLTYQMTDGRVAGGTVS
                     GSQGVGAALTSASATAAYGSITFSEHVVGAAEATRTVASADAGEQHSASALLLLGDYW
                     NGLLGFGYPASAGTLANDAFAGQPFASEAGADLNPSPFHVDAQQITIDPLFGNESFQS
                     SARPVEVVRRDEEAEHLRAPTPVAGSPPAAGIGGYPKSSTEDQALTPEQFRSVPLTLP
                     EPPPLDLSLPTVQPEGATYAAAALDWSLAAETAVPTSSLRRDSAEPSSKFLDETGSIM
                     NTSTLHRQKRRKSTGRRPLAPQYHVDSQLELATAVIRRALADTTDTLRRPIIDDSATE
                     LDGISKLTDLLQRIVPSQGAQVHSHIQKYWTDLSQAATAEPRDGNDTATLAHAHEEQR
                     SSALEPAAASPVLGTLDDSNFSFGLPTTEISRLSALSAGASPVPGDAAEVGPLRLERA
                     MASPAKLLSSWSTPGAHSSAAASPSIVTHRTERLLDYLVAKCREQPQNEALSIQKLWH
                     AEAASRRVIARSMLELLVLATQQRIVVQQAAPYDDIEIRVMV"
     misc_feature    complement(791621..793334)
                     /note="possible transcribed region"
     gene            <791684..>796996
                     /locus_tag="CYME_CML313C"
                     /db_xref="GeneID:16994722"
     mRNA            <791684..>796996
                     /locus_tag="CYME_CML313C"
                     /product="similar to ATP-dependent RNA helicase"
                     /transcript_id="XM_005536862.1"
                     /db_xref="GeneID:16994722"
     CDS             791684..796996
                     /locus_tag="CYME_CML313C"
                     /codon_start=1
                     /product="similar to ATP-dependent RNA helicase"
                     /protein_id="XP_005536919.1"
                     /db_xref="GeneID:16994722"
                     /translation="MLDTGPPAPPQSILHNFSASGYTAADDCPDELLLAALEKSGNQA
                     STAVGVPQAPFNNERINETALEFPLCARDERPAAVPQAPFNNERINETALEFPLCARD
                     ERPAAVPQAPFNNERINETALEFPLCARDERPAAVPQAPFNNERINETALEFPLCARD
                     ERPAAVTLDEEAANSWTFPGALHIREYQFNIVRRALTRNTLVCLPTGLGKTLIAAVVM
                     LNYMRWYPDGIVVFVAPTRPLVHQQMKACYQSAGIAPQLTAELTGHTRLAARRALWHS
                     RRVFFSTPQVMLNDVLRHICPVQRIVCVVFDEAHRATGRYAYCGLVSEIERSTGGCFR
                     VLALTATPGSSANAIQQVIHNLRIAHLEFRQESDPDVLPYTYERQVRVERVPLDAAIA
                     QVLGAFQRSLASTLQKLCAHGAFYQRNPEKVQHYQLVIAQRRWIEASRRQQTSNVNAS
                     RTLPVALFRDFAHALLLSRSVELLRSQGLGTCVRYLEQERTAQAKGNPRSPNELTRRS
                     ELQELHLRVKQLLEHGTRHPKIERCKELVVQHFLRHGSSASTRVMIFVQYRDVVAELE
                     AALSQAAPTVRPASFIGQANSGMTQADQHRIMRLFRQGALNCLVSTSIGEEGLDIGHV
                     DLIISFDALGSPIRMLQRMGRTARARAGQVIVLVSESAESQRFEEMNRRANGIAETLR
                     DKYSKFKFFKESPLMLPAEGQPIRCQVLPLTAMPALESQSQEPERPRGEAGSTQAPPL
                     SPRLERLLVLCVNSNRSMDWMKRRPLLALSASRDTSTEAAQIVLNESRSIEAQYRVRC
                     TSTTSMLWIRLHRLVQHFLTGMQASEVPICFERRQGIVGPGRCCTDWRRSRELALDVQ
                     PVPCRASAERARALLETGPAEAARAPLSDFQLTSDASQTGPPHSESAHGEPIIPMCST
                     SVRIDATASAPAAGTGAVASASAVYSCSESARCDAHSDPTLDTARYASSPWNALFPEP
                     LSTPADASDRVGAPRGSLDAASNTSSTSSVVEIPTPPELVSRAQQECPAAIPSSDSRS
                     SSSSSSASYSLCIAGSCSPHGTRGGHESVRSTRSSTPACRIDEFISNTGLWHSSSVAV
                     QSLQREANATFRPTEHPDIPSDHGAFSEALQGAAHNANTGSVACHVSAARECATPDVP
                     EEVASSDIYWDEVLYRTAALAEETIHGQSCRCRASPQQLNAHSPKTAHLGSPAHASVQ
                     HRGGGTQSASPQTYAQHCPGYPGEAVTPGAPPSFLDDNGSLNSVGAPARIPTKRQRAH
                     LRRAQASDTGTPVQSPSGGSQCVCTRSSARSHRVAALEHSPAILTPFLHHRAARRPRL
                     VRISDAASQVAQGTALSDALPSGSASRCLEVAEASPRISARLGSVAQRPRAAGTRSAP
                     NKRIRRKRRRELVAAFIDDQAEVSSSEGNASVDPDVAEALRGTDGDSTSPDTDTPGSL
                     RAFLTSQATSQSTGEQRRQRAMYWRSLRSPQLHSPLSAQVEHSLTTTTTDHRASIVQS
                     GASSETTSRHGMLAGLNEPSEGTATEPVASSPDTPCYRCGRSQDPERTLLCDRCDIEC
                     HTYCCDPPYASVPSGSWYCPRCEAYQRNVRILVHSRNLNHPLLTAVREQLARSYPLSG
                     LVPCAGLEADYVVSPRVAVFFLGPESGRTPNREQWFERLERAASRYTRIFVCWVWTSP
                     IQLSPRGLPAVLNTNATLLRCSGIAQAAERITDLALLEHRSGYGLAWVPLSWPDRFQM
                     ALGFLQKAADMSFLHAMLLLLRHGNGMDALRDWYRHEGAAMATT"
     gene            complement(<797217..>798350)
                     /locus_tag="CYME_CML314C"
                     /db_xref="GeneID:16994723"
     mRNA            complement(<797217..>798350)
                     /locus_tag="CYME_CML314C"
                     /product="similar to RING zinc finger protein"
                     /transcript_id="XM_005536863.1"
                     /db_xref="GeneID:16994723"
     CDS             complement(797217..798350)
                     /locus_tag="CYME_CML314C"
                     /codon_start=1
                     /product="similar to RING zinc finger protein"
                     /protein_id="XP_005536920.1"
                     /db_xref="GeneID:16994723"
                     /translation="MGNVNSQADVHVAQRFGDGPGNDAPEARVLGPRPVPAVETSPGN
                     LVPQPGAVDGLPPTGTVSWQRPGGDVNQGSSSGLRWLQGGAERSTQPVPTMVHAYTIK
                     NDLNVRKKSVRLVRDPENPQQFLLEFVFDATCSGLCTVFFMAKDLTNRTTRVEQFHVE
                     PLEPVPPVPTPFEAGMGQRYRQNSHRGFVPSRYRESFLFEQNPAKLAKHRYPIVILLQ
                     RLESAEDLAKSGHRQVQQSAGRSTDTDPNGGSLVRFQATYVTLCMPPKGLELADEIPV
                     KVVQQKILVDGTIYELQEIYGIEERMASADDSDAAAAEAEHDDLCIICMTDPRDTTVL
                     PCRHLCLCVDCAQLLRVRSDRCPICRSPVDSLLHIRNLRANAR"
     misc_feature    798758..801407
                     /note="possible transcribed region"
     gene            complement(<800177..>800935)
                     /locus_tag="CYME_CML315C"
                     /db_xref="GeneID:16994719"
     mRNA            complement(<800177..>800935)
                     /locus_tag="CYME_CML315C"
                     /product="similar to transcription factor DP-1"
                     /transcript_id="XM_005536864.1"
                     /db_xref="GeneID:16994719"
     CDS             complement(800177..800935)
                     /locus_tag="CYME_CML315C"
                     /codon_start=1
                     /product="similar to transcription factor DP-1"
                     /protein_id="XP_005536921.1"
                     /db_xref="GeneID:16994719"
                     /translation="MRSGRPREEKGLRHFAVRICHKVEQKGETTYNEVADELVAELLQ
                     GNNGVALRDPASEEKNVRRRVYDALNVLCAIGVVHKDRRAVRWHGLPRASVREQSLLE
                     NELSRLSSSVRDKDGRIQRYRTIVRALERLVQRNMRGAAVASSGRPRSASLQGDSAVR
                     LPFLLIATDPDAAVDIDGDEPGSDRCSFTFNRPFQVYDADGVLLELDAMICNSGARQD
                     SASVPATTNCALGSNEASASTSASATAAASEPPL"
     gene            <802262..>803008
                     /locus_tag="CYME_CML317C"
                     /db_xref="GeneID:16994718"
     mRNA            <802262..>803008
                     /locus_tag="CYME_CML317C"
                     /product="60S ribosomal protein L7A"
                     /transcript_id="XM_005536865.1"
                     /db_xref="GeneID:16994718"
     CDS             802262..803008
                     /locus_tag="CYME_CML317C"
                     /codon_start=1
                     /product="60S ribosomal protein L7A"
                     /protein_id="XP_005536922.1"
                     /db_xref="GeneID:16994718"
                     /translation="MTEKASKRQSIAEALFERRPKNFGIGQSIQPKRDLSRFVRWPRY
                     VRLQRQRKILLQRLKVPPAIAQFQKTADKNLTDSLFRLLERYRPEEKVAKRQRLQQAA
                     ERGETKPDTPKPIFVKHGVNHVTDLIEQKKAKLVIIAHDVDPIELVMWMPALCRKLDI
                     PYVIVKGKARLGALVHLKTATCLAVTGVHDRDRAELSKIIEVCKMRFNDRYEEIRRQW
                     GGGVLGIKSTHKLEKRRRALAIEEAKRAQA"
     gene            complement(<803013..>806930)
                     /locus_tag="CYME_CML318C"
                     /db_xref="GeneID:16994716"
     mRNA            complement(<803013..>806930)
                     /locus_tag="CYME_CML318C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536866.1"
                     /db_xref="GeneID:16994716"
     CDS             complement(803013..806930)
                     /locus_tag="CYME_CML318C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536923.1"
                     /db_xref="GeneID:16994716"
                     /translation="MEHLVRKHLEAPAVTQSIGSRRPVRGSALRGARMKVGFTSARRF
                     AANEEDPKSTLMLPMFAPVLQGQVIYAGYLFPQERIVQKRTVLQWSSRVPRTLTPRHA
                     RGRAWEVRPIQHRPLTRSSFAAAPVAFNQRSLRRSLHHVALQRNTSTIFAVVLPAFQW
                     SADVTDGGGSDPPDASAEAAAMGAAQRPPQQTSQPTQAAESDTQRRTLRSTPVPTVVL
                     SGLDDIARLRLLGTLLEQLLQRSPQPEERPPRVGVLLPATLATRLGLVWDEDEAGWLV
                     NASLCTESLPSSLCSALIGTHIYFEVLDNCVNQDELGPKIDQLMRRRARTPRASQAQS
                     GSAVQSAADQTVEAAPSPVNLFQVQAAYGVDYLIVCSPEKEEPYAIADSLAHVEWPLQ
                     LLALVSVIDAAAAAEVFAPTLRQQETASVAYSPENTAQTSPASERIPTTATGITGGTG
                     LEISHNDADQALATSDTVETSRDGSSPSRGTLLHEKKTASRVEAGDVGAGDNDGASAR
                     RPPAMERERGSASNAQADNLVQLLVDQIEYANLVVVYNQQQMPGRETDADVRPMRKSQ
                     DASPDPEVRTAPTPSFQNLLRYLRLLNCEAQVILMHANTEWPQTLLERILERPFDPER
                     MLWMPTWRRVLASFAATELTKTSQKYGSALPENRAQSTGKSSAKAGPSVGTSTAAATP
                     ATRATVPETSAASASQETTAATASWGAASAPDAGYDPGKAAAPKGPGAATGGSATHPA
                     APAVSSAAGTARPIWDSRFSNEQFLATLYSGTRPWERGFSTETVRPETSFLYRANRPF
                     HPRRLFDKISDISTFHGVLRSVGKLWLANRMDSFLEWSQVGNNITLKRGQRFLVTLPL
                     EQWPSAPNSQDRMRPLQWDERFGDRCSEIVFLGEDLDAMRIQIVLDECLLRDEELVFT
                     EAWSEFEDPFESLVPNTDSTRAGGKTPPAAQPPSFVERLSSRVAPPWILITGEAKRSE
                     ANSEQNERILVPGDVEPLPANEGILAVCGLPGAGKTSLVGALNAHEDLLAWRLEPPGP
                     STLLQRQRLEAVSEAALASRLESHPRPFRLALETDEPLDGVDAVVCAVDCLRFRSQDH
                     IQQQLVASADTVVFTKSDVVPAERLQQILEHVCGWNPHARVICAPYGRLQPAAIWVRR
                     RNRPWLREAEATTTTTTTTTTAPTHDADSRVLPRLTAQAMQDAAPAGDAHRPAAANRG
                     RLFRRLHLQRTMPIDVAAFMDLLRALEPFTETLYAVGIMRPANAPSPLLLTLDGVYMR
                     IESHAPASIASSLTMDLVLYADGIQAEDLGSFFDRVHAGTLTS"
     gene            complement(<809233..>811320)
                     /locus_tag="CYME_CML319C"
                     /db_xref="GeneID:16994717"
     mRNA            complement(<809233..>811320)
                     /locus_tag="CYME_CML319C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536867.1"
                     /db_xref="GeneID:16994717"
     CDS             complement(809233..811320)
                     /locus_tag="CYME_CML319C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536924.1"
                     /db_xref="GeneID:16994717"
                     /translation="MFRSWRNRLRELGQEAKRAAQWSVSEAKANSTGPVNVRNVLSRW
                     EHVGQRLATFGERFQRLSFAGATLYQMLHDWVGFETSIERILRSMQEFMANWRDAVPS
                     SPFVTEPGTSASNMEPDATRRALWAQWNECQLDLEERVLRVTEKRLRLRVQQPLAMAL
                     NEGQALLEGVLGLVEEIQQAQASLRQLSMQSGAYGYVGSVEEVYNSVMGPLLGKCEET
                     CVHLEAWILARSELLPSCLTELLEIQRQFYAAASFVVTEQHRLHGDDSSKKAATRNRP
                     NRRLDSCGNPAGAGTGAGTGADGGAPSNEAALGRSALQRLSTRKQMERSTATKPETLW
                     QTLHEKWRPTPTTGASELDASSLDTAFERGLAVMTDAGASTAAAPVADVVSSRGNARA
                     GSLSSPPSTSTWPAGHCAEDQTCTARPNAPKGPLEDQLVDIEEESEDVSQSAPAQATA
                     HHAPAGTPAEAPALHPASSSNAVSVAAATAMDSGAQEASPWDEVNEVVDDPQRVRASN
                     AATPEQFLQATRRSNGNSTGSSSSSSTTAERRKHAIRSTPTAHEARERYTADSSSVTI
                     ETETSTGYREVTSGTRETLEPQDGTATPEVIFVVEQRISEWTRNGSRAHNIRALLSTL
                     HEILGEDSGWERLTVQALLDEQQVKVAYRRALLLTHPDRGAANDIRRPAERLLRERVF
                     ETLRAAYKSNSIA"
     gene            <811582..>812397
                     /locus_tag="CYME_CML320C"
                     /db_xref="GeneID:16994699"
     mRNA            <811582..>812397
                     /locus_tag="CYME_CML320C"
                     /product="similar to stromal cell derived factor 2 SDF2"
                     /transcript_id="XM_005536868.1"
                     /db_xref="GeneID:16994699"
     CDS             811582..812397
                     /locus_tag="CYME_CML320C"
                     /codon_start=1
                     /product="similar to stromal cell derived factor 2 SDF2"
                     /protein_id="XP_005536925.1"
                     /db_xref="GeneID:16994699"
                     /translation="MQRKRPERCQRCGKRLHQEHVCAAKVCSWIRCFSATKFLLMCLL
                     LLLFVLPVHAKRTKAETTTPAFEPGFEYITYASVVKLEHPLTGLRLHSQEVAYGTGSK
                     QQTVTAVERHLDDDRALWLIKAPQQSGGRFFAESKGMRRVRCGDLIRLEHVVTRTHLH
                     SHRLASPLTGSQEVSAFSLSAEGSGDSGDHWQVECISKGAVFWARNETVYLRHVDTET
                     MYLSVLGEQRYHDPLENHAEVVCLERKSIRQPELRAQWVASEGFFHASAAVES"
     misc_feature    complement(812206..813472)
                     /note="possible transcribed region"
     gene            <813911..>814546
                     /locus_tag="CYME_CML322C"
                     /db_xref="GeneID:16994753"
     mRNA            <813911..>814546
                     /locus_tag="CYME_CML322C"
                     /product="dTMP kinase"
                     /transcript_id="XM_005536869.1"
                     /db_xref="GeneID:16994753"
     CDS             813911..814546
                     /locus_tag="CYME_CML322C"
                     /codon_start=1
                     /product="dTMP kinase"
                     /protein_id="XP_005536926.1"
                     /db_xref="GeneID:16994753"
                     /translation="MNGTRGTLIAFEGGDRAGKSTQAKQALQWIRETLREPAVLWHFP
                     NRHSATGRLLDTYLSGSTELTGQVAHLLFAANRWERVEELWQLLDSGSHVILDRYAYS
                     GVAFSVAARGLDPEWCLAADRGLPSPDLVLFLDLDPQLASKRGNFGEERYEQLVIQQR
                     VRQFFLDRLFQSENWVRISAEQPPDQVQLQCRRAITEMLPRVRSLPLKLLW"
     gene            complement(<815273..>816697)
                     /locus_tag="CYME_CML323C"
                     /db_xref="GeneID:16994749"
     mRNA            complement(<815273..>816697)
                     /locus_tag="CYME_CML323C"
                     /product="ornithine aminotransferase"
                     /transcript_id="XM_005536870.1"
                     /db_xref="GeneID:16994749"
     CDS             complement(815273..816697)
                     /locus_tag="CYME_CML323C"
                     /codon_start=1
                     /product="ornithine aminotransferase"
                     /protein_id="XP_005536927.1"
                     /db_xref="GeneID:16994749"
                     /translation="MPARRTARFCGQCVRMPKPGATTRTLLRFLLRTAPCRLIPATSS
                     VPWTRGYSGRAAATAPSERVPSAAAQRLLDLEARYGATNYAPLPVVIARGKGARVWDV
                     DGKSYIDCLAAYSALNQGHCHPRLVATLVEQAATLTLTSRAFYNNVLGEFERFICEYF
                     GYERVLPMNTGVEAGETAVKLARRWAYDVKGIPRYGAKVVFAENNFWGRTLAAVSSST
                     DPESRGGYGPFMPGFEIIPYDNPEALEQLLDRDQNIAAFMVEPIQGEAGVIVPRPGYM
                     RRVRELCDQYGVLLIADEVQTGLGRTGKLLCCDHDGIRPDILVLGKALSGGMYPVSAV
                     LASSEIMLTIKPGQHGSTYGGNPLGCRVAMTALEVLHNEGLIERAAHLGNMFLRGLSE
                     IKQESAGLITNVRGRGLLCALSIAENWRPGLNATKLCLHLMENGMLCKPTHGDRIRFA
                     PPLVIEEAELMRCLEILRTTIKAL"
     gene            <817456..>819342
                     /locus_tag="CYME_CML324C"
                     /db_xref="GeneID:16994750"
     mRNA            <817456..>819342
                     /locus_tag="CYME_CML324C"
                     /product="similar to SUMO-1-specific protease"
                     /transcript_id="XM_005536871.1"
                     /db_xref="GeneID:16994750"
     CDS             817456..819342
                     /locus_tag="CYME_CML324C"
                     /codon_start=1
                     /product="similar to SUMO-1-specific protease"
                     /protein_id="XP_005536928.1"
                     /db_xref="GeneID:16994750"
                     /translation="MPWTLWSAISRVLGDWVWRPEEAQACNATTLGTAETSANTRDVQ
                     PARREAAVFPQLRVREAPASTCVVENAWRSLDTEYVPNTCLFGALSASGAEDARFSAV
                     GRSEAAALLCTGSAYGDNRVLKPDETKDSIEGDNHESSKRFAVPARIPVSSVFAVHSR
                     RPGLGANSTDDVGYRDMSAETLVHENLSRSRRRESAAERERLLRRLARLESSVPPAVS
                     YAREPAFRTETTTAASRTSSPAVLRQEYPDARSRDVDRVSPDTSLVRLRASAALLSSY
                     LDYTRRLGTQKHDERSRSEAQAHTQSPESEAQVVEIIDISDDESTVDERDLAAAAATA
                     AAAHERWNTSADPSRRMHVMIPDKGNKALHRTESENLIAGPVRAEIISTLQKCSSLTS
                     PVTDVAHRVLEIAWNSGLDVREPLVSHEGFKLTRSDLLRLRPGGWLNDAILNAYCQGL
                     LMERQTREGTRRQWPRCAIFSTFFYTRLCNSDRLGDAYDYNGVRRWTRSVNVFELDRV
                     LVPINLSNTHWTLALIEPHSRKLTYYDSMGGTGKGVLQTLRRWLCDEAMDKLQLRIDE
                     QAWTLTVPKSVPLQTNGNDCGVFVAAFAEHLTRTAPVAFSASMIPHFRMRMCVEILCG
                     YVPP"
     gene            complement(<819769..>820404)
                     /locus_tag="CYME_CML325C"
                     /db_xref="GeneID:16994733"
     mRNA            complement(<819769..>820404)
                     /locus_tag="CYME_CML325C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536872.1"
                     /db_xref="GeneID:16994733"
     CDS             complement(819769..820404)
                     /locus_tag="CYME_CML325C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536929.1"
                     /db_xref="GeneID:16994733"
                     /translation="MATGPEFVVIGHRNPSISSESTWDEYFEDVSSSRPSWAWSERSP
                     SLSTATSETGTLAGASTPLAASLARRYEWHRLLLTAADGSVLLQHNFESEWIKTVCES
                     YQTLFRSRESAMRAGLGLGARHYDVHCWYPMTSDRQEPRIALVYGRRGTAIQGEGFGV
                     GKREDGVVFLVVFRFPLLTAEGVTALRTFLRRFHPNMLQMNDTDAASDSVA"
     gene            complement(<822235..>823938)
                     /locus_tag="CYME_CML326C"
                     /db_xref="GeneID:16994724"
     mRNA            complement(<822235..>823938)
                     /locus_tag="CYME_CML326C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536873.1"
                     /db_xref="GeneID:16994724"
     CDS             complement(822235..823938)
                     /locus_tag="CYME_CML326C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536930.1"
                     /db_xref="GeneID:16994724"
                     /translation="MREKLQCRGSGFEVQRELRSGKVAVNAAAAWVSPSSPLSSVVVY
                     AYQEHAGRCRALPEPPWRKHRHRARSLLVSSWYNDHPGTGPRAVLTGRRRSASSLDAS
                     PVRQHVLSGGSRGSLRTLKRVSGARRRRDERCCHHEATKETADPLELPHAGVHMPSVD
                     RGFFEGWYVRIVLPTEATSLAFMYSLEDGRRGRIQVLSSGVQDELLVSREMMDGFFPA
                     LRHLPTSTLRIGQWGRTSDLLSDERAEHARSLAPSLFREHVHTGYQLSAQWHQGSIQA
                     DDVDRERSMVAHLSPDISCAFDMRIEPLLSWGSDGARSTGTWLTRFQVFEPGWQILSA
                     FARSTGIFRDWHGRVFRFERAPTYIEKNWGSAFPSRWFWLQCHVFDVLREDASSLELS
                     SADIDAPLTLTCVGARRELCWPQRPNKVVARETIGIIAFHWKGYLWEFAAWNCRRISW
                     SVQWGNWQMEAHGTRYSVKVSAETAEPGAYVLGPTRHGMQFVVRDGARGTLRLQLRDE
                     QANVVILDALCRNAAAVELGGELASDPNGTSWTAERGAFPPPVKALFLIGERPGRAVR
                     V"
     gene            <824563..>826179
                     /locus_tag="CYME_CML327C"
                     /db_xref="GeneID:16994725"
     mRNA            <824563..>826179
                     /locus_tag="CYME_CML327C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536874.1"
                     /db_xref="GeneID:16994725"
     CDS             824563..826179
                     /locus_tag="CYME_CML327C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536931.1"
                     /db_xref="GeneID:16994725"
                     /translation="MTFSKYTSLLTCLSPLLVGALVSLRPCVGSLLHLLLSWLWMPGQ
                     VRGRSRAIRRLHSFATSLSLGYALVWILVYLGLRFSGLTRMDNVWTLDRSQTHATRVT
                     ASALGIPPWSPASDVFLHLLCGILAWFAYRYGEDEAVSATLERGRLLWSQVAKVSWLV
                     LVASLPPSIPSALLYTLLVLATLLSDSGQRRPIASRGGATKETSGRVPRGVARRRLQA
                     VVLTTALVLCALHTVASFVFQWAWIRSTPASESVCGQLFGLQVLQRERFVTARGAALV
                     LLASWRLLSLREPMLVTWKASGMGTPRAAAVLSFMVTMMLCSHWPGIFALVLAGLAEL
                     AVLLTGVSVWQTVMRILAAVATILIGLVAFILGIIATVAKRTVPTFWGLPLVGRSLLW
                     NAWLVLCPLLWTQQRLPTEQKSNPLGRLLPSEYVPQYVAWLLLVGALAALVQDWLLGV
                     LVAVLAIGVRTGKVRHLEAWVWLPLHGWAALIWSLRCGLCGFQSGILAESCIRSPQQC
                     YVWVALAATTAAGWVFRVQPQVSADPERND"
     gene            complement(828206..830155)
                     /locus_tag="CYME_CML328T"
                     /db_xref="GeneID:16994751"
     misc_RNA        complement(828206..830155)
                     /locus_tag="CYME_CML328T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461429.1"
                     /db_xref="GeneID:16994751"
     gene            <828563..>829996
                     /locus_tag="CYME_CML329C"
                     /db_xref="GeneID:16994768"
     mRNA            <828563..>829996
                     /locus_tag="CYME_CML329C"
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
                     /transcript_id="XM_005536875.1"
                     /db_xref="GeneID:16994768"
     CDS             828563..829996
                     /locus_tag="CYME_CML329C"
                     /codon_start=1
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
                     /protein_id="XP_005536932.1"
                     /db_xref="GeneID:16994768"
                     /translation="MSHELVHAGRRVVVTGIGMVSPLGLCTRMCWDALFRGQSGVQRI
                     SVFDPTGLPVQIAAQVDRAGVLERLESQVFASKTTSTAIATGLHERKLTPADILRAPL
                     SIQYAVLAAHEAIQDAALSPATLNATDSGVVIGAGMVSLSDLVESVNRHQSGRHLSPH
                     FVPRILLNAAAGYVALWFGLKGPSLSPSTACAAGAHAIGDAYRLIQRGDATVCIAGGT
                     EACIHELALLGFSRARALTTQFADEPEQSSRPFDRRRSGFVLGEGACVLVLEDLEHAR
                     TRRQAQPHTTYGELVGYGLSSDAYHVTAPHPEGIGAQRCMEMALRGIPRSAVGYVNAH
                     ATSTPLGDAVEAKAIGRVFGAEEPAPVVTSTKGATGHLLGAAGALEAAFTLLAVHHQC
                     VPGTLNLHDIDVGLEMSATTDTTTAGLRFIGHHAHYYWPESSPLRIALSNSFGFYGTN
                     TCLAFQRLPSDESRSGNGSFQGDGVST"
     gene            complement(<830777..>834379)
                     /locus_tag="CYME_CML330C"
                     /db_xref="GeneID:16994769"
     mRNA            complement(<830777..>834379)
                     /locus_tag="CYME_CML330C"
                     /product="DNA topoisomerase II"
                     /transcript_id="XM_005536876.1"
                     /db_xref="GeneID:16994769"
     CDS             complement(830777..834379)
                     /locus_tag="CYME_CML330C"
                     /codon_start=1
                     /product="DNA topoisomerase II"
                     /protein_id="XP_005536933.1"
                     /db_xref="GeneID:16994769"
                     /translation="MRSLGDIRLVERLVQPHLRKQRFSTLIEATYQRLTPREHVLKRP
                     EVYLGPVERIERRLWSIPATSATVEQVIHEGRITLRQVHYSPALYKIFDEILVNAIDN
                     ARRDPHTDAIDIWLPLEDSASTSKRTLRIRNTGRGIPVAMHPREHLYVPELIFGHLLT
                     GSNFDDTDASVRLTGGRHGYGAKLTNIMSKRFAVETIDEQRCLRYRQVWQNNMSTCSA
                     PEIEAVSPAIAQHPYTEIEFEPDLERFGLDRCGDRDTLMLMARRAFDAAGILPNVRVR
                     LNGTPLALNGFAEYVQRHGTDAEPSIILQPNAHWEIGLRALTQAEQAAPMVSFVNGIA
                     TFQGGSHVQCIQELLCRRIADRIAARYKSLRCVLTPSLVRSQLLLFVNCLVNRPAFES
                     QSKEMLTSRQRDLLATLPEQFPTENELNDALEQTKLMERILAAAEERLAAEVRGSRPV
                     SALVASASRGTGALRRLAIPKLEDANAAGGPDSSRCTLILTEGDSAKALAMAGLSVVG
                     RDYYGVFPLRGKLLNVRDCHPRQLAQNEEVNNLRIILGLEFDRDYSTPESRKALRYGH
                     VMLMTDQDHDGSHIKGLIMNLFDFFWPSLLEGGDFLEAFMTPIVKAAAKHGGAVQSFF
                     TITAFREWWEQLPASQRHHHWLIKYYKGLGTSTSAEGKAYFRDLERHRIRFAPVAPGD
                     RHQLDLAFNRSRAEERKRWLAELDTATPRDAGDAPLETNASSDAGVSLATFVNRELAL
                     YSYANNVRSIPSAIDGLKPAQRKVLYACLKRGLVRDMKVAQLAGYVAEQTAYHHGEES
                     LHSTIVRMAQDFCGANNLPLLQPLGQFGTRLLGGKDAASARYIYTCLSPVTRKIFPAS
                     DDPLLTYCEDDGQQIEPEYFVPIIPMALVNGIDGVGTGWSTTLPPFHPLDIIHNVRCL
                     LQGRSPKPLKPWYRRFRGQIIAQSELVFVSRGCVERLSSTTFRVRELPIGRWTESYKA
                     FLHELTEAGVLKGFREYHTDENICFELVMTRANAQRLEERGEGLWRHLRLESTISCTN
                     MHLFDARGRIRKYETPLSILEDFMIERERLYQKRLERECQELERKFASAQKRLAFVEL
                     VVSGKLELFGRSLNQVQRDMISLGISPDEATGSLEALLATPVRLLTREEAQRTRDETR
                     HWRARWEASRAATPRSVWQAELAELERTVRSMLANDKASSGADRSHVSEHSAES"
     gene            834438..836611
                     /locus_tag="CYME_CML331T"
                     /db_xref="GeneID:16994764"
     misc_RNA        834438..836611
                     /locus_tag="CYME_CML331T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461430.1"
                     /db_xref="GeneID:16994764"
     gene            <838315..>839325
                     /locus_tag="CYME_CML332C"
                     /db_xref="GeneID:16994765"
     mRNA            <838315..>839325
                     /locus_tag="CYME_CML332C"
                     /product="protein phosphatase 2a"
                     /transcript_id="XM_005536877.1"
                     /db_xref="GeneID:16994765"
     CDS             838315..839325
                     /locus_tag="CYME_CML332C"
                     /codon_start=1
                     /product="protein phosphatase 2a"
                     /protein_id="XP_005536934.1"
                     /db_xref="GeneID:16994765"
                     /translation="MSLAHVEPMSEVVTSKEPGPIGLVPSSEASHTYDLDAWISQLLS
                     ENSRPLSEEQVKWLCDRAREIFVEESNVQLVTCPVTVCGDIHGQFHDLLELFKIGGKC
                     PDTNYLFMGDYVDRGYYSVETVTALICLKLRYPQRVTILRGNHESRQITQVYGFYDEC
                     LRKYGNANVWKYFTDLFDYMPLTAIIENQIFCLHGGLSPSIDTLDQIRSLDRMQEVPH
                     EGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNRTNGLSLIARAHQLVMEGYN
                     WCHDRNVVTIFSAPNYCYRCGNQAAIMELDENEKYTFLQFDPAPRRGEPHVTRRTPDY
                     FL"
     misc_feature    complement(840776..842173)
                     /note="possible transcribed region"
     gene            complement(842274..844065)
                     /locus_tag="CYME_CML335T"
                     /db_xref="GeneID:16994763"
     misc_RNA        complement(842274..844065)
                     /locus_tag="CYME_CML335T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461431.1"
                     /db_xref="GeneID:16994763"
     gene            <842448..>843383
                     /locus_tag="CYME_CML334C"
                     /db_xref="GeneID:16994747"
     mRNA            <842448..>843383
                     /locus_tag="CYME_CML334C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536878.1"
                     /db_xref="GeneID:16994747"
     CDS             842448..843383
                     /locus_tag="CYME_CML334C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536935.1"
                     /db_xref="GeneID:16994747"
                     /translation="MGTGGGNWSKSLRHLATGESELARICSREDHSAAMSVQVYRCLQ
                     NSKEASDAWQRFKTELAGGPPMDLGAWARILLAAKKVPTRYRNWRRVQENLRLSLEDL
                     YQWERAKQIVHERVNTSFQSADKSHQELLQKLRQLVEPMLPAGARAPNRDWRYVGFQG
                     DDPGTDFRGMGIFALHQLIYFAETRPRTVQRILSEANEERWSDVSEHTTSTGSSMPQL
                     KRYYPFAVTGIHVSAFVARLVQHGALMTAWIGESSDTILRKINDLYCDTFILFHELWR
                     KGPERSIMEFQQVFRECCAQVERQIQLGVFLPHAP"
     gene            complement(<845951..>847609)
                     /locus_tag="CYME_CML336C"
                     /db_xref="GeneID:16994746"
     mRNA            complement(<845951..>847609)
                     /locus_tag="CYME_CML336C"
                     /product="similar to RNA helicase"
                     /transcript_id="XM_005536879.1"
                     /db_xref="GeneID:16994746"
     CDS             complement(845951..847609)
                     /locus_tag="CYME_CML336C"
                     /codon_start=1
                     /product="similar to RNA helicase"
                     /protein_id="XP_005536936.1"
                     /db_xref="GeneID:16994746"
                     /translation="MGCSRTRTFPQLGLDARVVEAVLRKLRWRTPAPVQEAVIPAVLS
                     GKDVLVNAPTGSGKTGAYALPLVHLLLQIYDEENARGAWCESTRAIVLVPSQDLALQL
                     GRTFVSLTENLPLHCCVVTGAFSNKALIDTWTDASVCVGTPAGLAQSLTTERARNVVL
                     LVIDEADLVLSFASSATQVHDVVRKIPTNAQGVLLSATLDEEVEALRALALHQPEACR
                     IEASWDADPSGNKSNVQYWVSRLSGLDERFAWLYVVLRLRILRDRILVFVDSVLEAYR
                     VKLFLDRFGIRCAVLNADLPVTSRQHCLQQFDAGIFDILVTSDEATTLKSTGYSASRG
                     LDFRSVDVVIHFTAPKNIEVFLHRSGRTGRAGRAGKVVTLVTNDDESQRIERFFTEHA
                     RLSMQGQPRLLAVRKETMETFRYRVEDALCACTDLAVREARVQALRDEMLRSRAFRDA
                     LLAARQGDRVDLEVLSHDRPLVRKRLAAHLGHIPDYMLKDDGLWQVLAPEMANAQSAT
                     DDLRPAGPEELNKPVEKRPKRKRIARNFRSGPRKRAEPLKRLRL"
     misc_feature    complement(847611..850216)
                     /note="repetitive element"
     gene            <850290..>851666
                     /locus_tag="CYME_CML338C"
                     /db_xref="GeneID:16994748"
     mRNA            <850290..>851666
                     /locus_tag="CYME_CML338C"
                     /product="unknown rhomboid family protein"
                     /transcript_id="XM_005536880.1"
                     /db_xref="GeneID:16994748"
     CDS             850290..851666
                     /locus_tag="CYME_CML338C"
                     /codon_start=1
                     /product="unknown rhomboid family protein"
                     /protein_id="XP_005536937.1"
                     /db_xref="GeneID:16994748"
                     /translation="MNDAEGRVYGADATRLPFVKSRRTCDVLGGCSQTRLPVTFSFPS
                     TGCLHSGTYSGGKTITRSKCGIKFLECPSELHLGAYHVGMFVRGQRSWKVHAPQQQRE
                     QSVIAAFVQGARTSAEHASSAESTCLRVRQGRRLAHSVERSSDSVDSRLVVDQSPLWR
                     ASELQSGSKPPPRRPGSCWTCLAEPPPEPDFGGWGHLSRSLAQVRVYVSGLESLRALV
                     SRADPSGLPLRARRNALRRSQYPGRPYRLHEHPKVTDWLAAITILSFLLQLWAGPAYV
                     MAGAKVNAAIRTGEWYRLFTPLFLHGNTLHLIVNLSSLKSLGPQIEATYGHRRYAALY
                     LLSGLTGNLFSFFFNTAPSVGASSAIFGLIGAMAAFYVSNTDWFGREHSHRVLRNIAW
                     VTLLNLGQGLAPASRIDNFGHLGGLLGGAVFGVLFGPRLYLDPKGRLVDIPLAQGWLQ
                     RLRRRRYR"
     gene            complement(<853984..>855627)
                     /locus_tag="CYME_CML339C"
                     /db_xref="GeneID:16994761"
     mRNA            complement(<853984..>855627)
                     /locus_tag="CYME_CML339C"
                     /product="steroid monooxygenase"
                     /transcript_id="XM_005536881.1"
                     /db_xref="GeneID:16994761"
     CDS             complement(853984..855627)
                     /locus_tag="CYME_CML339C"
                     /codon_start=1
                     /product="steroid monooxygenase"
                     /protein_id="XP_005536938.1"
                     /db_xref="GeneID:16994761"
                     /translation="MGAELNQFTNHVQNKSVVELDALIIGAGVAGLYQLHKLRSAGLN
                     ALAVDTAEDVGGTWYWNCYPGAKFDSECYVYQYLFDEKLYKDWSWSERFPGQPEIERW
                     LHYVTDRLGLRPYLRFCTTVTAAEYDEKRGRWIIKTDRGQTYDARFLIGCCGMLSAPL
                     ENRFPGQERFRGRIFHTARWPREPIDLNGKRVGVVGVGATGIQVIQTIADKVGQLKVF
                     VRTPQYVVPMKNPKYNPDDVNSYKKRFEELRELLPTTASGFEYVIKHRWADLTPEQRL
                     AVLEETYNDGSLRAWLGGFDEIFTDPQISEEVSEFVREKMRARLKDPKLIEILVPTDY
                     GFGSRRVPLESGYLEVYHRDNVEAICVRNNPIVEVVPEGIRLADGTVHELDIIILATG
                     FDASSGAFIRIDIRGRDGRSLKEEWSRDICSALGLMVHGYPNMFLTGAPLSPSAALCN
                     MTTCLQQQVEWITDCIQYIQAKGHNVIEPTASFQEAWVRHHDDLANSTLFSKTNSWYT
                     GTNVEGKPRRMLSYTGGVGKYRQKCAEVAAGGYEGFAVA"
     misc_feature    complement(855974..858704)
                     /note="repetitive element"
CONTIG      join(AP006494.2:1..859119)
//
DBGET integrated database retrieval system