GenomeNet

Database: RefSeq
Entry: NC_010139
LinkDB: NC_010139
Original site: NC_010139 
LOCUS       NC_010139             866983 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 13, complete
            genome.
ACCESSION   NC_010139
VERSION     NC_010139.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 866983)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 866983)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006495.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..866983
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="13"
     misc_feature    1503..3361
                     /note="repetitive element"
     gene            complement(<3380..>4570)
                     /locus_tag="CYME_CMM002C"
                     /db_xref="GeneID:16995123"
     mRNA            complement(<3380..>4570)
                     /locus_tag="CYME_CMM002C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536882.1"
                     /db_xref="GeneID:16995123"
     CDS             complement(3380..4570)
                     /locus_tag="CYME_CMM002C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536939.1"
                     /db_xref="GeneID:16995123"
                     /translation="MVLPTRFLGAVDMGLGLRGALAKTQRVALWVRLRSRGFADDASV
                     GSTGTGQGSQSEEREPRRRAGRSTLLAGLEQQQRERAQPTAKETGLPLNGTGRDTTRT
                     EPSHAALYTAKGAGALQRRVSRSLLGLAEVAEKVRSTARSATDTSAVSVDLDESSTQV
                     RRPWRQRKSRLLEAVSDARESARRAPRTKRQVADSESEAMDVSPRRMARASRLLEIRP
                     PQLSVSLLPPSVREEQARVASSLLEREGPAAVEKVRMYEEGLHSRLEADVRRQRRRQL
                     GKFLVFKNRYLPESVFKMDRYKTEDLWVNHAVRIAENIVSKAKNRQSPQTDAAAKTSL
                     WLESVVADLFPKARRAQEIMLMIRLLRKSMEDVQRLPPETRQAILNGKQRLTQDALKQ
                     LGAK"
     gene            <4926..>6206
                     /locus_tag="CYME_CMM003C"
                     /db_xref="GeneID:16995015"
     mRNA            <4926..>6206
                     /locus_tag="CYME_CMM003C"
                     /product="eukaryotic translation elongation factor 1
                     gamma"
                     /transcript_id="XM_005536883.1"
                     /db_xref="GeneID:16995015"
     CDS             4926..6206
                     /locus_tag="CYME_CMM003C"
                     /codon_start=1
                     /product="eukaryotic translation elongation factor 1
                     gamma"
                     /protein_id="XP_005536940.1"
                     /db_xref="GeneID:16995015"
                     /translation="MKLYTYPNNPRAYKALIAAQYCGAEVQVPPDFKFLEDNRKPEFL
                     RLNPFGQVPLLDLGDGKAVFESNAIARYILESSNRQDMLGGDDAVQRAQVAAFGDVAL
                     GRIDPLGRPLVYPTIFPAFFKPDKTRFEEALEQFRAVIGGFERHLTDHTFLVGERITL
                     ADITVSMSLFWFFEYLLDPELLMEYRALKRWFYTCIGQPEFVKVIGSDFKPCLKRPDH
                     LKMATSTNADLGGHAGNQGHESSDHAAEVTEDDQTARKPKNAFDLLPKSSFNLEAAKR
                     LYSNADNTREVMNQIWDTMFDPSGYSVWVVRYRYNHELSKTFMSANLLNGWFQRMDHL
                     RKYLFGSMIVFGTSGEPGSCAIGGAFIVRGTGDSLPEPLTEVEDTDLYTWTKADVFGK
                     DRDLVNDLFAWEGKFEGMGPDYDGKPVATGKNFK"
     gene            <6864..>8582
                     /locus_tag="CYME_CMM004C"
                     /db_xref="GeneID:16995016"
     mRNA            <6864..>8582
                     /locus_tag="CYME_CMM004C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536884.1"
                     /db_xref="GeneID:16995016"
     CDS             6864..8582
                     /locus_tag="CYME_CMM004C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536941.1"
                     /db_xref="GeneID:16995016"
                     /translation="MAPRQSLVSRYEAMLWVFIVLNAILVPYNSAEEAPYVQILHDSI
                     YEGDRFSTSCVHWRTWLTGRESLRDWCTVFMETLGCVPARVVGCLWRARNWALQRPIP
                     SFFFRLLGSWIEPKLPCLILVRCIIGSISWMSLVLGQRALSNDEARTYSMELLCVQFS
                     VILGASRISPVSLSIVVFSSVQALILKGYAKAGLAVLSFVGTASLIQTGFLQVWFILA
                     DLTGSAGGKTFLLGLLSRCSALLIGSLLAFGMLGTTMIPAMRGGFLLQYEPGTLQRIL
                     THAPTRVMLQYLTAHSKAFISRLALVIIAYVLLVKRAPFKAGTAGRMAFPALAYIACT
                     ASPSTVFHSAVPVTPLICAAAATILGRLHDFGLTAIESQKLQEAATALNELDLRPYRR
                     VMKEAERKRRVRRLLRFCRLLLVGGAIILQALFLTVSVWNSPGAEAMRALHRAYLLPG
                     DPPRGAACPDPYVHIDAASIQTGASTFLEVPAWKYAWESEPREGASKSLVLTHLVTEQ
                     VTVAGFERVYASRTFAGLTRFYPFLRFQERIFVHRRLSGYAGANDGLEQHLPLPGCWP
                     ARLPWN"
     gene            complement(<10669..>11658)
                     /locus_tag="CYME_CMM005C"
                     /db_xref="GeneID:16995017"
     mRNA            complement(<10669..>11658)
                     /locus_tag="CYME_CMM005C"
                     /product="probable protein kinase CK2 regulatory subunit
                     CK2B1"
                     /transcript_id="XM_005536885.1"
                     /db_xref="GeneID:16995017"
     CDS             complement(10669..11658)
                     /locus_tag="CYME_CMM005C"
                     /codon_start=1
                     /product="probable protein kinase CK2 regulatory subunit
                     CK2B1"
                     /protein_id="XP_005536942.1"
                     /db_xref="GeneID:16995017"
                     /translation="MPRTPRQQWGTSSWMNDCVPDLGTRAPSGDSGGEQSFTVPDEPL
                     SMSWHSRNGEVAMGLDATSPEAAMARQPEQRVSRGPEPGNSERADGRSATQRGDSIYS
                     SGIDSEAEGDDTEEDLSWISWFCSLSGNEFFCEVDEEFIQDDFNLTGLSSLVSYYEYA
                     LDTILDIELPDPGIDERQREIIEMNAEFLYGLIHARYILTNRGLHDMLEKYNNVDFGR
                     CPRVFCNGQPVLPVGQSDLPRTAVVKLFCPKCWDIYVPRSAAHSHLDGAFWGTTFPHL
                     FLQTYPELVPERNPCRYVPRIFGFRVSEKSKQVQRNLGLIHQNPDQDNRSPAI"
     gene            <14105..>15682
                     /locus_tag="CYME_CMM006C"
                     /db_xref="GeneID:16995029"
     mRNA            <14105..>15682
                     /locus_tag="CYME_CMM006C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536886.1"
                     /db_xref="GeneID:16995029"
     CDS             14105..15682
                     /locus_tag="CYME_CMM006C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536943.1"
                     /db_xref="GeneID:16995029"
                     /translation="MWQGGSALPRFPRLWSFNWRSSGQFVGKRDWTQRLQSFQPGRVV
                     GKAVLRTVLRWKSGRVSLAQSRVLGQNHLVMLSENASLKNASGDGYHPNYLSFPPLSF
                     HRERALSKSGTHALQTPTSTPFSRKIWVLPSDWRLGHLVRIRPDPLNGTELVALDVFS
                     DEEQLERLVRRGVYVGFLGTMDDEMLRKLFPCLVKRGSSAQHCLSTGDTTFHELFVAD
                     VHDHLAAERAPTAAERSGERGTGALGAHGVAVRTLRALLEVAADSENRLAADQLEKLG
                     IDTEDLAMIALRDRSVSVTDAQAALLAQARILTDWYHRNRFCTSCGNRLCAPAITSST
                     RIGRLLQCSACEHSVYPRIDPVVIVLVVASQSVDHSKPEHAMCLLGRKHQWQPGRYSC
                     IAGFVEAGETLEEAVVREVAEETGILLRPEAVRYASSQTWPFPSQLMLGFYASVPRDE
                     VLPQPRPSDGELESVAWFSAGQVRAMLAPEARPPAPHLPPREAIAHRLIVDWLQSLES
                     GAHQERLESVDRTPKEI"
     gene            complement(<17310..>18806)
                     /locus_tag="CYME_CMM007C"
                     /db_xref="GeneID:16995030"
     mRNA            complement(<17310..>18806)
                     /locus_tag="CYME_CMM007C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536887.1"
                     /db_xref="GeneID:16995030"
     CDS             complement(17310..18806)
                     /locus_tag="CYME_CMM007C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536944.1"
                     /db_xref="GeneID:16995030"
                     /translation="MFLPRTLLSRAMPWSERVYFRQRADATRKPLNGHYQADLELDWP
                     KKTKKCSFLGFRYWMVLAFLSFLLGLQGTVRFYRSRAHLSEGATFAPEAALVRLHSAY
                     WNFLEHLSTHCKSAAPRRLRVQGSQVHLAIVRPFSTKHVDLLERRTQDWIQMPHAIPC
                     LRSRDDEQNLMTADVDLIFVYSASESEHRAHDEGFRARLLGAAQPLLQNASQVSCFRQ
                     IHFWGHVIDMRESDVHPDVTCDMFYSIMERLAEINDTKYGPYTHFMLMEPDVQPVQAG
                     WLSEGIQDLAHIAAVDGTWVIGSISHNPMDYRDYHMNGNALYALKDKAFRVEYLRNRV
                     QRRYRRNARVPFADGCSGTAYGGYDVSLTGYLYDLPMNRDEWRYVTQVFHRFRATDRI
                     LNMGNAPDWRPWRTDYGIGCRSMLVHGKSANNVRNIWDPAEQGWTVEKGTSSGRPTKT
                     QIYCEISRFLEQLTESADPECTYRFCHSETPYPPRIFMDWVRAQLDSA"
     gene            19025..21583
                     /locus_tag="CYME_CMM008T"
                     /db_xref="GeneID:16995021"
     misc_RNA        19025..21583
                     /locus_tag="CYME_CMM008T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461432.1"
                     /db_xref="GeneID:16995021"
     gene            complement(<19928..>20905)
                     /locus_tag="CYME_CMM009C"
                     /db_xref="GeneID:16995022"
     mRNA            complement(<19928..>20905)
                     /locus_tag="CYME_CMM009C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536888.1"
                     /db_xref="GeneID:16995022"
     CDS             complement(19928..20905)
                     /locus_tag="CYME_CMM009C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536945.1"
                     /db_xref="GeneID:16995022"
                     /translation="MFILHWRPPLTTCLTFRQLAISRFNLGRRITRSNTGRWLCMSSI
                     ANQSTLRLLSQAEAQRVDEALMSETIGYSLEQLMELAGLAVALAAARENPKRSQRIVA
                     VCGPGNNGGDGLVAARHICILGYEHVFAIYPKPGSHPHFQRLVKQAMSHGVRFVDAAA
                     YEQTICEADVLIDALFGFSFRADRPMRDPFATLIRLMNASPRATTVLAVDIPSGWDVE
                     RGPPEAMRPAERTASDPRSSTSGDQRAPASSLAVMANVWVSLTAPKRCAAFWQGRAHY
                     LGGRFVPPALAKSMQLEPLPYTDSELIVRIDHLLPTSIPGHQQEASESR"
     gene            <23140..>24069
                     /locus_tag="CYME_CMM010C"
                     /db_xref="GeneID:16995025"
     mRNA            <23140..>24069
                     /locus_tag="CYME_CMM010C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536889.1"
                     /db_xref="GeneID:16995025"
     CDS             23140..24069
                     /locus_tag="CYME_CMM010C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536946.1"
                     /db_xref="GeneID:16995025"
                     /translation="MPRNGGMPTDADERAPRQRSPLGDAGTPRRRVKAKGAVVTTLAE
                     TPEFLHCPGIVGHYRSYDEYARSVKRILLSFFELHNESMNVWTHFVAALVYLTGIAPY
                     MFWMRLRDAPLLDRYTISLYYVAAATCFLLSAVYHLFLTHSVKAYRVLRMADHQGILL
                     LICASYIPAIGIGYRCHWRIAIQFLWVNAAFYMMAVVGLWYAHRHGYVVFRNITFLGY
                     TSWGLLPLAVGLTLQLEHAAWLLRHAFVMWSIYGIGFVLYVTRFPEKVWVGKFDLWFS
                     SHQLFHIATIAASAVWGRSMLRLHDHVSATGLC"
     gene            complement(<24249..>25286)
                     /locus_tag="CYME_CMM011C"
                     /db_xref="GeneID:16995026"
     mRNA            complement(<24249..>25286)
                     /locus_tag="CYME_CMM011C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536890.1"
                     /db_xref="GeneID:16995026"
     CDS             complement(24249..25286)
                     /locus_tag="CYME_CMM011C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536947.1"
                     /db_xref="GeneID:16995026"
                     /translation="MLGFCSLLGASVYRHRSNVGGVTRIAYGRRDEAARLGALAWYRS
                     HGGQRAAARDVIAGVARLTCSDSRKSKQSRSSDKKRPEVQSLPDEDRVEIVQVVDPRE
                     PKLEALPCFVEDAVTIEGVEYLVLSPCLQPVVFARFEDGEDESALIPIEDPVEVESLF
                     KEAFLALAEEDLCLVRTAVVFTVDGDLSQFFDDDDDDDEEEEDDENDLKDHETATAAS
                     AVNGVDDTLLRDALDDLGSAGAGVNHYELAADDDAESVSDIDDELELVTSEEEEVEVL
                     VTFQNTDGRVYYVCAPTEPLFLIGRRSEPESSLVAVVDREEQDRVGPLIELKVQERLD
                     RASKTSGRVSS"
     gene            <26513..>27610
                     /locus_tag="CYME_CMM012C"
                     /db_xref="GeneID:16995027"
     mRNA            <26513..>27610
                     /locus_tag="CYME_CMM012C"
                     /product="ring finger protein"
                     /transcript_id="XM_005536891.1"
                     /db_xref="GeneID:16995027"
     CDS             26513..27610
                     /locus_tag="CYME_CMM012C"
                     /codon_start=1
                     /product="ring finger protein"
                     /protein_id="XP_005536948.1"
                     /db_xref="GeneID:16995027"
                     /translation="MEFRETIRQQLQYGEATPLVMSSSIAAGSQNGGIGARLLRSDSR
                     QVRTHVHERVRTDLMPWTRKLSFAASFLEVLVEAAVLLLTRNQPCDAPLKLWIGVLIA
                     LQTASIVLRLLGSVYSRVALLELQPAGSDGSGLITQEVFRSGQRGDLTALAASSDFDA
                     PGATFAADVEVPAFAVQQPTRILHALYLGWIILGSIWLSESRTCPGTAPLLFRICVIL
                     VLVYFAFLMLPLVLITLIICCLPLFIRFLVNYAERLRRQERAAAPEIVEQLPVVQFDA
                     SQCEDFGFEEDGAPICTICLSQYEPAEEIRKLPCGHHFHRACVDQWLLFFDKSCPQCR
                     SDVDASQTTRHWQGNHPERINPASSSEEEYV"
     gene            complement(<28612..>29862)
                     /locus_tag="CYME_CMM013C"
                     /db_xref="GeneID:16995028"
     mRNA            complement(<28612..>29862)
                     /locus_tag="CYME_CMM013C"
                     /product="queuine tRNA ribosyltransferase"
                     /transcript_id="XM_005536892.1"
                     /db_xref="GeneID:16995028"
     CDS             complement(28612..29862)
                     /locus_tag="CYME_CMM013C"
                     /codon_start=1
                     /product="queuine tRNA ribosyltransferase"
                     /protein_id="XP_005536949.1"
                     /db_xref="GeneID:16995028"
                     /translation="MRAIFAARWSFQRTLVTRIIPDPWALPPCPSTFPAYEPKPFFRF
                     EIIHRSRRSSARIGRLHTPHGTVETPAFVAVGTNAALKMVDQRRADEAGLELLFCNTY
                     HLLLQPGPEIVTQAGGLHRFMQRSRPIMTDSGGFQVFSLAHGSVFDELNMKTRKRGSP
                     NLLLAVSENGPVFRSYRDGRKIELTPEKSVQAQKMLGADIIIPLDELPPYHIDRDALY
                     QSVLLSHRWEARSLREHLHDMRQQAMYAVIHGGIDLELRRKSVEYLTALPFDGIAIGG
                     SLGKDREELLALLAFLDTLLPKDRPVHLLGIADEESIRRAVPYGIDTFDSCYPTRAGR
                     HGTLLTRQHGRIQIKSRKWERVFEPVDTTCEGFVSQNHTLAYLHHLWRAHEPLAAALL
                     TLHNIKYMCDVMREIRTRILADEL"
     gene            <32059..>33750
                     /locus_tag="CYME_CMM014C"
                     /db_xref="GeneID:16995013"
     mRNA            <32059..>33750
                     /locus_tag="CYME_CMM014C"
                     /product="eukaryotic translation initiation factor eIF-2B
                     gamma subunit"
                     /transcript_id="XM_005536893.1"
                     /db_xref="GeneID:16995013"
     CDS             32059..33750
                     /locus_tag="CYME_CMM014C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-2B
                     gamma subunit"
                     /protein_id="XP_005536950.1"
                     /db_xref="GeneID:16995013"
                     /translation="MTNAAETDARDRTRRGSFAEFRVVLLAGDVGSRMRLFTDAVPKC
                     LLPIGNRPMLFYALYTIERNSIPEVTLVTTERALERVTSYVEELYGNDPAVMALRSSR
                     SSQPDLHVCIEAVPAELGSGEALLKVTKYLDAEDVLVVSADTFGLWDLASLATTHRVT
                     GATWTMMLANAKFGAKSDHNKRSAKSLGPAHGSSTAADQMAIGTPSRDCIVVDEVTQR
                     ILYLKPDVGAFGSADNIRLPGDALQAVGPMMIHRDLLDLHIYLFRKTALELLSVRPQL
                     TSLRADLLPYLARNQFVLERRLARALGSEMTGGRESPLRTAWQRYRNAPAGSASRVRS
                     VSPHRKSGEKDNCWLPSLEPLPLHSIMIGQSQTDSVRHGPVSIRCQGCFSAPEAGRII
                     RVNTISAYIEANRLVAAGVVYGDLRGASAVTPKRWCSEAATQGGTVQITGKNEETQAT
                     RGEQASARVHIAKDCLIAAEGVEISPGSTIKNQTVVHVHTIVGRRCKLSACIIMDHVR
                     IGNECLLQNCVVGSNAQIHDRCQLRDCLVGPDTEVPAGTIETGEVFTRADIPLVD"
     gene            complement(<35212..>36453)
                     /locus_tag="CYME_CMM015C"
                     /db_xref="GeneID:16995014"
     mRNA            complement(<35212..>36453)
                     /locus_tag="CYME_CMM015C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536894.1"
                     /db_xref="GeneID:16995014"
     CDS             complement(35212..36453)
                     /locus_tag="CYME_CMM015C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536951.1"
                     /db_xref="GeneID:16995014"
                     /translation="MPRTVSKYNHQQQRAWSAGTLKLLGRRALIVLLAWLGGLVLCHW
                     RSRVSSHCTYLLSYDPSYGAWNNQLMALFVGIHLAQLLGRRLVVPALVERARPTTSNT
                     WFDVLDIDAALLRRWILPESTAARCRRRGSMSTVFDARNISLRLHRDAACGDALGSLR
                     DASARAGPLLLQLAHLYGLMRCFTRSEASFLRLWQRITLRETPVAKLWMQHWGALEGA
                     PASPPLVVVVHLRRSGFEPRAHARRPDDFPANALHAWVLAGNESACVSSSARCALCQL
                     CAIQRRDPDARPLHFYVMHDGHGASLQTLALWKTFVEAQGDCGAAPSRVYDLTALVQE
                     SWQVLSPTLPAPGRNHIVSVVSEMYLAVYGAHLFVGSPLSTLSSNVARWRALGRYPLA
                     PSLSYTGDRYLSAIPHMFGFH"
     gene            <37288..>39432
                     /locus_tag="CYME_CMM016C"
                     /db_xref="GeneID:16995023"
     mRNA            <37288..>39432
                     /locus_tag="CYME_CMM016C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536895.1"
                     /db_xref="GeneID:16995023"
     CDS             37288..39432
                     /locus_tag="CYME_CMM016C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536952.1"
                     /db_xref="GeneID:16995023"
                     /translation="MAQTATLVERDLRSLLCSTRAGCCFAAAVAPERLRRRALTGAAA
                     HPPRRSGYHRGCPCGDVRMPGLHAGKQALLWRYQRSLPRRQQQYWGRHACRSGVLMSI
                     RSALSEQQAAASTDLLILSNGPGELYTWVRPLLMHLGEEFRISIALTPCPHASGREMD
                     AVLRFPHVARVLPPAHFWRLLLGIESHGLWEPGDSNAGSSSADMETFWRRQGVVLFLG
                     GDQFFAGLIARRLGYPCVAYAEWDAMWPGWISCYAVRRQAIRQRARRHLLYRLFVAWA
                     WILGLWGVTLQQRRRAVPRIVVIGDLTTDAVWQYDNVREKAKTLRDLYVAAYAETHLG
                     DSTAHETKLSPQNQHSSEVRSTAAAHQNRVPRTSVLQAGSSREKHILVGLLPGSKPSK
                     LAIMVPFLLLCAYHIHMRAMRLGVGPVVFVLPVAPGLDTATVQRFADPAHNSMFQFIP
                     GASAHSSLCTKFTAADEPSVATEQSKRPAPHAQVAQAMPSALDPDERNMEAGPGPLAP
                     CLLIDRVHAPAAGASGVGRLEASAVQVPIFLHEESPAYALLAATDICLTTVGANTAEL
                     ASLWTPALVLVPTHRLDVMRAWDGILGILCRLPLIGTIITILTNRIILWMYATRRWGY
                     FALPNRWAGNRELLPELVGNLDAQQVAARALGLALDQDRLQLIRHALRNHAQPSGAVR
                     RLAVLVRHAQRTAAVAAPREAVADAHDSLRTA"
     misc_feature    complement(40082..40654)
                     /note="possible transcribed region"
     gene            complement(40836..43455)
                     /locus_tag="CYME_CMM018T"
                     /db_xref="GeneID:16994979"
     misc_RNA        complement(40836..43455)
                     /locus_tag="CYME_CMM018T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461433.1"
                     /db_xref="GeneID:16994979"
     gene            <40934..>42064
                     /locus_tag="CYME_CMM017C"
                     /db_xref="GeneID:16995019"
     mRNA            <40934..>42064
                     /locus_tag="CYME_CMM017C"
                     /product="dTDP-glucose 4,6-dehydratase"
                     /transcript_id="XM_005536896.1"
                     /db_xref="GeneID:16995019"
     CDS             40934..42064
                     /locus_tag="CYME_CMM017C"
                     /codon_start=1
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="XP_005536953.1"
                     /db_xref="GeneID:16995019"
                     /translation="MSSQSTALSNGAKSVTSGQPDGNSDARVVYGDRLRFVPRNILVT
                     GGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIRGDIRSHD
                     LVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGKVRRFI
                     HVSTDEVYGGESNMETESSILAPTNPYACSKAAAEFICRGYVKSFGLPVIITRGNNVY
                     GPHQFPDKLIPKSICLLAQRRPCFVHGSGEHARNFLYVEDAASAFDTILHCGETDEVY
                     NVGSEIEKRNIDVVHDIIDLFGLSAEANRHIEFVKDRTLNDMRYRIDSSKLHALGWRP
                     QVSWEEGLRRTKTWYCDPNNLKRWPNYLSGLVPHPSLTEEKH"
     gene            <44215..>45558
                     /locus_tag="CYME_CMM019C"
                     /db_xref="GeneID:16995018"
     mRNA            <44215..>45558
                     /locus_tag="CYME_CMM019C"
                     /product="chloroplast ribosomal protein S1 precursor"
                     /transcript_id="XM_005536897.1"
                     /db_xref="GeneID:16995018"
     CDS             44215..45558
                     /locus_tag="CYME_CMM019C"
                     /codon_start=1
                     /product="chloroplast ribosomal protein S1 precursor"
                     /protein_id="XP_005536954.1"
                     /db_xref="GeneID:16995018"
                     /translation="MWAFLASLPLRSRSDFVSRSVRLGTPRSLLSARTTRPLSASPAA
                     SLVAAEERAAAPGNDAIKVITDASTSSDTKTRAPSRFERMRAKYGLSDVSEPEAAPAY
                     KELDQAVQNLSYKYELNMIVKGRVVHFEPRGALIDVGAKTAAYLPLSEVAMDRVSSPE
                     EVLKIGEERDFQIIATEDTEGQLRVSIKRIEFTRTWEKLQQALANDEVVQCEVVAVNR
                     GGASVRIDCLRGFLPASHIVLVPGFIPGLPSDPRLEDLMGKELPVKLLEVDPEKSRLV
                     VSHRRALAEKSLKNVETGTILEGTVRGIKPYGVFIESGGVSGLLHISQISHEHVEDLT
                     SVFTLGDKVKALVVSQDREKGRVSLSTKVLEPEPGDMLRSPQTVFERAEEMAARYRER
                     IAEEERARAEYASDIVAGLDVASLGVDAEVNGDAGAGAQREHPRPDQEESSPASS"
     gene            complement(<45636..>46355)
                     /locus_tag="CYME_CMM020C"
                     /db_xref="GeneID:16995020"
     mRNA            complement(<45636..>46355)
                     /locus_tag="CYME_CMM020C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536898.1"
                     /db_xref="GeneID:16995020"
     CDS             complement(45636..46355)
                     /locus_tag="CYME_CMM020C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536955.1"
                     /db_xref="GeneID:16995020"
                     /translation="MNTLFRFVFLRALPLVQQPELRSASATELADIAKQITSTAQDRY
                     THHLERLERSRLAPSAGTPSASVPETTTLDERSQTHVRLASWALGAYRTLYPLLSNDE
                     ERTLRVVRQGFGVQGDSTPQSVSLLQRLMVRFRLFLARDPRRARLMLAERFVADLGPL
                     FEARWAPTRHPEAHDVLLIHRCLYEEIFRLEGVPKLLSLFCAMDRANFVDLSQFTLEP
                     GLAYATKRQACRFDFGPAKLS"
     misc_feature    45692..46941
                     /note="possible transcribed region"
     gene            46464..47827
                     /locus_tag="CYME_CMM022T"
                     /db_xref="GeneID:16995037"
     misc_RNA        46464..47827
                     /locus_tag="CYME_CMM022T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461434.1"
                     /db_xref="GeneID:16995037"
     gene            <48748..>49659
                     /locus_tag="CYME_CMM023C"
                     /db_xref="GeneID:16995033"
     mRNA            <48748..>49659
                     /locus_tag="CYME_CMM023C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536899.1"
                     /db_xref="GeneID:16995033"
     CDS             48748..49659
                     /locus_tag="CYME_CMM023C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536956.1"
                     /db_xref="GeneID:16995033"
                     /translation="MGKRVADAVHGSFTPFNLLCLCILAFAGCFTPAIAVTTFPGAGQ
                     VVQAGERRLAQLALKATDSMHPCWTRLYEQFAYDTETEIGCRGGVERPAMLMLTCHLS
                     SSGRLSNASQPLQQLYTDFIKLTRYLNTTQSSLQATNEANRVSRASPLSSERFEFDVS
                     GIAAELSPHEFQLYSLFFAHCASICYFLLAYRHTAQVKEAVQQMQADATAAMHAMQVA
                     LERQPPGHPVREVFLGSPLLFVVTIGWLLHIRFGRWMLLVLIAIYAAGGWVAIAGMPV
                     PLVFIRLLFWLRRRFDEPLALAHYAGS"
     gene            complement(<50517..>51908)
                     /locus_tag="CYME_CMM024C"
                     /db_xref="GeneID:16995034"
     mRNA            complement(<50517..>51908)
                     /locus_tag="CYME_CMM024C"
                     /product="similar to nuclear protein UKp68"
                     /transcript_id="XM_005536900.1"
                     /db_xref="GeneID:16995034"
     CDS             complement(50517..51908)
                     /locus_tag="CYME_CMM024C"
                     /codon_start=1
                     /product="similar to nuclear protein UKp68"
                     /protein_id="XP_005536957.1"
                     /db_xref="GeneID:16995034"
                     /translation="MNTAAQGAQGGVLLERKLNHEERTALLGKLQERLRALFGAGPHP
                     VEEMLPEYILTMVENRRSAEFMAGELNSLLAGERAGLGDEIIQLVSGELRQLSTDAAS
                     QREQKRSRPGKSLENDHDVHETQNANASKGDVDGKRDACALNQEAQTTATSEGRQALP
                     VEQSPAALNGAENLAARPASDSESVHNREPQLDKRSTSATGKRQQQRTSREARTSQRQ
                     VSHTGETWKKRRMENENASQQRGELMDEPVQTRDEAPTQSTPAEKQTTGPQDSNACDS
                     DPGSASTASDLPPRCQFWPNCRNASACKFHHPTELCRFYPNCRSGDRCRFIHPTSRSG
                     SSATLALMRKAMGMPLHHGIPIPCKYGFACERRRKDRSCPYAHPLLACRYGKDCRKIA
                     LGTCAFSHAPLCRYGWSCTRPGCTFAHPAQESGTESSEQADANRSRGESVTTPSSDAE
                     MDNAQAPMMVSES"
     gene            51309..53196
                     /locus_tag="CYME_CMM025T"
                     /db_xref="GeneID:16995035"
     misc_RNA        51309..53196
                     /locus_tag="CYME_CMM025T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461435.1"
                     /db_xref="GeneID:16995035"
     gene            <54587..>58495
                     /locus_tag="CYME_CMM026C"
                     /db_xref="GeneID:16995031"
     mRNA            <54587..>58495
                     /locus_tag="CYME_CMM026C"
                     /product="polyphosphate kinase"
                     /transcript_id="XM_005536901.1"
                     /db_xref="GeneID:16995031"
     CDS             54587..58495
                     /locus_tag="CYME_CMM026C"
                     /codon_start=1
                     /product="polyphosphate kinase"
                     /protein_id="XP_005536958.1"
                     /db_xref="GeneID:16995031"
                     /translation="MRCCELGPNTGADQPERTEPPSETSESDEVAAAVAAAAAAAGDL
                     ADRLTRSVDEQSRSAGCAASGAQDKPQTLCSVQDVTASTAQRFDVRQSKECGEAVQNF
                     SELGVGKQQEHADPRTVWLPGSPEPTAFPQVRLVGNWDLPMVPMNEEPSEYTSSVREG
                     AVPDLCEEGSVTRASRIGACVVQAASHSREAVAGDAQSTDDQESEMHTASASTTTASS
                     LKQCTADGKSGESTQRLHTDSRASSGIAFVPYKSEEEVLADLELEDSMDDHTYTLLDL
                     RKSLPEQMQRRSYACPTVRDGSRSDRHLDRRAFRGENEEEHDDDSSSGPDRDVWTPPA
                     TPLDSEMPLIVCPPEPVWPCEEDLRDLTPAELARSTDVFMQVAEELHFHWRVLKLGTD
                     PVTPTPLLERLKFLCIVSSNLDEYFSKNMYDVSKTMRPLYERISAAIRDITAQQESCF
                     TDVILPALARYDMRILRYADLSMTQRAQMNAFFHARLFPLLTPLTLDPTHPFPLLRSH
                     SLYLAVLLKGAQLMPPSEHDAHDGDESPIPALSPPNASLDRSIATALPSDTHVAWVRV
                     PSSCSRFITVDNEKRFLPVEEIIIQNLDALFENVRVIAAYPFRVTRNTKLELDKIELN
                     ESEDFLKIVEENLYSRQRRAAVRLEVSRDMPDVLTTLLREQLNLEPLAMYRSRAPIIG
                     LNDCFMLTNVNIPALRYPPWRFKTHSILAGYKYGVQSGHTAHMFELIRHNDVLFSFPI
                     HSFDETTLRFLESAVRDPAVRLMKMVLYRCGNNSPVVKLLMEAARRGIDVNVLVELKA
                     SFDEDQNVLYARMLQEAGCNVAYGVKGYKTHAKLILVVREENHALVSYCNVATGNYNA
                     TTAKIYTDFSLFTSREDICADVTDLFNVFTGYSAKRSFRKLLVSPVNMRDRFLELIQR
                     EIDNARAGYPARIICQCNGITEVLITQRLYEASMAGVRVDLIVRGICRVRPGITGISE
                     NIRVVSILGRFLLHARVFYFANAREAKPEYYIGSADWRTRNLLARLEAVAPVEDKYLQ
                     QTLWRHLNRLLSDSVNGWEMLPDGRYVKGESEALGHLRDAIMAARREAEAEALKPPAQ
                     APVSADEVTPGSSEAEHLPVVRKAGCVPVRLNRRHNTRRDDIGTRYEVLLITSTSSSF
                     IARHPNDSRVSEIPDGGITWVFPKGSMAYGEDGRSAALREALEEAGVSGELGPLLSVS
                     TKRKRRTVVMTEFYLLHVKQQLSQWGESSQRHRRWFTLDEAANVITKEYLLEALMKAR
                     QALGETPTSQPTSPPAPPAPPPAAAAAAAFESTTNGGKKH"
     gene            complement(<59256..>62039)
                     /locus_tag="CYME_CMM028C"
                     /db_xref="GeneID:16995032"
     mRNA            complement(<59256..>62039)
                     /locus_tag="CYME_CMM028C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536902.1"
                     /db_xref="GeneID:16995032"
     CDS             complement(59256..62039)
                     /locus_tag="CYME_CMM028C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536959.1"
                     /db_xref="GeneID:16995032"
                     /translation="MEDPKIVEGLVITGNVGWIIRINLITAGLNLLLFAAVGNPASHL
                     TPEQRRILINFQRIVAEDADDTIDDALAGAPARVQQTLTGVPVEQLKKDVPSTIITAA
                     AAAATPTVSSRSPAADISLERNLYMSFVWIALLLAGVLSLYGLVVQLPLMLWFTRSTS
                     SASGWRTWWERMHTAYTLSAGFESGARAAVLMQLPVWMACVTTIVLWRLALSPTMRHD
                     SVGAVESPADERSTPPDAASHLPARYDSLARTSSMEAGQASRRKQRPLYLLLGGWPRQ
                     GWDAARIEAALYRRYPQLSIQKVELIYRGQLVAAERQRRRRYLQAFYEYLASLPSEEI
                     HIPLGLRLWTTSPSAQLEQRELWRQAELARLAQQLAQLDQHDDDDDGRTAGSEHAERF
                     TGWILVAFREPWWFHQCLVDCERHRRQRRLLPRLMSACRRLCASVDDAFQQPLVADSA
                     TSGLQLREAIPTRDASSNENVNEAFFRPLHAEAVESLSDVQWSHLGIPAWERWLREVV
                     LNVLFALGLLFLSSPVAILSVLQVLASATTNAPLSSLQAFTAPNASRWCLFWRQSSDH
                     QHGPVGSVVGNPHIRGIDMLSCFKTLSRRFEMHGAIQHVLRASSPWSKQIRRTLIRID
                     EATGMRTGRSSWPTAFVFSYLPVGLLMLINSAVPWMLRQLAKHESHMTRSAEEASILR
                     KSIAYYLLNTLVLPSLAINTAAEVVLLAYRRAASGKTPQRVLQVVERIFRGDNAFFYT
                     NFLIQLALTGNSLALLHPMHWLRFLWRRQHAYTPLVLAQAGQAAPFDYPYAYAQVIKV
                     LAIGFFLGPFVPFLWLFIGLYLVTKYFTDRYNLSKVHPPHPTDTRMARTATNAGAVVL
                     TTAIVLLVLLSWIYGNTGLLLVLLLSVAYLWGLLLELRWHPDRLVGFTHRIRQRFVLF
                     GTYALQLVRAAPP"
     misc_feature    59284..60881
                     /note="possible transcribed region"
     gene            <63450..>65264
                     /locus_tag="CYME_CMM029C"
                     /db_xref="GeneID:16995040"
     mRNA            <63450..>65264
                     /locus_tag="CYME_CMM029C"
                     /product="notchless"
                     /transcript_id="XM_005536903.1"
                     /db_xref="GeneID:16995040"
     CDS             63450..65264
                     /locus_tag="CYME_CMM029C"
                     /codon_start=1
                     /product="notchless"
                     /protein_id="XP_005536960.1"
                     /db_xref="GeneID:16995040"
                     /translation="MVLSCFVPPDYERGQPTDRVCIGPPVDLPLTTTSLQLAQLLLSF
                     LAQERERASKERWANLRTLAAASRNRKRDNSRNASDADQLTESQILADQERLAVLQAE
                     HWEASEKERAEAELYADWSKRLEHLARELEASTTPDDTNSAGAAGIALQQLAALPFAF
                     VVLETGREVRQTLADALSTTQMTSTERLLHIQFFLQASFRIRLISRCSATVPGHTDAI
                     LCLSFSPDAKWLASGSGDKTVRLWDPDAQLPRAMLNGHQGWVLNLAWSPDGRWLASGS
                     MDHTVRIWDMESCLVSGRGSKTNASDVRWVFTGHSRWITALCWEPYHCNQGRCERLAS
                     ASKDGSIRVWNIRLGRCERSLTGHSASVTALRWSGHGMLYSASQDCTIRVWEPSTGVC
                     WKVLPIHGHWVNAMTLHTDHLLRCGAYSVEDNAGRSNGAAASRIRRLSVEEAADRVAR
                     LGPERLCAGSDDHTLSLLTLEFDRNQDWSTARWRVKRLTGHQQLVNHVSFSPDGRWIA
                     SASFDKSVRLWNGFSGQHVATFRQHVQAVYMCCWSSDSRLLATASRDSTVKVYDIREG
                     LLKRDLPGHADEVYAIDWSVDGRTAASGGKDCVLKLWR"
     gene            complement(<67069..>67437)
                     /locus_tag="CYME_CMM030C"
                     /db_xref="GeneID:16995042"
     mRNA            complement(<67069..>67437)
                     /locus_tag="CYME_CMM030C"
                     /product="NADH dehydrogenase I beta subcomplex 9"
                     /transcript_id="XM_005536904.1"
                     /db_xref="GeneID:16995042"
     CDS             complement(67069..67437)
                     /locus_tag="CYME_CMM030C"
                     /codon_start=1
                     /product="NADH dehydrogenase I beta subcomplex 9"
                     /protein_id="XP_005536961.1"
                     /db_xref="GeneID:16995042"
                     /translation="MGAAVSMPAQRAAPFAPGLTHQQRVTRLYRHALRTARDWFVDVD
                     LWLERSREIQAEFQRNKNAGPREAQILLNRGLSRLLEMRHPEPYTAPYLPGGCTYQRN
                     VPPPPELCERSLPPHSEMIR"
     gene            complement(<68411..>70072)
                     /locus_tag="CYME_CMM031C"
                     /db_xref="GeneID:16995038"
     mRNA            complement(<68411..>70072)
                     /locus_tag="CYME_CMM031C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536905.1"
                     /db_xref="GeneID:16995038"
     CDS             complement(68411..70072)
                     /locus_tag="CYME_CMM031C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536962.1"
                     /db_xref="GeneID:16995038"
                     /translation="MQALRPKLAVFHGTSRHLTTSTALSDARQAVRRMRRYLSSSRGL
                     GSTLQPVLHALWFSSFQGRHRRVAELLLLLLSLWLLLLLLPQSVLHGLPRAFRNVSSD
                     LRLPRQFDGCARVPLGCKRSVDDYIALTGCCSRAGLGHTISAMNRIVHLAQRLGLRHV
                     YDPEAMRGLGHGIGDKAEAFFNLSLYTTPRTAVPSDHIAIRITASTLKHRDERELLAL
                     LQHWRSAVERQPTLRTRALFFQFEAVFSPGGALASSWACTASWWRSVFQRQRAVFMES
                     RRNQNADDFAELSRTVSIALHVRRGDQVPRYPMYKPNAYVEAGLRRNLPDSWYVAAAD
                     AAFKAHCHRAGPVFCAPHLLRIRIFSESPLVDMDGYPSRLKQWLYERFPGAKITQHLD
                     MTTIDALIEMTSADIFVGSRSAFSQLVARLMPVHSTVLVPPQFPSNYSDPEAAPLPCS
                     LVQAPWQLRTVGEPPGALYWPEYVCLRGENSAVPGSGRSSPQRISKANRPMWRRSRHA
                     MPRAFFGERWAQPRNWSFVVERLMHPDREWWLPELQHELQVRPHC"
     misc_feature    69673..70966
                     /note="possible transcribed region"
     misc_feature    complement(71135..72366)
                     /note="possible transcribed region"
     gene            <72963..>74660
                     /locus_tag="CYME_CMM034C"
                     /db_xref="GeneID:16995044"
     mRNA            <72963..>74660
                     /locus_tag="CYME_CMM034C"
                     /product="NADH dehydrogenase I iron-sulfur protein 75kDa
                     subunit"
                     /transcript_id="XM_005536906.1"
                     /db_xref="GeneID:16995044"
     CDS             72963..74660
                     /locus_tag="CYME_CMM034C"
                     /codon_start=1
                     /product="NADH dehydrogenase I iron-sulfur protein 75kDa
                     subunit"
                     /protein_id="XP_005536963.1"
                     /db_xref="GeneID:16995044"
                     /translation="MPALARTVLRTALSKVLHLHRERPLQHCRRFGALTSKPYAFRAR
                     PWELKSTESIDVFDGVGSNIRIDAVGTEVRRILPRLNEEVNEEWISDKTRFAYDGLKR
                     QRLTVPMVRIHTGEANEQLVGVDWYKARAILVNKLVSAIREAATPATTQRSAFEAHAI
                     IGPYADCESIAALRRIFYSMFPEGTAFVHVQGHANTGTPPTDFRYAYCANTTLAGLEH
                     ADVILLVATNPRVEAPLLNNRIRKAVLFGNARVGLIGCHADLTYNREHLWHLGTSPAT
                     LLRIAQGRHAFCSVLAKAQRPAIIVSQQAFQRHDGAAIFGCLATLVDHVPRLVPRDGS
                     WNGLNVLHTAANTVGALDLGFDHTLKGNRWIDQSGAQQTSEQPWARAKLLYLLGADDI
                     DGLEELPETCYVVYQGHHGDYGASIADLILPGAAYTEKNGTFVNTEGRVQRTARAFLP
                     PGQAKVDAEILDELLVGLDHAAGFFDAAQEMEFLAPHLGVQYGLQEPDLIRTPNTGQV
                     QLGGAKAERARSLPLSPMPFGPVIENFYMTDPITRASATMAKCVRVARYSNFEESSS"
     misc_feature    complement(75698..76025)
                     /note="possible transcribed region"
     gene            <77281..>78255
                     /locus_tag="CYME_CMM036C"
                     /db_xref="GeneID:16995050"
     mRNA            <77281..>78255
                     /locus_tag="CYME_CMM036C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536907.1"
                     /db_xref="GeneID:16995050"
     CDS             77281..78255
                     /locus_tag="CYME_CMM036C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536964.1"
                     /db_xref="GeneID:16995050"
                     /translation="MVPCPFAQRLTEQSSLGELNTPGEAEAENDPSRRPQCPFQRSVE
                     SGTEAPSRSGDQWTHARSESILCPLCHTPPVPRAGGYALALPCTHVYCGACAANGVRD
                     CLLCGCTVSGFVQGSEYVKEDALFEDIRQTAAKYLTLNAAQLCVQLGVKRREPFLLET
                     AIRTYARELEWSEQKEALTQLQAEAVSPVASATCPSIAEGSASEDVVANNGPSMELAE
                     DAWLTMPKLRARVLYAVACGILAEMKLSADWSSLELATRSDTVREAYHYAKTSVDVLL
                     GLDRLGSPFIEQALEQSLMRLEWAARVLRNLRSSTTRADKLHLSTEAA"
     gene            complement(<78252..>79352)
                     /locus_tag="CYME_CMM037C"
                     /db_xref="GeneID:16995051"
     mRNA            complement(<78252..>79352)
                     /locus_tag="CYME_CMM037C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536908.1"
                     /db_xref="GeneID:16995051"
     CDS             complement(78252..79352)
                     /locus_tag="CYME_CMM037C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536965.1"
                     /db_xref="GeneID:16995051"
                     /translation="MCSPSRSLHRPAGLSTVPVLELPSTPLTSERRGASRICDRSSTD
                     TALVMTAPPLDRRSRSRRHTALHRTLVEGEQFLYRGRRRQLELDAFQQPRRLEFGVDG
                     TDELPQTGHTSATIGTNAGNEARAPEKTRQDSMKPAAMYGSRVTLTPVRASPAQRRLL
                     GSSLVLSPVRVSSRQSRNAPASMGSGAAAKSPSTADLLAAASWAYSPNRAIPQPQSDE
                     PAVNESPVAGPAASWRQTLAALRQLALSGGGAAAAAVAECPREDPASCAQRERAKRND
                     PRTCTPAVHDALSEFSTPEKGAQGARSSTHHRSLSPASPAVADIDAIALAGASEPGTH
                     PLKAVSTENVPVLHAKRAASRTAGNLARLVPG"
     misc_feature    79259..82643
                     /note="possible transcribed region"
     gene            complement(<83309..>83476)
                     /locus_tag="CYME_CMM038C"
                     /db_xref="GeneID:16994980"
     mRNA            complement(<83309..>83476)
                     /locus_tag="CYME_CMM038C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536909.1"
                     /db_xref="GeneID:16994980"
     CDS             complement(83309..83476)
                     /locus_tag="CYME_CMM038C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536966.1"
                     /db_xref="GeneID:16994980"
                     /translation="MMIISTACAFFPVHVLYIGENPDILLNAFFMMIISTACAFFPEH
                     VLYMVKPLTYC"
     gene            <84066..>84692
                     /locus_tag="CYME_CMM039C"
                     /db_xref="GeneID:16995049"
     mRNA            <84066..>84692
                     /locus_tag="CYME_CMM039C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536910.1"
                     /db_xref="GeneID:16995049"
     CDS             84066..84692
                     /locus_tag="CYME_CMM039C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536967.1"
                     /db_xref="GeneID:16995049"
                     /translation="MASTTVNGEVGGSAARTGGKRGTGRVGDAASGDLVFTSACRLVR
                     DQSETLSASDAKSLPSIKVSWDQKLSTYIYRTKRFLLSSERVSISGIGMAITSVVMCA
                     EILRNEGFVDIVSIETSMLKSKAQNAPAHQKPVVEIVVERTPQFHERMEAENAARAAR
                     RPDRERRAATGAPSGRRGGGNARSAADARPHPRDGEEESEENEDAEHE"
     gene            complement(<85491..>85850)
                     /locus_tag="CYME_CMM040C"
                     /db_xref="GeneID:16995055"
     mRNA            complement(<85491..>85850)
                     /locus_tag="CYME_CMM040C"
                     /product="60S ribosomal protein L30"
                     /transcript_id="XM_005536911.1"
                     /db_xref="GeneID:16995055"
     CDS             complement(85491..85850)
                     /locus_tag="CYME_CMM040C"
                     /codon_start=1
                     /product="60S ribosomal protein L30"
                     /protein_id="XP_005536968.1"
                     /db_xref="GeneID:16995055"
                     /translation="MSATRKTRSVSEAINARLALVMKSGRYHLGYKSTLKSLRQGKCK
                     LVIIASNCPRLRKSTLDYYAMLAKAQVYRYPASSIELGTACGRYFRVMVMAITDPGDS
                     DILKAITEEAAGGSAAV"
     gene            <86341..>86736
                     /locus_tag="CYME_CMM041C"
                     /db_xref="GeneID:16995056"
     mRNA            <86341..>86736
                     /locus_tag="CYME_CMM041C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536912.1"
                     /db_xref="GeneID:16995056"
     CDS             86341..86736
                     /locus_tag="CYME_CMM041C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536969.1"
                     /db_xref="GeneID:16995056"
                     /translation="MSEIAWYRLRNLYRSILRKHQQCLPLELRVLGDQYVAEEFRRMR
                     EFLLRSQSQTASRQLSEFLEQWQMYLESVGPEGLTTVDVEPALWQQLSPEQRLQLERL
                     RATATTRGEGKAPASVFGRAGPPTRSSSE"
     gene            <87941..>89836
                     /locus_tag="CYME_CMM042C"
                     /db_xref="GeneID:16995046"
     mRNA            <87941..>89836
                     /locus_tag="CYME_CMM042C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536913.1"
                     /db_xref="GeneID:16995046"
     CDS             87941..89836
                     /locus_tag="CYME_CMM042C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536970.1"
                     /db_xref="GeneID:16995046"
                     /translation="MSSRAVRKLLSADSVPETNASEEPGVAVDDHSVAANEAQVGVRN
                     PFAVLADQQEHEDGFGEPEKPQNQLSDSVETFLVPESGAPSRRKGRSRRASRVAGQKV
                     SAETEFTIGYRERTLHGTRKDASREPQVDDENLSHHSELKHRWYAQTCAGFEPFAVDT
                     SKLNADGELKHLFGREVVERDHLDQQRAQSATATSSRGSRAIRQQQRRYRERNKSSRY
                     ALDLRRRSLFVYPNPDWFQLVRGLTMEPAPNWNAPRPVYRYRFRDPYNSLEEGFEQVV
                     RSGDHELLIEFSWTNPFHVGALLQLSELYRVFAEAEREQEAIERALWALEISTHPRYR
                     PGEAYLPFAYVENRQYYRALCCAAERARSKGAYRSATEIAKVLCTLDPPVDETGSTRR
                     PWSDPVGALLVIDAYALLAKEWQWICQCLESEHPAAVLLRDLPNWQFSYLYAKYKKNG
                     IGASQIHASLVDALLLKQLRMCVERFPHLARLLAFDARDGMESLPLLCRRAMFGYASR
                     TAALWRNSPLMDCIRQCLGTSDARSIPAYPISTTDASWIGCVGYSDDIRYTEWIHRGD
                     TAPANGSVSFGEEEAAASATTIADELQFLSMGTNTESNLDTNASSEVESGEMTPNGSD
                     SDAVAER"
     misc_feature    complement(90964..94549)
                     /note="possible transcribed region"
     gene            <94121..>95398
                     /locus_tag="CYME_CMM044C"
                     /db_xref="GeneID:16995052"
     mRNA            <94121..>95398
                     /locus_tag="CYME_CMM044C"
                     /product="box H/ACA snoRNP rRNA pseudouridine syntase
                     component dyskerin"
                     /transcript_id="XM_005536914.1"
                     /db_xref="GeneID:16995052"
     CDS             94121..95398
                     /locus_tag="CYME_CMM044C"
                     /codon_start=1
                     /product="box H/ACA snoRNP rRNA pseudouridine syntase
                     component dyskerin"
                     /protein_id="XP_005536971.1"
                     /db_xref="GeneID:16995052"
                     /translation="MTPKSSASLAEQQRSLSFQIPSDAGENGLSTDSWPLLLKNYDRL
                     NVRTTHYTPIPDAGYSPLKRPIQEYIRSGVINLDKPANPSSHEVVAWIKRILRVEKTG
                     HSGTLDPQVTGCLIVCIERATRLVKSQQSAGKEYVAVLRLHGMRPELDEATVRRAIET
                     LTGPLYQRPPLISAVKRQLRIRTIYESKLLEYDPKRRLVLFWVSCEAGTYIRTLCVHL
                     GLLLGVGGHMQELRRVRSGVHSEYDGMVTMHDVLDAQWLFDTTKDESYLRRVIKPLES
                     LLVHHKRIVIKDSCVNAVCYGAKLMLPGVLRYENDIECGEEVVIMTTKGEAVALAIAH
                     MSTSEIASCDHGVVARIKRVVMERDLYPRRWGLGPVASRKKAMIQRGELDKHGRPNEH
                     TPSDWRRVQPELESAPSRMERQAGPPVRPPKSH"
     gene            complement(<96361..>97791)
                     /locus_tag="CYME_CMM045C"
                     /db_xref="GeneID:16995053"
     mRNA            complement(<96361..>97791)
                     /locus_tag="CYME_CMM045C"
                     /product="stearoyl-CoA desaturase"
                     /transcript_id="XM_005536915.1"
                     /db_xref="GeneID:16995053"
     CDS             complement(96361..97791)
                     /locus_tag="CYME_CMM045C"
                     /codon_start=1
                     /product="stearoyl-CoA desaturase"
                     /protein_id="XP_005536972.1"
                     /db_xref="GeneID:16995053"
                     /translation="MTAKVESKVREEEKGSNPSTAAADDSGAVIPTLKPRPKPAVEPL
                     EREGVEFDPQRGLVFEKTRSSKWMSEKELNELPLLQRINWLSTSIIFTPLIGTLIGIW
                     FVPLQRKTLVLAIVTYFCCGLGITGGYHRLWSHRSYEAHWLVQVILACFGAAAFEGSA
                     RYWCRLHRAHHRYVDSDRDPYAVEKGFWYAHLWWMVFKLPRQRQGRVDITDLNANPIL
                     RFQHRYYLQIAILFSFVIPLTISTLGWGDFWGGLVYACLGRMLFVQQSTFCVNSLAHW
                     WGEQTFSRRHTSYDSVITALVTLGEGYHNFHHEFPHDYRNGVVWYHWDPTKWVIRLLS
                     WAGLAWHLVRFPRNELVKARLQVRQEILDEAKKRVDWGKPIESLPVWTWKDVQRLAKE
                     ENRLLVVIEGIVHDCTRFKVQHPGGQRILEFWNVRDATQAFNGDVYNHTKAARNLLAH
                     LRVAQLKEIYEPECDESTTEMSTKSS"
     misc_feature    97171..99155
                     /note="possible transcribed region"
     misc_feature    98867..100260
                     /note="repetitive element"
     gene            <101183..>103360
                     /locus_tag="CYME_CMM048C"
                     /db_xref="GeneID:16995057"
     mRNA            <101183..>103360
                     /locus_tag="CYME_CMM048C"
                     /product="pre-mRNA splicing factor ATP-dependent RNA
                     helicase PRP43"
                     /transcript_id="XM_005536916.1"
                     /db_xref="GeneID:16995057"
     CDS             101183..103360
                     /locus_tag="CYME_CMM048C"
                     /codon_start=1
                     /product="pre-mRNA splicing factor ATP-dependent RNA
                     helicase PRP43"
                     /protein_id="XP_005536973.1"
                     /db_xref="GeneID:16995057"
                     /translation="MTHVPSEDSHKIQVSTAKSPPPNSKRTIAHELESMETSARPSRC
                     RETNGGPAGPCNPWTGKPFSSLYYQLEEKRRALPVFQERERIVEIVKRNRVVVLQGET
                     GSGKTTQVPRLLLEAGFQRIACTQPRRIAAVSVATRVAHEMDVRLGELVGYTIRFEDV
                     SHPKLTRLKYVTDGMLLREAFQDDRLSRYDCIILDEAHERTLSTDVLMGLLKGILKQR
                     PELHMVVMSATLERDHFCTYFDHAPLLNVSGRMHPVDIRFAERPVFDYLFAVEQQVRQ
                     IHENEPAGDVLIFLTGEEEIEDMCSRLRHYSRATARKHGAPLQVLPLYSALPMSVQER
                     VFEPPRPPEARKVIVATNVAETSITIDGITYVIDPGFAKVKIYNPSTRVESLLVSPIS
                     QDSARQRAGRAGRTRPGICYRLYTEEAFRTELPARSHPEILRSNLCNVVLTLKKLGIH
                     DLIHFDFMDPPAPDTMIRALEMLFYLGAVDEEVELTQLGRQMAEFPLDIQIARMLLES
                     PRHGSSNEAITLAAMLSVPNVFLRPRQQADEADARKQRFVVSDSDHATLVRVFEAFMD
                     HGCDRQWCAENYLNDRALMHAVNIRRQLELMMQRMGLRICSPGRRAPDRWIRLRRCVL
                     EGFFSQTAFWMRRRDYLTIRDEQLVGLHPSSVIRHRPSWVVFHEFVLTTGSYIRTVSQ
                     IEPKWLFELPTKYYDLLEYKEGASRRALELAARLTGQRRSAAP"
     gene            complement(<104615..>106129)
                     /locus_tag="CYME_CMM049C"
                     /db_xref="GeneID:16995058"
     mRNA            complement(<104615..>106129)
                     /locus_tag="CYME_CMM049C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536917.1"
                     /db_xref="GeneID:16995058"
     CDS             complement(104615..106129)
                     /locus_tag="CYME_CMM049C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536974.1"
                     /db_xref="GeneID:16995058"
                     /translation="MWRQVLLCGLIFELVRNLALWFAFHQPRSELDAHSLPTSLLQRG
                     ARSARFRLHVWRHRTAGVVSKQYTEHVLEVRSPFCFNSTNAVLFIEASGSQRSVDPDA
                     THRVQSFLQQKRVRVERVTSLEPVRRAIPNLTNETLVLNWFSRAAYFNPAHFAGEWLA
                     NWGLPRQFGASEGKRHAPVVLWWPAHAQHATSPLYACGTERDNQSIFCVYLHAMVTAY
                     SRQQGRELPFRRNTVLCGSRLLLPGLLKSRFFRSPADAMAWRAAVLDHLGMKSAPAQR
                     TMLPADTSGRDQCRAVPSIMPLWHRPSPRLQVTYLRRGAEKRSQAACRRRCLANEDAV
                     VALLRRYREAYAYDFTIVEASANDTTRSSVQRLVEMIQRTHVLISVHGAQLVYASLLP
                     PWRSALIELFPYGFQHDMYAHAGGAPVHYFSVEGDSPPIPSSPLPFWERETDDMDAAD
                     LDFAAATATAHYPDSQTSSRVYLRDQAVQVPLRPLRRALQVALATLRDQACTES"
     misc_feature    105396..107038
                     /note="possible transcribed region"
     gene            <107909..>108946
                     /locus_tag="CYME_CMM051C"
                     /db_xref="GeneID:16995066"
     mRNA            <107909..>108946
                     /locus_tag="CYME_CMM051C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536918.1"
                     /db_xref="GeneID:16995066"
     CDS             107909..108946
                     /locus_tag="CYME_CMM051C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536975.1"
                     /db_xref="GeneID:16995066"
                     /translation="MFVLGLLHAARPSLSWQKLERRRRLHLGQRRPRSSGRGCVVALR
                     PPPGDPIAKKYAELDSDPYGPARIRNEPQMEKNQFGIEQPVLKPLEQFQVSIFGELRE
                     PVEEQDFTYRWERDSDEDWPVCPRGLYPENYPLSDVLKAELDMPTVEEYDYDERVYHI
                     VELEPSILDMLQEDGLLRVRDKRAPSDATGTKSKRGQRGIRAPVEGTEPARASKAGRR
                     RRERDDSEALFDDVEDVAFGDDVSIHELPDVDPDEPTLLEDESLVDGDLEIDDMIDEG
                     DLDVDSEYDDTAFEDDTTDYDADEVLDDDSDDYRLDSLDEDVDVDFDYDGGFGSRATG
                     PIGLSDDFDYD"
     gene            <110825..>111736
                     /locus_tag="CYME_CMM052C"
                     /db_xref="GeneID:16995067"
     mRNA            <110825..>111736
                     /locus_tag="CYME_CMM052C"
                     /product="transcription factor APFI"
                     /transcript_id="XM_005536919.1"
                     /db_xref="GeneID:16995067"
     CDS             110825..111736
                     /locus_tag="CYME_CMM052C"
                     /codon_start=1
                     /product="transcription factor APFI"
                     /protein_id="XP_005536976.1"
                     /db_xref="GeneID:16995067"
                     /translation="MSVFRRFLYHLGYLARETGQALDRAGCFLQGNFAYREALYLSRH
                     RQIMNLVDRKPIISPQVQFIAPNAAIIGDVAIGAASSVWYGAVIRGDVNKVVIGERTN
                     VQDRAVIHVASGGGKLERALPTFIGNEVTIGHGAILHACAVEDQAVVGMGAIVLDGSR
                     VESGAVIGAGSVLPPGTVVGAGQLWLGTPARFVRLVSAEEKQQFAVQCSQYVELAKMH
                     ATECGKTPDQLDAEQMAALLWEERSEDYLSSLGLLGKEEDVMAAQKAYLAHERQLAAS
                     GAPKGSGKPETKISSSTDARQQVSAGH"
     misc_feature    complement(112399..113260)
                     /note="repetitive element"
     misc_feature    complement(113752..114081)
                     /note="possible transcribed region"
     gene            <115253..>116362
                     /locus_tag="CYME_CMM055C"
                     /db_xref="GeneID:16995062"
     mRNA            <115253..>116362
                     /locus_tag="CYME_CMM055C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536920.1"
                     /db_xref="GeneID:16995062"
     CDS             115253..116362
                     /locus_tag="CYME_CMM055C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536977.1"
                     /db_xref="GeneID:16995062"
                     /translation="MNAAVLRAPTDVVLVDTGTADDTFRVDDNVDAEKVSPRVQRLSD
                     LDDAEQPRKQDVHRELDPVPTGPPVPLGEIPNINYMITNKFSGKDATLKTIHSLLFWR
                     PGTHLKVKQSLRQWAGVPADEPPSVADARRQRMRQRLMRLRMDELKPICNVLDLPLTG
                     AKEDLTQRIMRFLEHPFIWPGRRDLAAAAQRRRKRRATPSKGSTASKRRQRPHPCPRQ
                     SKDSHSMHAAANTLSDESSAASEASLDDSDSVPSDASSDADFVSHAPRVKRTPSASST
                     VRAVAAPKAARSPSGERAQEKSSTRTLRAQVTEALETILQDAKDRLHSLTMNQLRAQV
                     SQRIGTPVTDDEMVAFRQFVRSKLVSQMQAANASK"
     gene            complement(<118514..>119641)
                     /locus_tag="CYME_CMM056C"
                     /db_xref="GeneID:16995059"
     mRNA            complement(<118514..>119641)
                     /locus_tag="CYME_CMM056C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536921.1"
                     /db_xref="GeneID:16995059"
     CDS             complement(118514..119641)
                     /locus_tag="CYME_CMM056C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536978.1"
                     /db_xref="GeneID:16995059"
                     /translation="MDPEPNSLCWAVLNGNNHVGGPTRTVPSFVTRVVRPSPAYGRSG
                     RRCAVQKSGCESAALLPRKRWRRWRPYTSRSASVAPAVVQAVSEPSPGSEDAERVPRS
                     DDDVDVQVSASTEALAERLLSEIHRRLQESLEGQLRVELARQRAIDRIDLLVAVELVK
                     LREKLQLLFDSYRERLTLRTEEMDRRANELAPSWAQVEERLEAAQERARVLRQTQDEI
                     ESLLRGSPHTPVPRSGAAPKHAERTSLVRFDESAGAALPSRQALQQGSAWRLEEEQAL
                     SPYWVFFYGWLSALAGLEASMAVSSAHGVSAYTALSGTVCLLLLGHAVRLGWAARRQH
                     QATRGQQPALPSCRVVSSGTQAATTPSTEGQTEPTSLQQSE"
     gene            <120970..>122247
                     /locus_tag="CYME_CMM057C"
                     /db_xref="GeneID:16995060"
     mRNA            <120970..>122247
                     /locus_tag="CYME_CMM057C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536922.1"
                     /db_xref="GeneID:16995060"
     CDS             120970..122247
                     /locus_tag="CYME_CMM057C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536979.1"
                     /db_xref="GeneID:16995060"
                     /translation="MGSGEGTTGRANVIYNFAIGSNVNTERLRTRARWLGDQAEIKFL
                     SAEPAVLRGYRIVFNTPGFPPAEAAFCSVRACECGGGRRCPSEVHGVLYAFDRASYEL
                     LWVTEGGLGGREYGSSYVERRVHVETYRRPGVLHEAIIFETRPSRTVETWYRRWLRRD
                     VYRRRWLASEFRCIATSAMGALEQELAAQRVANAADQVASTSWLPKNGSAALPLWYTQ
                     HAHVLEVTQALPQDHSDRIALELERVLIRPSMRYLGLIRDGALQSGLDADYRRLLETY
                     MVHWRVSCPCAARPQPLQGWLTVSVNMSTPGFFRWLWWAHLTGRKRVLRFLYQLWNRW
                     FLRVLSFFAMERELHAMRLAQRTHACIGKPQVLLHWVAVYFCSVIILIWTLPIALAGL
                     LYGRGNFFHVRASTPALVPGNAAPAARSANVHA"
     gene            complement(<125813..>128170)
                     /locus_tag="CYME_CMM058C"
                     /db_xref="GeneID:16995063"
     mRNA            complement(<125813..>128170)
                     /locus_tag="CYME_CMM058C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536923.1"
                     /db_xref="GeneID:16995063"
     CDS             complement(125813..128170)
                     /locus_tag="CYME_CMM058C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536980.1"
                     /db_xref="GeneID:16995063"
                     /translation="MLGDSRRPVLLTPGFWWIATALLSTYAVVDAHLGHLTSVFERVA
                     VAVPLGWAVSSWLAYLFASLRYQTLDVRSVRAAWLVQAAIGLFHVWLVQRRRKAGHEP
                     AGTMRDSPARSAKVAPHGPGMGFTALTALIVWPMVSSRFLRNEPDGSVSSGGATWADL
                     PFHMNIAASFLYGTNREFDYRRTEAAFYAGSRLVYPLLPDFHAACLLVSGMSWRMSFL
                     LPALFLAVSASALLYAVNWRLTGSRAAAVLSVLLVMCAGGTGSFEHWIERGWSHATCV
                     AWDVDPVQADREGGRQEILWFAYFGHVFLPQRPATYAIPLILIVILLLVLAMTEGVPL
                     QQSAIVLRLAAFVAGILPLFQAHAFVGAVILCSVLFIMDFDRWYTHMDLLWRGWLTAA
                     FIGLALSAPQLPVYIGRVASSREQRGFLRFSWTAMSSFNSGFWRTWFRALTLHVPVYT
                     LVFGIVSVVLLAQALADLERLFGVRGYFPIVERIQNRVVHLLWGLAPAFSGPSHYWRL
                     KFFPAFAAVFVFCNLFLIPPWVKDNVKLVYIWLFQAAGVVGYLLVRLWRRGGPLGKLL
                     TPLILFFMIFSGLLGIRREWGGVTAELFTPAHQEVGEWIKANTHLRSVFLTNEGHSSP
                     ACALAGRTLYSGHLGWVWSHGLRDCYEREQFQDELLRGEGRNGTELLNQLRYLRVSHI
                     LLEPEISDPEFEGAFEESDVWLGYENQGWRLYFIKDVVLDDRPIESISREQLYFSTGV
                     SLVALWMAVMCMWYFPCVFASQEIAEDGNDVVPRGPVADRHTKTL"
     misc_feature    128443..129176
                     /note="possible transcribed region"
     gene            complement(<129218..>130246)
                     /locus_tag="CYME_CMM060C"
                     /db_xref="GeneID:16995070"
     mRNA            complement(<129218..>130246)
                     /locus_tag="CYME_CMM060C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536924.1"
                     /db_xref="GeneID:16995070"
     CDS             complement(129218..130246)
                     /locus_tag="CYME_CMM060C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536981.1"
                     /db_xref="GeneID:16995070"
                     /translation="MAETTGILRPRRSAANAAEGVTSDVASVSTGAGLAPGEVRRGPR
                     VSPSLLVFRFAIVCALFYVAYRITVTPFSSNNVRVTCTSDQELYRVRKHALSEDRFAA
                     VRECLNEEGSFSAILRRDHLTRIAHDSTKSDEDVLDFAAALLLPGVPSRVDPDASKRV
                     ARCVRCALDAFNLLDTRASMRLAAANMFRVRHLHAVNDSATRAGSFVLNAIDEASVGS
                     HNSRAASDQLVYVSHETSLLLLNLPVKHANATPPSVNESSRGCLLLLRGLRSDGGSPA
                     SPPNTSLEPVQLSLEENMIVSWRGDTWYQMMNVSERASWISLEQYIIDPKELARFHSL
                     SHVYVETS"
     gene            <130721..>131710
                     /locus_tag="CYME_CMM061C"
                     /db_xref="GeneID:16995071"
     mRNA            <130721..>131710
                     /locus_tag="CYME_CMM061C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536925.1"
                     /db_xref="GeneID:16995071"
     CDS             130721..131710
                     /locus_tag="CYME_CMM061C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536982.1"
                     /db_xref="GeneID:16995071"
                     /translation="MANINGNAGLAWRGTDKGPAERSALNVGASTGLPAWLLLPEHVW
                     FRIFWWASAEGNDLAWLSQTAALVCTQWNYLVRKVVYPRLVRLNLTSIEHQWKRCRLR
                     LRASEENAEVIQETDKHIAGFLERLFRDCSCARCLVATDCYRLVRDSVVQHIHVYPPR
                     LVELHFSNCALLSDVGVGFMLQRIAAHQAGEQTWIHTLTFFAEKLTSRAAAEIARRCP
                     FLQHLELQYARLDDESLRELGKLRFLRQLKVRGSEAVTDAGITYLAHLEFLDIALCPQ
                     ITDRALFTLAHSVHLRRLLLAHQRYNVWCTGKWTESGLSALREAGVDLHFIDV"
     gene            complement(<132502..>133683)
                     /locus_tag="CYME_CMM062C"
                     /db_xref="GeneID:16995072"
     mRNA            complement(<132502..>133683)
                     /locus_tag="CYME_CMM062C"
                     /product="probable aminobutyraldehyde dehydrogenase"
                     /transcript_id="XM_005536926.1"
                     /db_xref="GeneID:16995072"
     CDS             complement(132502..133683)
                     /locus_tag="CYME_CMM062C"
                     /codon_start=1
                     /product="probable aminobutyraldehyde dehydrogenase"
                     /protein_id="XP_005536983.1"
                     /db_xref="GeneID:16995072"
                     /translation="MRVAVVGAGLVGVATAHYFATRYTGLVTRLEVFEKSQHIAGEQS
                     GHNSGVIHAGIGYAPGSFKGRLCVLGARHIYEFCESPAGQRVPVRRAGKYIVARNEAE
                     AGRLAEIFTNAVANGVQGLELLDGVPLPSVRAVRSLYSPNTGVIDYPALARALVADAA
                     ERLGDRFTLRLGTEVPLRALEPDAETHPRWAVDARAWYQHWDWVFVCVGGSTLPTTQL
                     RILPVKGQYFELRPDAIQRLGLSRCNIYPVPDKRYPFAGVHFTPSVDGRRVWVGPTAT
                     LAGWPPIQYPGFWRLVQQHWRFGLSQWWQENAPLALWRALRGMVPDLGPHDLERSFYG
                     VRAQALTRDGTLLNDFHFERHRNVVHVRNAPSPAATSSMAIAEYLVEGALQGSMSETA
                     S"
     gene            complement(133783..133870)
                     /locus_tag="CYME_CMM063R"
                     /db_xref="GeneID:16995073"
     tRNA            complement(133783..133870)
                     /locus_tag="CYME_CMM063R"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:16995073"
     misc_feature    complement(134220..135622)
                     /note="possible transcribed region"
     gene            <135799..>136311
                     /locus_tag="CYME_CMM065C"
                     /db_xref="GeneID:16995080"
     mRNA            <135799..>136311
                     /locus_tag="CYME_CMM065C"
                     /product="Sm protein D3"
                     /transcript_id="XM_005536927.1"
                     /db_xref="GeneID:16995080"
     CDS             135799..136311
                     /locus_tag="CYME_CMM065C"
                     /codon_start=1
                     /product="Sm protein D3"
                     /protein_id="XP_005536984.1"
                     /db_xref="GeneID:16995080"
                     /translation="MSGYRPAAFDLPRALLREAKNQIVSVETKNGMEYRGRLDNVSSR
                     MNLVLSAVTVLNATGERTQKNRVLVRGDSIVLVVLPEALEDAPQLDVLLQVKQARKAA
                     MHVNNTDRKSRGARRSEADVHERSGASTLPLPQSESQPQLKRTRVFLSGNAETVQRTK
                     EGGDSNRRNV"
     gene            complement(<137394..>139118)
                     /locus_tag="CYME_CMM066C"
                     /db_xref="GeneID:16995081"
     mRNA            complement(<137394..>139118)
                     /locus_tag="CYME_CMM066C"
                     /product="alanine aminotransferase"
                     /transcript_id="XM_005536928.1"
                     /db_xref="GeneID:16995081"
     CDS             complement(137394..139118)
                     /locus_tag="CYME_CMM066C"
                     /codon_start=1
                     /product="alanine aminotransferase"
                     /protein_id="XP_005536985.1"
                     /db_xref="GeneID:16995081"
                     /translation="MQHVLAGRVGRRTFGLLNFSYLRIGRRNRSHGVSAGMPHEADGT
                     RRRKALDLRTINQRVVAAQYAVRGELPTRAARLQQTLEKGGPEAAALPFKEIIYCNIG
                     NPQALGNPPFTYHRRVMALCDCPDLAAALPEKEREKLFPADVREATERILRSAGLGGT
                     GAYSDSQGVPIIRQDVAEFMNKRDGIHEDSEFAARVKDVFLTNGSSSAILMLMALLSG
                     SDAALSADGTNGVSHGRETRSMRPGVLIPVPQYPIYSALCTVLGIEALHYHLVQEQNW
                     SIQVTELTEQVRQARSRGIEARALVVISPGNPTGQLLHPANMRELMDFAYREGLLLLA
                     DEVYADNVYLDGRKFESFRRVLHSSMPEEVQESLELVSLYSASKGLVGECGRRGGYML
                     LSPGVTNEAREQLLKLASIMLCPNLGGQVMIDCVVRPPEPGQPSYELYQKEKLERYES
                     LRRRAHRVVEAFKSMRGVQCNPSEGAMYAFPSITVGTKALQAAQKSNMPLDTFYCVSL
                     LERTGICVVPGAGFGMHSNEPTSSVPNGSCRFYLRTTILPPEEKLEPVIALLRAHHEE
                     FLQKYPPD"
     gene            <140332..>142143
                     /locus_tag="CYME_CMM067C"
                     /db_xref="GeneID:16995082"
     mRNA            <140332..>142143
                     /locus_tag="CYME_CMM067C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536929.1"
                     /db_xref="GeneID:16995082"
     CDS             140332..142143
                     /locus_tag="CYME_CMM067C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536986.1"
                     /db_xref="GeneID:16995082"
                     /translation="MTLGTGFVCPSVHGAERVSVQYGRGLLVGTTCRLWQGHWRGIGQ
                     RARFNSNKLSDLRDLGRFRRRFFDEFGTPQRRTLVASATDKSPVVRVGWVYSRGGQTP
                     RAWLGVLALFLGDRGFRWLFSVLRIRFPSSLAGMLFLFLLLLLTENRAWPTGLPPSPN
                     QVAAASVEPERLSIADNIVLLVSPGLGLVTRWLAIFFVPNLIMLPHADAPHGSALLRL
                     VLALCVGLIFSLVSSLIFVSILAWVSDQRRGATKNRRPTHDQPLVEKVQDGNTRPERS
                     SKLSRPESPGLRTGNPASSGPRFALIGLWGLVWIVSAVCWITGAGASADFRALALWLH
                     QLSSTVVGFSLGQRLPSRFQKVLHPLVSCVVFTYFSLWMLACGTGSAWSELLLLYMRR
                     PGKKWPPAVTGNLSAIARSTVFALGGPGNLLLSFLGPAVLSFAFQMYQRRTIIRANGI
                     QVIGGCLMAAFFGMLGSAALARLFCLPASLRLVFAPRSITAPLAIGIADILETDATLT
                     ATVVVITGLLGANFGRLCLDILRPVLPSASSPVARGLAMGASAHGLGTAAISEEPDAF
                     PFSAIAMALVGTLSALMVTLPPFRALLSMVAGTTLGR"
     gene            <144658..>146655
                     /locus_tag="CYME_CMM068C"
                     /db_xref="GeneID:16995078"
     mRNA            <144658..>146655
                     /locus_tag="CYME_CMM068C"
                     /product="citrate synthase"
                     /transcript_id="XM_005536930.1"
                     /db_xref="GeneID:16995078"
     CDS             144658..146655
                     /locus_tag="CYME_CMM068C"
                     /codon_start=1
                     /product="citrate synthase"
                     /protein_id="XP_005536987.1"
                     /db_xref="GeneID:16995078"
                     /translation="MPLTKRSARKWNYGHVSVAKEQSLTLNKPGSIRHRTFDKLSEFH
                     LGWLSRSSRQTKQNAARHQPDAAAKRDRACAAADVVASPKHIARLWLVACRALVPGEA
                     GSHPMEEYRLPDVSLVVESIHSNEKKTHEVELYANWKASTEPPNVGRVLVVPSARCPY
                     RLFDPNMYHTAVCATRITFADGVNGKLYYRGYDVEDLVRRTADPRKPTATFEEVAFLL
                     INGELPDRDALSTWKELLLSHTFLHEDILAQLRTLRHDAPPMGCLIAAVSALSTFHPE
                     ANPALRGSQLYRNDEKARNKQVYRLLGKVATIAACVWRVRIGRQFIPPLSGEQVRPRE
                     RTAARAPTDRQQEQEPGDAPIGYVSNFLTMLDGCQPNPVLVNIVERAWIVLADDGLNC
                     AAGVLRHVASSGADPYVCVATAMAAIYGQRISGVGMAVMRMLTDMHAYLRSTGMLDET
                     HEKQLSCLNSYLQERYILTKRRLQGFGHVNYKKYDPRARVLRELCLEAEAAVQEPEPL
                     LQTALLLEEVVTNNIWFTSRGVWPNVDLYLPLLLRILGLPLEFYAVFVAVPRTAGWIA
                     HWLEQLDDADVRIYRPRQLYSGPPLRPYVPMEDRVEDVLSSFAEDGQDAGSDQDDTAH
                     VLRDGNARRYGANRQCMLRGQNVLNRMVRSVSIYRRRSYIE"
     gene            <150144..>152396
                     /locus_tag="CYME_CMM069C"
                     /db_xref="GeneID:16995079"
     mRNA            <150144..>152396
                     /locus_tag="CYME_CMM069C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536931.1"
                     /db_xref="GeneID:16995079"
     CDS             150144..152396
                     /locus_tag="CYME_CMM069C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536988.1"
                     /db_xref="GeneID:16995079"
                     /translation="MMMIAKRYTASVSPRRNIRPTRTAHSAHRTAKFAAPSQTFGTRA
                     EPRTAGDLATSKPVGHVSSTVAPAMRSAHACLVWQVPPRCTPNGSHDARARASMLHER
                     RNACVRACMHFHTLEISAMRYVDCSSTAASDCSSGFRTFLLSVLPDYLSHRAMTSWLS
                     LGRWRASTVSFVSSESPPKSLSSHCQDVTRYADAELVVHQRVADSPAVVCAPDGKTDG
                     ADRDLLTSTKTQRALSRTKLKRGWGKLASEQGDARSPDSCFRDVARTPDLRCTDESIT
                     SLLTPSLCTSEADTSVAGGHDSSPTDRTEQTEDIRGLLERYLQAEERYGYTWTLPTNE
                     CFRWWSAARCNGRLANAEVDSGERRAAFTRIAWQLRLRQVEAIYRLAPCMDTALAAVM
                     FFDRGMVRFVQIYTDAELYGDNDAPGMRLLRVGMPLVALTSLWIATKIHEREAGNVQA
                     WLREWPVDEHMGSPGVLGADAEASISMPLIKAVELVLLEALGWDLVPVSPLHFAMTFA
                     VLGSQRCTGVWALTSKLCSLSMLEQSIAGRYPPSAIGLSCLLSALRLRRHPMAVQRND
                     ARYPSGNLVAEWARGVLEFTTPNVDLFSSMVQELEAMLHEVVYPIPSAGFSRSLSPCS
                     LENGKRDLRRRKRRAGQDLERKCRRLAKDQSSPLTSFHAQDTCLFQPHGAEQESPELY
                     SSSMETVSEAASPRNVTRMSPDAGRPCAPRGHASAYQVAMQRAILAESGCCLETCTQQ
                     APSSRRLRLH"
     gene            complement(<152755..>154044)
                     /locus_tag="CYME_CMM070C"
                     /db_xref="GeneID:16995100"
     mRNA            complement(<152755..>154044)
                     /locus_tag="CYME_CMM070C"
                     /product="probable mRNA-decapping enzyme complex component
                     DCP1"
                     /transcript_id="XM_005536932.1"
                     /db_xref="GeneID:16995100"
     CDS             complement(152755..154044)
                     /locus_tag="CYME_CMM070C"
                     /codon_start=1
                     /product="probable mRNA-decapping enzyme complex component
                     DCP1"
                     /protein_id="XP_005536989.1"
                     /db_xref="GeneID:16995100"
                     /translation="MVKHRKKPSARERSGAHGLAGVTGAAVTAPPRPPLPSPSTLPSL
                     TSVAEQAITTEASLVALRQSVDPNIESILFSARHVVEFDLDVQLSRWQRVNREGALFL
                     VRYREPRYALVIHNRKNPEDLVEPVVAGMDIEVQDEFLMYRTTDGSAAASDAFARALW
                     FHGGVAEVQACANLLQDIVWMHQQQQQQQQQQHAMISAGRQGSTPAQPGFGPLPHPQL
                     GMSAFPSALNAAAPLPPVPSSAMTTARNPEIGWNSGWTSPITAWSPSEARLSGAPQAG
                     HAVSTGDLRSELGAPSRNDGTEPSQALHAAYELSKGGVSEAQHRWPEHWNPGAFPVAP
                     TLGASQQPVTSGGKRTNAGVFSPGHGCMPSSAGAPVPLVADAQSENHQTYVNTIFAAA
                     GGRPGAHREFVLAVLQTLANDSMVFEQAYRSYRMQWG"
     gene            <158170..>161538
                     /locus_tag="CYME_CMM071C"
                     /db_xref="GeneID:16995101"
     mRNA            <158170..>161538
                     /locus_tag="CYME_CMM071C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536933.1"
                     /db_xref="GeneID:16995101"
     CDS             158170..161538
                     /locus_tag="CYME_CMM071C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005536990.1"
                     /db_xref="GeneID:16995101"
                     /translation="MGYRGCTSEKKCPEKKKKTWNGAISPKIHRNLKRLDNSFANCLA
                     PSPRHTQKHTHTHTHTQTHTLGGFGSVEAPNVPSWMTTMENGTASATDLRSVVEQAAR
                     EDAPVTTVVVALETLAYWCHGRGKPLQSRVVDAADRELFLTSGALTELLELVLSRCPL
                     AAFGTRERAALSVASMFRFGPAGQVVLAVDRALRRVQRLASDPVVREQRAKWIAFELF
                     EKHFVRVPGCLLGALAGVRYRATEPRCLTVDREADPDTVLRSLLAMPDIVTNVLQCAL
                     PETCTLHPQRYPHCLAWTVTEWLLTLCSSQYASMGVEKQQLIWLTNEALASNVVAEVS
                     GSLSALDLHEDDTTYGSAVMLSMPSPQDAYAFGSSALETLMDMAGRLGRHLCRRRCIT
                     AWCQVAIRALIALERQLSASQADYWKRCCMESFTALPDRYIAPLMEQFAILGCKGPDQ
                     HQVAAIAYLEYLCRTRDTAVAFVSKTLPSSMPKATSMLSPLAAPGDQRILLFLLRSCR
                     DVVETSHWRTALTLALKRWMQTARTAALWAEDLHITRMLLFLAQASCSGDPEHSCSRT
                     ESCESYGVDWFVLLGEGVKEHLAGALPETHFHGMIVGETVSRIWDPPGKSMQFDIAAY
                     EAWKASDPELLQPWIEATKEPLLAQHQQHQHPVDGGVATGTPPSEGTSLCAPSTHAVA
                     TVGVRSPAVADENDNDDLKPYPMPADELAIDPHSEPREDGTGSCAQETLGLPQTFETL
                     YRALAAEVRHEPFGAEAALRGPSSTTPQDSTPTSTSIPTQRVLCQLEQLIERDVAGLE
                     YWAMPMLQLLHRLGTGSSSTSIARDCAALCRTIAVHAFSSIAVPVAKLVFSQNMTLTE
                     RSEWLEILANSVETLLNTQYTARKPTQRGAAEATSPTPEGHQDHQICSRVRRVSVRSL
                     HQTKARQSESFAMSQRAVFTAAAGACDASGQTSLHTQPALHFHAMVQAFFELLAGADT
                     EEPWLDLWRRDQMLLAQLVQTCALVLHCAQGPGSLCIGAVTRLASMGQALAQLAYTAR
                     TCSDAAVHRACVLAFNAVYEILLRIREAYGIQSFRQLEHWWRSNQSSSNVSLEHIAQL
                     LERWSSDAQDSATRELAQALLPCFHDDGRAQRIA"
     gene            complement(<162781..>164556)
                     /locus_tag="CYME_CMM072C"
                     /db_xref="GeneID:16995098"
     mRNA            complement(<162781..>164556)
                     /locus_tag="CYME_CMM072C"
                     /product="sigma subunit for chloroplast RNA polymerase"
                     /transcript_id="XM_005536934.1"
                     /db_xref="GeneID:16995098"
     CDS             complement(162781..164556)
                     /locus_tag="CYME_CMM072C"
                     /codon_start=1
                     /product="sigma subunit for chloroplast RNA polymerase"
                     /protein_id="XP_005536991.1"
                     /db_xref="GeneID:16995098"
                     /translation="MIQRSGSGRTSMRVGFTVALFTGRTRSWFRRRGIQPSQLVDLSV
                     QRRVPAVRSIALDGIPTSKPRMQSPSEAERPSARTEGPSGRRSKRARAPRSRSKSEKD
                     SSASKSVKTYAEPDQPRKRSLEQASAEASLPARKETEDNSAKKGGRKPRKEKLEALTE
                     LAKERLREEQRKRLEVQQMEREQRERAAAAQREGQSDDVLRERGRSSKYDGPVETDDD
                     NDEDDDDEAMQLGERSLTLDAMAEPSLATDDSVNTSSSSSSSAGERQNRDSLFDYLDE
                     IRRYQLIEHEEEVALAREVQHLNRIEEKRQDLEKMLHRPPTSQEWARALNMKSAAELQ
                     EALARGHQARNRLVTSNLRLVNAIVNRFSRRAEAIGVTMSDLMQEGSIGLIRAAERFD
                     GSRGYRFSTFASWWIRASIFRTLDEASRIIRLPSRVTDAYQRLRKLRRLLTAELGREP
                     TEDELAERAGMAPDKVRFVFEQVNRQVLSFDRGMDTTEDPDPDSGSFLESIADPRDEE
                     DLVDSFMKDAVLRLLRSVLNDREVFVLRLRFGLDDDEPKTLQQVAAILNVSKERVRQI
                     SFAALAKLRKSQSAERLRNEFAEYF"
     gene            164828..166859
                     /locus_tag="CYME_CMM073T"
                     /db_xref="GeneID:16995099"
     misc_RNA        164828..166859
                     /locus_tag="CYME_CMM073T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461436.1"
                     /db_xref="GeneID:16995099"
     gene            <167447..>168991
                     /locus_tag="CYME_CMM074C"
                     /db_xref="GeneID:16995096"
     mRNA            <167447..>168991
                     /locus_tag="CYME_CMM074C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536935.1"
                     /db_xref="GeneID:16995096"
     CDS             167447..168991
                     /locus_tag="CYME_CMM074C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536992.1"
                     /db_xref="GeneID:16995096"
                     /translation="MDATAHIGSAFDLRGNIGEESPLSVENEAPPNAFQGTRGSDTEN
                     DSRLSLGALSSYAPLLVEVACQLSKLRDRLNDLEHQSRKSSCVQDQLGALANQVAVLE
                     ERLRQHVLAREHWCAAESVPERKSLLESEDASDAVDKLAEEFRDQFLDIRAFELRLTQ
                     AVNARFLELYRWTESQLTRLEERLASIDVDGSLKREMATHAEQIGQKLEHLESGMRSC
                     ISREEWSRERDALEKHLRHDLGECANRNASSKPSAPTEQGTTSTSVALDAMRSVMHLQ
                     STVEGNARAVEDALTAVRTSCQALNQRLQRIEHQLTTDEFVGGAGMRQVAPPPDWNQI
                     QQTVRKLESQLQKLSSRLPDPEEIHTAVTQTKELTGRNDQLERRVERLHVQMESERNQ
                     RSELEHKVTRLEDFTSTLQSLPAELTSLTKSMTQGDEVLQEWVRGQLQRLDARLHEHE
                     SSLHELRAETAHLYEQYAEVAALILLMTPADNRATVERRIRQLLPGLGALKLPASRAG
                     TSEDTR"
     gene            complement(<169671..>173348)
                     /locus_tag="CYME_CMM076C"
                     /db_xref="GeneID:16995097"
     mRNA            complement(<169671..>173348)
                     /locus_tag="CYME_CMM076C"
                     /product="probable cryptochrome"
                     /transcript_id="XM_005536936.1"
                     /db_xref="GeneID:16995097"
     CDS             complement(169671..173348)
                     /locus_tag="CYME_CMM076C"
                     /codon_start=1
                     /product="probable cryptochrome"
                     /protein_id="XP_005536993.1"
                     /db_xref="GeneID:16995097"
                     /translation="MSSSRRPSVVWYRGHDLRVEDMPALLAAVQRGGPVVPVFIWAPE
                     EDGMWCLGRPARWWLSRSIVALDRRLRELGCETGLILRRAKSESGGGGGVETTLLEVV
                     KRCGAEAVYWNRVYDPVVLRRDEEVRRRWSKHHRLAVESFKAELLVEPWEVCATESRP
                     ASFGDRPLDTFHEFMSAWMAMPPPPEPLPAPKRIEPLIASQSGDQGPLFAVPESTMQP
                     SDVLQSPGGEDTDTEMGIWWNQIHNLGSLEEYWRPGVDCVAERLQDFLTSVFPTYGDA
                     RRRQRLRNGTSRLSPYLRFGELSPRRLYHAVRASVLQSEPSDAIIRAARTLLRNLCLR
                     EYAYHMLFYRPSILDRPLVPEFDHFPCTKEDVGRLLEVWLSGRTGYPLVDAAMRELHH
                     TGWLHSNLRFLVASFFTKYLLLPWQIGARCLFKLFIDGDLASNAICWQWVTGCNYDVF
                     PLNCLVNPVVMGMRVDPEGEYVRTWCPELQQIPSSYIHAVWKCPPTILHQARVELGVT
                     YPRPVVENRVARRRARDALRYLRQVVLNKRGYGVRVPNTLSLKGTQELMSDWPIDEVY
                     NVLDSKQEDLFGLSDLGHELPSGRQPERPMRDSDASIDDQEIAGDSIGGDHVGLLPRV
                     WSMSQDDPLHNVFDLGGSASGANGAQLAGPSPGLGGSNGYAQGPGGGNGGSSLMYGVS
                     AGTFGNQQMALVSSGMGMGSSGVGGGGGGGGGGSDRSIPEVVVGAPSSVDEDSYTEKL
                     HRVDSFHALLSAGATTPLARGSIMEPTGRVPGTNPDFMRAPPTEHLSSLSGIVAPNAS
                     HPSSAVHVSTSGSRSLVTAGGAAAALSPGQMMRTPNAAVDPGTTSASPLLLHHTGGAG
                     HGRGSSRGTATLPGSQSQPMGTRSMLNANLPGSVFAFESGEPGAMPRPAPGHSLGPET
                     SVSAPASWALINERPSLSAAEDASVHRRPGAMPASTSTRYDNGEAARYLEDRAGRKRA
                     LADEGVCTNPDLTMPERFPAVAAARVTQRLEHDTAGSVSSAAKTKRRASGAAAAPQAP
                     AQQRTRDGSAPNEAPAPGSSALHHDATRAPAGSRWLEQGASGESLDVRSSSASSDRTA
                     PITLEGLGDVEPPQTRSERLELLERIHRSDNAYARFAGFLLQHYDITENVRRNPKSTD
                     FVRLRNLKDHFNRYSAPPRAGQGAAHREPLRIYRIKQFFSKILNLEVTGEWDRHAHGG
                     VRGPYVYGLVLRADALQRAAP"
     gene            169794..172136
                     /locus_tag="CYME_CMM075T"
                     /db_xref="GeneID:16995090"
     misc_RNA        169794..172136
                     /locus_tag="CYME_CMM075T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461437.1"
                     /db_xref="GeneID:16995090"
     gene            complement(174463..175640)
                     /locus_tag="CYME_CMM077T"
                     /db_xref="GeneID:16995089"
     misc_RNA        complement(174463..175640)
                     /locus_tag="CYME_CMM077T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461438.1"
                     /db_xref="GeneID:16995089"
     gene            <176078..>176959
                     /locus_tag="CYME_CMM078C"
                     /db_xref="GeneID:16995091"
     mRNA            <176078..>176959
                     /locus_tag="CYME_CMM078C"
                     /product="similar to Gbp1p protein"
                     /transcript_id="XM_005536937.1"
                     /db_xref="GeneID:16995091"
     CDS             176078..176959
                     /locus_tag="CYME_CMM078C"
                     /codon_start=1
                     /product="similar to Gbp1p protein"
                     /protein_id="XP_005536994.1"
                     /db_xref="GeneID:16995091"
                     /translation="MTSNASVTGPHPENGTVQPGAVPVQDAMLTVTNEHEFADSSGNV
                     AVGEQAASLMSGQVSDTAPASPRRPVRTSKLDPNAPPAGPGSEGGALPSRRVYVGNLA
                     WSVSWQALKDHMRKAGEVVFAEVFTERDGRSRGCGVVEYATEADSANAIATLNDTELQ
                     GRLIFVREDREPNQPLRRNKTSASGFHGANATTGNRHHEARGRNQPPSFPSDKGRKII
                     VWNLPYSYTWQDLKDEFRACGNIIRADILIDQEGRSRGAGTIVFESEEDAQRAIQMMD
                     RAELAGRIVDVRLDKYA"
     gene            complement(<178947..>179855)
                     /locus_tag="CYME_CMM079C"
                     /db_xref="GeneID:16995092"
     mRNA            complement(<178947..>179855)
                     /locus_tag="CYME_CMM079C"
                     /product="unknown transcriptional regulator"
                     /transcript_id="XM_005536938.1"
                     /db_xref="GeneID:16995092"
     CDS             complement(178947..179855)
                     /locus_tag="CYME_CMM079C"
                     /codon_start=1
                     /product="unknown transcriptional regulator"
                     /protein_id="XP_005536995.1"
                     /db_xref="GeneID:16995092"
                     /translation="MTDADLGNLSLLERISLLEERVTALQQKVAAGAAAAAREFEACA
                     AHKCLAARFDSQNDRNMSLSLEEQIHHRDSMQILDALQQQSQVISLASMVANPTPLGL
                     FAFGVTTLLAGADLYGATAKNTFSVALIIGGLAQILAGMWCFRRNNTFGATAFSLFGS
                     YWGARGVQLLVELLHPGLFPSADRAGTCIFYVIFCILTLILLVQALRMNYALSATVFF
                     VALVYIFLAITAYVEGVKYVAATCAIIAGSLAFYVGLADFTNEIYEKPLIPLFPHPRH
                     ARDYEEGKRYVPRPHAHKSAVDIPPV"
     gene            <180994..>181662
                     /locus_tag="CYME_CMM080C"
                     /db_xref="GeneID:16995093"
     mRNA            <180994..>181662
                     /locus_tag="CYME_CMM080C"
                     /product="similar to trefoil factor"
                     /transcript_id="XM_005536939.1"
                     /db_xref="GeneID:16995093"
     CDS             180994..181662
                     /locus_tag="CYME_CMM080C"
                     /codon_start=1
                     /product="similar to trefoil factor"
                     /protein_id="XP_005536996.1"
                     /db_xref="GeneID:16995093"
                     /translation="MQKSSFIWALIFGVFALWLQVPSVQAWSYTMTPLYEFTPTCTPT
                     PMCTPTPTCTPTPTCTPVFEPKHYHEYVLCGDYTQTGDIEKCEKYGCRWIPTNYCGLE
                     NEWAQYKGVCVVIPNKAPECQNIPYFKRINCGYDGITPHECAERGCCWEGGPNRYNWC
                     YYPRKCRDVCVEEVTAEGEVCVEWTKPKGYGKQEEKPVCIKWKPKTKCLKYVKECSDE
                     CYKP"
     gene            <182123..>183634
                     /locus_tag="CYME_CMM081C"
                     /db_xref="GeneID:16995094"
     mRNA            <182123..>183634
                     /locus_tag="CYME_CMM081C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536940.1"
                     /db_xref="GeneID:16995094"
     CDS             182123..183634
                     /locus_tag="CYME_CMM081C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536997.1"
                     /db_xref="GeneID:16995094"
                     /translation="MSERPRVLVIGAGAAGCAAAWSLARSGDAVAVEVWEKAAVAGGV
                     ASTQRWKGYWFNDGVQGGAPCYANTFRLHAAAGFEPRPVHMTINFGKGPTWWNNYGEK
                     LETDLVRQLRPEIRRFGQLLERVNRLPWLYIWVPIARLLRWHGFSKSFINLMVLPLTA
                     LFFGTGNQTPKVSAVIVARVFLDPHMRLFAYDPDRLLSTQPLMFAFDALESIYTAMLK
                     HPGIERVCYEREACRLEALPDGVWVTDHNQRRERFSQVILATDAQTALKLLGSGATFM
                     ERNVLGRVRYFHDVTVTHTDEAYMDRYYQMDPDRRTDMYFVRTDPVDPSCIDMSFLLS
                     AYQEQLRDAHGEPLPLFQTIFLNKEERHRWTMDEIRRDQIVLVRWWKQMSHEWRHFVQ
                     VVPFVRFIQGGRHGNLWYAGSWTLMNIHEVAICSGLAAAEACGWALSKQTGKSPIGAY
                     PFERDADASRFYTMYAKTAYGSRFRERLRNARRASAATVEPLQPSAPGTPMES"
     gene            complement(<184962..>187874)
                     /locus_tag="CYME_CMM082C"
                     /db_xref="GeneID:16995095"
     mRNA            complement(<184962..>187874)
                     /locus_tag="CYME_CMM082C"
                     /product="alpha glucosidase 2, alpha neutral subunit"
                     /transcript_id="XM_005536941.1"
                     /db_xref="GeneID:16995095"
     CDS             complement(184962..187874)
                     /locus_tag="CYME_CMM082C"
                     /codon_start=1
                     /product="alpha glucosidase 2, alpha neutral subunit"
                     /protein_id="XP_005536998.1"
                     /db_xref="GeneID:16995095"
                     /translation="MQRARFRAGSQYPLWSTVGFIFVLCFLIWELAGVQAAERGKYAR
                     CSTQSFCAYHRQRREQQTSQQELAANATAPGTRCRLREPEPFRLQKTSSSVLIFELLQ
                     REANDSGTLSQLQLEVGAVTHSIFSIRVREPPPSDTIQLGLLRRRKQHASVSKYERYS
                     PVEDVMMYREPWLQLERLAASTATSCPYVSSAAWLSSDTETVIVTASTSHASTEPVYN
                     VLRVQHEPCRIALFNNVADWCALLQNSTATTTRPSLVWNAAELLAWIPLDANTTAAGS
                     VAADVAFPRAIGLYGLPEHALDLRLPTTCTREPLRLYNLDVFEYELNSELGLYGSIPF
                     ILALNGSAHTVGALWMPASETYVDLCPLLDQERGTAMPHAHFISERGIPEMFVFAGPS
                     PVEVSQQLALLTGHAPLPPVFALGYHQSRWNYRDEADALHVDGQFDANDIPYDVLWLD
                     IEHTDNKKYFTWDGAKFPDPARLQQTLFEKAKRKLVTIVDPHIKAEPNYSLHERALKE
                     DWYVRSGDGVSIYEGWCWPGKSHYPDFMDPRVQTGWSSCFVPSFYHGMTEHLHIWVDM
                     NEPSVFNGPEGTFPKNVRHRLGALEHSDIHNIYGHMVHRATFEGLYRGRQGNLRPFVL
                     SRSFFTGSQRFGAVWTGDNAAQWSHLAASVPMLLSISVAGIAFVGADVGGFFGNPQAD
                     LLTRWYQAAAYQPFFRGHAHLDTKRREPWLFGEPYTSLIREAIQERYALLPYWYVLFA
                     AERTLPVIRPLFYVFPDESSLAGVQSSWLLGDALLVAPVLEAAPSTHRITLPGPASLC
                     WYPVLPRTRRLFSGEHLVHRGQDTLVYPKPALSSMYVFQRGGSIIPRWERQRRSSSLM
                     LGDPLTLHVALDAGFQARGMLYLDDGLSYGYQRGDYCFWRIAAMGQRLANGSTSLQLR
                     LTLQALDALPPPSNLSRCAHVPLERFVFYLHAGERVVVRKPTLSVSGDVTTWQGVC"
     misc_feature    complement(188682..190310)
                     /note="possible transcribed region"
     gene            189267..191217
                     /locus_tag="CYME_CMM084T"
                     /db_xref="GeneID:16995087"
     misc_RNA        189267..191217
                     /locus_tag="CYME_CMM084T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461439.1"
                     /db_xref="GeneID:16995087"
     gene            192029..194002
                     /locus_tag="CYME_CMM085T"
                     /db_xref="GeneID:16995088"
     misc_RNA        192029..194002
                     /locus_tag="CYME_CMM085T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461440.1"
                     /db_xref="GeneID:16995088"
     gene            complement(<192254..>196867)
                     /locus_tag="CYME_CMM086C"
                     /db_xref="GeneID:16995083"
     mRNA            complement(<192254..>196867)
                     /locus_tag="CYME_CMM086C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536942.1"
                     /db_xref="GeneID:16995083"
     CDS             complement(192254..196867)
                     /locus_tag="CYME_CMM086C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005536999.1"
                     /db_xref="GeneID:16995083"
                     /translation="MAPQQQQQQQQQQQQLGPVTALKRLNRCGLGTSTETEWILGVGV
                     GHLLELWREDPLCLLGTVACLPAGQFIHGIETSSLDPAPPAAGTAASQWLVVFGGRHL
                     CLCHWPCDDAQLPVRCITYAADAWILAVSEPQLWSAPGGVVEEPALAAEASPRSASSV
                     SRTREPAAGAGCPASVDRNATHHHRVAEKRESNDTASLRLYLALADGRVLALRATTCS
                     NDARIHHIRTCCSLERACYWSAAFSPTASLVAFGTADGSILVQALASQQNPTFLTREA
                     SFSVPVFEPKRSSLSCRRYQAHRGPIYGVVWARPFLTASNGTIRRDSIPAGSLSNGTG
                     PEALNTLWLCSCGDDRTVQCFRVQCDVATNGLSGSTTCTPVQAVDPVFIGVGECGASS
                     TPEAVQVAGLERIALLRGHQARPWAVRAYTCPASEASPPKLHLMVASVGEDDTVRLWD
                     AQRNCCLHCWRGHRQRNCWCLDLALAALSTRNAVAGPWPLLKLYSGGADGSVSIHTVP
                     WPREAALPATIVQRAAAENPACPGRGSAEANLTSTTAEASVRQQLHFWPEGLVAAPPL
                     PPLSAAARPSVREHARAMAVLANPQLLCISTSARRVLALQLEALKWTEVLHGDHSVDF
                     MPACIAAAKSRPWLFLGSSHRQSTILALCLDLDHMNASDARSGHLLQHQVCWNARPEA
                     HPVTLVELWQDRLLGAAFADGLVLVFDIASLLEQRLLPRERAPTAPHVIARVPAPRGI
                     VQQPSCIHFFANLTGAACNTPKDAALHSPAAVIALLIGHRSGHVRLHPGLSSSAEACA
                     ELGCIQLVRPHDDRVSSIAPTGVAGDGARSSKPQALASMLCLLSMDGTFTRFALEYGT
                     DASRLRLVQCSREKCPSECEQGDCLWELAECAEPGDPRVPASPRMLFASGFRGQYAGI
                     WRLDTAQPLFLVPCGGWRRPHTLYERNVPAVGRVIGFGFWKAGSVYLYERILQSPDGG
                     CCRCYWYLPQRLRLQGSGMRIQGLVVLRVSGQCALDVDARMLEPETGSRVSQHWQKRL
                     EQKEQRQQQQQQQQQPQQQREQVAGVPQHSRATREYASHAGETLMYWIATASEDTNLD
                     LYQWQVQRLSKGGLFSAASWERVASGSAVHFSGVLTLAALPWPHFEADRAALATPMDA
                     VQDAEAYLLVSGGGSDTLAIWRVSAAGLNHLARYIRSRSRAPFAASLCRPSDESLARV
                     TAVVLGAASSTDRQHGAHLDATQTTLAVAEQRTEPKLLTAWLLCGRSDGTLSLYRLQV
                     QPHVDARHPAGIRAKTERFEQRSPDRNWYTTMTLVAVRPRQAYAYPRALCSIRGTAYV
                     FAGDTGGSVALYVWPHDWHTAELRARRGTLDAGNAPLADPATFEPCWEQSAFLAAAVN
                     AVDGHWFRLQSHDWLLLVAGGDDQHFRFHLCNLANQACHWSSERIGRHSGALVGVQLR
                     RVQLVHAADELFHLYAELWTWSTDRWLRCHELRLELTAERGVISASVTTTRSLLVGVG
                     DPALLTLVPTCSALVACGCGIVTVFPEQAQGTVTAAEKHICFR"
     gene            complement(<197439..>198644)
                     /locus_tag="CYME_CMM087C"
                     /db_xref="GeneID:16995084"
     mRNA            complement(<197439..>198644)
                     /locus_tag="CYME_CMM087C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536943.1"
                     /db_xref="GeneID:16995084"
     CDS             complement(197439..198644)
                     /locus_tag="CYME_CMM087C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537000.1"
                     /db_xref="GeneID:16995084"
                     /translation="MSASPGQRHVDASPSNEAVLPVLEWMVRHADIKQASLRSILQDL
                     SFKFGGYDFSSRKNWIKEHVLRCLRERMQTASGASGEQPISGGNATAPNASVNRTADP
                     EGPPGVIESATRKRRSNKAKRSQENDDDTATYRESPLRFTGLMAPVMLAPELAAVCGG
                     QDILPRPWIAKQLHAYVREHELRDPSQGMRFRPDAALAKLFPDRDSVSFFEMNKLLEQ
                     HIRKESQCAPEEQARIQAWRQEWEAKGLTQRRKIPAKRARVRAGRQHLKEKALGASFS
                     PLSGGSQSTQDSHRSSTPSTGKRKASGLAQPLQVSEALSDICGGARILSRCEVVRLLW
                     EYIKKQQLQDPNDRKVIQCDAKLQRVFDGETRVTAFGMNRFLGKHLQPLQRNDEVGRG
                     SQSELDSES"
     gene            complement(<200201..>201211)
                     /locus_tag="CYME_CMM088C"
                     /db_xref="GeneID:16995085"
     mRNA            complement(<200201..>201211)
                     /locus_tag="CYME_CMM088C"
                     /product="probable purine phosphoribosyltransferase"
                     /transcript_id="XM_005536944.1"
                     /db_xref="GeneID:16995085"
     CDS             complement(200201..201211)
                     /locus_tag="CYME_CMM088C"
                     /codon_start=1
                     /product="probable purine phosphoribosyltransferase"
                     /protein_id="XP_005537001.1"
                     /db_xref="GeneID:16995085"
                     /translation="MCASVDCRRGTRVGNRYANVMERKVPDLQQQQQQQQQQTASDQL
                     LAVLRGKVSPAAAFASVTADCASLCWHARAAVARGKGVHGYDRRPAAGHRVRYPVPAQ
                     RCISERSFWRRSFWSDAERKVLRGVFACVRPASGPAHGDTAAGMANFRGKYTIVTWAE
                     VEELANALATRVMEKSVPTGGENLSTHPGRGRVCYDLLLGITRGGLIPCTLLAQRFEH
                     RNILTATVIFYDDSGERFYGLQEPRALMFPDMKLIEGKRVLIVDDVFDSGRTARAVRL
                     RCERARAALAHVAVLHYKPENNRFGSGEAPDFYGKEVAGSEWIVYPWELLSPQAAFKD
                     IR"
     misc_feature    202723..205303
                     /note="possible transcribed region"
     gene            complement(<202867..>205515)
                     /locus_tag="CYME_CMM090C"
                     /db_xref="GeneID:16995118"
     mRNA            complement(<202867..>205515)
                     /locus_tag="CYME_CMM090C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536945.1"
                     /db_xref="GeneID:16995118"
     CDS             complement(202867..205515)
                     /locus_tag="CYME_CMM090C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537002.1"
                     /db_xref="GeneID:16995118"
                     /translation="MFRRVSKLPSRLQKERQTFQFDVQLVGFQGSPRQRAVVLQLQRG
                     LRTATSQPFETNPAGQRVALAESLSIICSLYRDRKTGKFESKDCKLRLLTWQAPGKRQ
                     PSRGSELSSKALEKVHFDLVMFLGELGSGVQREHVFVLSNGSRIFARVCLSWMGSALP
                     SGSRDSVSSYAPSELSQWSVESTLWSDDSESSAEASTLSKEQLHAQPVQPSVVLEPTS
                     SATDGHANAGVTGTLPATEMKRRVSSSVSGPDERPSTPGKDEQVFGKKEGAISTASLV
                     GKSASSATQVLSPSTAASQEKSARYATDQDSGGHVRIEDAFAGTGTHGARPSSSRTPG
                     TTNGIAPEEERTLPTAQCAAHAAALARTLSLLTAPLASESESGYETVRVAQEIPSNSS
                     PQINGDEMDTAETVTLAWKKCASLVSALSGLSHQLSVMRAHLQPHSAASEHQHPVALA
                     EQQPPGRAVGSVRTSQPTRSDLGEGPNSQAPLARGMEPALTSVVTLRKQLKDLSDAVL
                     VRDQILQKRYSHQLRKVVIVLQRLSGTELPALYQHVEHCFDLTASQIAGLLERLRRHR
                     SMSVTRPMACVPSERDPRLENDSICSTLRQAKVELKHLRKKMHMFQGEMQQQAQEACE
                     RLQRGRVSVEGRLARVTQRQTTLARKLSKETSDCRAHLFAWRLQWEAFEKDMLQGFQE
                     LHHALQRNKAQHVFVQQNAASFSPAEALPERISIRMQRPRHQVLRLKTELLLLKSTCT
                     KAIDQWQQWWASVVASLAHVKASSCTIQAQQSTLNQIGEKAAVAGQAASGTHGVTAYA
                     VNADVLPLSFDEHALLQELIETKVELAQQREHEENLRRDMRRQQRDYQNVITKLGETV
                     SKLEVRLARKRMRQKNLVHIEPSSYT"
     gene            complement(<210514..>211275)
                     /locus_tag="CYME_CMM091C"
                     /db_xref="GeneID:16995115"
     mRNA            complement(<210514..>211275)
                     /locus_tag="CYME_CMM091C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536946.1"
                     /db_xref="GeneID:16995115"
     CDS             complement(210514..211275)
                     /locus_tag="CYME_CMM091C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537003.1"
                     /db_xref="GeneID:16995115"
                     /translation="MFRHTLSVDPSEQLSQDFADPVTDSGYESDEEAAAAATASLSGE
                     EAALWNLVDPQQRLIFVLDGPAAQTLRVKRTGNLERQVVNIHRLPLERAPTVATSLLA
                     ATRPQHLVVALRTIEPHQAAAILTSTSYPSLSNVENASQVLVLANDLVQIDDPLLRPL
                     WSDEGTQQNRIQLRWVETGCIGGITAALLAAGCWLRIPVLALLAVEDDDGPSPATLEA
                     LLLAAERFGCFTRADWEIRMPNLRQLLAKRQLLYI"
     gene            211932..213397
                     /locus_tag="CYME_CMM092T"
                     /db_xref="GeneID:16995116"
     misc_RNA        211932..213397
                     /locus_tag="CYME_CMM092T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461441.1"
                     /db_xref="GeneID:16995116"
     gene            complement(<213719..>215335)
                     /locus_tag="CYME_CMM093C"
                     /db_xref="GeneID:16995111"
     mRNA            complement(<213719..>215335)
                     /locus_tag="CYME_CMM093C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536947.1"
                     /db_xref="GeneID:16995111"
     CDS             complement(213719..215335)
                     /locus_tag="CYME_CMM093C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537004.1"
                     /db_xref="GeneID:16995111"
                     /translation="MPRGRLGARATGLSRGSRVRPKRGRLLLESDAASAQSAKDETRS
                     PSPSADTSSVLAEASSPGRSDETPASEPPVVPERRTRRHKQHPTNKHGGVSVEEDHTP
                     GGLGVTTQSRDGSRREDEAVDQSPRRVSSVEKERVQDLHLLQQLLRACKQRKPWTSSA
                     IMDCEEVTEPHPMPLVTNSDEKQKQDLASAGNAPASTWESVADADQSRAPQPDRPAWL
                     SMLEQLSCVLHVYNLLTDAIFREACEEAFREEYFSRILRTNDRARIHSPLFEALRMTS
                     LLDEDTVETPLNGCTQARQAAREGVLVCFHCKSSVSAARYAQHLEKCWGGGGRQSSRV
                     AAVRLRQASARTVNESSEQLPRNAAATGNHLDEDNGSAGTDTLRPGPRASSGKNEGGQ
                     LTKTSASVEPENVPREGRWFPGRPDEGPEASVEQRPVSGMQTGFHDQGVIQEPEQHEG
                     RPVSLRLPTERISDGNEPAEDEAIGSEDVPGRIHDDDADDNVEDGNNVDDDHDDHDDD
                     DDDDDFTQRPPKVRKRSTSRRRPERRRRGR"
     gene            <216036..>217784
                     /locus_tag="CYME_CMM094C"
                     /db_xref="GeneID:16995112"
     mRNA            <216036..>217784
                     /locus_tag="CYME_CMM094C"
                     /product="elongator protein Elp3p"
                     /transcript_id="XM_005536948.1"
                     /db_xref="GeneID:16995112"
     CDS             216036..217784
                     /locus_tag="CYME_CMM094C"
                     /codon_start=1
                     /product="elongator protein Elp3p"
                     /protein_id="XP_005537005.1"
                     /db_xref="GeneID:16995112"
                     /translation="MSTSQVIDYIIRKLIEAYENDEAVSLDRLKLEAAKHFGVNGVPK
                     LMDIVAAVPDEYRDVLVPQLRVKPVRSSSGIIIVAVMSKPHRCPHIYTTGSVCIYCPG
                     GPDSSFPYSAQSYTGLEPTSMRAIRARYDPYLQVRSRIDQLQSLGHAADKVEFIIQGG
                     TFMSLPADYRDWFIRNLHDALSGHASMSVAEAVRYGEQSARYKCIGLTIETRPDFCQR
                     THLDAMLQYGCTRLEIGVQSVYEDIARLTNRGHTVEAVIRCFQLAKDAGYKVVAHLMP
                     NLPDMDRERDVECFREFFENPAFRADGLKIYPTLILANTGLYELWRAGKYRSMPPPEL
                     VDHVAELLSLVPPWVRVYRVQRDIPMPLVTSGVQFGNLRELVLARMRDLGLRCRDVRT
                     REVGIREIHEAVRPQSIELVRRDYVANGSWETFLAYEDPVRDILVALLRLRRLSKETT
                     HRMELRIEDTAAGDDSSNSGVGQGTGCSVVRELHVYGTVVPVHERDPTRFQHRGFGTL
                     LMEEAERIAREEHRSCKLAVISGIGTRNYYRKLGYTLEGPYMVKYLAAGTAKVSPSGM
                     SSCMGEQIRADMAVSV"
     gene            218919..220570
                     /locus_tag="CYME_CMM095T"
                     /db_xref="GeneID:16995109"
     misc_RNA        218919..220570
                     /locus_tag="CYME_CMM095T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461442.1"
                     /db_xref="GeneID:16995109"
     misc_feature    complement(221092..222932)
                     /note="repetitive element"
     gene            <224617..>225690
                     /locus_tag="CYME_CMM097C"
                     /db_xref="GeneID:16995110"
     mRNA            <224617..>225690
                     /locus_tag="CYME_CMM097C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536949.1"
                     /db_xref="GeneID:16995110"
     CDS             224617..225690
                     /locus_tag="CYME_CMM097C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537006.1"
                     /db_xref="GeneID:16995110"
                     /translation="MALQSTRGKKNIGMPDAVTSSLVPDDDSLALKQAVSLLMRQNGV
                     LVLHFCRSRKANSKHFPEWCALELQALCLLGREAEAVRFARELLHKNDTVGSAWRCPP
                     LVRCCFSVLANFLEPDEAASIAKTCLESFFNSVEASRWGEADTRDLLERVWLRGVLFG
                     EALRFPGREQRRAWLERHLAVLEHAMSTSSAEGSDALTHALHQWVSKEALQSLAKRCM
                     TSDAELDEQSTLERNELTSRTCAAEDETTLRYSTDERGQVLNAHVRAADESGAASWLP
                     MGVSASLQRLRHRFQHDPAFVADFVTYTCAGIAALGWLIYAHRTRQRKRLQTPGTRIA
                     ARGSNRFWRSARDLLRSALFLGV"
     gene            <226573..>228129
                     /locus_tag="CYME_CMM098C"
                     /db_xref="GeneID:16995107"
     mRNA            <226573..>228129
                     /locus_tag="CYME_CMM098C"
                     /product="asparagine--tRNA ligase, cytoplasmic"
                     /transcript_id="XM_005536950.1"
                     /db_xref="GeneID:16995107"
     CDS             226573..228129
                     /locus_tag="CYME_CMM098C"
                     /codon_start=1
                     /product="asparagine--tRNA ligase, cytoplasmic"
                     /protein_id="XP_005537007.1"
                     /db_xref="GeneID:16995107"
                     /translation="MEQIEQGTSNISLDDYLKMSEEERQQLPKTRLKKLQRQAALAER
                     KAARAAELAANAATEQRERLEEARQVRIELDSSLPKPLICKLRDIFASPEKFVDQRVC
                     LAGWVHHWRMDGKRLAFLELRDGTGFMQCVLSNELCMTYDALTLCREASVRVWGTVRH
                     DARAKGGLELHADFWELVAPSTPEIEMVLTHESNPDILLNNRHLVIRGRRTSTTLRLR
                     SLITQCFREHYFQRGYVELAPPTIVNTMCEGGSTLFKLDYFGINAYLTQSSQMYLESG
                     IPAVGDCFCVLPSYRAELSDTRRHLAEFHHIEAEMPFITFADLLDAIEDLVCDVIARV
                     LAKAGDLVRDLNPELVVPRRPFRRLTYADAIAYCREHEIYKDEEQKIHFEYGDDIPER
                     PERLMTDQIGEPIFLTHFPVSMKAFYMQPCTDQPDLTESVDLLMPGVGEIVGGSMRIW
                     RYKQLMDAYAREQIDPKPYYWYTDQRKFGSCPHGGYGLGLERFCCYVLGVRHVREVCL
                     YPRYRGRISP"
     gene            complement(<228831..>230756)
                     /locus_tag="CYME_CMM099C"
                     /db_xref="GeneID:16995108"
     mRNA            complement(<228831..>230756)
                     /locus_tag="CYME_CMM099C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536951.1"
                     /db_xref="GeneID:16995108"
     CDS             complement(228831..230756)
                     /locus_tag="CYME_CMM099C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537008.1"
                     /db_xref="GeneID:16995108"
                     /translation="MRDARGSRNCRGGFLNSALDCCRVCSGAKRPIKVLFSNLLGISS
                     AKELDLDFLNRSEELLRRPYVKFLSFRGPLKPSTLSYAASAAAPLGKQALLLSSHQGT
                     LRRSVPCRLMVLPRRRRSVVSPPLEAAALVSEACEATLTGAPPHQRFAGAFPPTALRD
                     TLPQRSAETRPLTEVTATRPHTVGTRYWTRSQACADAQLTSFQTAFQRPTSTRAFPEA
                     PAAQSTAWRQRSYPRDEREPAKHQQSKSEDPSLIPLLGFVSRTLNDERCSSTPVLRET
                     RSDVNSLRFSRRALPANELQNFAPYDDSCSNDERKPHACEQGDDVQTQPGALCSAQTG
                     TGDSPRSTRRCNDSLSEDRWPAALWTLASTLSAVGAAELQRTPDRAKAAHQNAGFAGL
                     KALCVPDSESSDPTKADMIAFCAAVGSLLLHIGCKNPFGIDGPESTALRRASATSVSW
                     YAAGNRMIRICLNMIAMGLQLAEGVLVPLFGVFVGCMTPPASESFTATDASAPVMPWR
                     RARTLVFIERVVLIGIGAAEATLLAFPQARVSRKPTGKNAIATDSLLYVTCIYHGVLL
                     VFLFLLVSILGLGVLVVRRLFTTRVAKMLVGLAGLWGAVHLCSLDIALRHHAVHGLRR
                     SRVLELQLERFIRRRDP"
     gene            complement(<232084..>233115)
                     /locus_tag="CYME_CMM100C"
                     /db_xref="GeneID:16995104"
     mRNA            complement(<232084..>233115)
                     /locus_tag="CYME_CMM100C"
                     /product="similar to nuclear receptor binding factor 1"
                     /transcript_id="XM_005536952.1"
                     /db_xref="GeneID:16995104"
     CDS             complement(232084..233115)
                     /locus_tag="CYME_CMM100C"
                     /codon_start=1
                     /product="similar to nuclear receptor binding factor 1"
                     /protein_id="XP_005537009.1"
                     /db_xref="GeneID:16995104"
                     /translation="MATHIPSTQKALEIVSFGDPLKGALRLNTTASVPKPGPGQVLVK
                     MRYACLHPADVFVVQGVYPGVAAVRERRPGFVGGLEGVGEVVAQGPATSLPVGTRVIP
                     TLADRSGCWQQYLVVDENLCIKVPQDIGDKEAAQLIVNPLTVVGMLEQIEAEAPVHGN
                     PWIGQTAANSTLGRMFIQLAKKRGLCTVNFVRSKASVAELKQLGADEVIVFGEEPNLA
                     ERLNAITNGRGLAAVVDAVGGEMGSAALAALSPGGLFMAYGLQSGKPTCVMNSDLIFK
                     GIVVRGFSLTTWLKNQKPTIFEETFEMIRKGDMRPQVEQEYTLEQYEDAFRAQFAPNR
                     KGKILFKLE"
     misc_feature    233253..233741
                     /note="repetitive element"
     gene            <234163..>237066
                     /locus_tag="CYME_CMM102C"
                     /db_xref="GeneID:16995105"
     mRNA            <234163..>237066
                     /locus_tag="CYME_CMM102C"
                     /product="probable ATP-dependent DNA helicase"
                     /transcript_id="XM_005536953.1"
                     /db_xref="GeneID:16995105"
     CDS             234163..237066
                     /locus_tag="CYME_CMM102C"
                     /codon_start=1
                     /product="probable ATP-dependent DNA helicase"
                     /protein_id="XP_005537010.1"
                     /db_xref="GeneID:16995105"
                     /translation="MGGAFAAYAMTQALILPGSSAFIKIPPYANNRTTSTYSNGASCV
                     ASRRHCRFLGAGSGRSRALTAFLVKQQCCRCVDSLRRAQTAKRSPGVAAIRLATESPE
                     QDPVLDWLRKELNDEQFAAATAPVDAPVLVMAGPGSGKTRVLTYRMVYLIIKELFRAR
                     HLLAVTFTNKAADEMRARVIDLLKSRQGTEVESSHSVPTVGTIHSACSRILHRFGAVM
                     GISSKFNIYSESDAKRLLHRILEENGETMIDPKKIALFAALLSEMKQEQFCAEFGYEP
                     SPSRSPAYDARGITAYMVERAKTLLPVYQSELRRLGALDFDDLILEAGRLLRNHPAIR
                     LELQKQWQYIMVDETQDTSQAQYHVIRLLAERKRETEKYFPLFLVGDPDQSIYGWRGA
                     DMHAVRRFRDSLPETRVYLLENNYRSTKAIGDLAQYVIQQDRERIHPEKRMRTQLEGE
                     HPVRLVFCRNSKSEAEFVVKQIRELVARHKLSGRDIAIMYRTNVQSRTLEEACIHAGV
                     PYVLVGGLPFYERREVADMLACLKLLLHEGDTASFERVLSFAVSGIGKRTTAALYEWA
                     KHLNCTPIAALRALSNVDADTPIVSKAIPSVPRSLPVHETPAVDENASNGTRGAAELE
                     TTPTLTDEQVAMLGVTSRKRKILLKFLEMYERWKRLLRTPVAEMSRRYYVLPLMIKTI
                     FADTQYEEYVRKQALHGPAVNEETSALRVQERLENVVELARAASTAEELCLKRGAQTA
                     GDVLVTFLHEVALVHGANRDENTPKDAFGCVNLMTLHASKGLEFEAVFIVGMTESLLP
                     HKLCRTRESQIAEERRLAYVGLTRAKRHLTITWYPNGSEWLSRFLLDAPDELVSRHCA
                     RDLMKGRLDPIPREEYTLRCKQAHAGSKEPVRIGDIDVLGEVKARSRAAESKRARVQA
                     NADSKLAAGVFVRHSKYGKGIVVKKLDGTPLVVVRFFEQRGTKAVPGNFLERL"
     gene            complement(<237658..>238698)
                     /locus_tag="CYME_CMM103C"
                     /db_xref="GeneID:16995102"
     mRNA            complement(<237658..>238698)
                     /locus_tag="CYME_CMM103C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536954.1"
                     /db_xref="GeneID:16995102"
     CDS             complement(237658..238698)
                     /locus_tag="CYME_CMM103C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537011.1"
                     /db_xref="GeneID:16995102"
                     /translation="MQELAREVDRAAAGTERVYCRLEQALEERERKLFVLEKRAMAVR
                     LFLSRLRPRTLDTTARSRKGSEQGTGEPSRSQTGVVPAPVTSSAPAVSACQERSPLRL
                     LNSAGQGTGTAVSKHRRNASPKTNFNENVSGAESRNCGTASAATPMNVQPKDTERGPV
                     RLFRWADRGYHFLVRPTGETNADAVKPVLREDHATIRNAQTKAIAAVAGLTPSLPDWN
                     GILAKAPPIPPRKDGVRFRSAPKAALASNTGAIPAKTPDMASLPPTKQPQGQQHSSGG
                     DAAPLHDERAATSPGLQVSSSASRTGGTPKRSVRFAEPEVQMSAVEERSLQNILPRRQ
                     RIVTKPAFRQRS"
     gene            <239138..>240733
                     /locus_tag="CYME_CMM104C"
                     /db_xref="GeneID:16995103"
     mRNA            <239138..>240733
                     /locus_tag="CYME_CMM104C"
                     /product="mitochondrial processing peptidase beta subunit,
                     precursor"
                     /transcript_id="XM_005536955.1"
                     /db_xref="GeneID:16995103"
     CDS             239138..240733
                     /locus_tag="CYME_CMM104C"
                     /codon_start=1
                     /product="mitochondrial processing peptidase beta subunit,
                     precursor"
                     /protein_id="XP_005537012.1"
                     /db_xref="GeneID:16995103"
                     /translation="MSEWLLPVRASWIGLTRRCFAFQRLGSVRYAHTGSGSSVSSHST
                     AAAMPLPDPLQTSFQPTGLKRLVKQVFGENAAPLPPGYRVEPRLLTQTPTHVTTLTNG
                     MRVATERLDTPTVTVGLWLDTGTRFEPAAVNGAAHFLEHIIFKGTQRRTQQQLEMEVE
                     DMGAQLNAYTSREQTVYFARCLSDVLPQSVDLLADIIQNSRLDAAAVEREKDVILREM
                     EDIESQPEEVVFDYLHGTAFQGTPLSRTILGPVENIQAMQREALLEYIRRHYRPHRMV
                     LVAAGGCPEHERFVELAEKHFGSMPRAEDESVSSETLAAAEPAYFTGSDVRVRNDDMQ
                     LAHFALAFETCGWAHPDAPALMVMQALMGAYDRNAALSRFSSSRLCRGLHNVPNAVSA
                     QAFNTSYVDTGLFGVYAIAHPPDLDDVVYEIQMQLTGMAYKLDESEVERAKRQLKTSL
                     LLQLSDSNAVAEDIGRQLLTYNRRVPLAETFARIDAVTAESLIHIANKYLCDRELAVA
                     SLGPIASLPDLLWMRRRTYWLRY"
     gene            <243129..>243764
                     /locus_tag="CYME_CMM105C"
                     /db_xref="GeneID:16995113"
     mRNA            <243129..>243764
                     /locus_tag="CYME_CMM105C"
                     /product="similar to 8-oxo-dGTPase"
                     /transcript_id="XM_005536956.1"
                     /db_xref="GeneID:16995113"
     CDS             243129..243764
                     /locus_tag="CYME_CMM105C"
                     /codon_start=1
                     /product="similar to 8-oxo-dGTPase"
                     /protein_id="XP_005537013.1"
                     /db_xref="GeneID:16995113"
                     /translation="MAADVNREPSFACSACGASQTLFKRYTLCIGYGNANGTETVLLG
                     LKQRGFGRGKWNGFGGKVEAGENVCQAALRELYEEAGVHIVADGHPSSARCTTPRHDI
                     RRFRWAGCLCFTFEAKSMPRMHVDVFSGSICACREPRASDEMIPQWYAYSQIPYESMW
                     PDDAIWLPLLLQQDQELHPRILIAEFIYNDDADNILKSNVRLLPREQAGIF"
     misc_feature    complement(243260..244179)
                     /note="possible transcribed region"
     misc_feature    complement(244437..247022)
                     /note="repetitive element"
     gene            <247200..>249086
                     /locus_tag="CYME_CMM108C"
                     /db_xref="GeneID:16995119"
     mRNA            <247200..>249086
                     /locus_tag="CYME_CMM108C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536957.1"
                     /db_xref="GeneID:16995119"
     CDS             247200..249086
                     /locus_tag="CYME_CMM108C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537014.1"
                     /db_xref="GeneID:16995119"
                     /translation="MNAHHNDWTPDKVLDTVREYVDAGALSECAALDLLERLPLPLLG
                     WTLEEYAVRASLEASDSDAVPSDNIFDSVRVLTKTMEKLVKLSATSARVRHLVPIEQV
                     LQLIQLGLSSRYPLVRTAALRLLCLLLERNDLPEAFCQQVADTIIERFESTNELRPEI
                     EAAQAPGPEVNASSTTAQHASDILSLVLLSFRDDPSTEAAGLCEKILKNLVQLKPFRG
                     AVVLFSEARGAQILVQEMLSGAAGAVAHIRALNLLLEICDYSSVAEIAARRLLPTVLV
                     AKIAAPVRLDEDMLLRLNLLDVLGAFMQRSAIAAELLDQISVFDVLLRQHLAYLLAPD
                     EPASSDLAERWFIWMCGILRFVRTSAGSSRCAFHAWMNANLVEILGRFLLLHVVDGET
                     ETAHWSVQLDQVRRTTLLVHLISAVGALGLCERGMDVLLADVDTLKLTLRFIQTASVC
                     DIRVASLRALSVFLAGLDEPLSSAAVSGYGAAESDLEFRQQRVLHLFTDAIRDADPVK
                     AFTNALPIVLDCARHPSEEERLAAAAVFAALGLSRIGVVALASMAGFVEWLCDPADAS
                     LEVLEAKMRVARRLVELHASDGEVAFGALKWSRIVAVVSNRSDPRAVRQQRVPAVNIA
                     TLNR"
     gene            <251107..>251424
                     /locus_tag="CYME_CMM109C"
                     /db_xref="GeneID:16995120"
     mRNA            <251107..>251424
                     /locus_tag="CYME_CMM109C"
                     /product="Sm protein E"
                     /transcript_id="XM_005536958.1"
                     /db_xref="GeneID:16995120"
     CDS             251107..251424
                     /locus_tag="CYME_CMM109C"
                     /codon_start=1
                     /product="Sm protein E"
                     /protein_id="XP_005537015.1"
                     /db_xref="GeneID:16995120"
                     /translation="MPKAALDRRIVPEQLLATLARQQARVEVWLFENTRYSLEGTLRG
                     FDEHTNLVLVDTVEQWGSTAKHKRRTVALGTILLKGENVVLVRSLGMPTQRKEVTHSA
                     TRE"
     gene            complement(<252149..>253192)
                     /locus_tag="CYME_CMM110C"
                     /db_xref="GeneID:16995130"
     mRNA            complement(<252149..>253192)
                     /locus_tag="CYME_CMM110C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536959.1"
                     /db_xref="GeneID:16995130"
     CDS             complement(252149..253192)
                     /locus_tag="CYME_CMM110C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537016.1"
                     /db_xref="GeneID:16995130"
                     /translation="MRLLLQRWSQTIRHGSRNALGIVRLRSFPGRLSGSESRSHWRPV
                     TVWSTCAAVIAASLASVQRPEWRPWLCYAEASTSLESTHNFTAATEKVAPLSDAAEPA
                     TILWKQLPDSLAELRKADIVLYQYETCPFCNKLRAYLDYWRIPYKVVEVNPVGKKELK
                     FSSYRKVPILVVNGTQLNDSAAIIKALARITDPDRPLNTQWFDWIDSWFVHTLPPNIY
                     RTRHEALETFDYITEKEKFSPWQRFTIRYVGAAAMYFVSRRLKKKYHIVDERQALYDA
                     CRDWLQAVGWPERRFLGGARPCAADLAMFGVLRSIEGFTAFHELAANVPEIVQWYRIM
                     KDQVGPSARIDSM"
     gene            <253700..>255073
                     /locus_tag="CYME_CMM111C"
                     /db_xref="GeneID:16995131"
     mRNA            <253700..>255073
                     /locus_tag="CYME_CMM111C"
                     /product="eukaryotic petide chain release factor eRF
                     subunit 1"
                     /transcript_id="XM_005536960.1"
                     /db_xref="GeneID:16995131"
     CDS             253700..255073
                     /locus_tag="CYME_CMM111C"
                     /codon_start=1
                     /product="eukaryotic petide chain release factor eRF
                     subunit 1"
                     /protein_id="XP_005537017.1"
                     /db_xref="GeneID:16995131"
                     /translation="MASITTVAAAAVGAALPSNNHEQDDEDRAVTMFRIKKLLKGLEA
                     ARGNGTSMISLLIPPGDQVAKVGKLLADEAGTASNIKSRVNRLSVLSAITSTQQRLKL
                     YNKVPPNGLAIYCGTVLTDKGEKQVTIDFEPHKPINTSLYYCDSRFHVEPLMNLLEDD
                     EKFGFIIIDGNGALFAVLSGNTREILHRFTVDLPKKHGRGGQSALRFARLRMEKRHNY
                     LRRVGEDAVRLFIPDGDKVNVSGIVLAGSADFKNELARSDLFDPRLQAKVIAVVDISY
                     GGEVGLNQAIELAADSLSNVKYVREKRLLKEFYDQIALDTGKYCYGVDDTMKALEMGA
                     VEKLIVWENLEYERVVLMNPQSGEETVRIVQKEKLDQLASDTAKDGGPDMEIKESESL
                     VDWLAQNYKRFGAHLDLVTDRTAEGSQFVKGFGGIGGILRYQIDIASLDQEEDDESDL
                     DEDDWAL"
     gene            complement(<256004..>256645)
                     /locus_tag="CYME_CMM112C"
                     /db_xref="GeneID:16995128"
     mRNA            complement(<256004..>256645)
                     /locus_tag="CYME_CMM112C"
                     /product="similar to 5-formyltetrahydrofolate
                     cyclo-ligase"
                     /transcript_id="XM_005536961.1"
                     /db_xref="GeneID:16995128"
     CDS             complement(256004..256645)
                     /locus_tag="CYME_CMM112C"
                     /codon_start=1
                     /product="similar to 5-formyltetrahydrofolate
                     cyclo-ligase"
                     /protein_id="XP_005537018.1"
                     /db_xref="GeneID:16995128"
                     /translation="MGSTQDVLLMKRELRKRMRELLRQVSRNELRERSAEACRLLTNS
                     EVFRSARTVAAFCHMPTSEVETTDLLAACFAEGKRVFLPRVDEGSVRKMLFLEAHGLQ
                     DVESWPLNAMGIREPPSTWNGQVRREMRTLVERERKPLDLIVVPGLAFDTFGRRLGRG
                     KGYYDTFLATCEHLHLEMQLPPPRRVGLALSCQLVTEVPVSAHDQVVEAVFYA"
     gene            complement(<258426..>260375)
                     /locus_tag="CYME_CMM113C"
                     /db_xref="GeneID:16995126"
     mRNA            complement(<258426..>260375)
                     /locus_tag="CYME_CMM113C"
                     /product="similar to inorganic phosphate transporter"
                     /transcript_id="XM_005536962.1"
                     /db_xref="GeneID:16995126"
     CDS             complement(258426..260375)
                     /locus_tag="CYME_CMM113C"
                     /codon_start=1
                     /product="similar to inorganic phosphate transporter"
                     /protein_id="XP_005537019.1"
                     /db_xref="GeneID:16995126"
                     /translation="MLPRAKAPKERATAVDDADAGLQFEASENSLQLSRTQSEVETPA
                     NGVDVPEVRQAPRARYWTVLMSMIRSMSAGAGMFIAAYFLITTGQLKTVWEAAYPTCW
                     LGAVHGSVNCANQVRCPGLFPQCTSAPCQDNIPGFCTGPGGGYPSRDTCTRSILIANS
                     CVVFGGIMLGMLGFGWVADALGRRIGSICTAAVMVTGALVMTFVYSVDISTIFIVLSS
                     FFGLLGIGIGGEYPISASRAAEHKQKIEETSAHERHQIQRRLRGAAITLVFSMQGIGI
                     LFGSLLTLVAIAVAKQTAPNCRIQSNNEMGYSQRALSFVWRFVYGVGALWLFGLLIHR
                     FYFVQEDEVFKRAAKRREARRRRVLTLRSSRSEYRQLLSYYWSRLIGTGFTWFLNDVI
                     LYGNRLYSGPIFNGINENADLLIQNAWIVLNNGVSLVGYYLAAAIIDQPWCGRRRLQL
                     FGFAMIAVFFAILAGTYEHFRTSNRHALIALYILASFFSQVGPNVVTYVGAAELYPSE
                     VRARAHGLSAFCGKLGALVSTLTFGYVDIRTIFILTAAAAVIGFLATFIFLPDATGLD
                     LREHDWEWDLTLRNHAELYGGEAANLRHLSLCERWQGRGKRYTPHWRAQLRKEERSSD
                     AAATKLATPPIAASTLIPSIAPDNR"
     gene            <263143..>266370
                     /locus_tag="CYME_CMM114C"
                     /db_xref="GeneID:16995127"
     mRNA            <263143..>266370
                     /locus_tag="CYME_CMM114C"
                     /product="calcium-transporting ATPase"
                     /transcript_id="XM_005536963.1"
                     /db_xref="GeneID:16995127"
     CDS             263143..266370
                     /locus_tag="CYME_CMM114C"
                     /codon_start=1
                     /product="calcium-transporting ATPase"
                     /protein_id="XP_005537020.1"
                     /db_xref="GeneID:16995127"
                     /translation="MLGSSGASIQRTREVQSPKRRGDVRSFGHAKAAGVRSPQVTGFV
                     PELCPRWGACPARQTRRRHTAAHCVVRPSSVYPRAVCSFVSSSWRLALKHIETASTGS
                     VQRRLLGLQASSDSKDSTGAPTARLEPVFQTAEHVAAHYAVEIEAGLSTSRARELLRI
                     HGPNALPEPEPQTLVQRVLKQFDDRLVQILLVAAGISFTLAATAKERTASAFLEPVII
                     LTILLLNAGIGAILESRADESIRAMRAYMSEEAVVVRDQGARSCIPARELVPGDVIEL
                     RAGDLVPADARVVRLLSNTLQVDESILTGESLAVDKYVEAMEQAKDARGTGRLPYQEQ
                     RNMLFTGSVLTRGRCLAIVVATGENTAVGTIRGQLVRRSSSSSSSSASRKNGETELAT
                     EATTETPLVEQMNRLGDLLTNLVLGICAAVFALNLVQEIQQVPLAMIISQQQVDLSRI
                     LEQVIESFKFSVALAVAAVPEGLPAVITTCLALGTQRMSKRNVLIRSLPCIETLGCTS
                     VICSDKTGTLTQNRMRVVELVPVHDSLKEALSLVLALCSEATLDGRGDPTELALLRAG
                     EELRPSDSNRAFWESHARILQVNEFDRVRKRMSVVVTCSVPVLSTANTNDHKSTYTYS
                     LVKGAPETVLEQCSFVEPDAVAYWSEQTRERSRSGLRCIALAIRECTSDAAQDSAEKQ
                     LTFLGLAALQDPPRPGVREAIARCRQAGIRVVMITGDHALTASAIAAQVGILDTSMIA
                     DAAAEKSGTLTPTVVLGADLESNRYTPDQVAAARVFARVEPKHKLQIVETLQRTRSEV
                     VAMTGDGVNDAPALAAADVGVAMGTGTQVAKAAADMVIVDDNFATIVSAVEEGRSIYA
                     NMRQFIRYLLSSNIGEVIAVLVSSLWLHVPEILSPAQLLWVNLITDGLPAIALSFNPT
                     DPEAMQRPPRRRDEPFLRTQGGLGGDLARYLAIGTYVGLACVFGYRGFIDNTVQARSV
                     AMSVLVTAEMANALNAVSETESIILQPHLMVSNRWLLGAVLASMALQLIVLESPLSQT
                     AFGVERLSLGDWLFVVGASVPVIAVDEVFKFFLRRARAKRSSQGS"
     gene            complement(<267370..>268887)
                     /locus_tag="CYME_CMM115C"
                     /db_xref="GeneID:16995124"
     mRNA            complement(<267370..>268887)
                     /locus_tag="CYME_CMM115C"
                     /product="similar to glycosyltransferase"
                     /transcript_id="XM_005536964.1"
                     /db_xref="GeneID:16995124"
     CDS             complement(267370..268887)
                     /locus_tag="CYME_CMM115C"
                     /codon_start=1
                     /product="similar to glycosyltransferase"
                     /protein_id="XP_005537021.1"
                     /db_xref="GeneID:16995124"
                     /translation="MIRSTVQNYGSERALHKGWLPAWPDREYQQRRARRTVGRRRLRL
                     LGLAALIALVCCAFFLVRFVPTFNYALFRRKVSTNGDALRAVWLGDSDTLPRGPQREY
                     FRCVRSLARLMYLCRLIDNPHQLAGTDPPLTLPACEELENALYERCAEARQAPSRTVP
                     SQTALALRTLPYFVAASAPALDTLKLENVLGPQKIQRSHRALTEINVSLVTHASLSKL
                     SELRRLTEHWPAPISCALVLPDVSQSHQVLDMYPKGRSDRVDIHLLLADDYERPTYYP
                     FNAARNLALDNARTDWVFLVDVDFVPSPNLVESVQRTLRRFPELREEMQQRRAVLIVP
                     AFEKLQAREEHQTSLPATRAELVAETRAGRIVPFHVSWYWPGHGPTDYIRWLADANET
                     SEHEPHKPYRVRYRDGYEPYIVAYRHGLPRYEDSFVGYGWNKQSFIKELHYAGYRMYV
                     LRDGFIIHMNHEYASWRNQQKHENLRALKSARAYHEQLLRTRYGKSVSFEERSTS"
     gene            complement(<271917..>273026)
                     /locus_tag="CYME_CMM116C"
                     /db_xref="GeneID:16995125"
     mRNA            complement(<271917..>273026)
                     /locus_tag="CYME_CMM116C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536965.1"
                     /db_xref="GeneID:16995125"
     CDS             complement(271917..273026)
                     /locus_tag="CYME_CMM116C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537022.1"
                     /db_xref="GeneID:16995125"
                     /translation="MRSKTSSYSGFKPQLLLTVYLVAAFTCAALPALWLLRRPLGTDI
                     VEEPPERLPVSRLFAVVVPLGSSADLVTLRANFRYWRPNTGASGAAPCLFSKDSERSG
                     KANLEDRPDLVVLTSRALNVTDRTRIVNEFERNAYCRNCFRSIRFLDCGLKPEHDVYN
                     MTKSGTISSRFNGPLLTFVCSIGHNQIWNNYHAIFLMELDAVPIQNNWLSEVEIEARN
                     LAREQLLAVQSGCSLTEDKSRGSWRNGSPALYRVGFDAQRFFLQCFKHFWCIPTLEES
                     CGFPWDSYIHSCRLQTPESMSLFGVSCRFIHVGSLWHMRRASKSIWTTASSEALRSAV
                     FIHSGRVIREIDETVTALEQKIREADASGVPSEEN"
     misc_feature    complement(273570..274588)
                     /note="possible transcribed region"
     gene            complement(274847..276462)
                     /locus_tag="CYME_CMM118T"
                     /db_xref="GeneID:16995140"
     misc_RNA        complement(274847..276462)
                     /locus_tag="CYME_CMM118T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461443.1"
                     /db_xref="GeneID:16995140"
     gene            <276677..>278035
                     /locus_tag="CYME_CMM119C"
                     /db_xref="GeneID:16995132"
     mRNA            <276677..>278035
                     /locus_tag="CYME_CMM119C"
                     /product="glutamate dehydrogenase 2"
                     /transcript_id="XM_005536966.1"
                     /db_xref="GeneID:16995132"
     CDS             276677..278035
                     /locus_tag="CYME_CMM119C"
                     /codon_start=1
                     /product="glutamate dehydrogenase 2"
                     /protein_id="XP_005537023.1"
                     /db_xref="GeneID:16995132"
                     /translation="MEAEQDSRLKDALGNLHRAGKIAHVDPEVLKVLSSPKESLITAV
                     PVRMDSGKLEVFRGYRVRWNDARGPTKGGIRFHPSVCLDEVSALAFWMTFKCAVADIP
                     FGGAKGGVACNPRQLSPSELERLSRSYGRSISLVIGPDRDIPAPDVYTNTRIMGWIME
                     EYEHTHGGIRQPAVITGKAVAQGGSPGRDDATARGAYYLIKEMETSTHRELLSGANGP
                     ITVAIHGFGNAGQHIARLLAHDRKYRVVAVCDSRTGVFCREGVDVDRCVEVKAETGAL
                     DAERVGHGATSLEPTALLLLSVDLLVPAAIENVIHSENVGQIKARLIVELANGPVSPE
                     ADRALASRNVDVIPDILANSGGVIVSYYEWVQSRTGQWWSAEQVHERLQAKMVHAYRA
                     LFELLQRIRASPTGTASAETDGALGALTFRDAAYVLSLQRIAAAIQATGGSAFFEKRS
                     HM"
     misc_feature    complement(282261..282518)
                     /note="possible transcribed region"
     gene            <282780..>283343
                     /locus_tag="CYME_CMM121C"
                     /db_xref="GeneID:16995141"
     mRNA            <282780..>283343
                     /locus_tag="CYME_CMM121C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536967.1"
                     /db_xref="GeneID:16995141"
     CDS             282780..283343
                     /locus_tag="CYME_CMM121C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537024.1"
                     /db_xref="GeneID:16995141"
                     /translation="MVSCVFFVSTFHPYSLNWQPRNAPLLRRETLTRRPTPVVVQRRA
                     NGAALPIRTEWSGWTRPESGVRRMPTNMPRGRSRKPSFSPTGGGATTLEREAVREKTT
                     ATKGVDPGKKYKLLLFNDEKNTRERVVEVLLKCIPGLSKLDAQSIMQKAHTTGMALVG
                     VWVFELAEAYCDLLRSEGLVSDIEPAE"
     gene            complement(<283535..>284431)
                     /locus_tag="CYME_CMM122C"
                     /db_xref="GeneID:16995142"
     mRNA            complement(<283535..>284431)
                     /locus_tag="CYME_CMM122C"
                     /product="similar to 3-oxoacyl-(acyl carrier protein)
                     reductase"
                     /transcript_id="XM_005536968.1"
                     /db_xref="GeneID:16995142"
     CDS             complement(283535..284431)
                     /locus_tag="CYME_CMM122C"
                     /codon_start=1
                     /product="similar to 3-oxoacyl-(acyl carrier protein)
                     reductase"
                     /protein_id="XP_005537025.1"
                     /db_xref="GeneID:16995142"
                     /translation="MQAPAASRPHRPVPRSSSRAITFIFRDYSLFHIAMAGPVSIIFG
                     ATGGIGAATARLLHKRGHQLVLVARNKEKLDQLAGELGGSRPSDTGAPTVHAADILQS
                     AAVEEAFKKALDQHGTLDHVTHCVGSIVLKPITSVSDELLQETLQLNTASAFYVLRAA
                     CKQLPRLRQSTGDGPVNKSVTLCTSAVSMHGLPNHEAIAAAKAGVIGMARSAAASFAP
                     RGLRVNCVAPGMTETPLASFITERPASRKASEVLHPLGRIGRPEEVASAIVLLIENPF
                     ITGQVLAVDGGLSTLVSQQSAR"
     gene            complement(286353..288244)
                     /locus_tag="CYME_CMM123T"
                     /db_xref="GeneID:16995143"
     misc_RNA        complement(286353..288244)
                     /locus_tag="CYME_CMM123T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461444.1"
                     /db_xref="GeneID:16995143"
     gene            286731..288168
                     /locus_tag="CYME_CMM124T"
                     /db_xref="GeneID:16995136"
     misc_RNA        286731..288168
                     /locus_tag="CYME_CMM124T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461445.1"
                     /db_xref="GeneID:16995136"
     gene            <289419..>290132
                     /locus_tag="CYME_CMM125C"
                     /db_xref="GeneID:16995137"
     mRNA            <289419..>290132
                     /locus_tag="CYME_CMM125C"
                     /product="CDP-diacylglycerol--Inositol
                     3-phosphatidyltransferase"
                     /transcript_id="XM_005536969.1"
                     /db_xref="GeneID:16995137"
     CDS             289419..290132
                     /locus_tag="CYME_CMM125C"
                     /codon_start=1
                     /product="CDP-diacylglycerol--Inositol
                     3-phosphatidyltransferase"
                     /protein_id="XP_005537026.1"
                     /db_xref="GeneID:16995137"
                     /translation="MTGKAAWPVLLYVPNLIGYARIGLALVAFWNVPHPATFLTFYTT
                     GFLLDAADGYAARLLGQSSAFGAVLDMLTDRFSTAGLLLLIALQDLANAGLTCNTVTC
                     ALTTCFRVTVCVALLILDAVSHFWQVCAATLARATSHKAAGPGRLVKLYYRRSVLTTV
                     CLFSEVFLLLHFTRVAGWSARVETASHMELLWIAAYYGCAIVYVLKQFISLAQIWNAA
                     ALLELSCSGCGHVSDAKRP"
     gene            complement(<291646..>292515)
                     /locus_tag="CYME_CMM126C"
                     /db_xref="GeneID:16995138"
     mRNA            complement(<291646..>292515)
                     /locus_tag="CYME_CMM126C"
                     /product="similar to elongation of very long chain fatty
                     acids Elo3p"
                     /transcript_id="XM_005536970.1"
                     /db_xref="GeneID:16995138"
     CDS             complement(291646..292515)
                     /locus_tag="CYME_CMM126C"
                     /codon_start=1
                     /product="similar to elongation of very long chain fatty
                     acids Elo3p"
                     /protein_id="XP_005537027.1"
                     /db_xref="GeneID:16995138"
                     /translation="MNLNMILEASIQQFKFAVETLRTGPGSMKVPIHWTHWSTLSPSA
                     TSHAFSAPIWLLIFWFFYFLSTFILWLAWRIHVSRPLDQALRLLAFLHNLVLSAWSGV
                     MFLGAASAVVAVTRSDGSIERTFCSSSFDNFPRNIYYWLYMFYLSKPVEFFDTFLLAA
                     RGKPLTVLHVWHHASVVFETWSWLRYGLNFSIYGMLFNTAIHTIMYMYFAYASMQWRF
                     PWKRWITLLQIVQFITSFALTIPYLYLYWRNPQRCMGMPALAISTFCNASYLLLFLRF
                     YRRTYWPVSKAKD"
     gene            <292699..>294855
                     /locus_tag="CYME_CMM127C"
                     /db_xref="GeneID:16995135"
     mRNA            <292699..>294855
                     /locus_tag="CYME_CMM127C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536971.1"
                     /db_xref="GeneID:16995135"
     CDS             292699..294855
                     /locus_tag="CYME_CMM127C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537028.1"
                     /db_xref="GeneID:16995135"
                     /translation="MKPDPQKASIKPDIHAGRYIGEEDLSDDDDFEPVLESGSRTQDG
                     TPYREYTLRVLPWVDWDKLFTDTQSEPSDSLELSDSSQSGDEDELGNDSGETAARNTK
                     EAAEAEFVRREYILARFPNTDGCTTDKREQTTGLRFDPSTKLPVPKRGAVPRYQPGGF
                     ARLCREGEETLRERLEALEEAQRVDAQLKVGKAPWYKQRRDLEGIARIPERYRKRLIL
                     EVEETSEPAQGASASEPSAAHMSDAKNAGRPEATRTVRDDPKAPSTKRRKVFYGTMDS
                     ALGSDYCLMIVRDDRTIDLVPVGRYAWHNFKFAPKLSDMANERMHRRDARQAVDATRP
                     SEMTVDRRGSSPVIADTGEQAITVSTEDDPLVHVEQKLRARAALADTILERRRHLVNS
                     SSHAASLWSGTQWQRPFVRRTDEGVHPPHDSEPAVSQGQLDPSLLLSRREIDSSDESN
                     AEDRSGEDDVDVVRENGRHTPERYPNASADDASVLAAAFRYRGGQTPSCSHSNASGSG
                     TESQSSLERLERYQAEDPLRQGSFSDAGDDTDMQWRHRSGLSENGRMLKRLLEREKTA
                     QPPAGVGFRSEIPLTRPSSQAPSDAGATGTSGYDSAPRFQEHESIAGSAGAKYPGKPV
                     SAGEQHAVPSHLLPAPDGVIEEMHIKAVLRYLARQGSYVTVKELLSYFQPWFPAQKER
                     VAALVRKMCTAREIPPGSGRICVLLKEQVLQHAPAS"
     gene            complement(294588..296923)
                     /locus_tag="CYME_CMM128T"
                     /db_xref="GeneID:16995144"
     misc_RNA        complement(294588..296923)
                     /locus_tag="CYME_CMM128T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461446.1"
                     /db_xref="GeneID:16995144"
     gene            <297132..>298139
                     /locus_tag="CYME_CMM129C"
                     /db_xref="GeneID:16995145"
     mRNA            <297132..>298139
                     /locus_tag="CYME_CMM129C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536972.1"
                     /db_xref="GeneID:16995145"
     CDS             297132..298139
                     /locus_tag="CYME_CMM129C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537029.1"
                     /db_xref="GeneID:16995145"
                     /translation="MVHTGVCASGEHILQKQVACLEATCETLREHSQREYAALEKSVA
                     QAFTALQRENAELELIASQWRRCCAEQQWAGIVAHQELVKERARVRELEEKIELMDLL
                     YAEEQRRWQQALASMEAELVLLRSVSVPGPLDTNPDLQPALMEVPAMKSMTCPQIVEP
                     SVVPATENDADDAIESRENTAEVPERRSSAKSNKSRTAKRNQSRGKRLVPSHRTEPRR
                     KSETAPKPSKRESEQRDAQTPVVCSTTAKRRRRVSFSSPADPVSVLEGSSLYEGPGRD
                     CVHPQEPGPAERIVPDRRQKAVDLHFQKAQQGRRKLFSFITQQRLVIAKPRPVPTLTQ
                     L"
     gene            complement(<298560..>300047)
                     /locus_tag="CYME_CMM130C"
                     /db_xref="GeneID:16995146"
     mRNA            complement(<298560..>300047)
                     /locus_tag="CYME_CMM130C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536973.1"
                     /db_xref="GeneID:16995146"
     CDS             complement(298560..300047)
                     /locus_tag="CYME_CMM130C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537030.1"
                     /db_xref="GeneID:16995146"
                     /translation="MTESKWSRDLQEIFGDSSSDESVEDAVDVGAQSRFAVETAAREP
                     GRGFGAPNRTPLEPKAHLIKDADYEAAESRAEHCVAGSPGGAAPVQGGAGAGGLRRHT
                     PDYYLLRLPFKFIGIEALENRESQSHARTDSRTDAPAGPWRNRSKKPALIRWRRNPTT
                     GEWESNARIIEWSDGSRTLHIGDRVALELIVEQGIPGREHVICGDPQRMVNYNGEIKG
                     HFKTNVDPAVVQQLLAGARVPSTAKLGAGLEKELRAGDLASRSFAETGRSRRVQVAAL
                     DRAPESEEKTLLDFENQRRKAEQRIEARRRRRGQRLAQNELLAPQQLGVDPLAGEQRR
                     DAGHTGSTGTLARDDDSGEEASDADSAMELLDDRRFGVRQRTIRDEDAELERLEAMLD
                     DDHEDDHSMNSAESASDEALVEHETPESTSEHPGTSPLDAAAPGAAVHLQQRSRAGAG
                     DNVAASPSSETAVSAEPQAPAASGVSATASSSRRRMLVTSDEEDA"
     gene            300221..302344
                     /locus_tag="CYME_CMM131T"
                     /db_xref="GeneID:16995134"
     misc_RNA        300221..302344
                     /locus_tag="CYME_CMM131T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461447.1"
                     /db_xref="GeneID:16995134"
     gene            complement(<301050..>302864)
                     /locus_tag="CYME_CMM132C"
                     /db_xref="GeneID:16995147"
     mRNA            complement(<301050..>302864)
                     /locus_tag="CYME_CMM132C"
                     /product="mitochondrial propionyl-CoA carboxylase, beta
                     subunit, precursor"
                     /transcript_id="XM_005536974.1"
                     /db_xref="GeneID:16995147"
     CDS             complement(301050..302864)
                     /locus_tag="CYME_CMM132C"
                     /codon_start=1
                     /product="mitochondrial propionyl-CoA carboxylase, beta
                     subunit, precursor"
                     /protein_id="XP_005537031.1"
                     /db_xref="GeneID:16995147"
                     /translation="MRDTSWPQRLQSVTWRTVRQRFRVWLSTACSRSSTGGGGAFAEH
                     PHDVGTGGSVNGSVTTNRDLDSASTEAGATDQIVASGLASVLGVGERTYQEEVFALCG
                     GGRARVRRQHAQGKLTARERLYLLLDRGSFQELDRLVSSRESLHASSSDPLGKHRTPG
                     DGVVSGFGRIHGRPVFVYSQDFTVAGGSLSEANAAKICKVIDKAIEVGAPVVALCDSG
                     GARIQEGVRSLAGYAEVFKRNVLASGYIPQLSLILGPCAGGAVYSPALTDFVLMSRRH
                     ARMFVTGPSVTNAALGEQTTDEALGGAAVHCRISGVAHLDADDDIAVIQLARELLSYL
                     PQNARVPAPQVVVTEDPSDREEPVLDRLVPSDAHTPYDMRDVLMRLVDDEEFLEIQTD
                     FAPNMLTAFARLNGRSVALIANQPLCIAGAIDSDAAVKAARFVRFADAFGIPIVTLVD
                     VPGFLPGTQQEHGGIIRHGSKLLYAYTEATVPKLTIILRKAYGGAYCVMASKHLRGDL
                     NATWPCAHIAVMGRAAASQILRRRVASTDALETSGDTEASEESSVSVALQRGYVDAVV
                     RPRLTRRWLIHGLSLLASKETAALREPWPPKKHGNIPL"
     misc_feature    complement(303045..306153)
                     /note="repetitive element"
     gene            <306540..>307991
                     /locus_tag="CYME_CMM134C"
                     /db_xref="GeneID:16995148"
     mRNA            <306540..>307991
                     /locus_tag="CYME_CMM134C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536975.1"
                     /db_xref="GeneID:16995148"
     CDS             306540..307991
                     /locus_tag="CYME_CMM134C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537032.1"
                     /db_xref="GeneID:16995148"
                     /translation="MPPRETNDHQAALESANAHYPVQAHCVQDMEEEEHDPSLTYKEG
                     VPGPTLSFIWGLKVPPGRAVEHRVEDGEYVVISSASLGIKKPKGKRSVLVMEDLDVPK
                     RGFSDDEDSSADSDEVASESESSSGSDSGSGSSEADEAMVNGIDEDASDSEDDEGDSQ
                     ESSPESSATGTGSEESADEALVSSEDESASEVSDDEDDSFPDTPVIRSIPVCVLLPGK
                     VESQSLNLEIVGPRVLHFRTYGKDTIYISGHTEIEIDEYDSETDAEYDDDVEMSYEGS
                     ESDDGIAEYSASGSSSASDDEPLPSPPLSGHRRSVRITEIMESEQADRVKHADADRTA
                     HRTRARSGATAAATDAGALTSGGAQTSTRKAEQKNRKEGASSAGDAKTGLSSSAADGT
                     SKRGTTPRSESSTDQSHAGTKHVRFPETLEPEERGKKRSASERSSNPAAAAAASSVAA
                     ANALSGSVSCSTCGKSFKMASALEQHMKAKHAA"
     gene            complement(306658..309111)
                     /locus_tag="CYME_CMM135T"
                     /db_xref="GeneID:16995149"
     misc_RNA        complement(306658..309111)
                     /locus_tag="CYME_CMM135T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461448.1"
                     /db_xref="GeneID:16995149"
     gene            complement(<310577..>312271)
                     /locus_tag="CYME_CMM136C"
                     /db_xref="GeneID:16995165"
     mRNA            complement(<310577..>312271)
                     /locus_tag="CYME_CMM136C"
                     /product="NAD-dependent deacetylase sirtuin 6"
                     /transcript_id="XM_005536976.1"
                     /db_xref="GeneID:16995165"
     CDS             complement(310577..312271)
                     /locus_tag="CYME_CMM136C"
                     /codon_start=1
                     /product="NAD-dependent deacetylase sirtuin 6"
                     /protein_id="XP_005537033.1"
                     /db_xref="GeneID:16995165"
                     /translation="MAHDYAGRLRPYENKGRLGLAPDWDRLLDVQRKVQVLAQWLRAA
                     CGDVVVHTGAGVSTAAGVRDFRGPHGVWSEATRSKNGRSRPGVAPGAAQQHEPLTRDG
                     ARCADVIDPRTQPPPPDCSLELAAPTWSHWALTELVRRGLVRRIVTQNIDGLHLRSGL
                     ARHRLSELHGNIFAEQCERCGQIFLNDVVVPTVGGRRTGHQCVYCAWRGQRASTRDML
                     LDWEDPLPQADLMGATEDSRNARLCLVMGSSLQMVPAATLPALCLRKDGARLVIVNAS
                     WTARDDAAHLVIRAPTDMVMLLLLDELALLPPGDARVRLWRPQLTLGVRWRQRPRQSR
                     PSVDVCVWNGNGNAPGLTLDHTLHGACKREPSKHNSSCADTPLYWIPLHGRMIADANQ
                     VPALEALELDASGHLSLTVAGFGQRSCAEPPFCTAAAVSIRLGFPLAPRGTSQPPLVV
                     PNVWYFLSIPRAGWLEFNVVAYRAYVVRLLASEWVQSERIQLPPALLFYREDDRRRCS
                     CIVCGASVPPQKRTHHVQCVHAEALGQRAASAPDLERQRNDLQGRRSEKRARLPRV"
     gene            complement(<312359..>316651)
                     /locus_tag="CYME_CMM138C"
                     /db_xref="GeneID:16995166"
     mRNA            complement(<312359..>316651)
                     /locus_tag="CYME_CMM138C"
                     /product="similar to cyclin dependent kinase"
                     /transcript_id="XM_005536977.1"
                     /db_xref="GeneID:16995166"
     CDS             complement(312359..316651)
                     /locus_tag="CYME_CMM138C"
                     /codon_start=1
                     /product="similar to cyclin dependent kinase"
                     /protein_id="XP_005537034.1"
                     /db_xref="GeneID:16995166"
                     /translation="MRRSSQCRALSELGFEEHSRCHQSCHGLSLFVGMVPKCRGEMCC
                     TVAELECLNSSAESGASNFHALLSHGQHETGIPFDEEERTRARLLTGRRGPGERAPSS
                     PSRSAPQTSDADMIQRVWFGELLRVSQRQRCFSFPVYVQNVYASGSRTDATLMTRQVY
                     IPLPPSPNNTDGESTDDVYQVAYDDEYGLSYKQVREAGIALWLAAQTPLFHHFVCPLI
                     EVRLDVPSYHLQQKSGYLLLEPRQHRSLDRANGSVKLTLFYANARYDWYKQSFDLERT
                     RFFAFDLVLAFAFCHTQGFVHRDVRPQNIVAMQTGKHESCSCAVHETFALINFSLGRE
                     APLQVYEPTGDASDGDSLHRNSSRSTFEALTPVVATLWYRAPELLLGSRRYSAAADLW
                     AAACVIAEVANVHDANEDERALFRGQSEVDQLRLIAEAVGGPLDDGWHSQPEASRLPH
                     FGNGLQVPRIEAALSTNSPLRARFEKCFGSDGLDLMRRLLHPNPTKRLSAMEALEHPY
                     LAVVGDRLSAGCCRGEALAHLRIQQQRIQRLCEYAAESKENLSAMTTPSKSDGVTRHP
                     KIPWQHWERAFNLLKHLSLPQSERPNAAALSASIKTAVQPFYGHVPRGHSRLSSAPCV
                     PDLLRCKCLMAAFIHEHALSPRTLHLAWSYFDIICSSQREPFVRFPTSRRHRLQRTDW
                     LAVGATMLAIKYNEVTNPGTEELARFFALQFEWRDLFYVELWCADVLGFSFAWPTEWD
                     GFLLAWRAAQHQTSSHDHAHIQRTGAYLLELCNLYRTVQECGSPTAAHVGDSLSLGAV
                     LAQSLCQASVLSASDAKHIAQILQALYWAENQPLLRELIQPAYPEVTFHECIEELSSI
                     VMNLQARALSWTEAAQHRTSLSPLTPAERWNKIPDDSCSPTPKRQRIAGADVAKPVAF
                     RMSLETTSSAFPELLGKASHTDGVSSNEASFVVPRARPGARVHPVNALGDAASARDIL
                     RHLFTYLSFPELLRLRQVSRTWRAVVEDTPALWRVLDLSGSCDLISDDVLLNLVQRVE
                     QLICRLHLQRSPVRILDLSGCWRLTAAGLGNALHSPALSHLRVLRLAELNPQALTNEL
                     MLSALPPMLEELDIRATPGSGCLHHPEIFAHLLRLPLRVLNVAEHPGLRISTTVLQEA
                     CNSHGVGFPGLEVFVAHGCSLALDGPLVERLPTLRLRHLDWSFVSFLDESVPRDTAPA
                     SGLPEQNPPSVALVLHLARRAPSLETLRLAHWPMLTDRSVTQLCQALPVPGRLRELNL
                     MMAWELTDRAADVIAHHLHGLHSLDLSSTAVRRPFLSLFPEDTRQLLQQGRACARRHL
                     PLPQLQCLVLNFTAIGDRDLYRLVPCLASLDRLFLVGTFPSRVASAAGTPDALLTSGN
                     ALQPVTPGDAERFLCGLLAHFRQGWNRARDTELDRASNPLTLVLSSDVRVIE"
     gene            312726..316258
                     /locus_tag="CYME_CMM137T"
                     /db_xref="GeneID:16995164"
     misc_RNA        312726..316258
                     /locus_tag="CYME_CMM137T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461449.1"
                     /db_xref="GeneID:16995164"
     gene            <319252..>320598
                     /locus_tag="CYME_CMM139C"
                     /db_xref="GeneID:16995163"
     mRNA            <319252..>320598
                     /locus_tag="CYME_CMM139C"
                     /product="probable arginine deiminase"
                     /transcript_id="XM_005536978.1"
                     /db_xref="GeneID:16995163"
     CDS             319252..320598
                     /locus_tag="CYME_CMM139C"
                     /codon_start=1
                     /product="probable arginine deiminase"
                     /protein_id="XP_005537035.1"
                     /db_xref="GeneID:16995163"
                     /translation="MNSYWKDNAYSTLATSLDGQRTHSPRDSPLVTTRAPMEAGQEHE
                     DDLAQIAIVSSPGLPKMMGSLHPAGSLYEKPVNLRLAVEQHHALRRLLSSHGIKVYDV
                     HDILLKDTERSVSARVALEKLAARCLTYQFSTDVDRARLDDSERSFIADSYKEKVLEV
                     MAPEQLADIVKTNPVVTIEPSGRDTGFTASYAFKPLTNLMFTRDQQVTTRRGIVMARL
                     RSEQRRREVDVMQFCFEKLKLKIIGRIPENAFLEGGDFFPAGDDLCFIGIGLRSNLEA
                     VHYMLEHDLFGTRRVAVVKDMLDQSQDRMHLDCVFNIIGRKTVLMLADIIGSQSPIRR
                     MVDEYARESEQDAYRLVRRDVEFGAYVEDQGFEIIPLSLADQMAYGCNVLNLGASHIV
                     SVCSSAARKIVADDRFTGNVEYLDFSQCTAMYGAAHCATQIVYRSRVPPISLDHEH"
     gene            complement(<321343..>321897)
                     /locus_tag="CYME_CMM140C"
                     /db_xref="GeneID:16995167"
     mRNA            complement(<321343..>321897)
                     /locus_tag="CYME_CMM140C"
                     /product="similar to alpha-hemolysin"
                     /transcript_id="XM_005536979.1"
                     /db_xref="GeneID:16995167"
     CDS             complement(321343..321897)
                     /locus_tag="CYME_CMM140C"
                     /codon_start=1
                     /product="similar to alpha-hemolysin"
                     /protein_id="XP_005537036.1"
                     /db_xref="GeneID:16995167"
                     /translation="MPPLSSLEAPISEYKEVHGGVMHCALRTRSRNPLESSLDMLFSR
                     SMFLSPGATTQIERHNRFAALRRAKQPFQQRVNLSSRQRDALAPVRKTLVGGLRLYKR
                     CISPVLGPACRFVPSCSDYAVQSLEEFGVVRGILLAMWRILRCNPLGGSGYDPPRWPP
                     VPYGHVGALPPTVSPENETRDDSS"
     gene            complement(<322718..>326074)
                     /locus_tag="CYME_CMM141C"
                     /db_xref="GeneID:16995168"
     mRNA            complement(<322718..>326074)
                     /locus_tag="CYME_CMM141C"
                     /product="similar to zinc finger protein"
                     /transcript_id="XM_005536980.1"
                     /db_xref="GeneID:16995168"
     CDS             complement(322718..326074)
                     /locus_tag="CYME_CMM141C"
                     /codon_start=1
                     /product="similar to zinc finger protein"
                     /protein_id="XP_005537037.1"
                     /db_xref="GeneID:16995168"
                     /translation="MPSKRRPHSDAKVAAGGSSGDGLPPKRSRQNGSAQFKAPPLLHL
                     FHFHRAIRHDLEQLLELLESVPPGGSVIEHEREELAAQLESLRHILRHHCSSEDDVLL
                     PVLVRKGCRILEQNEGAACHNSAVFMELHEKMEALERHLKAADTWPSRAEWEQLRDAV
                     FLHLDAEEEAMTPYIWDSSCLTPDEQGQLLVKIIFAMPEETQTRLVLKSLRELTSTAE
                     RSYFLVLLKQYASVEQFASVAGHVAQDMSPEEFQELSEHVPGLTEAAESQLRPLMEIR
                     HIHMAFRHALEDLQQAIDDVDPSDELQLRSFAKQVRFLRLMHAAHSQSEDAVFLPELR
                     KGDREFAEFIHGDHHTEDSIFYELLCDVEKLCAASAEQRPPLMSKLRSRVRSLCGHLL
                     RHMASEESRLLPRLEGHYPVLEQDRLVREVRRKIPEDALRVMMPWLLGSLSIAEQETL
                     VRNLLRSMSRQEFARLIESVAKSVHMGVLDGRNWYELARRVPEIRNHSGIESESGLYS
                     GPLAEIMRVHKAIRVDLQALADAALKLDPESLNPRHLTTLRERFAFLERMVRDHSNAE
                     DRVVLPALAERVHGIVEEYETDHHCEQELFRRLLQTLLDIQCAGTAAETRSLIRKLRG
                     IVRALRVDLMHHLEREEVVLWPILAEKFSADEQTQIVGQVFGQIPASRMQELLPWLVR
                     VLSRHESANMMQHILTITRSTMFAQWLRTWFKGFDELVGGTRQADATGPGGNASIVAT
                     PAHGRDMDSAKYEAAAEGYIRRAMGDVERAIRSIARDETLSERERTMLMQNVMISQWR
                     RRKLQPPAEHAASSSSSARSCTWGDAEALIKNTNTTNNNNNSSPRASTDPQGRGICRM
                     YRPGSKTDSSPGQLGCRHYARACRLLAPCCQVYYTCRLCHDEVNDHVMDRYAVERILC
                     MRCLTEQAPAEVCSSCGERFAHYVCLICKLYDDAPNRDIYHCGYCNVCRVGKGLGIDY
                     FHCMKCNACMSTASAKSHRCMEHSLESDCPVCGEYLFTSTNPIKFLRCGHLMHASCYR
                     RYAAADYRCPLCKKSLADMSAYFAARLRDEPMPPEYRGIPARIFCNDCSARSLVEFHF
                     LYNKCPQCGSYNTEVLQVGRLLPSTNAALS"
     gene            <326390..>326680
                     /locus_tag="CYME_CMM142C"
                     /db_xref="GeneID:16995156"
     mRNA            <326390..>326680
                     /locus_tag="CYME_CMM142C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536981.1"
                     /db_xref="GeneID:16995156"
     CDS             326390..326680
                     /locus_tag="CYME_CMM142C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537038.1"
                     /db_xref="GeneID:16995156"
                     /translation="MRPGAWRNVVHRRNTATAGIGNGELCCVQVILSGVSRWMKHPSR
                     SLYSEPCVTREKFSDSIYKTGSFSSRSTLYALWDRRSKNPEGKKFLCRCELR"
     gene            complement(<330766..>331434)
                     /locus_tag="CYME_CMM143C"
                     /db_xref="GeneID:16995157"
     mRNA            complement(<330766..>331434)
                     /locus_tag="CYME_CMM143C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536982.1"
                     /db_xref="GeneID:16995157"
     CDS             complement(330766..331434)
                     /locus_tag="CYME_CMM143C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537039.1"
                     /db_xref="GeneID:16995157"
                     /translation="MLQSMPRRMSYCFCFIPGAILLSAENIAQIGRRSLGIDYGFRRV
                     GVAVSVGFAPRPLGCLPNAHRVATGPQNKVKIEGNRNRGQGRKSTVPDRLIEDVLDLA
                     LQEAVDQIVVGLPLHSDGLESDQSRETRVFAEKLAKATVLPVYLWDECFSTQEARAVL
                     EANAIRSRRRIERQIDAESACVILREFYEYRGACAELVPGSTRKTNRVRGYGKGTLGE
                     APAS"
     gene            complement(331944..333714)
                     /locus_tag="CYME_CMM144T"
                     /db_xref="GeneID:16995150"
     misc_RNA        complement(331944..333714)
                     /locus_tag="CYME_CMM144T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461450.1"
                     /db_xref="GeneID:16995150"
     gene            <334053..>335828
                     /locus_tag="CYME_CMM145C"
                     /db_xref="GeneID:16995151"
     mRNA            <334053..>335828
                     /locus_tag="CYME_CMM145C"
                     /product="asparagine synthase, glutamine-hydrolysing"
                     /transcript_id="XM_005536983.1"
                     /db_xref="GeneID:16995151"
     CDS             334053..335828
                     /locus_tag="CYME_CMM145C"
                     /codon_start=1
                     /product="asparagine synthase, glutamine-hydrolysing"
                     /protein_id="XP_005537040.1"
                     /db_xref="GeneID:16995151"
                     /translation="MCGIFAIIGNTTRSEQELAQLTCKCTEKLRHRGPDEFTTEVYGG
                     GWAAFGFARLAINDPAHGHQPMRNDLSTVFAITNGEIYNHEEIRRDALGNRPLHSHSD
                     CEVIIPLYEKLLGENAEQATSRTGPALVERLLLPAKTLYDMLRGVFASVLVDLERGVY
                     VAARDPVGVRGMFVGASADGAVWIASEAKALVEHCDRVEAFKPGTLIVGVRGQERATA
                     FTFEPWYVPRFLADDSWTPTAPANLQLLHDAFVVAVRRRLMADVPVGVFISGGLDSSL
                     VAAVAKRYLAPDYVFHSFACGLAGSPDLAAARRVAEFLKTEHHELIFTVEEGIAALDR
                     VIYHLETYDVTTVRASTPMYLLSKLVKQYVKVILSGEGADEVLGGYLYFHNAPSAAEF
                     QRETVRRLRLLYTADVLRGDRSTAAHCLELRVPFLDRDYLDVAMTIDPQEKMCVPGKR
                     MEKWIMRAAFDEHLGPARTRYLPDDILWRQKEQFSDGVGYNWIDGLKAFCESHVSDDE
                     LHNAAARFTYDPPTTKEAYYYRMIFEKHYGSYPSAQSLRSCVHKWIPLWSESTDPSGR
                     AQRVHLANARQENHLKAPQKQERAN"
     gene            complement(<336492..>337226)
                     /locus_tag="CYME_CMM146C"
                     /db_xref="GeneID:16995154"
     mRNA            complement(<336492..>337226)
                     /locus_tag="CYME_CMM146C"
                     /product="probable inosine triphosphatase"
                     /transcript_id="XM_005536984.1"
                     /db_xref="GeneID:16995154"
     CDS             complement(336492..337226)
                     /locus_tag="CYME_CMM146C"
                     /codon_start=1
                     /product="probable inosine triphosphatase"
                     /protein_id="XP_005537041.1"
                     /db_xref="GeneID:16995154"
                     /translation="MQRQRHLVCFSVGLSVLGCRHRHVSAGRYCCCHSRGRFRAVSTR
                     TAMLTGLSQHKPLTFVTSNEKKLAELRAILRDLVGMEVTIEARHIDLPEIQGEAEDIA
                     REKCRYAARAIQGPALVEDTQLCYHAFGGLPGPYVKYFLRNLGPEGMEKLLAAWDDKR
                     ATAQCIFALAVDADAEPHLFTGQTLGRIVVPRGKRNFGWDPIFQPDGHEKTYAEMSEG
                     EKNAISHRFRAASRLAEFLRNHYTTR"
     gene            <338626..>339459
                     /locus_tag="CYME_CMM147C"
                     /db_xref="GeneID:16995155"
     mRNA            <338626..>339459
                     /locus_tag="CYME_CMM147C"
                     /product="similar to signal recognition particle receptor
                     beta subunit"
                     /transcript_id="XM_005536985.1"
                     /db_xref="GeneID:16995155"
     CDS             338626..339459
                     /locus_tag="CYME_CMM147C"
                     /codon_start=1
                     /product="similar to signal recognition particle receptor
                     beta subunit"
                     /protein_id="XP_005537042.1"
                     /db_xref="GeneID:16995155"
                     /translation="MQPRLPRPARAVLDTFAKCDFADWLCLQQHWSEQSTTDRGLVVR
                     WLVAVGVLLASVLVVLYNSRRRRRRLPLVVLLSCPSAETVASGAGKTTLFWRLWKGQL
                     PRYAPVPSQQPNEAVVTLDDGVRFLLVDLPSDARARGTWGRFTSLDKLNAAAVVVVYV
                     VDAKTDSLTREAEYLFRDIDVRALLQRGTTCVVLANKADLRTAMPAKVFLARWMREVE
                     RLGHSRTNSLTPVLVDESTIAQIPSLRREQRLMLVHGSAKTGDCLPKLYTVIRSAVRH
                     R"
     misc_feature    complement(340629..342343)
                     /note="possible transcribed region"
     gene            342947..345153
                     /locus_tag="CYME_CMM149T"
                     /db_xref="GeneID:16995160"
     misc_RNA        342947..345153
                     /locus_tag="CYME_CMM149T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461451.1"
                     /db_xref="GeneID:16995160"
     gene            complement(<345748..>349347)
                     /locus_tag="CYME_CMM150C"
                     /db_xref="GeneID:16994851"
     mRNA            complement(<345748..>349347)
                     /locus_tag="CYME_CMM150C"
                     /product="similar to I kappa B kinase complex-associated
                     protein"
                     /transcript_id="XM_005536986.1"
                     /db_xref="GeneID:16994851"
     CDS             complement(345748..349347)
                     /locus_tag="CYME_CMM150C"
                     /codon_start=1
                     /product="similar to I kappa B kinase complex-associated
                     protein"
                     /protein_id="XP_005537043.1"
                     /db_xref="GeneID:16994851"
                     /translation="MENLGVEEVDLIELRDSIQCSARGKHQNQCWRLLRRASEPCVTA
                     AVLDAERLRVALCELHVLSGTRSSRDLPLSTDVQNASLLGIFWSTALAQFVAALTSGH
                     LIAENEPVGLVPEGLLAVEASPSQDVVVLVSTRGELLLMDAELNVIERGTLSEPLSPG
                     LSWPTAEDSHIIRVAWRSDGNLFAVSYPGQDQRVHVDIFRSPSLRREATAHTEPLVAK
                     PTDAQRTPPALDLVLCWEQRPGGMLTVATRDGDVVFFERNGLRHTRMDMHRKLTSKRR
                     IWGLSWNANDMLLAIGYTNLATDAPDSCSRKRIDLYSFRNYHWYLKYRLELGSSDFAD
                     NDHVWMAFDFTDPLLLYVYSGTWASPHERMLRLYRLQWTISLNAERDDTLAVIDGHRV
                     LLTPLRRCVLPPPLYAFDACIPANEADDTIQYVLWEKDSLFAISSLGRWYWLRRDGAL
                     VAVQAPIPAVADAAAKQVPARDELVWNPELGMFMIHPIRSISLAGGRLLYRRRSRLLQ
                     WQPSNESSTEPARTISTDCLSVAVVSSENLIFWTTPSGSLRYHELGIELDAAAERRYR
                     TESERVVDRGAILVAALGDALRLVIEAPRGNLETITPKICVERKIRRVLRSALDANQK
                     PDMIALLQLARKHCIEPRFVVEAYGPKRLADDTDWFLQQILNAWSEAHVAEILTQLIV
                     SLNEKEDVYRHLVAGFVAQMHAVDPERFFQAILTAYITQRPQADIDAALKLVSKRFSA
                     ESLRYISTIARKPIQELYRAALGIYDLDLAAKIAVAGRMDRNLHEPFLESLRQVTPEA
                     LRRYEIDMFLTRPRAALGHLLEARKVLGPQVDEKICRLVEQFDLHHEAYIEVEKIEHE
                     SLTQGLWHELALRWATRLENKGAHLQAAHLYAMHGALEQAAEAYLAGGQAPLAIAAYL
                     QKDHLIGNEHDFVSFLRRLVETLCNQCQWEVAAQILAGSPLAQPEEALQLLLDAHRFQ
                     AALRLLTTQGRGDWLRERLRPAVISAAEERTTEIRTSAAKYHERAVRLQLVREHRQQL
                     QLRSTGDFKNPNVVTGADTDSEVDAIASEIASMSTFTFGTHSARSKSSSSSSSNSSNI
                     HSGMAASERSAAGKATAKTRKKTKRKIKPGDPHEELFLVEYLRRLEPTPALRETVQEI
                     AECLLICGEYRLVTALQRAVKELDETIANWKRTLGVVPERPLSPSTPNGISTY"
     gene            <349617..>350984
                     /locus_tag="CYME_CMM151C"
                     /db_xref="GeneID:16994852"
     mRNA            <349617..>350984
                     /locus_tag="CYME_CMM151C"
                     /product="probable histone acetyltransferase GCN5"
                     /transcript_id="XM_005536987.1"
                     /db_xref="GeneID:16994852"
     CDS             349617..350984
                     /locus_tag="CYME_CMM151C"
                     /codon_start=1
                     /product="probable histone acetyltransferase GCN5"
                     /protein_id="XP_005537044.1"
                     /db_xref="GeneID:16994852"
                     /translation="MPSKRKQPTAKQTVKTEPAGSSQVSASFKAEPESKTPPPEEEEE
                     DFRVEPSCEVPRARNPIQPDYPGAYTMSSEDIIGTDSHLAYVSRWHRMREEERRGSVC
                     FRVVTNDGSRPALVQLLGLKNVFVRQLPNMPRPYVVRLVFDRKHESLIMIKKLPSGEE
                     VVMGGCCYRPFSEQRFAEIAFLAISHSEQVRGYGTRLMAHTKERAKALQLTHLLTCAD
                     NNAVAYFKKQGFSKIITLPPERWQGYIKDYEGIVLMECALNYKVDYLNIPPLLKAQKL
                     CLLEKLREVSRSHIVYPGIDVKKMKGIRIEDIPGLQHVDLDRVPPPTAAHGTRSGVSS
                     AKPLTAAAAIARERDPVQLAALQKELQQVLNQIKSHSSAWPFLEPVDPQETGAYNYYE
                     IIKNPMDLRTIQERLDSGWYYVNRDIFLADLNRMVKNAIDYNGPGHYISELALSLKRF
                     YSSKL"
     gene            complement(<352185..>353081)
                     /locus_tag="CYME_CMM152C"
                     /db_xref="GeneID:16994853"
     mRNA            complement(<352185..>353081)
                     /locus_tag="CYME_CMM152C"
                     /product="ribonuclease P protein subunit p30"
                     /transcript_id="XM_005536988.1"
                     /db_xref="GeneID:16994853"
     CDS             complement(352185..353081)
                     /locus_tag="CYME_CMM152C"
                     /codon_start=1
                     /product="ribonuclease P protein subunit p30"
                     /protein_id="XP_005537045.1"
                     /db_xref="GeneID:16994853"
                     /translation="MVRGAFWDLAVNVRHGHTTVGDVRALITAAKESGYRGIALNTTV
                     SGRLEPGHACSTRALVVVDPELAGTQAPLDATSPVNTVLTPSFRPAFRVLHRLTVRVQ
                     EAADLYVFNAANESLLSYDILAVEVSEEKLLQQAMLLDCIDLISFPSATRASFQLKRT
                     QVHACAKRGILFELSLASLLTRDQVARRYALQNSRTVCQRTNRGSRCVLVSGAESPMQ
                     MRGPLDMANLACVLFGMSEANSIASVSSFAEFVIRHAEYRRVTGGKGACWIGKIASPE
                     AVPRMDDTETVQNSKSEDHGSA"
     gene            <353421..>354833
                     /locus_tag="CYME_CMM153C"
                     /db_xref="GeneID:16995158"
     mRNA            <353421..>354833
                     /locus_tag="CYME_CMM153C"
                     /product="similar to mitochondrial magnesium transporter
                     Mrs2p"
                     /transcript_id="XM_005536989.1"
                     /db_xref="GeneID:16995158"
     CDS             353421..354833
                     /locus_tag="CYME_CMM153C"
                     /codon_start=1
                     /product="similar to mitochondrial magnesium transporter
                     Mrs2p"
                     /protein_id="XP_005537046.1"
                     /db_xref="GeneID:16995158"
                     /translation="MRVLERLFWRSERAGRPQGSSLDQVPGNESQALGDLSGELEHPR
                     SGFRDELAVRDSTHAHSDNSGGTGTDRAIPALSKRLSGGGASGESTTMVRAFPEHQRL
                     KAFQELECLAFDEKGNFERRAVSRLELLRAARSVQSALIDYPPLLSDSGDDLSQEQIA
                     KLMKRRQKRIHEYRQNFLQIRDLRQIDPSFASKTALWVRQNVLIISLLHIRALIFADR
                     LLLFDPDAPEVQETSLVIRERLRSVPVDRDVYAPFEFRALEACFICVCNALERELGAF
                     EPYLMQLLEDLSRESTMQKIESLRMLKLRLNGFLAKAQDIRQTLKSVLDEDEDMARLY
                     LTELRKQHGKPRTTEDHEAAEQLLESYLQLVDHVHNRAELLDAATSDTEDLLSIQLDA
                     MRNRLLVLDMSISVVTGAFSWADVVIGLFHMNLQLPIYGENGGSVGWFIGVVFVMLAW
                     ALLLVAIMFTWIRRSGLWHA"
     gene            <358310..>361657
                     /locus_tag="CYME_CMM154C"
                     /db_xref="GeneID:16994854"
     mRNA            <358310..>361657
                     /locus_tag="CYME_CMM154C"
                     /product="unknown metalloprotease"
                     /transcript_id="XM_005536990.1"
                     /db_xref="GeneID:16994854"
     CDS             358310..361657
                     /locus_tag="CYME_CMM154C"
                     /codon_start=1
                     /product="unknown metalloprotease"
                     /protein_id="XP_005537047.1"
                     /db_xref="GeneID:16994854"
                     /translation="MTAWKQLAAVDVGTVRQKVTVEKHRSTTSGITVYLAQVPGPLVC
                     GTLVFATEAHSDAGEPHCLEHLVFMGSESYPYKGVLDLVANRSLAQGTNAWTETDHTA
                     FTVETVGARAFLHVLPVYLDHLFFPLLRESAFRTEVYHVVGETCADAGVVYSEMEARE
                     NTAESKGLLRCLRSLYGEPARCGYAAETGGILDEIRQLTNERVRAYHQQFYRPDNFAL
                     FVSGVVDRDLLFATLSRFEQRLVSVFTATHRRPWSERVPPAPRFGLVRERVLFPAERA
                     DCPDEATDDTGIVFIGWRGPPIHDLVMRTAIEVMNDYLSESGNAPLQEALVECSDAFC
                     NDVSFMQMDFRITANILQVENVPMHRLDDVFDRVMGILEVTHEQGIDVNGRLRTIIER
                     RRRQFFAALEDGANDAILSLLIPEFLYNDQDDQGYFRQALDMPGVLAHLAALDESFWR
                     EHILRRWYLPGDGDHGASLVSCIVCQPSKDEANRLRTEAALRIQERLERLSAAERVAL
                     GQRLQESVAEHQVSIPESLVPVCSGLLDPASISRFRVETIRIDDVGSGVRLQIDDVDS
                     EFVRLTALLDTRGLSGRQRLLLPLFLETLFNTRVGERDHRAVRDALLADTVDYGCAIG
                     LSKEGGDAGAGFAIGAFSQLISVTIKSERALYETCVHWLYDILYRSQLETNRVRIAAQ
                     KLLNDVAQHRRDGSALVAWLSNEVLYGANDEANIPAMAPFRQRHLLRQVLKLLGENRN
                     DRDEDEHDDDDEHDGDMKYDDCGEAHSFDAPERVIPSTLHHRADEMPSRVWTANALAT
                     DASASPDWSRTTGTSQRYSMTALLDELEALRRSLTSPGKVFLHAVLHCDERLDALLEP
                     WKQTFGVISGMLPNGNGPLPAHPQLVQFSHEVRPSASVPRRCIVAGVDGVDSCYAKLI
                     SDGPKSFLDPDYPLYLVLFELLDALEGPLWRDIRGAGLAYGYNLGCTPESGTVSLSLY
                     RSTAFEGALSAALGVLERFHQQPQELIDENTVASACSGVLCTLLNQESTVEAAAFQRL
                     CNSCRGFEGDYTGELLAKVINVTPAKLTEFATRVLAAFRLEHCLVTVVTNPAKAPAAM
                     EVLQSRGALRTTCVDSLDDFFALEKTV"
     gene            complement(<361964..>362719)
                     /locus_tag="CYME_CMM155C"
                     /db_xref="GeneID:16994855"
     mRNA            complement(<361964..>362719)
                     /locus_tag="CYME_CMM155C"
                     /product="probable pyridoxine 5'-phosphate oxidase"
                     /transcript_id="XM_005536991.1"
                     /db_xref="GeneID:16994855"
     CDS             complement(361964..362719)
                     /locus_tag="CYME_CMM155C"
                     /codon_start=1
                     /product="probable pyridoxine 5'-phosphate oxidase"
                     /protein_id="XP_005537048.1"
                     /db_xref="GeneID:16994855"
                     /translation="MFCRCVNTVQTRTRLARWTAHSLRWRATMTDEVAKLRVQYSNTP
                     LTEEEARAAGSPMHLFQKWFDEAIRVKSYEPNAMTLATATPDGVPAARMVLLKGLDLE
                     RATFTWYTNYESRKAQELDRNPRAALVFWWPELERSVRVEGSVERLSTADSDAYFASR
                     PLGSRLGAWASAQSRPITSREALERQAAQVEERFANGEVPRPPHWGGYRLHALRLEFW
                     KGRANRLHDRLLFERDSKSSDHDMQWRMTRLQP"
     gene            complement(<365469..>365750)
                     /locus_tag="CYME_CMM156C"
                     /db_xref="GeneID:16994911"
     mRNA            complement(<365469..>365750)
                     /locus_tag="CYME_CMM156C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536992.1"
                     /db_xref="GeneID:16994911"
     CDS             complement(365469..365750)
                     /locus_tag="CYME_CMM156C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537049.1"
                     /db_xref="GeneID:16994911"
                     /translation="MCLVTRFKMRDGHYEVGPGAFFDWLREGCPKREECAPTPTRTPR
                     SSTVGSAGAPGRDSIEDMRAYLDMNMHDKHNTGAPVAVETEDMDTSGRK"
     gene            <367696..>368139
                     /locus_tag="CYME_CMM157C"
                     /db_xref="GeneID:16994912"
     mRNA            <367696..>368139
                     /locus_tag="CYME_CMM157C"
                     /product="similar to pterin-4-alpha-carbinolamine
                     dehydratase"
                     /transcript_id="XM_005536993.1"
                     /db_xref="GeneID:16994912"
     CDS             367696..368139
                     /locus_tag="CYME_CMM157C"
                     /codon_start=1
                     /product="similar to pterin-4-alpha-carbinolamine
                     dehydratase"
                     /protein_id="XP_005537050.1"
                     /db_xref="GeneID:16994912"
                     /translation="MYVALIAQWQRRILVDTALRRMSSCTLGTPRRDVSREARCVPCE
                     GIGSALSAEQVAELVATKTPQWTTTPDTKRLHRTWVRPNFKDAMEFLNRIADVAEKEG
                     HHPDLHLTNWNRVRVELWTHALGGLTENDFILAMKVDEIAEQGQK"
     gene            complement(<368604..>369734)
                     /locus_tag="CYME_CMM158C"
                     /db_xref="GeneID:16994978"
     mRNA            complement(<368604..>369734)
                     /locus_tag="CYME_CMM158C"
                     /product="chloroplast ascorbate hydrogen peroxidase,
                     precursor"
                     /transcript_id="XM_005536994.1"
                     /db_xref="GeneID:16994978"
     CDS             complement(368604..369734)
                     /locus_tag="CYME_CMM158C"
                     /codon_start=1
                     /product="chloroplast ascorbate hydrogen peroxidase,
                     precursor"
                     /protein_id="XP_005537051.1"
                     /db_xref="GeneID:16994978"
                     /translation="MRILSCSLLRNGYSGIRSSMNSGQIAFSNAVSFPSLRSIQVRRI
                     SSVSVRSANKVRFSSYFVQREAYRGAAVLRLNTQAPTRRLVTMAIDTQTMTSVRNDLV
                     EMIKRTKAMPILVRLAWHDSGDYDARLGTGGANGSIRFNKELQHGGNVGLPGALNLLK
                     PIKEKYPNVGWADLIQYASVLSIEVAGGPKIPFRFGRVDAQSENEVPPEGRLPAGGPP
                     FHKAEGENPNEPAPDKEDAAAHLRRVFYRMGFNDQEIVALSGGHTIGRAYKFRSGFGA
                     GEEGTKYTRAVSGVTKGGSSWTPDWLQFNNMYFKVLMDPNADPELLKLVTDKALVEDP
                     EFNKYVKIYATDEAKFFEDYANAHKKLSELGSKWDPPGGIPA"
     gene            373387..373466
                     /locus_tag="CYME_CMM159R"
                     /db_xref="GeneID:16995012"
     tRNA            join(373387..373419,373432..373466)
                     /locus_tag="CYME_CMM159R"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:16995012"
     gene            <374009..>376090
                     /locus_tag="CYME_CMM160C"
                     /db_xref="GeneID:16995129"
     mRNA            <374009..>376090
                     /locus_tag="CYME_CMM160C"
                     /product="similar to TFIIH subunit TFB2"
                     /transcript_id="XM_005536995.1"
                     /db_xref="GeneID:16995129"
     CDS             374009..376090
                     /locus_tag="CYME_CMM160C"
                     /codon_start=1
                     /product="similar to TFIIH subunit TFB2"
                     /protein_id="XP_005537052.1"
                     /db_xref="GeneID:16995129"
                     /translation="MPSLVSIPEPQRTGSEASDKAWSATSSLVDYVCRLDERSIDMLF
                     TACDLTVFGILRALPPLAKIILFRFLALSDYVQEIPAHIVTAWIADPRTEERNDPVWG
                     HTSRTSAKSTSAFPDSERERNLIVSRILHVLTRLRFLRRTVQEQPSNGTSQELVTYAL
                     PPAIREHLLRYLWATTNSQENLEGACTPRRSSASSVDASTRASWIRLLEPFQRIANAS
                     DGRIPTRLTAPQLREYTRHAWEHVLHFVIGIPVAEPEIRQPTGPEHTPEHVMEPPSDE
                     VIEALLSLGVSEQVGSDGMRITERGFSYLLLDIHAQLWALLEAYMENWDEARGDRLEL
                     FDLLFRLGFSVPGHIYDGGDPSLSAAQCRMLGFLAEIGLVYLMETEQSRQDGDNDEQL
                     VIRRRRPGRPLYLHATSTKDSRRSPDGQARFTSSPLQPLGSLMDANDRVATNISAAVP
                     GKNDLTFDRRVAALLKKHSSRVLFSPTPLGTQLMMGPALDPVVAREQPDAVPRHAEIL
                     IESEPVLATPSAGRRPSLGRSILSGSPFQIIVETNFRLYAYAASSFQVALLSLFTRIL
                     YRMPGVAIGVITRDSVRRALKCGITAKQLLHFLGIHSMEGKSVPFNVHDQILLWELER
                     KRIQAYPGVLLEGFEPTSDGRAFFDQLQEYTVELGAQQWCDRVRQLLVADASSFERLR
                     EWIRRQAQTLS"
     misc_feature    complement(374723..376421)
                     /note="possible transcribed region"
     gene            complement(<378800..>380125)
                     /locus_tag="CYME_CMM162C"
                     /db_xref="GeneID:16995007"
     mRNA            complement(<378800..>380125)
                     /locus_tag="CYME_CMM162C"
                     /product="adenylosuccinate synthetase"
                     /transcript_id="XM_005536996.1"
                     /db_xref="GeneID:16995007"
     CDS             complement(378800..380125)
                     /locus_tag="CYME_CMM162C"
                     /codon_start=1
                     /product="adenylosuccinate synthetase"
                     /protein_id="XP_005537053.1"
                     /db_xref="GeneID:16995007"
                     /translation="MASDLPGGATVVLGAQWGDEGKGKLVDLLAQRADVVARCQGGSN
                     AGHTIVVNGTKYALHLLPSGILNPKVLVVIGNGVVVHLPTLFAEIDQLEKQGVPNVSA
                     RVCVSDRAHILFDYHQIADGLLETERAGTAGGSIGTTRRGIGPCYADKAYRRNLRIAD
                     LREFRGIEFEAHIQSAVEDLRKRFGSAAEQALKHYDVRAEVARYYEYARRLEPMIGDS
                     FTLLYDMLANGQHSILVEGANAAMLDIDFGTYPYVTSSNCTIGGCLTGLGIPLAYIRQ
                     VIGVVKAYTTRVGAGPFPTELLDARGIQLQQLGQEYGTTTQRPRRCGWLDTFLLRYTC
                     RLNGFTALCLTKLDVLSCFHEIQIGVQYWYRGKKLQGMPASLRELAECEVEYEQMPGW
                     HEQSLSEIRDFADLPRNAQAYVKRIEELVGVPVRFIGVGPGRDAIIYRD"
     gene            <382095..>382487
                     /locus_tag="CYME_CMM163C"
                     /db_xref="GeneID:16995008"
     mRNA            <382095..>382487
                     /locus_tag="CYME_CMM163C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005536997.1"
                     /db_xref="GeneID:16995008"
     CDS             382095..382487
                     /locus_tag="CYME_CMM163C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537054.1"
                     /db_xref="GeneID:16995008"
                     /translation="MNRNDQAVAQVAALKNLIEQVRSKEDQWTKQVARKRSLLAQLQE
                     NEFVREELTLVERDPGARLYKLHGPCLLPKRRADVADNVKQRQDLLLGEIRRVDGVIS
                     NLERELQELQQRLREAQRQLTTPATTTA"
     gene            complement(<383519..>386557)
                     /locus_tag="CYME_CMM164C"
                     /db_xref="GeneID:16995009"
     mRNA            complement(<383519..>386557)
                     /locus_tag="CYME_CMM164C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005536998.1"
                     /db_xref="GeneID:16995009"
     CDS             complement(383519..386557)
                     /locus_tag="CYME_CMM164C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537055.1"
                     /db_xref="GeneID:16995009"
                     /translation="MHLRSHSRRCFSQCRKKRGIIRKRLLAGGFLLVLVLLLSRWLGR
                     GPLRASPGSTEPEKLRVVGKLNNLVRPGHTGHLIEVLPTTGSLGVVIARFHDKRGQVQ
                     ELFQGCFAVRKTDTSTANAAPQPVYVRVCPADEEKVTTSEELAETSSEYESLELWRHS
                     LRSSPQESIWRRVGSGECLGVDTKTWQLVLGLENCIVWDEREKGTLSAGQIRLELQAP
                     LLRLDRLRAKSLRNKRSNNVASANLPSAFKEVPEVLPWPLGAQTVRLESRTGRSTKAL
                     LLALDAPRLDVLAAISPAFRERHRSTIGMVTVRRYVPLSRYTPEDLQRTRFPPERMPP
                     VDPKDRTIRYPAPASNVSSQHQTLAGHYVETKVERKNRTLCLSVTSLADRTVDLLPCE
                     SKHDDPDGQHQVWNRDGQRIYTALSHELCLDTETQRKLLPCPLRNVTCGGVYATVASV
                     ILSFWRDPVYMPTAAAASAAALSVDAAGMPSLSPEHEFIDKLHLFASNYPPDDEYLRV
                     FRHNPTRINIHRWDEAFRDHLETSGAMPLERIQQSRHAIGTVNYYAALRGLDLFASPE
                     RDLVLLEDDVKAADDAWVNMLHTLRSIEHDLDSLAQAPNRRYSFPPNTSYAAQLYVPE
                     KWHDPRLGWPYAFLEHSRIYGTQALVYPAGTRRRMVEHYLRGITQTQDPFLIPKYDLH
                     LHDLDFPFFGLARSAFEHSGCASTGLGAGLHRSRTWTPCELVYSLERLATGTTVQAVR
                     SHVWSGTKRSPPLVTASDLNRVERAPKQPVRFELVVMDDPATETEEIVSRPIARYASL
                     SSLLAAAWADGATTLDRLEHIYFVGDDSGPIAHHQVMSMHPDAAACVEAVVRSPSTPI
                     ASEKILIFLQHQRPLFAEYALAFPDGWFTRLEGLIQRIRSSAAAHTNLPPLVMLGLYA
                     KPSDGASPETVWNTTASNIYLDRASQRRWDDSVCEKLDLVVIAGAAEGKLGLLRQLLG
                     SQRPRTLVELCRILQQSDLISPVLPDVHENANLYPVLETY"
     gene            <386540..>388036
                     /locus_tag="CYME_CMM165C"
                     /db_xref="GeneID:16995068"
     mRNA            <386540..>388036
                     /locus_tag="CYME_CMM165C"
                     /product="similar to adenylyl cyclase-associated protein
                     CAP2"
                     /transcript_id="XM_005536999.1"
                     /db_xref="GeneID:16995068"
     CDS             386540..388036
                     /locus_tag="CYME_CMM165C"
                     /codon_start=1
                     /product="similar to adenylyl cyclase-associated protein
                     CAP2"
                     /protein_id="XP_005537056.1"
                     /db_xref="GeneID:16995068"
                     /translation="MRTQVHVLVLEQTPTGILGKAQTIHPVLGESCAGVALRSPPSGR
                     VSKLLNFSSTACSIMTSSSLQEWLQEPSKRLQIEADTNCCKSKPEVALLNDAVVSTSA
                     LLEAVGRGGTTGSETVGATRAKLEKRVYFQIAQCASLGPDSPVAVVAKALRFYEVEEL
                     DALFQRCLQELARLPLREGRTPAYVACVRDWLEALQSYAQRYREGACSRLVPEDVSTP
                     NTQPETATEQSGETLSFAAPTPPPTPAADEGQSSRLSLEKMAPGTVSTTAANREALLS
                     QIEAAGDAITTVLRPTRAVPAKAPAATEPVRCEPAPPVTTVPTQQKSHESGETPLLLF
                     ERTANRWRIEHFRALSAEPLQVSICHPRETVYVYRCEKQSIKIRNKCNTLMLDACRDV
                     VVLFESVVSAVEVVRCSKCRLHFTGCVPSISIDNCDSIVLYGMPGQVITCCATAVTIV
                     EPDGDTERETPIPQQFITRRQSEEAAAAARTETAHRWVTEPLKHSGAE"
     gene            complement(<388014..>389642)
                     /locus_tag="CYME_CMM166C"
                     /db_xref="GeneID:16995069"
     mRNA            complement(<388014..>389642)
                     /locus_tag="CYME_CMM166C"
                     /product="phytoene synthase"
                     /transcript_id="XM_005537000.1"
                     /db_xref="GeneID:16995069"
     CDS             complement(388014..389642)
                     /locus_tag="CYME_CMM166C"
                     /codon_start=1
                     /product="phytoene synthase"
                     /protein_id="XP_005537057.1"
                     /db_xref="GeneID:16995069"
                     /translation="MWQLCLDPHISRSSSPVEEGCCTQRVEKATRRRRALQRARHTMY
                     CRRVWTAHLEARSARDSDWKPSSGQTSDPRQLKGEWRSSAGRDASKAENAGQSQSDDC
                     NSVANGASRGAPKTWSGEALHPYGILERAVRSFRTSEPAGSRAQDTVDEVFAKQPGAW
                     ETPPLSSPTNEGLDAADALLANDASMGGSFLTLPQTTPKRVFPWDTTTGVIGLSHFER
                     QVAFYRRRQRLLQQAYKECGRITSIFAKTFYLGTLFLPKRKRDAIWAVYVWCRRTDDL
                     VDGPRVRQRDASLRQKLSEWESRLEQVWAGYPQDALDLALADTVRNYPGLRIDPFRDM
                     IQGMLMDVDRARYETFDELYLYCYRVAGTVGLMALPILGVDPEHCKSEAEAVESALAL
                     GIALQLTNILRDVGEDALRGRVYLPQEEMRYFGYTEDELFASVVNDRYQELIKFQIAR
                     VRAYYRTAECGIAKLHPSARLPIRASLDMYRQILDAIEENDFDNFHRRAYVSKLKKAL
                     TLPVSCLRVQETEGTWLGRLWGPFDRGFIQRPNV"
     gene            complement(<391636..>392658)
                     /locus_tag="CYME_CMM167C"
                     /db_xref="GeneID:16995075"
     mRNA            complement(<391636..>392658)
                     /locus_tag="CYME_CMM167C"
                     /product="glyceraldehyde 3-phosphate dehydrogenase"
                     /transcript_id="XM_005537001.1"
                     /db_xref="GeneID:16995075"
     CDS             complement(391636..392658)
                     /locus_tag="CYME_CMM167C"
                     /codon_start=1
                     /product="glyceraldehyde 3-phosphate dehydrogenase"
                     /protein_id="XP_005537058.1"
                     /db_xref="GeneID:16995075"
                     /translation="MAIPKVGINGLGRIGRLVLRAAVEKGTVEVVAVNDPFIFPDAGY
                     AAYMLKYDSTHGAFPGEIGTDGEHLVVNGKKITCFAIRDPAEIPWGSTGAEYVVESTG
                     VFTVTEKASLHLKGGAKKVVISAPSKDAPMFVMGVNHDTYSKDVNVVSNASCTTNCLA
                     PLVKILDEAFGIENGLMSTIHAVTATQKTVDGPSNKDWRGGRGAFQSIIPSSTGAAKA
                     VGKVYPKLNGKLTGMSFRVPVADVSVVDLTANLKTPTTYEEIKKVMKEAAASPKYKGI
                     FAYTEDPVVSADLVHSSFSSVFDAEAGIMLSPTFVKLVSWYDNEWGYSNRVVDLITHM
                     AKVDSA"
     misc_feature    complement(392784..395519)
                     /note="repetitive element"
     gene            <396689..>398047
                     /locus_tag="CYME_CMM169C"
                     /db_xref="GeneID:16995076"
     mRNA            <396689..>398047
                     /locus_tag="CYME_CMM169C"
                     /product="probable calcium-binding mitochondrial carrier
                     protein Aralar"
                     /transcript_id="XM_005537002.1"
                     /db_xref="GeneID:16995076"
     CDS             396689..398047
                     /locus_tag="CYME_CMM169C"
                     /codon_start=1
                     /product="probable calcium-binding mitochondrial carrier
                     protein Aralar"
                     /protein_id="XP_005537059.1"
                     /db_xref="GeneID:16995076"
                     /translation="MDAQKVTASAPYASRLDPRTAGVSFPEQGDVQSPAENEGSAVCP
                     PRQTSLGTKSLGANILFGGLAGVTGTTIIFPLYTLKTHLMTDTGSRECRGSSESAAVY
                     NTASKAEPVRGNAVSTGTANPTSSTGPALATEAAKHTSTLAVKDTACTDSHAKLPTVE
                     AAAPARSSKVASNGSRGPAAASQSTLASTPRTNALKAASLLKRRPRLVETLQQILRSQ
                     GVRGLYRGLTPVLIGVAPEKAIKLAANDFFVSEFKERSPNPHGPLSVKQGMLAGAGAG
                     LCQVIATNPMEVLMITMQTRAAHGHPQHSVTDTIRMLGLRGLYRGVSATLTRDIPFSM
                     VFFGMNTSLKERLSLHYQGGLPMRIVFGVGILSGVTAAALSTPFDVVKTRIQSGVRDR
                     HGRSYHSVVNTLVRVVREEGFRALWSGAVPRVMIVGPLFGITLLFYELQQRLAQSAHQ
                     RT"
     gene            complement(<398982..>400109)
                     /locus_tag="CYME_CMM170C"
                     /db_xref="GeneID:16995077"
     mRNA            complement(<398982..>400109)
                     /locus_tag="CYME_CMM170C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537003.1"
                     /db_xref="GeneID:16995077"
     CDS             complement(398982..400109)
                     /locus_tag="CYME_CMM170C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537060.1"
                     /db_xref="GeneID:16995077"
                     /translation="MDPEPNSLCWSVLNGNNHVGGPTRTVPSFVTRVVRPSPAYGRSG
                     RRCAVQKSGCESAALLPRKRWRRWRPYTSRSASVAPAVVQAVSEPSPGSEDAERVPRS
                     DDDVDVQVSASTEALAERLLSEIHRRLQESLEGQLRVELARQRAIDRIDLLVAVELVK
                     LREKLQLLFDSYRERLTLRTEEMDRRANELAPSWAQVEERLEAAQERARVLRQTQDEI
                     ESLLRGSPHTPVPRSGAAPKHAERTSLVWFDESAGAALPSRQALQQGSAWRLEEEQAL
                     SPYWVFFYGWLSALAGLEASMAVSSAHGVSAYTALSGTVCLLLLGHAVRLGWAARRQH
                     QATRGQQPALPSCRVVSSGTQAATTPSTEGQTEPTSLQQSE"
     gene            <401438..>402715
                     /locus_tag="CYME_CMM171C"
                     /db_xref="GeneID:16995121"
     mRNA            <401438..>402715
                     /locus_tag="CYME_CMM171C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537004.1"
                     /db_xref="GeneID:16995121"
     CDS             401438..402715
                     /locus_tag="CYME_CMM171C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537061.1"
                     /db_xref="GeneID:16995121"
                     /translation="MGSGEGTTGRANVIYNFAIGSNVNTERLRTRARWLGDQAEIKFL
                     SAEPAVLRGYRIVFNTPGFPPAEAAFCSVRACECGGGRRCPSEVHGVLYAFDRASYEL
                     LWVTEGGLGGREYGSSYVERRVHVETYRRPGVLHEAIIFETRPSRTVETWYRRWLRRD
                     VYRRRWLASEFRCIATSAMGALEQELAAQRVANAADQVASTSWLPKNGSAALPLWYTQ
                     HAHVLEVTQALPQDHSDRIALEMERVLIRPSMRYLGLIRDGALQSGLDADYRRLLETY
                     MVHWRVSCPCAARPQPLQGWLTVSVNMSTPGFFRWLWWAHLTGRKRVLRFLYQLWNRW
                     FLRVLSFFAMERELHAMRLAQRTHACIGKPQVLLHWVAVYFCSVIILIWTLPIALAGL
                     LYGKGNFFHVRPSTPALVPGNAAPAARSANVHA"
     gene            complement(<404596..>405747)
                     /locus_tag="CYME_CMM172C"
                     /db_xref="GeneID:16995122"
     mRNA            complement(<404596..>405747)
                     /locus_tag="CYME_CMM172C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537005.1"
                     /db_xref="GeneID:16995122"
     CDS             complement(404596..405747)
                     /locus_tag="CYME_CMM172C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537062.1"
                     /db_xref="GeneID:16995122"
                     /translation="MVETVGDRAAITELARALRARRVRRLVCRFDTELLVSAPKLLWL
                     LQDELWRQAQPDESEIELFLSLEQSGPLEREEVSGLRASADALIYFQATDEGRRVLSD
                     LPVIYVDRSLRLVCESRIREREASATQLPDRFLRKRFAVVRSTRETARIFGLLTVNLS
                     LPFCLEAVTRVQELLQRNERNVYCLHMTSLTPEKLANFAEIDVFVLFCDLGYFRAIAS
                     CLDAYWKPIITPYETCIMCSIADEAALASACTDPARYTFNLEVIAGWSLPSSSSSSSS
                     SSSSAAGAHQHDPHSNEQISDCAAVGTLRDSAVLSVNEAHGSDFAGGRLQRRGWRGLE
                     PAAATAISHRALPGRAGRASAYDDERQRIERQASGERSAQGLSDHIESQ"
     gene            <406653..>407795
                     /locus_tag="CYME_CMM173C"
                     /db_xref="GeneID:16995169"
     mRNA            <406653..>407795
                     /locus_tag="CYME_CMM173C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537006.1"
                     /db_xref="GeneID:16995169"
     CDS             406653..407795
                     /locus_tag="CYME_CMM173C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537063.1"
                     /db_xref="GeneID:16995169"
                     /translation="MVQVELPVVDISSYRCYHNETGSANSSNASLPVDIERECFCIAQ
                     ALARYGAVVIRDTTVSAEENNAFIELMASYFAHPDKAEDARPQLNYQVGWTPAFTERP
                     RPIPADFHGDAPVTPRPQSVPPITSQDPKERFLWRIGPRPATSRFPEQNAPPVVPRRF
                     AERWSQIMDRWGHRLLDAIQLVAEMVALGLGLGRDAFTSRMKDGPHLLAPTGSNLSGL
                     LDRPNTVLAGFHYDLCFLTIHGKSNAPGLYLWTREGSRFPAKVPPGCLLVQAGLELEW
                     LTGGLIQRGYHEVVADEAALALAKAHMEQQHDATGKQRRPFWRISSTLFAHIASDQVL
                     EPLAGLAGVTDSSRVKYPPILAGDLVRRELMAISLCPSATATDTAS"
     gene            complement(<410637..>412193)
                     /locus_tag="CYME_CMM174C"
                     /db_xref="GeneID:16995170"
     mRNA            complement(<410637..>412193)
                     /locus_tag="CYME_CMM174C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537007.1"
                     /db_xref="GeneID:16995170"
     CDS             complement(410637..412193)
                     /locus_tag="CYME_CMM174C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537064.1"
                     /db_xref="GeneID:16995170"
                     /translation="MDRKRLQQLSAYVHGGCSGLNEATQLWPRRRARASQSSWSRSAL
                     FAKYFIEERNQASGRSRVFLHDEEQRHWRVVPEPPAGTAVTRPENWPQRLVQTLLLPA
                     DYPSAVSSDYDRFWRWNILRHTLLEAAEVLGTQSMLLALGVGGASALPLAAAWKWILK
                     DGLGYFAKVALATQLAPRVDNDPKRFRFYGDFVMALGTLFEMLTLAFPPWFLALASTG
                     NLLRKAADVATGPAYRVFLYHFSIRNNSGDVSSKSESQVVVGRLSGIGAGIAVSAVTS
                     HDASALVMAYGLLSAGHLYATYQSVIRLELRTLNRTRLEYVLNVYTASSGKRVPSIAE
                     ANAAEQKSFLRPWSHVYRIRFVNSLNELLSDPYEGTGQGRPEHLARATISSKSGDGAT
                     AHSTEKPAGWERFLGDPKLRYLLARRARRPYHRTQGRADDFLIALHCDAQVVDILQAL
                     LHVWQSGGRDWPPPDPHPLLGQLREAGWDISRILWYTGSVRLLWGHETASTEALNRGA
                     DKDAARQRYL"
     gene            complement(<415444..>416076)
                     /locus_tag="CYME_CMM175C"
                     /db_xref="GeneID:16994864"
     mRNA            complement(<415444..>416076)
                     /locus_tag="CYME_CMM175C"
                     /product="similar to divalent cation tolerance protein"
                     /transcript_id="XM_005537008.1"
                     /db_xref="GeneID:16994864"
     CDS             complement(415444..416076)
                     /locus_tag="CYME_CMM175C"
                     /codon_start=1
                     /product="similar to divalent cation tolerance protein"
                     /protein_id="XP_005537065.1"
                     /db_xref="GeneID:16994864"
                     /translation="MFCGYFARTKGAHRHWVRLLRCTLWGQGALCTCESAARTVVLVR
                     LRRGIPHSAGHRHALTMSSWQAAKTYVLYASLFVLSFSMMTWFREPKLTAFFRERTET
                     GASAVLALCTAPEAATAESIAQALLSAHLVACVNIVPGVQSMYWWEGKIHNDKESLLI
                     MKTRSELQDAVIDTIRKVHPYQVPEVLFLPIQGGLPAYLDWLHEMTRKSS"
     gene            <416689..>434067
                     /locus_tag="CYME_CMM176C"
                     /db_xref="GeneID:16994865"
     mRNA            <416689..>434067
                     /locus_tag="CYME_CMM176C"
                     /product="similar to vacuolar protein sorting-associated
                     protein VPS13"
                     /transcript_id="XM_005537009.1"
                     /db_xref="GeneID:16994865"
     CDS             416689..434067
                     /locus_tag="CYME_CMM176C"
                     /codon_start=1
                     /product="similar to vacuolar protein sorting-associated
                     protein VPS13"
                     /protein_id="XP_005537066.1"
                     /db_xref="GeneID:16994865"
                     /translation="MWFLGIFQALLQLFLGWLCPGLTLRSLRLHWRRGWLELRNLNVP
                     ASMTRYLPVRLPVRFVRLHVGRLRIKVSWRALRQLARWRVRSRHQGPDPDTRRVSLSF
                     LSELLCIEIEDVGLLCTDDTEAYLESRLERALWKRLQLQLKLAKLQECERLAARVLQL
                     PVMGALESGAAWDASLDAEGNEGQFLLEDARHRPGNTEAPDEAVDITRNARADPVSND
                     RCIVTTQVPHESVLQGSVSTDGACSWTAAPVSSSAAPDGEPAKQLVNATQSEALEASR
                     RTHAHACTPEHTAAAAAAAAAVPNAPSMEDAPSRALASTLEPSDLMRSNNVVSDHGES
                     TVTADAPECTARQHPSAEATREAPDSADASSSSVGDELREPQLPSDTGLLASPAATSE
                     ASTEPHDAPQLSETGASGIATTTGTTEALALDWDAAPFLEIFERSSWIQVFRQVRIRL
                     RRVWIRLEASPQPNGKDHKDMAPAPYALECSLEDAYLEPPDEAFRAQVLERCGLSLPE
                     LDPSEDASYEESVFLWRGCCFRGLRIRFAVDDERWLPLLAQTPQQSRGGSASDEPPLP
                     PLQESDWDWLWRRLRHREPTSYLIADLLLLARLGINMAAFEDTTRYTMDALHQNSLPF
                     AAGAGAGAGAAAADTTTIRLHASIPYVHGHLTLATLFSLTRLAEQLAHWFWRAYLHQK
                     YDVPAERPRRLSPYRLARLPGRRHPARAWWRYAVRCVLGLRRRQRREAALPAALPELS
                     RWLRLQLLYFALYRELVYGESAPKQLFECVMSSLDAVGGHRVCPRENNGALRFRSVSQ
                     PGSGLNLADDSETALPRRLVAQLRYLEERMPLEQLLNARLLVHVHERAKRLQAEAANE
                     KRSSSWSRGHIWRLASTSWQWIRSTVSSWFGTYQLYQVVKQRRESRRALRWIATATEA
                     ASDGSARAEHLSQALVTQASMDSGAGARAPVSAATRAPATDVSAPASVDPGAAAAAGA
                     VGADHQDMDEFLQRLRDAFHEAWVAVFGESGRDAVLFTESLVEAFETSVPLDLEMQLE
                     QASWTLHGIGDSERLPGDLPSCTRAASMPKNNNNENKNKNKSSVSASLLTLRLQGIWW
                     RLHDLGTTSPLQTQVVVRDWEVIPDVVRVQAQTESVFYADLPSTAPSAALYMRLQVQK
                     RVDRRNSTTDALPLLHENGNGGVPGEPAAPGTAQTPLQPRETASHATGCNSLASSTET
                     ESASALYVRLQPLRVHLQTEQLVPLLSLLQEWRACIPRSLAERIAGLMQEHPSRARHR
                     AIEALQLEQRFRVDVFCEWIQVWYASRWLLQLERLSLLRTRSLVKAHFGEAQRDEPQP
                     LLLSIASMHAHFVPQRRGSNAAGRNAAASERNEQVSMSVHPHDAGATISLLEPVPLVL
                     KLFGRLERGQNAAATVATEPRLHIVVSLRVPVRLQLAPVVIGALFEQVRHWQQCWMQR
                     GRRRPWLWGRVQDTRLSPEMRSNAPVWQQLVMIPVVWRQRLATQHAWHRGESALCLGI
                     LGMDAAGSLQLVDASADRLSSIIGMALEFPCWQLEPLHDPLPWPLERASTRGAQLLLM
                     LLRRSTDERPAPVIASPEHGRLGAPESVERTTDSAQLQGSNETTQTGATTGPRADTNT
                     PVSTNARPSRGAAHASSASSSTTTCTASGAVVAFALRFASAAHAELWYRRWRCGKFED
                     PQQQQRYGWWALLHPGYRWCSRSDTIPGAVSAGARTPVLSSEAYPPLLAAVALWIQVE
                     MPHGAVLEMPLGRWTNGWHPAGAHGVAGTRKSMPFSRNADTTPLDCFEVSFSSLRLQL
                     RSACTIVPVDSALVRMEQLSIRLQTRTSSGDTTAGGGTPLIQIPAVSPAATATPQLAV
                     DTARRALWRDPRWRAYVAHDGLWGFADGPSLRTWVSTELWVAFRHPREAPDRTQGFVL
                     IPSVSLLLQSTWMEALIQLCSQIMLAAGPSGELACAGIQRSTLRSSDSPPLHATGAEA
                     YAAASMPKNSWSNRQQRSHMHWQRVRRRLRCWRLASHFWVLLLERSVPVNAPPTCSQT
                     EAERIDAPAAQHSSFLGRTNWESLRQWRHRRSRIATTATASWLPRSTSSGSSPTGCTT
                     TGPTPEDRANAEAAGGADAAADAAEAIATENAAAARRCAAETTLGDTVADPCAGMMLG
                     AAPGERRCGDALTTTTTEQQTGLDGTFQMVLFLAEALVAMRSVSEELGIFAELLARHL
                     DLECCSEDQSSLQLTMKLSGLALRDLLSLRSDTGGELRFYSGTLDEQAVEDESPTAGR
                     ASSGPMSLVALSSSSSSSRATLRDSLRDATAEATLALESAPAGASQETSCTRAALEVH
                     GVLGLDASGSSGASKSSSATSELEQERPVATAAPTSARRRRLQSPEASLRTAVVPGLQ
                     LRMMVNAPEIVYFHPFYALLVQTVYAWRDTLAMVSACQHVQPPVILGASSPTDETSAA
                     AVALAGAVSRKGSARMGPASSSALPAGISDTGQIPNTATAMRLPVHIEIHCIQPRVCF
                     PSELHEASFVEVKLETARLRLEQTALSSPVATSVSAERPFPMLGDAIVASYFEAQTEE
                     VSVFCRLADQERVAVCFLEPVPLLEASIYWTLPTGKLDTGHQVTSPTMGSSQTASENA
                     GTSTGIRRAVTVPGEIPTRSSQTASENAGTSTGIRRAVTVPGEIPTRSSQTASENAGT
                     STGIRRAVTVPGEIPTRSSQTASENAGTSTGIRRAVTVPGEIPTRSSQTASENAGTST
                     GIRRAVTVPGEIPTRSSQTASENAGTSTGIRRAVTVPGEIPTRSSQTAPPAEKRTEQR
                     SSPEPVTLPLEVSDEPVDVTSLVLQAQAAELECHLSPTVIAALELVLLTNLLRSYGQR
                     CFPVSSYEPKRITVELSFERCLLFADATDPELEELWGSSGNVNSSDSTTPLQTETETN
                     TEPAIDASGAVRDTRRSAEQAPSVSSSTASAFSASKIPGSITSSVSEARAPVALPGET
                     SSLGAQQRRYRSRKPATSEPGRNPVSASASSLGAANWSSTGSLRSMVRERSESNESRP
                     VLHSRGNQDSNTRTRTASDTETVPAQVLMDCRDFRGVFALTLPSGASEGHFTLSELQL
                     WSRRDQAERTEEQQDVFAAPTSRALRKPALASSVTLSGSQTPEMAATAAWQLPSATPE
                     AFAAQPPEANTPTLAQHTRKTRWRQTRTGMVLCSGPVSLDLGTQPGHPFRWRFETDKS
                     LQLTMRGISDVAVLEVLTVYTITLGQTTKSLRPYLRLHDLSVESLFGTSGWDMQLELP
                     RLELLLLDQRTFGATMLAGVGIELAMHAALKLSATGKLERLVSGVQEVLFFRAWLAQQ
                     AAPKQNVWHGGSVYDIQCQPYFASIVVERQLTSPRGHEASSSTIQVQLLSEELELRFG
                     VDDLVLCLRTLDGLLNTLFQRLQTARVRRAWYRHRLALRSAAFVSRASGRLGAALLGL
                     ADTDLHHRRFSGSIRSSYSAGGSGAPSIDQERDSEHLDHGARDTDNDEGHAAGNESTG
                     AAATARHLHQRGSSGRRPLGLAAAAVNSGPLKAWLSERLGRRRTVPSAKQAQSLDVHV
                     PRRHAVDAAAAAAAAATTRGIDLEAGLQAKEQQSFLDQSRESGKRRTLASLLRSSLSM
                     DSDAQSAPRPAERIDSTSPRSPMHLDGTSTTPDTGATAGATAASTGTPEQTIHWQGSI
                     GPIRFSLMDTFAQVPYALVSLALCPEDLEVTWAPDQQALGVTVHLRMAMHTFASDRLV
                     WDPLVDPFNLWIRSRSQINQTLDTMTLGVAIEVPESIECTVSDRFIQAIAQTDQRIRH
                     EFAMEHRQLGRHRQLRHRQRAWVRWTRPRSEPQLLELYNATELVLCLETQLQLVPLQL
                     APGARVALPLVAPLPSTCCWYPADDDRQRADAAFRARLWVQDATAAAASCLTSPWTPA
                     WLNLSHYGRQLLRLQWQAGGIGAALAATDSIPAKAAAGAAAGAAAPFLELLMIGALRG
                     EQLTVSFHSPVLVQNTTGTSLRLRLRVPGGSPVPKSASNKPHAIEIRSWYAHQFACYH
                     QSRKADPTPVPKTRHRATDEQPAGVDCWQRAAWPATAATLDASSTAADSQLAYASLDV
                     NQRSSVGTSAPSDEAPGDVAGASYQRSGVDRNWAPSQAPCADAATTGTAIAGTGTAAS
                     TQRPGSASATPRTRSVETQLVLETVIPPQGVRSLPLAFSTLDGELYIQAYRRPESRVP
                     ANACDSSGVSRTPAEALDSQSSSSDALRSKEPPPNAPLEMGAFLRATQLEPLLMEARH
                     SAVCLPLYSETKYAAFGTGGRANAGVAASQRRVLWYARMQAFRMRSDAWWLALSILPV
                     VKVLNALPYPATLDLLQDGQRTGRLSLASGAEDTITGVNWMRPWLMEWSVREPDDTYK
                     CRVPSVFTLEAPRSLPDASQSYWDGWFRGQQTNALRCWRLQLAPHGDLDRSSARWLLT
                     LTASYWLLNFTNIALDVLPLNPVPPATPSADRSSRWCWVSSSTKKQRPDVLGEVAAEL
                     QAPCTRDAATRQPTHELDTESPVRLHRANATVPPGVPGYPEVSVTAASSQGVFPALQA
                     ALSSSLESRSELASGAPQQQHARTAFERGTEGLWMLSLTSAAPAATMANRARFGVQAS
                     PTSDRHQSRRQRRFAGGSVDVRYQTLGRSEFVLDGWPLVIHRQPHWELTGVTLVSLHP
                     YLLIQNASTFAVAVRALHGSSAAVLELPASAGSEASGAFSVRPLRLWQHGRGRSARSW
                     LSRPVLSLAVREDRCEEASAINWHWYRDLPLKEDRVFTLSFIMEHLLLASHLGAQRVQ
                     LVERPGTGGSTGLKSHSMNPHGTEAEQQQQQQSCSRLETGNQHGTKASQPVGASRSKA
                     RLLESNVDQRRHQRNDDPHKQRYPTRYQEQDQVQLGTCRQGELPDTKRHQHWQRYSSN
                     ESAHLREAFECLLHVQVSSNLLGQKIVILSDELPTSPRFALWNRTPYVILYRWMPPQT
                     LALGGSLFHRRRCMFQVARPYARLTLSPAWVTEHYCLQAMAFASLREALEWRLWRHGQ
                     VYDLMEPQRYAALPVQGQAGTAIDLVYPQVDLVGTGTAQLVFSSTRHTAATATTTATT
                     TDTAQHTSTSAQARALIETSFMSAGAQASASNEVPLLGAFLHRQRGAPSLEILLQVEL
                     KRAAVSLVLCDSHQRFFEMLYAAASGMELFLHTCGPESSLSLQVTSVQCDNTLPFYVS
                     PVLMLTREQPWLSCAARWRQHAGGRHYYSIQLRIAELLVMLDDGLLWQLLEAARELWS
                     SFSQRRAGLERTAPVLRSVLEAVDAPSLWLASSRAVAEQRRAPSFFQLVRVERMRLRL
                     SFKTDRERALETAALTRQTLFNAGLVLTELDNALVLVGAFQLRQVYAPLVQVIERMVQ
                     HVLWQSFLSSYNFIGGLSWLGDPAGWLYELREGTFDFFNEPISGLFESNEALWRGFRR
                     GAFAQGQALTFALTQPAAQLAGSLARALGTISLNRTFEIARARQDRTLGEPEDIFLGI
                     AYGMLGAGTALGAALTGIFVEPVRGYRQSGVGGLFQGLVAGLWGWLPLTLASFLVLVQ
                     KLAMGIRNQNRVDLRTRERLRDPRVLYRASDAPLPPYVAYLARGQRLLHQVQRGALAT
                     EPYVIHIEFEMSALEDREEEEARDSSMEATQRPSVWGAVSRRRLIGWISKGRLASSLG
                     KNPGAAGAGAGAGAGAGAGAQETLITVAVPAAVILSRSYLVAVDGNGAFLWRCRLARI
                     EAIRERSDPTGIRWLWIQARPRRGRSRRAYLFSKPEAAASASAAAGGGGAVVMTWAAL
                     PTRPPSPSLDAFMQLVSLMRQRQASMEAASLPPSREPSTTRATSTNKAAAETLTALET
                     DILDAV"
     gene            <434971..>436224
                     /locus_tag="CYME_CMM177C"
                     /db_xref="GeneID:16995106"
     mRNA            <434971..>436224
                     /locus_tag="CYME_CMM177C"
                     /product="similar to D-amino acid oxidase"
                     /transcript_id="XM_005537010.1"
                     /db_xref="GeneID:16995106"
     CDS             434971..436224
                     /locus_tag="CYME_CMM177C"
                     /codon_start=1
                     /product="similar to D-amino acid oxidase"
                     /protein_id="XP_005537067.1"
                     /db_xref="GeneID:16995106"
                     /translation="MSSSTHPETAAEVVVVVVGCGISALTTAVHLLETFGSGRLLVGI
                     YGDLTQLNQTTSCGCAGLWLPFHIEPQDKVRDWARSTYQRFLQDAENPDTGVRFVPAY
                     QFYPKPPESLPYWHADVLDLAVIGRDQRPEETLASSARTESTAVADTMPSFPDGYSYA
                     LQWRTAVVDMPRYLEWLVARFRRLGGIFWNENSGEPPLPLQRLTDVVRRCRIPTTNRM
                     TIVVNATGLGARTLCADSELRPALGVLVRVRYPMRFVLQVAGGPLGDPQYPTYVIPRN
                     EELCTCGGTVLFDLPAAEQERLVQLSTIADHLEPEQIPPIARDMLERCRQLYKPWQNK
                     DVALSVAEVWSGLRPVRTGGVRLELERWPAAGEANNADASRWIIHNYGHGGGGVTVSW
                     GCAAAVTELVRSLCETIDTASCGNA"
     gene            complement(<437216..>439039)
                     /locus_tag="CYME_CMM178C"
                     /db_xref="GeneID:16995152"
     mRNA            complement(<437216..>439039)
                     /locus_tag="CYME_CMM178C"
                     /product="NADH dehydrogenase type II, chloroplast
                     precursor"
                     /transcript_id="XM_005537011.1"
                     /db_xref="GeneID:16995152"
     CDS             complement(437216..439039)
                     /locus_tag="CYME_CMM178C"
                     /codon_start=1
                     /product="NADH dehydrogenase type II, chloroplast
                     precursor"
                     /protein_id="XP_005537068.1"
                     /db_xref="GeneID:16995152"
                     /translation="MFLSFSAVFAGRNCCRTQQSHRQSVFSPTAWPHLFSGAQRVERG
                     RRATSQGRRARSLLSTRTFCMSSSQEDQPKSKSMASLRPKVCVLGGGFGGLYTALRLC
                     QLPWGRDLRRYEAAARTPQRESTFSVDNSERRRASDTSKQSASQRLVAGQRTRPELTL
                     IDTRERFVFLPLLYELVTGEMGIWEVAPPFAELLEDTDVDFLQAQVQHIDLDKRRVTV
                     RPMMPSNASESKESDEIISYDRLVIALGSEDTRDMVPGAREHALGFRSVEDAIRIRER
                     VRLLESSSQPTIRIVIVGGGYSGVELACNLSDRLGPRAQIQIVDRGRELMAASTAYNR
                     SQATRALRLRNISFVPETSVVSVGPNSLRLSYAEKSGDRAPPASETTLEQIDLVLWTA
                     GNRINKVIREGLIASRQVERNERGQLLTDRFLRLPNYPEVIVLGDAAQIREPVAAVPV
                     VTREQPRGMTAQIALQEADFAAWNTWASLTGREPLPFQYVHLGEMITLGRDDGSVQLL
                     GLLNLSGPLAHQLRRLAYIARMPTDAHRLRVGASYVAQPLLRILEGVLAVGNDVLDAL
                     GQGRGTRAPGCPFTANQDTQQQQQRQQSWSSSTAPRSDESS"
     gene            <443373..>445733
                     /locus_tag="CYME_CMM179C"
                     /db_xref="GeneID:16995153"
     mRNA            <443373..>445733
                     /locus_tag="CYME_CMM179C"
                     /product="probable sulfur deprivation response regulator
                     sac1"
                     /transcript_id="XM_005537012.1"
                     /db_xref="GeneID:16995153"
     CDS             443373..445733
                     /locus_tag="CYME_CMM179C"
                     /codon_start=1
                     /product="probable sulfur deprivation response regulator
                     sac1"
                     /protein_id="XP_005537069.1"
                     /db_xref="GeneID:16995153"
                     /translation="MKVPNGSDGTPSVESTEKVSLTDDEIVPNERSRPTSSLDLSANG
                     QPRYSIQKLREPPNVFHTLGASLLGSTGRQLENGSDRGDHIPSRQRFQQRDQGRLGAC
                     PMQPRFDWKRLGRSLATIGRQLPHVCSKLITDFGTWLLDSFSDLVRRSSAFVRRYWVA
                     LLLLALAGVGLALLGRLVFEPLSWKGWFTFAVLLLLLASLICSWLPTEVSFAYAVVTL
                     MAFFVISPAEGLIGFSNTGVAAVAVYFMVAEGVYRTSALRTIFRILLGRPSSLLMAQV
                     RTCLPAAVVSAFLHNTPTMVMMIPGVQRWARFNGLSGAKILMPLNDAAVLGGSTTIIG
                     SSVNLVVLGLVQQTNVLDPATNHVVQFGIFSITKLAIINLAACLVFIFVFSGMLLKDR
                     ENVVEDVVEHPREYTVAVMVREGSPIVGLTIQEAGLRALKGLFLVELSRKNGNLIAAP
                     GPDTVIQAQDVLLFAGRLETVAELYLIDGIIPASTHTRKLSVQMHRRRLYEVVVSPFS
                     SLVGHTIRETNFRRKYHAAIIAVHRGGAIVREKIGDIQILGGETFIVEASEDFGERYA
                     RDSDFSLVSEVSGTERPREDLPHMLAAGLFVVLMIAFATTGFMSIFVSASLATIGMLI
                     TGCMTFRQAGASVQLPILLTIGAAFGISEAMQVSGVAAQLSLLIVKILRPLGSIGILF
                     GIYVITALLTNAITSIGAVTLTFAIVASKGTGIIYLTQVNVYAALYTMMVAGNCSFML
                     HTGHQTNLMVHGAANYRVSDWLKLGVPLQLVSCIVTVVAANFLYRS"
     gene            <447750..>449375
                     /locus_tag="CYME_CMM180C"
                     /db_xref="GeneID:16995161"
     mRNA            <447750..>449375
                     /locus_tag="CYME_CMM180C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537013.1"
                     /db_xref="GeneID:16995161"
     CDS             447750..449375
                     /locus_tag="CYME_CMM180C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537070.1"
                     /db_xref="GeneID:16995161"
                     /translation="MDARFVTDSDRLQPVRKRVYRIRLSEGEQLCLCGKYSVTIAGAQ
                     GPLRQRLFFNSAETALSIWQDPVPVDAPAWQSAPVWRVQQGQLVLLITDRSRGSYPWP
                     IRLSAPAENSQHLTPKSLVARYTAPPLHFSGLENLVAALPGEQAPVVLVAGPRHTGKS
                     TLVSQLSFMGWPYHPQPLILELDLGQNYFLAPGYVSFHEVRDLAWPIWRASTACLESV
                     FCGNVTPFADPALYRQAVQRLWSACEAWRGKRLVLVNTMGWVRGYGEVLLGSVLDTIR
                     PDLIVWVSEGTDAQHAGGEAEIEAFGTTAGSRVQVLHVQRAPSSAHKQRSLLPAVARA
                     SQLIHELVQQCEDGLPRGIIADQFRWFLWQNQPAYPIVQLLCSITPWCVPLEFFAAVF
                     MIEPCGMHRLQPGHDSERLYSMLNASVVALCVTVIDKEEPTEEISLQAPQRWLLRSPG
                     LGLVRSIDPQNGLLYIVTSVPLSVLESTVALAMSPEVQLPAAALQLGGMEAEPFLGLG
                     CTGTAEDTASDAVVTSRKNLLRRRLMKAKVSPS"
     gene            complement(447778..449723)
                     /locus_tag="CYME_CMM181T"
                     /db_xref="GeneID:16995162"
     misc_RNA        complement(447778..449723)
                     /locus_tag="CYME_CMM181T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461452.1"
                     /db_xref="GeneID:16995162"
     gene            complement(<450412..>451473)
                     /locus_tag="CYME_CMM182C"
                     /db_xref="GeneID:16995010"
     mRNA            complement(<450412..>451473)
                     /locus_tag="CYME_CMM182C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537014.1"
                     /db_xref="GeneID:16995010"
     CDS             complement(450412..451473)
                     /locus_tag="CYME_CMM182C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537071.1"
                     /db_xref="GeneID:16995010"
                     /translation="MFICSAFSNCKMERCGRKAVPLRCKLHTTRDVTSALTLGLQKGQ
                     RWVPHANEALSSLQSLGFRSSRIAHNILANVVGTATTALTPETYCKSTGVVFSGQLFP
                     VPDDVNEKRQAVNARRSTPTAAAVTACTEPEPLDPESKSPTAPPARKRTPSSTRAETM
                     RLRWTDPLLRARLLQNRRSNGTIAKQAASLSKRWQDPAFRARMRQALSGKPAWNRGKK
                     HSEATREKIRRAMLRHWVKRRGDRAGTEARTNSDTSEENAFDRLKRQFTALAMDLKLW
                     SDGFYTRMGRRPRASDIEAVTLGESQRRSGRGAALDMMTPALMFKCQRFLELKRLVTN
                     QDESLQGLGDEIIQDDLNP"
     misc_feature    complement(451485..454741)
                     /note="repetitive element"
     gene            <455177..>456457
                     /locus_tag="CYME_CMM184C"
                     /db_xref="GeneID:16995011"
     mRNA            <455177..>456457
                     /locus_tag="CYME_CMM184C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537015.1"
                     /db_xref="GeneID:16995011"
     CDS             455177..456457
                     /locus_tag="CYME_CMM184C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537072.1"
                     /db_xref="GeneID:16995011"
                     /translation="MTKECKANLARTSARHEQLASKPFGFCYTVLREENSHQARDELS
                     DAIRTHFVNAKVNERSIPSRFFYDDAGTALYERITCTEDYYLTRCEREIFRKYCDRIL
                     NIAVGLDEDAPIRSHSPNERALHIIELGAGDGHKTAVLVQRALQRGLHITYRPIDISE
                     RAMTDCAERILATLSDPENGHQRLEHSSVEAQFTFHGIVGDFFEGLGYALRAPGRRLQ
                     NPVEDRLLANAGNAGYGAAPESAHEHARHLVMFIGSSIGNFDPTNAIAFCKQVRSLLQ
                     PARDHFLVGFDLRKPYAIMHRAYSDREGITAEFNRNLLRRVNRELGSNFNPAKFEHFA
                     QYNVRLGAMESFLVATEHMRIVFPNLAMDTTALPTGNEIAIELRPWEAIHTEYSWKYT
                     LEDISALAQKAGFSRIAANFFDSKNGFVDSIFAP"
     gene            complement(<458176..>459258)
                     /locus_tag="CYME_CMM185C"
                     /db_xref="GeneID:16994935"
     mRNA            complement(<458176..>459258)
                     /locus_tag="CYME_CMM185C"
                     /product="similar to protein phosphatase 1, regulatory
                     subunit"
                     /transcript_id="XM_005537016.1"
                     /db_xref="GeneID:16994935"
     CDS             complement(458176..459258)
                     /locus_tag="CYME_CMM185C"
                     /codon_start=1
                     /product="similar to protein phosphatase 1, regulatory
                     subunit"
                     /protein_id="XP_005537073.1"
                     /db_xref="GeneID:16994935"
                     /translation="MSERPLVRPDEDGVVDISYSGLGEIAEAYRLPCGTDAAFSNPFL
                     EFQATNCRISRIQNLDRCTSLRRLVLRQNLITELRGLETLSELEEIDLYLNHIREISG
                     LEHKPKLKRLDLSFNRIHSMAGLERFHLPALEELYLVQNRIKEIAGLQAHNLPQLRLL
                     ELGSNRIRTLGDNLFEVGGSLEELWLGRNKIVQLPSLHCFRRLKRLSLQSNRLLALGS
                     ALEYCRDSLEELYLSHNGISALNGTEMLRNLKLLDLGCNRIARLDDLLDDLQNLEELW
                     LNDNKIDSIEQLRHLSAHAKLRTLYLEGNPLAERLQTQHGNKWYRALVLRVLPMLTQL
                     DAEPIDEETRALADSEHCECLWNREG"
     gene            <459867..>461402
                     /locus_tag="CYME_CMM186C"
                     /db_xref="GeneID:16994936"
     mRNA            <459867..>461402
                     /locus_tag="CYME_CMM186C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537017.1"
                     /db_xref="GeneID:16994936"
     CDS             459867..461402
                     /locus_tag="CYME_CMM186C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537074.1"
                     /db_xref="GeneID:16994936"
                     /translation="MKTKSRGKTNHWDRDGAPAVAREHQYRSSRKGTAKGSVAAPVHK
                     RSLYARGLLLVVLYLFQGVPMGLTFGSLPFLLQTRSSYAKLGVFSSASYPYSLKLLWS
                     PIVDSVYASRLGRRKSWIVPAQLLIGVIMASMAAAVERWVQHARVMQLTLFCWGLVFL
                     AATQDIAVDGWALTLLGEAGSGYASICQSLGLSLGYFSSYTVFLALNSDEFCVRWLQQ
                     TSAVIRLYTFLRIMGASFIAFTLMLAVFVKEEMAEDLTLVPQPDTGGLWSALRDAYAA
                     LWSILRKRSIQRLVVFLLFSKFPFAAHDHISSLQLVRRGFPRQQLAFMAVLQWPFDVI
                     GAIAVGRYARNSRNLKDSLWRWGFFLRLMLAMFTPLLIHYFFPRGESARSRWMFVAIF
                     IVSVLYQLASDGLMFVSTSSYCARISDKRFGGTYLTLLNTASNLGGTWATPLVFGAAH
                     RFGYLRVALALPLCGLLVYLLLLGPTLDYLEKVPASAWQLDRGPAQAVASVPHRKTLR
                     CRE"
     misc_feature    complement(461050..463660)
                     /note="possible transcribed region"
     gene            <464042..>472201
                     /locus_tag="CYME_CMM188C"
                     /db_xref="GeneID:16994914"
     mRNA            <464042..>472201
                     /locus_tag="CYME_CMM188C"
                     /product="acetyl-CoA carboxylase, multifunctional enzyme,
                     cytoplasmic"
                     /transcript_id="XM_005537018.1"
                     /db_xref="GeneID:16994914"
     CDS             464042..472201
                     /locus_tag="CYME_CMM188C"
                     /codon_start=1
                     /product="acetyl-CoA carboxylase, multifunctional enzyme,
                     cytoplasmic"
                     /protein_id="XP_005537075.1"
                     /db_xref="GeneID:16994914"
                     /translation="MGDLGEHAPSNGSAKDSVRRYVEEHGGSRPIQRLLVANNGIAAV
                     KCIRSMRRWAYEAFGSERALEFVAMATPEDVQANADYIRLADLFVPVPGGSNNHNYAN
                     VELIVDIAERNECDAVWAGWGHASENPLLPARLAETGIAFLGPDAIAMRALGDKISST
                     LLAQSADVPVVSWNGDDLKVTFHRERGGIDEERYRRACVANVDEARAAADRIGYPVMI
                     KASEGGGGKGIRLCRRPEDVRDAFRQVAGEIPGSPIFIMKMVDQARHLEVQIVADEYG
                     HAIALYGRDCSVQRRHQKIIEEGPVTATPPQVWKELEHGAVRLAKMVGYVGAGTVEYL
                     YDGRRFYFLELNPRLQVEHPVTEWITGVNLPAVQLQIAMGIPLQRIAAIQALYGNRPD
                     LDLERHQPNPPHGHVIACRVTAENPEEGFQPTSGSIQELSFRNTPNVWGYFSVGAWGG
                     VHEYADSQFGHLFAWGADREMARRNMVLALKELSIRGDIRTTVEYLITLLELESYREN
                     RIHTRWLDNLIASKVKPERPPFHIAVVLGAVHQAYRAWSERRRSFVESLSRGQVPQRI
                     DATFIEFQFELIYDELKYALIVRQAGPNAFHVSLAQHPEERVRVDFRPLLDGGLLIMC
                     DGRSFNTHSKEDSTGMRLSIDGRTCVFPGEMDPTRIAAQASGRLVRYLVANEEHVDQG
                     QVIAEIEVMKMYLSVQAPEPGTIHLLKPAGAALEPGEVFAQLDLDDPSKVRRVTPFTG
                     RFPTMLPPQRLGKKPHQRFESAKQQIEALLDGYDVDMEPLGMLLQLASTEPAVPAGKL
                     QEALSFLAGRIPSTLHAALLGQVFELRSVARDDHERLQQHFREMKRMISDFCEQLAIA
                     ADREALEATLRPLTSILEAYVRGGLRGYHEHLVVCLMQRYVNTEKYFAQGRRLDEVLF
                     DLREQHREHLEVVADIMLAHAQLARKNQLMLALLDHIAADASLLRSVIVRQCLHEVAA
                     FIHPDYSQLALRARLLLASSRRRALPERRERLCKQIEQAVHAPTEEQCYRLLHAVVES
                     QESILDALVSLTMNPGVPVEIRKAAVQCQILRAYKAYHVYDLVVELDEELGFLRALWR
                     FQYRSNLNAFGSHSSMRSFPAALVAASAPLARRQLRSYDSADNLQNWGFRVGMLVVFE
                     TLRAMVQGFDRVLQVFRAETGGETLASPRTKSSAAVDSSADSSAEGIGVNVLTIAIPW
                     TAVEVADFAKYLGVADADDRLQASNANDSEQVVALLTRFCRSSAERKASMRAAGIKLV
                     TFLVAPGELCQRTLGSSLPRESTYPGFYTLRASLEYAEDPIYRHIDPPAAFQLELNRL
                     ANFRITRFEHPNRSIHVFYAEDRTDKGDARFFVRAFVRQAEVYASPSDTAAVSIPEAE
                     RTFVACLDALETARCDRRFRRTDFNHLFLHLIPRVSIDVDDVEAICTRLFYRFSSRCW
                     RLRVFMVEIKVHVEKMGPKPLRFILYNPTGHSLRVEGYVEQGDRLLSLDSSDPGHLHG
                     TPVDEPYQVLNRIQRRRVVAQTLETTYVYDYQELFTKALHEQWRRYSQERLLGGFRRH
                     KIPLKLLTCTELVLQDEDHDESELIETNRPAGENEIGMVAWRYTFFTPEYPQGRDAIV
                     IANDITYLSGSFGPREDRLFAKASQQARKLGIPRIYIAANSGARIGLAEELRNVFQVQ
                     WKDAHDPSRGFDYLYLGLADKLKYEDELGIVRTRDVGGGKYALVDIYGAEDGIGVENL
                     MGSACIAAETSAAYNDCFTITYVAARCVGIGAYLVRLGQRVIQREHNAPIILTGYSAL
                     NKLLGREVYTSHEQLGGTKIMYPNGVTHLRVSNDYEGVRAILDWLAFVPRMQGERPPM
                     IDSIDAVVREVDYDPRVANEDIRYAIEGKWVGPFAPDGASVVSSSGSSVSSNGPVATG
                     ASAGLPPVNMESVGGEVRYRSRSRTASYAGANAATAAAPGASSLATSGAALANATGRA
                     AARVSLVSTKPATGVEEVPAALPSGSSSLALRSTAVAAPVPQERAKTDADADADADAD
                     ALEATGTARGADTSGAGAHASPDTRQPPTLDALKTARFAPAPAALPTTGLRSPPQSPG
                     SVSAYSPLESGSPLEPSLDEDHIAFTDTDRMRIGSPLVHATDAWDTSNSVHSSSATTM
                     AAGAVRGSRLFTASSSTSAAAGASASNSSNNGSSNANTNTMNNAGSSVASAGAPLNTT
                     GSINTNTNANANTNNILGSGGVGATASLTAWSGNLPPLPYVPNTLMVVDNQGYVFLAG
                     LFDRHSFRETLAGWAKSVVVGRARLGGIPVGVIATQTVTTEKVIPPDPAAPDSRELRE
                     QQAGQVWYPDSSFKTAQSIRDFDREGLPLFVLASWRGFSGGAHDMFQEILKFGSEIVD
                     ALREYSKPVFVYIPPGGELRGGAWVVLDTAINPRFIEMYADESARGGVLEPAGTVDIK
                     FRTRDLLKTMQRLLPSSRRDESDSSASDVVGMLSLDASSSSAAATAATTTTTTTTTTT
                     AGTAGTSSSTAGRSESRVTKSTADGLPAFEADGRSSLEQTLLPIFQQIAMTFADLHDT
                     AGRMQHKRAIRRVVPWRTSRTFFYWRLRRRLAEEELRSRVSQADPQLSDAEIDALLRK
                     WARAHDPALDGDIYELDDPRVVQWLEDELDSQLERRLHKLREARATWQAVELGNTAPE
                     ALLAAIERILVQMDEVGRNEWLRTLSARLENTSSGLGDLEAPSSGEQAAPRRVLSGRG
                     LLRRFLG"
     gene            complement(<472778..>474595)
                     /locus_tag="CYME_CMM189C"
                     /db_xref="GeneID:16994915"
     mRNA            complement(<472778..>474595)
                     /locus_tag="CYME_CMM189C"
                     /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase,
                     cytoplasmic or mitochondrial"
                     /transcript_id="XM_005537019.1"
                     /db_xref="GeneID:16994915"
     CDS             complement(472778..474595)
                     /locus_tag="CYME_CMM189C"
                     /codon_start=1
                     /product="3-hydroxy-3-methylglutaryl-Coenzyme A synthase,
                     cytoplasmic or mitochondrial"
                     /protein_id="XP_005537076.1"
                     /db_xref="GeneID:16994915"
                     /translation="MELQTSWLSDKDSWCSSDQQTQRTSSCLSRREQNRPWFCGMPPT
                     TSAAQESEPLHPDTMRQAQLLAPSVSTFDPVGILAIEVYFPRKYVDQRALESFDGVTP
                     GKYTIGLGQQAMSFCGDREDVRSMCMTVVQTLMEKYRIEYNDIGRLEVGTETIIDRAK
                     SIKTALMSLFEQSGNFEVEGIDSTNACYAGTNALFNTIAWCESCTLFDGRFGLVVCGD
                     IAVYPRGPARATGGAGAVALLIGRAQPQRYPQLEPILVLEPGLKSSHFENTWDFFKPA
                     RRQDTEYPIVNGTESIACYFRALDICYTRFTGRVEQQTRRTRVWLAETSGRPGAEQVT
                     EQQSLRCTLLTSTAFAEPSVTPVADADATQLDYVVFHAPFNKLVRKSFARLVLNDYLR
                     YPELASQHRAVSGALRAQLAKLKRLPAHLNPTGVCVPPPSTYWDRTLMQLVLECSEPL
                     YRAKCAPSTTLARQTGNAYTASLFGNLLCLLDAERDRTLGKRVVLFGFGSGMAASMYA
                     MRVVASPEALLRRVGLIERLGARIPTSPACFHETLRLREQNYGACDYEPSEPLEELFP
                     GTYYLVRIDGRGIRYYDRYQGSRASDQAACCNALCPDKP"
     gene            complement(<475863..>476597)
                     /locus_tag="CYME_CMM190C"
                     /db_xref="GeneID:16994916"
     mRNA            complement(<475863..>476597)
                     /locus_tag="CYME_CMM190C"
                     /product="chloroplast ribosomal protein L17 precursor"
                     /transcript_id="XM_005537020.1"
                     /db_xref="GeneID:16994916"
     CDS             complement(475863..476597)
                     /locus_tag="CYME_CMM190C"
                     /codon_start=1
                     /product="chloroplast ribosomal protein L17 precursor"
                     /protein_id="XP_005537077.1"
                     /db_xref="GeneID:16994916"
                     /translation="MPSLRTLSSAWRYHKTLLGVSCWTPRSTLAKDVSTRFTGYLSFS
                     QFVACVRVCSDSRQMLSRITLGFVQAPLARVAPASCVAACRVLPARPASVFRGAPLIP
                     SVPVPRFNFAVQTRVPAGSGVLSLEAMRHGDRLKKLNRPADQRKALIRALTTEVLRHG
                     RIKTTVVRAKVVRQYADKMITLAKRGTLAARRQAIGFIYDKQLVHALFEAAPERYGDR
                     NGGYTRIIRAGFRRGDNAELAYIELV"
     misc_feature    476753..477911
                     /note="possible transcribed region"
     gene            complement(<478137..>479072)
                     /locus_tag="CYME_CMM191C"
                     /db_xref="GeneID:16994918"
     mRNA            complement(<478137..>479072)
                     /locus_tag="CYME_CMM191C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537021.1"
                     /db_xref="GeneID:16994918"
     CDS             complement(478137..479072)
                     /locus_tag="CYME_CMM191C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537078.1"
                     /db_xref="GeneID:16994918"
                     /translation="MVKFLLILLCISVVLSGVCGMQPVLGYQVARATLQVERSGEPLR
                     ISGDANTFGQSLASHLPLRLSRGDALQFWVELEPFATAPEQAFFLLFNEHTGVQHALT
                     ANVRRENTIGFRFSPAEHLVQEPYLVEDSFATLVVIAGSARDEAPLVWSLEAPPGQRS
                     ADRRSATLKVDLRPTPVPERPGIFERNFTVHWGPRPEFAVQYSHSTPKTYPLVAGLCT
                     ATVVAAGFAWCALAFAQGLLVTPWALDASLGTHALAWQLCLGSALAMLVMFFTKWNLM
                     QTLGYLGFAMPFWTVSGFLVLRRRAAAAAATRRAL"
     gene            <480172..>481191
                     /locus_tag="CYME_CMM192C"
                     /db_xref="GeneID:16994981"
     mRNA            <480172..>481191
                     /locus_tag="CYME_CMM192C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537022.1"
                     /db_xref="GeneID:16994981"
     CDS             480172..481191
                     /locus_tag="CYME_CMM192C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537079.1"
                     /db_xref="GeneID:16994981"
                     /translation="MTCSYVLDAYTRCRETMKEGALVDGSEHTGSSFTPIWRRVFFVG
                     TEWDQIDEVYRFPWDFSHLDRDVVQFLQEPSAFRWYLFGATEPQLVHWQQQETVLPIP
                     VVVVVQSKVPPPALVGIKSVQRTTEQVVPMRAVKMEFFPLDVSEMDAHNLTPSKKKLE
                     TQQRVTDRVQILQCEQRRSSLRALSAERLHRYDYVLPYALRAELQQDANTDLVVDTTV
                     DGIAEIPERPGQPVLFEFDWEMDILEEYITELLESESLANTEANRTALRQTIQQAIQQ
                     RQAALRAEQSARERRLQAMTPAERESYQSMRVIKYYPQNREPSIQALKTAFVNRYYGK
                     ADEIR"
     gene            complement(<481744..>483039)
                     /locus_tag="CYME_CMM193C"
                     /db_xref="GeneID:16994923"
     mRNA            complement(<481744..>483039)
                     /locus_tag="CYME_CMM193C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537023.1"
                     /db_xref="GeneID:16994923"
     CDS             complement(481744..483039)
                     /locus_tag="CYME_CMM193C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537080.1"
                     /db_xref="GeneID:16994923"
                     /translation="MEKHPLALCPEHRSRSTAELQLLPSEHLLQTRALPGPVTTTTDT
                     RQPRRLRRQRSAPVDPQGHGNGSAGQRSGLSGALPGTGQLVAASAADMSSLETPGTRQ
                     PAASNLLPTSPSSQDFQHCQWRIRVTRGAIAGEEERSLLQRTCLCDLHSLPSMLFTQN
                     NIHIERYCGNDAAEGFQPILRFNAVDALREVQPAPAAPPQVHEASAWQRQVSSVARVP
                     LTVAKDWTFTTTYAGTLADHLQIGSWRPVPVSKALPLTELQSREIPPEFYTELILFED
                     ELDDQGISSYSVRIRVMRQAFWYLLARFWLRIDRKLVRIYDTRYFHRFGSSVLVRQVQ
                     RREASMETVQRAILSGWHASMSTGAMQCRPDDKDNEDDEDAAEPGCKASEGVSPTNAC
                     TSVEDITQWRATYHCTDADRVLAFVPIIEQSAEVLDLRS"
     gene            <483741..>485594
                     /locus_tag="CYME_CMM194C"
                     /db_xref="GeneID:16994924"
     mRNA            <483741..>485594
                     /locus_tag="CYME_CMM194C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537024.1"
                     /db_xref="GeneID:16994924"
     CDS             483741..485594
                     /locus_tag="CYME_CMM194C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537081.1"
                     /db_xref="GeneID:16994924"
                     /translation="MDDESGRLPQCAVTCTALRTRSFSTRAVQVSGGSGVAFVTVRLL
                     ERIPGRRTLLGSRTTLERVVHVHRTCPERARNQSALWIMPACIAARSRFCSSTLQLQS
                     RRQVPLTRPACRSLAGGTFRKSWICSVSNRECESHGTTSAPNVPTVYVRSEKAHLFAR
                     QVRPLIFGRAIVVPTTRPNGTYEALQPRTDDLVCVRLATSGLEGQGGRTDTPGPVLGY
                     GFYNPDSMYRVRLIWQNRLDGDSVPLLKYPDGSYRVDLLRVLTRLFTAAWRLRERLGL
                     VGSAHAACRLINGEGDRVSGLCIDLYARYLVVQSSARWVEHHRPVIEQALRNVTKNAY
                     ELVWRSNSDRLRQDGFVMSDDPSRATAPGAASTMTRRASSTAATWITEHGLMYEVDIM
                     HGQKTGHYCDQRDNRLFIRHLVQEASIQRVLDLCTYTGGFALNAVLGGALHVTAVDSS
                     GQALMQAHRNAERNQVSSRLILDKEPGIPGESPPTLWLVRDDVQRFCERLESHIEHHP
                     ESTQRYDLVVLDPPKLAPTVESLPRARHRYRKMNAAALRLVRSSGFLFTCTCSASMTQ
                     SGQFSAVLMEAALDAGRRITILAERGAALDHVVSPAAPEGRYLTAMLLAVE"
     gene            <486773..>487402
                     /locus_tag="CYME_CMM195C"
                     /db_xref="GeneID:16994931"
     mRNA            <486773..>487402
                     /locus_tag="CYME_CMM195C"
                     /product="similar to ESCRT-II complex component VPS25"
                     /transcript_id="XM_005537025.1"
                     /db_xref="GeneID:16994931"
     CDS             486773..487402
                     /locus_tag="CYME_CMM195C"
                     /codon_start=1
                     /product="similar to ESCRT-II complex component VPS25"
                     /protein_id="XP_005537082.1"
                     /db_xref="GeneID:16994931"
                     /translation="MLIRTTPVQETGNHQPKTEPASFAFPPWHQYPPLYTIQPCARTR
                     ERQLYLWRRLILDYCEHFWILTLRLYDAESPQMPLFCNRAIQRRLSRSALQCIFQELV
                     LSGDAAWSNPEEKEELLIFWRSPRLWADELLRVVAQYGQNKGGVFTLPELASMLGERC
                     SLGRQQRAQALQTAIPIAFLEHILELLAAQGKARVFSTNEGRGVKFDFS"
     gene            complement(<488037..>489701)
                     /locus_tag="CYME_CMM196C"
                     /db_xref="GeneID:16994932"
     mRNA            complement(<488037..>489701)
                     /locus_tag="CYME_CMM196C"
                     /product="pyrophosphate--fructose-6-phosphate
                     1-phosphotransferase"
                     /transcript_id="XM_005537026.1"
                     /db_xref="GeneID:16994932"
     CDS             complement(488037..489701)
                     /locus_tag="CYME_CMM196C"
                     /codon_start=1
                     /product="pyrophosphate--fructose-6-phosphate
                     1-phosphotransferase"
                     /protein_id="XP_005537083.1"
                     /db_xref="GeneID:16994932"
                     /translation="MLALNFVPSCFFGRSGQNSTCGASRKPLQWKLRTPLQLGKQGFV
                     RLQRRTAQSGQPARGRSAFQISCTHGRPGGSSDAREAFDENDADFILSPEIYQSLSIS
                     DIDSGRYLKSIPRLQDFLPASQIPRVCNPATSKVSFRGLDNYDTSPNDVVLKQTVINP
                     DKRRNFARYLRAGPRSWIAFRPEEVRAAIVTCGGLCPGINTVIRELTDGLWHLYDVRS
                     IVGIRGGYRGFYNGTPYLELSPRTVDGIHRLGGTILGSSRGGFDLEQILGAIRRHGLN
                     QLYIIGGDGTIRGAAAIAEACMRERLRVSVASIPKTIDNDIPVIDHSFGFMTAVEEAQ
                     RALNAAHVEATCFPNGIGIVRLMGRNSGFIAMYASLANRDVDCCLIPELPFEIEGPNG
                     LAAFVEKRLQENGHFLLVVAEGAGQDLLAASTEIDASGNRKFNDIGLYLKERLQAYFN
                     RENIEVSMKYIDPTYMVRAVPATASDQMYCAVLAHSAIHGAMAGFTSFTVGPVNGRHA
                     MIPLQDVAGQQQRVDIRDRTWSRLLSSTGQPSSFLNQPAAALHQTA"
     gene            <491771..>492994
                     /locus_tag="CYME_CMM197C"
                     /db_xref="GeneID:16994949"
     mRNA            <491771..>492994
                     /locus_tag="CYME_CMM197C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537027.1"
                     /db_xref="GeneID:16994949"
     CDS             491771..492994
                     /locus_tag="CYME_CMM197C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537084.1"
                     /db_xref="GeneID:16994949"
                     /translation="MPEPGSNSPSATRTGAHATEYLRGEGSMPRDSPKDKEFGIVDAG
                     GLTSLSLSPFLQGLTGEDALVAVHGASLWETTATGRTRDTLTQDITIRKETLTEGDMS
                     HAPYGERAGTQRRAASQKRTQPELEGTLAPAAKTRHSLSRTGCIRSSRRASPGSSEAD
                     SDPQNHGDKVREIQRRKRLRERERRESMRTKYNALIELLRQGRRNLMSWDLYRRQRSN
                     RADIQVSAGKSLDESAMPHSFVIPSDKDAVLSECMGQLNAFNRLMAGIREEFDTLHHQ
                     LDEMRSEKADLRNDKLYLREEVQRLRDEVRRLREGTLQMFLASRKGDMVADGTLEAAL
                     RNRIFDSNDEQLDLLLDPSTSVPMGSVPSGATPQIHQERDKTSAMLSNAREGYSSYGK
                     CPDNSADEPDYSTCA"
     gene            complement(496211..498052)
                     /locus_tag="CYME_CMM198T"
                     /db_xref="GeneID:16994962"
     misc_RNA        complement(496211..498052)
                     /locus_tag="CYME_CMM198T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461453.1"
                     /db_xref="GeneID:16994962"
     gene            <498328..>498852
                     /locus_tag="CYME_CMM199C"
                     /db_xref="GeneID:16994963"
     mRNA            <498328..>498852
                     /locus_tag="CYME_CMM199C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537028.1"
                     /db_xref="GeneID:16994963"
     CDS             498328..498852
                     /locus_tag="CYME_CMM199C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537085.1"
                     /db_xref="GeneID:16994963"
                     /translation="MDAENLPDPGNIQGFTIRVTESLLNRLGDGFSRRSPMEGDVGVQ
                     VRTPRERQLVEQVQAIERRKRIELAKRVQSRLQQLEERRLLQAREAAERKLQELEQKD
                     YAAPAPVGALPCSAERRALFRCYKENPNPLQCGLEVSAFEQCAKEVELQVLRRELGPQ
                     HAANVAAARSSASE"
     gene            complement(<499911..>501245)
                     /locus_tag="CYME_CMM200C"
                     /db_xref="GeneID:16994966"
     mRNA            complement(<499911..>501245)
                     /locus_tag="CYME_CMM200C"
                     /product="probable DNA binding protein"
                     /transcript_id="XM_005537029.1"
                     /db_xref="GeneID:16994966"
     CDS             complement(499911..501245)
                     /locus_tag="CYME_CMM200C"
                     /codon_start=1
                     /product="probable DNA binding protein"
                     /protein_id="XP_005537086.1"
                     /db_xref="GeneID:16994966"
                     /translation="MADDAPERNIEDPDVITKYKTAADIANQALEAVSRALRPGASVA
                     ALCRLGDEAIRNRCGTVFNKNKGKKREPIGKGVAFPTCIGINNCAGHFSPLETEDTTV
                     KEGDVCSIDLGAHIDGYVALLAATGIVTESGLQWQAHPLELFAWSEAKTRNETSEAPG
                     ASETESMQVERNGKDQPAVPERAADAICAAYYAAEAALRLLRPGCKNSQVTEVLAKVA
                     ADFGCSVVEGVLSHEMKRYVIDGRRVILSKPTVDQRVEECEFEVNSVFAIDVVMSTSE
                     TGKVKPGDARTTVFKRAIDRDYLLKMKASRQLFNEVNRTSPVFPFTLRGIVQDDPENK
                     VARLGIGEMQSHGLVIPYPVLYEKEGHYIARFKYTALILPAYTQRITTMPFPTGVKSS
                     KTIQDPYVRQLLEQPVGKEAKRLHKQAAKAAMRIDSNGEPRPVSATAEDARM"
     gene            <503248..>504828
                     /locus_tag="CYME_CMM201C"
                     /db_xref="GeneID:16994967"
     mRNA            <503248..>504828
                     /locus_tag="CYME_CMM201C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537030.1"
                     /db_xref="GeneID:16994967"
     CDS             503248..504828
                     /locus_tag="CYME_CMM201C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537087.1"
                     /db_xref="GeneID:16994967"
                     /translation="MHCDKAFGYTHLPMEHNSGETLEHTQVHCRHATTLKAHVELQST
                     FTGPKLPGEPTSMQGTCSVATERYGFVAPNQLLQQNKRWRTQALRRAGVWDVPEAVVS
                     LRTFRVARNAGSGRVPRAGFIRRVLALSVRHAREGQTLDPSAAPRSSLESGTWFKLIC
                     GASFNEVTEIAPLTRDYALAGADCVDCAAEPAVVQAVLDGLDEAERRWRWTLTSDSSC
                     ARPDRLTKSFARPWIMVSITDDEMEPHFRKARVHVDAHAPCWQCPAPCAQLCPADALT
                     LPATAKNVNQFQIFGISSTRCYGCGRCIPACPYHLIETHSSKQTPQQVMALVRNYPID
                     AVEVHTRDPLSESFAALWYSEIGRTLRATMKLIAISMPEPNDWSVFEYIARLVYGAHV
                     DESGTVQEAPATPPSTPILLWQCDGKPMTGDLGAPATTRATVRYATSLAEYFRRNPHL
                     LAARGFIQCAGGTNAHTIPLLEGVDGVHGVAYGGYARRLVATGGYEAAQRLVQQVKTR
                     LVSPKAANREAVQPETSL"
     gene            complement(<508370..>511075)
                     /locus_tag="CYME_CMM202C"
                     /db_xref="GeneID:16994969"
     mRNA            complement(<508370..>511075)
                     /locus_tag="CYME_CMM202C"
                     /product="probable glycosyl hydrolase, family 31"
                     /transcript_id="XM_005537031.1"
                     /db_xref="GeneID:16994969"
     CDS             complement(508370..511075)
                     /locus_tag="CYME_CMM202C"
                     /codon_start=1
                     /product="probable glycosyl hydrolase, family 31"
                     /protein_id="XP_005537088.1"
                     /db_xref="GeneID:16994969"
                     /translation="MEGNCRITVLNERLLRVEYNERGRFLDSPSFAFISRATRSEPRI
                     YTIGRSGALGTAPDITESALGSERHAKDDLIVLAESHQLRLCLDTRSGNLLAMTQQCR
                     KTVLEYVDSGVADAAETAAASKNDPPRMKYRTVRDPQNQGGTIQTLDECDGWYHIRKL
                     VDIRQNGIGEGFFSADGLAIINDSNSLVFTGKNWSDPLDEQGFVTRAAFFGGSHDHLD
                     LVLFEHSPKGPEQSFPEILRKYLFPYIGAPPKPPLEVFGVWFCRYWPYRQQDIMDLVL
                     RFENRSEPESAPHRGQANASQPCRLPAVDLSIFVIDMDWHQPDQWTGFSWNRALFPDP
                     EALMAWLHSRPCPVRVALNLHPADGIAPNEDMFLQARALAYPEHNETEHIPFHIMDCR
                     FRQAYFSVVLNALENQIAANEMRMIKHGVDFWWVDWQQGVSKRDGFDPMPLLNHYHYL
                     WAANGSRNGRLLPVILSRWPGLGGHRYPVGFSGDTLATWDSLAMQPAFTAMAANVGFY
                     YWSHDIGGHYGGYEDPELYVRWLQWGCFSPILRLHCSKNPFMSRTPWAFGSFEIEAIA
                     RKILSLRASLALFFASIPAHIPICAPMYHFSWSEAPERRSWTPPAFDSWTNQYYLGGN
                     TVIVAPFLSPREASTQLSSVSVCLPPHRQWIAWDEGIATMHPCTDLDGIALDDSAVWN
                     TALPTDTCFRRFGELSSLNVFLGEGAIVLRLIRTNNEAILKVTIVTGRQNTLEVPHLA
                     LRIEIGGVHGDVVSVERLQAECPSSWYRPRPIRRLRMVLRKPNHTTMLHDFTAEDLWG
                     RPSAALSLTWAAASRASSHAQATARSVVKLFLHHFRLRSDQKEHLFQRYLESTFKAGD
                     AADFERYLDEFAMVLSAAQREALLAAHLHGWMAFAAPFVGEVFTS"
     gene            <513164..>515080
                     /locus_tag="CYME_CMM203C"
                     /db_xref="GeneID:16994970"
     mRNA            <513164..>515080
                     /locus_tag="CYME_CMM203C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537032.1"
                     /db_xref="GeneID:16994970"
     CDS             513164..515080
                     /locus_tag="CYME_CMM203C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537089.1"
                     /db_xref="GeneID:16994970"
                     /translation="MSEVTLMNGVNSALVDELVEEHVQVRKEYGSQPKCTVLERVRQA
                     LQQVDVDELCHGELARTRVGERALRVFHNEPNLLMGLRKAALADLIQREQKRERLAAS
                     GDIQNPVPWTKVLEYLRRPTLLEEALELHPDAFGHFKQMLRLILDDAAVARTLSQEKD
                     AIVESVTELYRCCTPIQVCSPTTLDGDHRVMKESLGYDCIPLTRLEAVLYYLERYRGR
                     DYHPDQAAAAAAAAAGGGGGGGGDSTPVRRIEAPRKAERVAPDSDVISKEEKKALQIC
                     HDALGISQYSLELLRSYVNDWWERPPSVREALPQVVLLESTRTALQPELQSAIKTYAQ
                     ERLGLLKRVRALIERGDWAGVAEITPAHDAEHILPMPGLRIETPRSPWILNFVLLYIQ
                     ALHELSLGEYVSRLASIALNSPMLWAMFRRLVRFLVLAEYERGAVAADSVPRQCQVHE
                     RLPQDLCVAIASAVCSRALGTNSPLRTRLESDLAMRHEWLQKSALRTEEPLWHEQCLL
                     ISEIEQINVLEMPILDERQLSAAIRTSYCSRLGWLQARLSYLLSDSEAPEPLLVSNRL
                     ELIPDDSRDHQGALHTSDSETSADIDEELVSVIMEFTDVTRAGAIFILQEYMRQNPGG
                     RMSNAQEILDRLFP"
     gene            complement(514962..516530)
                     /locus_tag="CYME_CMM204T"
                     /db_xref="GeneID:16994887"
     misc_RNA        complement(514962..516530)
                     /locus_tag="CYME_CMM204T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461454.1"
                     /db_xref="GeneID:16994887"
     gene            <519468..>519752
                     /locus_tag="CYME_CMM205C"
                     /db_xref="GeneID:16994888"
     mRNA            <519468..>519752
                     /locus_tag="CYME_CMM205C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537033.1"
                     /db_xref="GeneID:16994888"
     CDS             519468..519752
                     /locus_tag="CYME_CMM205C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537090.1"
                     /db_xref="GeneID:16994888"
                     /translation="MCVPPPSALHCNLTARFVMQMASRRRNDNRNDSRTRCDTTLGEM
                     QPRLDRGAPPTSARRNQRANVLACLPMRRPLAPVLPFRLRRCTPARIVVI"
     gene            complement(<519749..>521050)
                     /locus_tag="CYME_CMM206C"
                     /db_xref="GeneID:16994889"
     mRNA            complement(<519749..>521050)
                     /locus_tag="CYME_CMM206C"
                     /product="similar to trefoil factor"
                     /transcript_id="XM_005537034.1"
                     /db_xref="GeneID:16994889"
     CDS             complement(519749..521050)
                     /locus_tag="CYME_CMM206C"
                     /codon_start=1
                     /product="similar to trefoil factor"
                     /protein_id="XP_005537091.1"
                     /db_xref="GeneID:16994889"
                     /translation="MRKLFSFISAAAAAAVLALLCMVAAMGGVNAAPSMLVDSNLERW
                     SSLNSTYIGTTCSIYLCGDAGNDQQKCFDYQCCWQTQVNWGFNYNGDGVCVSYEPTSI
                     CNISAADRVAIGYPQITPAECLQQGGCWNPLPPTEVGPWCYAPVGYSPPPQQQLPNVS
                     CNVGDYKVPCYSGWNNMNQLDCEAQGCCWEQNPNLTYEDSIPSSQSLQKQQKVNFFGN
                     SYGFCYQPLMTCNVTYRERQNCGFPGISEQQCLERNCCFDPILLPPYLQQKYQTQDIP
                     WCYYKNPVVNFPSGWNATAVFGPFNYNKSYYKKYYPKQQVQPFNPYSQNSGQQQPVQT
                     ELEPSSGSSSSSSSSSGGIVVTGSSGSSGSSGSSGGIVVTGSSGSSYGSSSSGSTTST
                     DGTTVVGPVASPMASSGPSTVVVGSGTGSRLVMQEAAAMMH"
     misc_feature    520811..521404
                     /note="possible transcribed region"
     gene            <523343..>523915
                     /locus_tag="CYME_CMM208C"
                     /db_xref="GeneID:16994891"
     mRNA            <523343..>523915
                     /locus_tag="CYME_CMM208C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537035.1"
                     /db_xref="GeneID:16994891"
     CDS             523343..523915
                     /locus_tag="CYME_CMM208C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537092.1"
                     /db_xref="GeneID:16994891"
                     /translation="MNGDDDAKRSGKRLPDQPAKTQRTKGPVSFPSTVSLASLCEEGA
                     TASSNLDLLASCSSVQGSEDCDCEGHQPESERRLKRPRQAPWAAEPANQRRPPFDHGN
                     SESIPPAGVQSQGTSASNGTDSSERKSTEATWSRQSVDCSTAEKLAGNLCANQVSAER
                     SGQFYTKVNELLHDLHKERVSRQCRSPHES"
     gene            complement(<524321..>525841)
                     /locus_tag="CYME_CMM209C"
                     /db_xref="GeneID:16994892"
     mRNA            complement(<524321..>525841)
                     /locus_tag="CYME_CMM209C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537036.1"
                     /db_xref="GeneID:16994892"
     CDS             complement(524321..525841)
                     /locus_tag="CYME_CMM209C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537093.1"
                     /db_xref="GeneID:16994892"
                     /translation="MAASIYPLVVKSFCSDNHACCFVPQQARVSTWMDTGTKKTQATA
                     FLSVSSFVAGKTLAQPRLRRLLHGGRGLSFRVHQRPSRVWTLVASLEQRESGRKLDSA
                     TEAVQKLYNAYPFPPDPPTSGAPPGYNWRWHYPTAYAFCAKGRVPATTKVRILDAGCG
                     TGCGTEYLVHLNPQAEVVAFDLSPTALATARERLELSVPDARHRTSLYCKSIFDLEDG
                     EISGRFDMINCVGVIHHTPDPARALQMLAGKLAPGGILHVFVYAEAGRWEIRRMQAAI
                     ALIQEATGSKGDYKKGVALGRALFRALPDENRLKKRENERWAHDNRSDATFADMYVHP
                     LEHDFDVPSVLALAEKSGLRFLGWSNARNFDLDHLLGNDPEVRQLVQGLSDAERWRLV
                     ELLDPERITHFEFFLARDPFPSTEPTDDEIAASIPEWSECAYGAPSELVLDRDYRPVS
                     LSAAQVAFAKQMVADASSGGALSNRRRTRELMEASGCTLDQVRMLIRAGLVHIRAP"
     misc_feature    complement(525914..527531)
                     /note="repetitive element"
     gene            <528664..>529110
                     /locus_tag="CYME_CMM211C"
                     /db_xref="GeneID:16994893"
     mRNA            <528664..>529110
                     /locus_tag="CYME_CMM211C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537037.1"
                     /db_xref="GeneID:16994893"
     CDS             528664..529110
                     /locus_tag="CYME_CMM211C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537094.1"
                     /db_xref="GeneID:16994893"
                     /translation="MALSGRAEEGRTLMAVDLALQPAPALPKDGGAEVTAAIDLCAEQ
                     LQLMIQCLLEREADEFCQESLLLFAACKERRDNALRTRILGYDRRHGVQVSTLERESQ
                     EVAQALDREKQRQGERETLGVVHLTSRLQDLRARIKALTNGTESTD"
     gene            complement(<529682..>530446)
                     /locus_tag="CYME_CMM212C"
                     /db_xref="GeneID:16994894"
     mRNA            complement(<529682..>530446)
                     /locus_tag="CYME_CMM212C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537038.1"
                     /db_xref="GeneID:16994894"
     CDS             complement(529682..530446)
                     /locus_tag="CYME_CMM212C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537095.1"
                     /db_xref="GeneID:16994894"
                     /translation="MELANGAGCCCCDDRHVDTERPLDRMYEEGHEDPVSVITGLCRQ
                     FYQLGWVTGTGGGISVRQGRCVYMAPSGVQKERIRRQDIFVLDLETGEILQRPVSTPS
                     LRVSQCCPLFYNAFRLRDAGACIHTHSPAAVMVTLLPRTQADAEFRITHLEMIKGIPL
                     HGYHDTLVIPVIDNTAHEEELAGDMAKAMQRYPKSPAVLVRRHGLYAWGRDDVEAKTV
                     TECLDYLFDMAVRMQHAGIDYTEPPVDCRQCYASDV"
     gene            complement(<530494..>533187)
                     /locus_tag="CYME_CMM214C"
                     /db_xref="GeneID:16994895"
     mRNA            complement(<530494..>533187)
                     /locus_tag="CYME_CMM214C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537039.1"
                     /db_xref="GeneID:16994895"
     CDS             complement(530494..533187)
                     /locus_tag="CYME_CMM214C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537096.1"
                     /db_xref="GeneID:16994895"
                     /translation="MRRFSGGRTVHEVLKKLARSFCRQYMQRGSVIFGDRSSWLALSS
                     VLPLHELLELPVDIAAIYDWETPVRELAVRELWTSQVGAVIPIIFLIGCEVPSLLEDG
                     LISAIVERVLAVIEPLSIVTERDTDPSVADALQLRVLLFTTWTNAEAAQAWRVRQSAT
                     SWSASEMHHSSELSRDVGRGETSRESLGELFPYAALKARIEREVLRRYTATCAACRGS
                     PGEIPCQRHRRDLDVQSWILYAPLLAMYSAFPSQNLGVLSPGSCAWYQCIGFGDDVKP
                     WTHPRILFEQSLTDSLADAALRVSREVAALCAALKCSCTGAFVLGRAPVADAIAKRFV
                     ESLECAESEMADLELANYEGLRIDDLQRLESDLSATPVRMCVVFMDRLLDVASAVRHA
                     NGMDPAIHDWFGCLLASQGHVLEKVSRRFLYSESDAGSDLDWFIAPLGGVSGTRALLS
                     TGEFTEALLERQHDVAAFLSFVKKQLSFLATPQQTLANKAVHTRPAETVRCSSIAGPP
                     RPPRRKLGATRLGRVSTAGVGVENSQAVPSAMSHPDTEIANASSVEKTASLGDQVEQM
                     RTLIESVWDALEPRQRVRQSGLFIYAATAIWCAATMLQDADTKQHADPSVEAACTDEQ
                     RLQSLLQLARNWASAGFSLHHIMDELLDVISNQNLHRVVLPFLAYTCSVLDWKADASE
                     AERTRLSGAIEAAATRAGDAWIRDTANLLVDRLFELSSISAHNGPDYEAVASVWTNWL
                     NSTLVEAVQSGTANATQSMGVLTLPALLFASLEGANTNLSFHPRRKGSALAAIAEIIG
                     FPRESRGAQASNSNVPQLRDHDLILVCVPNGITVSELRAFQALSQYYEASHKQILYLQ
                     RGFQFVDRRKLLAVCFGVEGDGRIDELPAAGAVDQPAMRAR"
     gene            530603..532295
                     /locus_tag="CYME_CMM213T"
                     /db_xref="GeneID:16994896"
     misc_RNA        530603..532295
                     /locus_tag="CYME_CMM213T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461455.1"
                     /db_xref="GeneID:16994896"
     gene            complement(<535972..>537735)
                     /locus_tag="CYME_CMM215C"
                     /db_xref="GeneID:16994900"
     mRNA            complement(<535972..>537735)
                     /locus_tag="CYME_CMM215C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537040.1"
                     /db_xref="GeneID:16994900"
     CDS             complement(535972..537735)
                     /locus_tag="CYME_CMM215C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537097.1"
                     /db_xref="GeneID:16994900"
                     /translation="MDLSAQGSGVSPTHPGLREAPEPDLEAVSRPSAIICASECPICF
                     EQLASAGAHQICCLRCGHIFGRSCLERWLRQQRRASDRCCPQCKQRAQLCDIRLLYVP
                     GTHMERDARPGGNRTGAADERQLSHVQRDPATVQLVTREVDECEELRNALRVERKRRV
                     RMELELCRVRNELRTLQASSGREQRKSEPERLCTSAQIPGAAGTAELPPAMVSVDPRE
                     RAAASSDYSMLERLNIRFCGQTRCLLDRARIAYIHADRASIYVSTAVSDMKGVHDAQT
                     YTLKEIPLELMSSPVVPALDPDLHRGPIRDVTSNGQLLASASLDGNVSLVDMQTRLFA
                     AKIFVGEPLWSVKFANSWEHGIAVGSQRGLLRLFDLRKTLEPLGIFRCAVPSGGIHSM
                     HLDSVGDSCSEQLNFCTLQSLHTVEFSWSTLSGNHAVEAYRFPDLFSSPTQMYCMRVH
                     RRFMLLSGRRGLASDGEHVLVDVDHPSGQPLVVHRASGFQPGPQLCSTDFAMLPNRQA
                     PEDDPVPLLLSGDAKSPGALRCWAPGVISESFCLNLGVACERGSEQRFVPNVVADERL
                     GVFAAVAPESLSVFSWTRQKS"
     gene            <539866..>540561
                     /locus_tag="CYME_CMM216C"
                     /db_xref="GeneID:16994899"
     mRNA            <539866..>540561
                     /locus_tag="CYME_CMM216C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537041.1"
                     /db_xref="GeneID:16994899"
     CDS             539866..540561
                     /locus_tag="CYME_CMM216C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537098.1"
                     /db_xref="GeneID:16994899"
                     /translation="MDVANMKVAELRCELERRGLDTTGKKQELQERLQKALEQEAHGE
                     TSAAEAVPSKGDKEAEAESAEHGTRPERGDQQSASNQEQGALEAGAEDTGTGNLDTTS
                     APRASAPAPENSSSPEKETRKLTDEELEQFLTPAEREEVAKTMARAARFGVPYGGLPA
                     ELRRAALNRYRKRRRFEKALEKHGGLVPVDEAEEERRRKRMERFGLSKPVLELEAEER
                     ERKRYENKPEKTR"
     gene            complement(<540954..>541295)
                     /locus_tag="CYME_CMM217C"
                     /db_xref="GeneID:16994904"
     mRNA            complement(<540954..>541295)
                     /locus_tag="CYME_CMM217C"
                     /product="similar to single-stranded telomeric DNA-binding
                     protein Gbp1"
                     /transcript_id="XM_005537042.1"
                     /db_xref="GeneID:16994904"
     CDS             complement(540954..541295)
                     /locus_tag="CYME_CMM217C"
                     /codon_start=1
                     /product="similar to single-stranded telomeric DNA-binding
                     protein Gbp1"
                     /protein_id="XP_005537099.1"
                     /db_xref="GeneID:16994904"
                     /translation="MNGYQESELEGDLKTEEVAAQELKSDKRHQRNPACRVYVSNLAW
                     RTTWRGLKDHMRSAGEVTYADVYLDKETRRSRGCGVVEYEDEASAQRAIRELNETTLD
                     GRQIYVREDRH"
     misc_feature    complement(541685..543458)
                     /note="possible transcribed region"
     misc_feature    542378..542738
                     /note="possible transcribed region"
     gene            <544588..>545700
                     /locus_tag="CYME_CMM220C"
                     /db_xref="GeneID:16994910"
     mRNA            <544588..>545700
                     /locus_tag="CYME_CMM220C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537043.1"
                     /db_xref="GeneID:16994910"
     CDS             544588..545700
                     /locus_tag="CYME_CMM220C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537100.1"
                     /db_xref="GeneID:16994910"
                     /translation="MSFSFGSGSTPAFGSYNRGLATQSNAAQPSFGVGGVGSGDPTSV
                     GSVGGNAPRPGAGSALAAQGFAGTPNPPMDASRLPEALELCYYALDPTSPDYPFAFYS
                     YNRREDADAPQPGAETVQAPPCPPRPLAQLWIEAVESNPDPKKYAVVRIAGFPGLQER
                     AALQTRRLEELRRATEDIEQRISRLRVTFEQHIVNRLERIRAQHSLLETKFLTVVALL
                     ECTLVSRTAVETATGAVPPSAAGRSALVLKRDSVAESRLRARLDAVRKQLDGANGTRA
                     RALRALEATATVLGLDISSSPESIPAASASGKSGGQSSTIGRIRPADTVSERHLLEIL
                     ERERQGMEHVFEVLEHDRRETETLWRAARELIGPTR"
     gene            complement(<546173..>547093)
                     /locus_tag="CYME_CMM221C"
                     /db_xref="GeneID:16994909"
     mRNA            complement(<546173..>547093)
                     /locus_tag="CYME_CMM221C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537044.1"
                     /db_xref="GeneID:16994909"
     CDS             complement(546173..547093)
                     /locus_tag="CYME_CMM221C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537101.1"
                     /db_xref="GeneID:16994909"
                     /translation="MWTGIGSWAPYVFVWTAQRIGYSGARREPRCTRRKLTAAFASCP
                     KPVMRLSISRAYSSQLQQLRRDDRCHRSAGYLSGLYGCLREIERESVDHSVCCPIQYV
                     ASCTLYNVTGVGWRMRFEPDAHETAVPRSAARMDRLAGRVLPFLHQVRQIERTLQQVF
                     AESVSPCVRHVYPCLITDILRAFGGMRTNASILYCSKSYHARMAFCGIRLIARSGSPE
                     NAATETKLEMLFRRGTEHESGGVRLIASAAQRFRNLAYAFEVSELHAVVALHASSSPS
                     LRQIGDNPTALNPSVSLSHRARRLATSEID"
     gene            <548659..>550017
                     /locus_tag="CYME_CMM222C"
                     /db_xref="GeneID:16994921"
     mRNA            <548659..>550017
                     /locus_tag="CYME_CMM222C"
                     /product="similar to mitochondrial carrier protein"
                     /transcript_id="XM_005537045.1"
                     /db_xref="GeneID:16994921"
     CDS             548659..550017
                     /locus_tag="CYME_CMM222C"
                     /codon_start=1
                     /product="similar to mitochondrial carrier protein"
                     /protein_id="XP_005537102.1"
                     /db_xref="GeneID:16994921"
                     /translation="MLVMLGSSFLHPGQEPFHGSIADSSHWISSGSGYRWELGPALSL
                     NVMIASPTHTHSDSGVRQTTSAVPERARLVTLSKGSSSTGWCVSRRNITCEHVAFVAV
                     SKPMNEHDETQRTEVDIHTTQAAVLSSLNHRKQLASLMAGGFAGTFASTITCPLEVIK
                     TKLQSISSVGSGGKHATFLSVARNIARQEGVRGFFRGLLPTWVGILPARATYFWAYST
                     TKSVLAHVFGESDARTHVASAAMAGVVSNALTNPIWMVKTRMQLDTGGSNGFHYRGYG
                     DACRRILAEEGIAGFYKGLTASFWGVSEGAIHFLVYERLKKFLQQRQRAKLDEGVDQH
                     EADKLPAVQYLLAAGFSKLVASTLTYPHEVVRTRLREQRPVYPGGPLKYRSVPHALWV
                     IGREEGRRGLYCGMGTHLLRVVPNTALMFLAYELVSRWIEKYYAQRDEERTQKAARIS
                     TS"
     gene            complement(<550757..>551194)
                     /locus_tag="CYME_CMM223C"
                     /db_xref="GeneID:16994922"
     mRNA            complement(<550757..>551194)
                     /locus_tag="CYME_CMM223C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537046.1"
                     /db_xref="GeneID:16994922"
     CDS             complement(550757..551194)
                     /locus_tag="CYME_CMM223C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537103.1"
                     /db_xref="GeneID:16994922"
                     /translation="MPNRRLHDDVSAFVSLATGSVLGRQAEFPLKRTRFRECCRSRLA
                     RAAARRAVACNLNRQETESKKGPTRAKNQLGEGSRPASKTYGSSGATPKRLESIEGSR
                     KFRYIAGNKGPDIWLVVAILSILLPILFIAWAFKTGIVDPSGY"
     gene            complement(<554666..>557092)
                     /locus_tag="CYME_CMM224C"
                     /db_xref="GeneID:16994933"
     mRNA            complement(<554666..>557092)
                     /locus_tag="CYME_CMM224C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537047.1"
                     /db_xref="GeneID:16994933"
     CDS             complement(554666..557092)
                     /locus_tag="CYME_CMM224C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537104.1"
                     /db_xref="GeneID:16994933"
                     /translation="MASMKAGTHFENEDNGNVSTNSVTLTRHAVPAAWKGSSSLPYTM
                     VSCFSWADLSDSESDDENQTSRPGADLSKGVSIIEESKSMDDQVANALNKTVYDDLSI
                     QLSPLTSGTPTASSNWLRSLEARSALNLIHESCLGHSSTTEVKANVSKFPENGDRSDP
                     YSSVCESFDLFGYASRSCARSAPGKVASSRNCAKASQGTIEAADAEIALLPLRGENPT
                     EMGAQQGHKLWQSSRALLESTRRHGCHRNDYNERSSDQGFSLYAAVAERVELEEVIDA
                     AERASKAITNGGARLERPYRSGASGAYLIRNATGTQSVLGIFKPFDEETAGTELPLQP
                     ARMYFHPAEGAFKECAAYLLDHGHFANIPQTALAKCELVDNCGDTMTRKTKCGAFQVY
                     YRNRGDAEDFGPGVFDTESVQRIAAFDIRVLQCDRNASNVLVCDTSELLRHRGLLKDS
                     ESCEKECKQASQRTQMQLVAIDHAYILPEQVPTVPRACWMDWTQSQEAVLDSVRRYVL
                     GLDSFADVKLLTRELGPRALRKGSLRSLCVGTLLLKLGIQAGLTLYQIGLLVYGDASS
                     TRSAESWQSTRAARSHRTQDSSPEDYGRAEQSRFEGRSKLETAVLEAERVCAARDKRL
                     QSLFCERPTKPVGSLYVPLVDDDYGVFAFEEQLQAAIATSTSSGPITVSTAIAGPEQQ
                     HQEHQQPRNTSADAETPSNKTQGMFHCFDDAEADLVPICALESPFFCKYLSKRLTIEI
                     ERLKQSAPGTNSVAESGSVQSLMDMIAARRSMSPEAPVAKTSAPASGSSHPKHSGIRR
                     CSSEPNLQIP"
     misc_feature    558041..559315
                     /note="possible transcribed region"
     gene            complement(<558954..>560216)
                     /locus_tag="CYME_CMM226C"
                     /db_xref="GeneID:16994939"
     mRNA            complement(<558954..>560216)
                     /locus_tag="CYME_CMM226C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537048.1"
                     /db_xref="GeneID:16994939"
     CDS             complement(558954..560216)
                     /locus_tag="CYME_CMM226C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537105.1"
                     /db_xref="GeneID:16994939"
                     /translation="MPTMFVPSITNFCVYDRSTSTRTTLKTNTIGYDCFCSEVRKRRG
                     SARFTLRAQLAPGAGGSTPASGRNQPSSAGASRNWDERVELATPFGVAVRELLSLPAR
                     VATVAEQCRTEGGIPQAQSRFEKLREAIANGNMRSRLTAMQEAHFYPRSLVVPVLLQV
                     LRSAVEHARERNRLEGTGPSAADSSRPKNLSTLVLPDRVFDEMSRSQAAFSLAILLGQ
                     GQATSEAAVEEWRQMAVEALIEVLQEDLDPAARAASAGALGHVGSRCEQFKPMLVSPL
                     LGCFEKQSEDWIVRLSAAASLGLVRAREALLLFIEELNSHEVNSESGKSLLVQTVICA
                     LGDLAYADYSQSEMDQELLQRSVRAIERFTRSEDVLVRISVTESLGHWCRHSSKARAA
                     VESLLLDPNENVAKTARFALDTYAKQDQ"
     gene            <561819..>562973
                     /locus_tag="CYME_CMM227C"
                     /db_xref="GeneID:16994940"
     mRNA            <561819..>562973
                     /locus_tag="CYME_CMM227C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537049.1"
                     /db_xref="GeneID:16994940"
     CDS             561819..562973
                     /locus_tag="CYME_CMM227C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537106.1"
                     /db_xref="GeneID:16994940"
                     /translation="MAFVQLASRRTGGRNQFRGRAVDRTLAGGVRHPSERGTVKFSSG
                     LRLQLTPGFPHSKDTGRSGRSDREPAFSGDADALRLPALTRAALSLAPALVTVSAQDT
                     SVSRSKAGGASGTSPMNSSAVASWPRTELTTAAFRYTFYSLGSNDNLYKQTLQAEIQS
                     KLIHVGTEGAALIVRVDPSYVAWVDDAQITEPRMPGTLADRVGGRPLSADAHLRGGSP
                     GPYHATESMRSEFVADVEHGTGRKPHFDRAAYKRLDENQRSSRPCPRALTSPYIAGGA
                     LPSDEEGLAQRCRLYIEGEVTHALPCNASFHGPSPPECFIVRVLRRCQNVFRQFAGSE
                     PCSASPTTIEESVEDFCIMCSAQRGSAECRSFPATLGTGINVALNALSAT"
     gene            complement(<566305..>567504)
                     /locus_tag="CYME_CMM228C"
                     /db_xref="GeneID:16994941"
     mRNA            complement(<566305..>567504)
                     /locus_tag="CYME_CMM228C"
                     /product="unknown hydrolase"
                     /transcript_id="XM_005537050.1"
                     /db_xref="GeneID:16994941"
     CDS             complement(566305..567504)
                     /locus_tag="CYME_CMM228C"
                     /codon_start=1
                     /product="unknown hydrolase"
                     /protein_id="XP_005537107.1"
                     /db_xref="GeneID:16994941"
                     /translation="MASASSCFCGQIRLRALNPPKTCTSNYVGCNGRLLRPNGHRWLV
                     ASAANAPQQRGLEFANGPSPKPKIRAIASDMDGTFLARDHSAPKRNIETVLDCMQRGI
                     LFLPATGKSRAGAMASIGPLAKHLTSNGRHGAPGVYIQGLVVHGLEGELVYQRTLPRE
                     TARELVRIQRQLRFGSLVAYSGDRIICEKRNEYTELLIAYHEPAPDDSFGEVWERILA
                     RPEQELPIHKMLFVDTVERIRELRPLVEDAMGQNSGSAAISDGGYNTKMQDDTGNGAP
                     KSMNWTPAERNPCKAVETDMRPSPRGRCVQACPEMLEVLPLDANKGNGLQRLLHHLGI
                     LPSEVLAIGDAENDIEMIRNVGLGVAVGNALPQLKKVADVVLEETNDEAAVAAALERF
                     VLCPSKA"
     gene            complement(<568723..>569991)
                     /locus_tag="CYME_CMM229C"
                     /db_xref="GeneID:16994942"
     mRNA            complement(<568723..>569991)
                     /locus_tag="CYME_CMM229C"
                     /product="3-isopropylmalate dehydrogenase"
                     /transcript_id="XM_005537051.1"
                     /db_xref="GeneID:16994942"
     CDS             complement(568723..569991)
                     /locus_tag="CYME_CMM229C"
                     /codon_start=1
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="XP_005537108.1"
                     /db_xref="GeneID:16994942"
                     /translation="MSFSATCFVNTFPKNVSYSREQRFQKLVKNCPASRAPTRRRAPR
                     RTCLVAKVARHRIAVLPGDGIGPEIMNVTLEVLRTAGRRFDVEWEFLEAPIGGAAIDA
                     AGDPLPVETLSLCRRAEAVLLACVGGPKWDNLSSKQRPEAGLLRLRKELEAFANLRPV
                     RTFSQLLDASPLKSELVAGVDLIIVRELTGDVYFGEPRGIEFIPEGNGEREAFNTMLY
                     RESEIDRVAKVAFELAMTRPRRKLCSVDKANVLETSMLWRSRVSTMAASYPDVEFSSM
                     YVDNAAMQLVRYPKQFDVVLTGNMFGDILSDEASMISGSLGMLPSASLGDGTFPAIYE
                     PIHGSAPDIAGQNKANPMACILSATLMLRYSLNRPDMADAIELAITNVLDQGYRTADI
                     MSAGKRLCNCSEIGDKILEALQESAVSRVA"
     misc_feature    569381..571610
                     /note="possible transcribed region"
     gene            complement(<571763..>573688)
                     /locus_tag="CYME_CMM231C"
                     /db_xref="GeneID:16994944"
     mRNA            complement(<571763..>573688)
                     /locus_tag="CYME_CMM231C"
                     /product="6-phosphogluconate dehydrogenase"
                     /transcript_id="XM_005537052.1"
                     /db_xref="GeneID:16994944"
     CDS             complement(571763..573688)
                     /locus_tag="CYME_CMM231C"
                     /codon_start=1
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="XP_005537109.1"
                     /db_xref="GeneID:16994944"
                     /translation="MATTAGTRRSPSGGALCWAAAPVAAVRFGRWAPPRAHSWTPRRT
                     YPTWSLSLVRSARWCLLRGRRAQVCGAAVMSATEGSSPSSAVRESASSHPAGRAISDA
                     GVIGLAVMGQNFALNLASHGWRVSVYNRTYARTAETVERAQRELAADDTTASGSVTGF
                     ADLRSFVLSLKRPRRVFLLVKAGSAVDATVEALAEVLEPGDIIVDGGNEWYENTERRA
                     ASVAARGLLYVGMGVSGGEEGARYGPSLMPGGSREAYQQLAPLLEQVAAQVPGSGPCV
                     TYIGPGGSGNYVKMVHNGIEYGDMQLIGEAYDLLRGAVGLDAMAAAEVFASWNAGALQ
                     SFLVEITARILRVPDTSSSAASAPALVDQILDRSESKGTGLWTMTEALRRGVAVPTIA
                     AALDGRYLSARKDERERASRVLRGPERLSGTGHASELAAAGASPGAAGAVAETGPDTA
                     PERVAALASGSVRASASTSRSDASAERALIAAIEDALFCSKLCSYAQGLSLLQRASGE
                     QGWSLDLGELARIWKGGCIIRAQLLERIEGAFRRDPSLPNLLLDADLAAEIGRRHESW
                     RRVVGLAASLGVPAPALTASLSYYDTYRQAVLRSSQLVQAQRDCFGSHGYERLDDPGR
                     RWHTRWLSGGDSAEVSS"
     gene            574301..574430
                     /locus_tag="CYME_CMM232R"
                     /db_xref="GeneID:16994945"
     rRNA            574301..574430
                     /locus_tag="CYME_CMM232R"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_002461456.1"
                     /db_xref="GeneID:16994945"
     gene            complement(<575141..>578308)
                     /locus_tag="CYME_CMM233C"
                     /db_xref="GeneID:16994946"
     mRNA            complement(<575141..>578308)
                     /locus_tag="CYME_CMM233C"
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily c"
                     /transcript_id="XM_005537053.1"
                     /db_xref="GeneID:16994946"
     CDS             complement(575141..578308)
                     /locus_tag="CYME_CMM233C"
                     /codon_start=1
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily c"
                     /protein_id="XP_005537110.1"
                     /db_xref="GeneID:16994946"
                     /translation="MVPPRKRRSRTAREQQGNGTHIPDGNKSTSTPSEEVRTGAAADA
                     REDTAFPSAEGQRPADSRRKRVKSCNISMKDYEDPHQIAKFEAISAQLNAESPEQLGF
                     RPGDSVDVSPRALSLLTGNLLQFQERVLGRNSVEPPEIRGFMTKLPNRLFHDYSAHGS
                     LRTIIECCFRFRVARGIRRFDLHKPDMTGVFLEMLQEVERELIKRKQLQMPRLFFAPA
                     LGSAEIDRLSAIARKHGASVVSSPREATHIVYPDPPGTTEAETEAEDYCVSLKRKGNQ
                     VLTHWWYFPDSYDSWIPAQEVEDPDGELHGEEENLSGVIEGKIWHVQKRFLEDCEKFN
                     EWCNENDYEVIPEEEKLNVDEWKPPSASRIDGHLRGSESKTAAPTPSKRKSAEPSPVK
                     PEPDGTPERVTVRAVREESAEPMKIKVRLAPPIASQDAGSSSNAPAEQVPAPNIAGPI
                     TFTTETCAAVDAEQPSAAAGAAPRISRPTVRPLVPDDATLRMRNVTASSRDEQLQKRL
                     AQQREALRERRKERNDAAAAEEDALPGPAAHAPRDRESLAPRRVAEALGGLAERETLP
                     AAAAATAIGEKSPIRVPAHSRWFRIDAIHDIERRALPEFFSGKFASKTPEVYMLYRNF
                     MIDTWRQDPTRYLTGTAVRRHLAGDVGAVMRVHAFLEQWGLINYGVAPETRPQTVSGG
                     FSGSGATLISTSSGSLAASSAGLEGGLPRIFLFDDGSRIPKSRMHLAPMATRRELYAA
                     AAAIEYQCDVCGRDCSQRRYHCLLKADMDLCPECYHQGKFPEDFNGKDFIELRPVLSL
                     GSAASATGTLTAPSTDDWTDVEVLQLLEGIEAYGDDWDAVAQHVGTRSRDACITKFIR
                     LPIEDPFLEDDLSRLAVPAVAGETVQTERNEPPLFADAGNPLMAHIAFLANSVSPDVA
                     AAAARAALAAIMKSDAPPEALADANAIQAVAATALGAAATRAAELAAIEHLELHRATE
                     QAIETQVRKLEEKMNVLEQLEEEFLREREQVEIYRKELFAERLNLVARREALSSTATL
                     GASPATALNASIPEWTVARDTRKQC"
     misc_feature    complement(578410..581407)
                     /note="repetitive element"
     gene            <581758..>583107
                     /locus_tag="CYME_CMM235C"
                     /db_xref="GeneID:16994947"
     mRNA            <581758..>583107
                     /locus_tag="CYME_CMM235C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537054.1"
                     /db_xref="GeneID:16994947"
     CDS             581758..583107
                     /locus_tag="CYME_CMM235C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537111.1"
                     /db_xref="GeneID:16994947"
                     /translation="MDHKVVALKWDSRSLQLSPRPIGTYLRADGRLGRRRRQGSSGQP
                     GADSVLSDGVLEVASSRSAFLSKHDTSALTSEEGTRRQRVWSFALPLSRRRFSEAEEE
                     ARGSSLKSSVQPRATRKQPSWKYLVSGALAGVISRTAVSPLEVVATMNMSTSLATRNF
                     IHEMIDIFRREGLPGLFKGNLANCLKVAPTKGIQFVVFETFKRLMARRRQWSQVRRAA
                     RFPEGNVLVEELDDIELTAGERLIAGGIAGMGAAVLCYPLEVSKTLLTAEPGRYRGVF
                     GTLRSLVRERGFQALYRGLVPTMIAMFPYVGLEFMVYEQLKITLANKRALAMAAVGKG
                     PEGASPNARLGRQPSSDQLPVGVLLLIGAIAGTVAQTACHPLDVIRKRLQLQGIGNRP
                     VQYKSMIHVAQEIIRNEGGVRALYKGLSPAATSVFPSAGVSYLVYEWCKNALGAKSF"
     gene            <587189..>589609
                     /locus_tag="CYME_CMM236C"
                     /db_xref="GeneID:16994948"
     mRNA            <587189..>589609
                     /locus_tag="CYME_CMM236C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537055.1"
                     /db_xref="GeneID:16994948"
     CDS             587189..589609
                     /locus_tag="CYME_CMM236C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537112.1"
                     /db_xref="GeneID:16994948"
                     /translation="MELVVTRDGFGDSEQSTPLTAVRPDTTCNEDVDEVTGQVGPAPA
                     SEPEKFWVHLGQLLGAFGSFRVLTEFLHRFLEAEASIAGTASHSTSAPCSCTEAVRSA
                     GQHASSQSCCMHGTGSRFRMSLRRYRNWLVPLTACDLENELDAISPEPAAARLGNTAP
                     LYSAGQENPSAQISDVFIQKKARNRYLQWVRLRAWLQERLISCAHMRLPSFAPRWSEF
                     SMENLPSFENIRKSLFLMNWRCMWSSLPESAVTVGTRRPADHRDSLIFTCWFSKKDTI
                     TEKSCRKKRLWSSRLLWRAQTTNDGFTRIHGATRSSRCSASESVPKSAELDRDANTSE
                     RMCDGDPTPPQPASVAMHSSPQVQHEQEDARQLRWLYRLPWTQRKWIWCETDESTHPG
                     AEGSRATGNNQNARSIETWRVLDSLSLDLNRVSSWLTARRLSSTFEEWDADEEPPLDP
                     SAPLIISAARSSTAEDDSPRFNLLHGVTETAADTQESIQADTQLDAANHHQGNSPGSL
                     RSASAGQSRMRMEFTSDEHTVFQDDSSASGSRVPRHLREPIQRLTMNLHFLLDNPHLN
                     VAPYERLANMGSSSFDDLSALDHAQRHLGNVENLRTHSGLDPETIERYTLVGSVTEEG
                     IPVIGTLNPGPLDLEHSSTWNSNDDSGADNANQVTRMASDAARVSAPGECCCVVCLEP
                     MRRAEIVRILPCCHFYHKDCVDRWLQRHKRCPVCNGDIEQLALAFSDPSAGCDSGTQG
                     ANGSARVAIRGGHAASRRDRLRRRYRAGDRAPSPALFFPNEDPLDLIEADGAWWDWFQ
                     GPAPHELE"
     gene            <590729..>591862
                     /locus_tag="CYME_CMM237C"
                     /db_xref="GeneID:16994952"
     mRNA            <590729..>591862
                     /locus_tag="CYME_CMM237C"
                     /product="actin"
                     /transcript_id="XM_005537056.1"
                     /db_xref="GeneID:16994952"
     CDS             590729..591862
                     /locus_tag="CYME_CMM237C"
                     /codon_start=1
                     /product="actin"
                     /protein_id="XP_005537113.1"
                     /db_xref="GeneID:16994952"
                     /translation="MTEEEITALVIDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQAV
                     MVGMGQKDSYVGDEAQSKRGILSLKYPIEHGIVTNWDDMEKIWYHTFYNELRISPEDH
                     PVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVVDSGDGV
                     THTVPIYEGYALPHAIMRIDLAGRDLTDYLAKILTERGYSFTTTAEREIVRDIKEKCC
                     YVAQDYDHELEIASSQPAKIDKQYELPDGQIITIGSERFRCPEVLFQPSLIGMEGEGI
                     HNVAYQSIMKCDVDIRKDLYANVVLSGGTTMFPGIADRMQRELASVAPSSVKIKLVAP
                     AERKYSVWIGGSILASLSTFQQMWISKAEYDEFGPSVVHRKCF"
     gene            complement(591017..593181)
                     /locus_tag="CYME_CMM238T"
                     /db_xref="GeneID:16994953"
     misc_RNA        complement(591017..593181)
                     /locus_tag="CYME_CMM238T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461457.1"
                     /db_xref="GeneID:16994953"
     gene            <593511..>597185
                     /locus_tag="CYME_CMM239C"
                     /db_xref="GeneID:16994956"
     mRNA            <593511..>597185
                     /locus_tag="CYME_CMM239C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537057.1"
                     /db_xref="GeneID:16994956"
     CDS             593511..597185
                     /locus_tag="CYME_CMM239C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537114.1"
                     /db_xref="GeneID:16994956"
                     /translation="MERRASGSRAPLTPVQPVSEDVPQSRGRTPEETRQTTPERALKR
                     ALSPTFSEKTTKSKTNSIHSSKNKRVSFGGQEVKFYERHEFEWSSPPAPSPSRRQSLE
                     PQGDHAYPGVASSSFAGRVSNTPSAYEHEPNVRAAAAKTHTGNNTLDAPSPHRDLPHL
                     LATACPTVGSMESDDDNTIQSGSSLSEATLAQVAYGIRSYASGAADDATSSTNEDDSL
                     QYRERFSGSSEGLSLFMDEDITKAVGHPRMSMPLTGTTSLTRSVTRTLLTGGERFGRR
                     ASLSRPPLPRPRRSSRLSTGSWRATSNVDYQGTTRGNRRDSIDDNITGKVPSLAALID
                     ADSEETAVGDRSRERFAHETDAGDNIRPSSTPGKLRYEDEPPKFPSIQEGSSSQEPSL
                     SHHSDSGRNCANSEDTPRWRSLWSTDIRDAQLGIVANTSPTVATCVPPRKESNSPIAG
                     SISEVQRDEESGGLTTVPETSALLEDITGQVPRLTALIDEDNEISDLHLQQMPQGNGN
                     SQISVHGGVCRVASEQANSASRSFAADTKSPALSPDLTARDLIPQQSESPQRRVTLGS
                     VGAPIQQSTRSMHGFDTSTSVARRRSLAASVRRLSMKASLVQTLSASKEIHLREVHSG
                     MKANSHSKLGASPEAEPLGRVLQERYSNQIVRLERDPNETAKTVVATQSSTIGKGAPR
                     DDTGLESSSLPASEASVASAPGNAVFKDFLYAAGVRFLDDLSTRRRITSFGVPSNRIC
                     VQPDSLEQHIRVACITVALLGAFQYSCEVLASENGKLATEIAKAEEEFRTRWLFTRLI
                     ELHFSGSEPNLLTRYQLQLKRLKNVGRLRARCEWYLWRARHEQRIQVQLRAQQENLQN
                     DLAQLCGLAENLRATISAATEDAITSGLGQLSTDPKLVHERNLHNQNTLRHVEERDAQ
                     IQETRSRLEQLHHELNRLSEHKAQLATECLALRTRHQELQAKARLGDAASCSLMLAEQ
                     QDSFDILVSLTACRPISISNDTLCVRVGSTVDIRCSFVQEKMPSDACGSLVLNNVQAC
                     GVTPPNEATEAPILIERVAQAVVASFTAQQREHFSVMRAISGRPLWQLRWVLFAVARA
                     VTELQALLRNISIWKRTKPYEVEYRESHDHAGLVHALFSDITKHIRVEVILKLEPASQ
                     ALCGIQLRLHDIVWHLPNRCERLSASFVAIISNNLEQWARREQDVEVAPPAQHVRLAA
                     LIETTLDAVAQTLQEARHAP"
     gene            complement(<597375..>597647)
                     /locus_tag="CYME_CMM240C"
                     /db_xref="GeneID:16994957"
     mRNA            complement(<597375..>597647)
                     /locus_tag="CYME_CMM240C"
                     /product="40S ribosomal protein S25"
                     /transcript_id="XM_005537058.1"
                     /db_xref="GeneID:16994957"
     CDS             complement(597375..597647)
                     /locus_tag="CYME_CMM240C"
                     /codon_start=1
                     /product="40S ribosomal protein S25"
                     /protein_id="XP_005537115.1"
                     /db_xref="GeneID:16994957"
                     /translation="MAGKKKWSKGKTKEKSDHKVIFDPETHDRLLKEAAKYKLITTSV
                     LVERLKINGSLARSAIRELIAKDLVKPVSTHQAQLVYTRATHGAAE"
     gene            <598071..>599501
                     /locus_tag="CYME_CMM241C"
                     /db_xref="GeneID:16994971"
     mRNA            <598071..>599501
                     /locus_tag="CYME_CMM241C"
                     /product="similar to transcription initiation factor IIF
                     beta subunit"
                     /transcript_id="XM_005537059.1"
                     /db_xref="GeneID:16994971"
     CDS             598071..599501
                     /locus_tag="CYME_CMM241C"
                     /codon_start=1
                     /product="similar to transcription initiation factor IIF
                     beta subunit"
                     /protein_id="XP_005537116.1"
                     /db_xref="GeneID:16994971"
                     /translation="MRFGGGRASRNKSRTWSRSRWRRRKRSVYAQSYRGGGEGTSAAV
                     GLLDVTNRDRGLYVLRMPRFLGEILDKCAERELQAAVELGTGAKTALPPGTGTVIGRL
                     RVSSALKPFEDGAVSSHEAARAPNSGNVVAQVILDEPVLRSHVPESWEEAASDAVERN
                     QIPTRYDLRIYEENPNMQVFSIDSSDPYAPARLEGTVLSIGGLQPRLDDALRAMHRRR
                     ATMHQTTVRKAGKRIRSISDADLRQEELKRLRPDAESQPALVSGLMARSASKASGETP
                     VSGPAFIGVRRAAQEIESQFARQIENRLQTRLLRRDASSRAIVDAKDENEWRESVTTR
                     VFRLFEEQFWWRLQDLAENLQIPAARLKPVISELCDYNQRGPYRGMYSLKDHLKTENQ
                     RAMMDTLFQRRAAELEAARRERDQERENRRREREAVERAAKRAQLVAESDYVDSLIQR
                     DGETDLGERQDGDDGEASDVDYLDES"
     gene            <601692..>603974
                     /locus_tag="CYME_CMM242C"
                     /db_xref="GeneID:16994972"
     mRNA            <601692..>603974
                     /locus_tag="CYME_CMM242C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537060.1"
                     /db_xref="GeneID:16994972"
     CDS             601692..603974
                     /locus_tag="CYME_CMM242C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537117.1"
                     /db_xref="GeneID:16994972"
                     /translation="MHASHKVNHFLKYLVLTFAFVVLCSLQPKRPCGGSDVVRLRAYQ
                     RNYGKLQPLHLTVRPGHVLTSCRHFCTDEGVCRPIKFEQRRLRFLEKFCGEQRVALSG
                     PALLFLKPSRFTLQCSKTANSFEVLSQGPMWLDVHRVRMMSGTDSPTAVSQHTRASPA
                     NTGPFDTNRFRRENASSELLVHYVSDPLSVGESRYFVSHIEFRISQLPEVHDAMRNAS
                     AGNRNSAQAVSVRFVPTDPNKDPRPYLVDPVMSRQVVHAWSCGNEAASRKLQACAHYI
                     PQRRSVGELASLWMLILGVIILAGQNHYRGARRESPRSLKSTPQGHNWSRISRQRASS
                     LDDGVHHIPVDCEHGVHRGLDRPGSTVARASHVSDTSKPLESASAFGVSTANTIEAPR
                     DSDMHATCARIPTPAWASRTFLILFLILQNSAMAFFYFIGIFCPPSSCVKLVAIDVAT
                     ALACSVGAACCTELWSLVCWIDCESGNERASIGEAQDVPLEKTPPDVSAHAANVEPIA
                     ASVSNGKRAPLTDNYSPGAGSAEPWNESASKGSIFRTQCGALPRLAARHSERLRLLER
                     LNFNPLMLWFFRIFQWKRSTFWLIRDTNIIPCWFTGPVIYYLGLRLLITLLLWSGEPS
                     RPEALFVNLQAMIPVFLGSSLGAKVARSIRSRQVPRWFSKVQQTEIFQVSPARILQVW
                     FLVDVLLNGWFYPGAGRPLPFTLIFRLPRACAGDFLDNLTEYSNSDEKLYLAAYQLLP
                     WYGWNAICKLFAALVLFVEA"
     gene            complement(<605258..>606661)
                     /locus_tag="CYME_CMM243C"
                     /db_xref="GeneID:16994870"
     mRNA            complement(<605258..>606661)
                     /locus_tag="CYME_CMM243C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537061.1"
                     /db_xref="GeneID:16994870"
     CDS             complement(605258..606661)
                     /locus_tag="CYME_CMM243C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537118.1"
                     /db_xref="GeneID:16994870"
                     /translation="MACLRVAFTPSGAVSSEKFLIRRRNCTSVRRARSGTSFATLPRC
                     HVVQRSAEEPRSHALCTVLERKRASLPFNPKVWTQGSASGTESPLASLCGGGYGGNSG
                     HSGGGGGSDGGRGRNERPDGNDENGPLSLLTQLGALLFCIWRRLGDTNPECLRASLFG
                     TVLLATQFNENPHTRRHVAGSVVDAAAFVGDSQRPVVILLSWLGAQQRHMVKYAEWYR
                     DRGYDVITLFNGLQTALIPAFSRRQALRVLHLMDEIPENRPIVVHSFSIGTGIYGYML
                     DIIQRGQYVTEDMGRKLQRQIRGVIFDSGPGHMQASSLAQGLYAACPKVGYRVWNAVA
                     EALFRFLNVAEGFRAAEHALQNVQLPSVPQLYLYSLDDSIVKDLDKSVREYIDAQRRR
                     GLEVYQKVWEQSQHATHFKVHPEEYKAQVESFLKRALSDVEVGMRGMLDKLHEATGDS
                     ESKANPTSITAAPAAAK"
     misc_feature    complement(608451..609092)
                     /note="possible transcribed region"
     gene            <608990..>613375
                     /locus_tag="CYME_CMM245C"
                     /db_xref="GeneID:16994872"
     mRNA            <608990..>613375
                     /locus_tag="CYME_CMM245C"
                     /product="similar to RING finger-like protein"
                     /transcript_id="XM_005537062.1"
                     /db_xref="GeneID:16994872"
     CDS             608990..613375
                     /locus_tag="CYME_CMM245C"
                     /codon_start=1
                     /product="similar to RING finger-like protein"
                     /protein_id="XP_005537119.1"
                     /db_xref="GeneID:16994872"
                     /translation="MPLGCGARFLNGSGCAPGNDVSVDLNGKVPEFIDMQPCREKSHS
                     AARLSIVSDDSNVHAADQARLRIIARDVRPLNVTKPEIASVRLVERSVQQDQGTHVSI
                     DGYSLLLSGQVAGYLRTLQQFLDFEVLECVKQEIDRQIWFVVSLTPHLKKEPPENATI
                     GLIPGKRSATHDSFLWLARHLLMERLFGSTLEPSPRIPSCGVYPCTACDARDNRHSAT
                     PKRFRLAQVIRVLPSKLKAFLHLKHRAMQHLENIYASAYTQCSSLQTLPENVLVQIFQ
                     HTDSPTILALGQLSSWFRCLTNPIVPELNVELFKHQQAAVLWMLSRERHREHRCGPVA
                     PLPQWKNPLLQHLDGDLYFNWMHRRLERNQSTCYDCRGGLLCDEPGLGKTVTALALIA
                     RTRSTIPAIPLFSVDVEYFGSSETDLAVFICKQTLQFLDQVIEKARARLSRASLDEFT
                     QDVGAVRSRLEEYSDMFHNHINGCCTGQVPELLRFLGNWLQCHEGVLSSIVGSVAAKG
                     AIGAYLRLVVQQNPYTAKTCVLPPSEMLYVQPGREKLWFFIVSGKYLQGPSGFLRLAS
                     EGIPAASAAGARLCRGASRSTILECAGLCALANEHTGNQGADGTLLMEPSEYAQGPSA
                     AIEPFAMPFRRRCKSRRVPEIECAFDYHLIVCVPTTLVALPENLIPHWTVQIRRLVRA
                     PHELRYCLFSQIRNAVVREIADYDVVFISLNELRSEYSSLVRGLSILNRVYWLRMIID
                     EGHSLGSLSCTSLQRCCLIVLAERRWIMTGTPTPTTKSGIAEVHHLYPLFSFLGLEPF
                     VWARRAVFQQCVQRPLERALGYEGIHILQQTLDHIMIRSTKEEVQDIPHLEVRDEMLS
                     FTKEEADAYNALVSVVKRNLFLADFFDENHRESLLNPENRKSARVVLQNLRLCCCVTG
                     HMKFEVIREELEELLRTLRQSMQAAKDNTSPSLGFRCGAKRHVPETNQDWWSPCSGDA
                     IADFENGMDRAVSTGSSTLAQSSDCKRRRAQVLMKHDHSAWNALDAAPAAPVRRCLWS
                     LSPSLAAGNLDPELAQTGTQSTAVEALRYPMQAFESTGIETGPFAQRCAQPLPPAESP
                     GEHCGGPPALGDAGADIAAALSPVDYIEDRLRHIERVLRDPVYAQGCICESCGRIGSL
                     MPIVTPCAHIQCLDCAATNRYACNICGRKYVLGRRQEPVDLIEMQPSFTQEAWVPRWD
                     RKMTSKIARMLQLLGEWSSATYTASREGAPCSDQGGNSRQSCVAHGKREKVIIYSNFA
                     HHFDVIHYHLCQGNFDFAYYCSRLSPTERRAQIDRFIYDPHTWILLMDEKGALGLDLS
                     FVTRMIIMEPVWNRSQEHQIISRAHRIGAKQRVIVYRLMMVDSVETDLIDMSSEPTHQ
                     NGTARNSDRLSDAGETDSYQYSGVDASPKKSSGISLSNKEKEEKLRRNRLLQRLHFVV
                     AASGRPGTIAFRRVQVFRKGAAPMP"
     misc_feature    complement(614349..615366)
                     /note="possible transcribed region"
     misc_feature    complement(617056..618870)
                     /note="repetitive element"
     gene            <621626..>622900
                     /locus_tag="CYME_CMM247C"
                     /db_xref="GeneID:16994874"
     mRNA            <621626..>622900
                     /locus_tag="CYME_CMM247C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537063.1"
                     /db_xref="GeneID:16994874"
     CDS             621626..622900
                     /locus_tag="CYME_CMM247C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537120.1"
                     /db_xref="GeneID:16994874"
                     /translation="MLKRSSKVDLPCFLIRWPEASLRLSCRKIATFSTPTKRSHTSGV
                     ELRALQRTRASCLDRRPITLNGLQLAEDGSAHPVRNELFYHLVEGRRRVRADAKQPRF
                     QVSPSYEYGAVAPGGGSGDGTRSRKYGGDNDDNEEDRALDPEIEALLRREERGVSSLP
                     EEFQRKVGEGSLAVKDLKRLLIIEKIPLIGALASRWPGLRSRLVANPRFMSVMAVELV
                     IGFFSKSAAEVKQRGRNFWSEFDFYLSDIMLELVGDFSLVWLLSPTMNAYRMPATNSA
                     FTSLLGHLERLPKFALQPGMQYTLGQRSACLLLKGLQFGAVGFCASVVGHSLTKLLVY
                     SRRCLGPQSASSSVKLAPVLANSISWGAFMGLSSNLRYQAVSAVEARMLEPLLAGAPA
                     IVFTTISFLLRFANTYIGGVHWIQWARWTGVQ"
     misc_feature    complement(624697..625184)
                     /note="possible transcribed region"
     gene            <625921..>627066
                     /locus_tag="CYME_CMM249C"
                     /db_xref="GeneID:16994875"
     mRNA            <625921..>627066
                     /locus_tag="CYME_CMM249C"
                     /product="phosphoribosylpyrophosphate synthetase or
                     ribose-phosphate pyrophosphokinase"
                     /transcript_id="XM_005537064.1"
                     /db_xref="GeneID:16994875"
     CDS             625921..627066
                     /locus_tag="CYME_CMM249C"
                     /codon_start=1
                     /product="phosphoribosylpyrophosphate synthetase or
                     ribose-phosphate pyrophosphokinase"
                     /protein_id="XP_005537121.1"
                     /db_xref="GeneID:16994875"
                     /translation="MFLQRPSSKVLFTCSTAAVADGRSRLSAKRTNRATCCSKRGNTA
                     VWCLQSAEPPALAPSGGVFFAPAKLKLFAGSSNKELAFGVARYLGKEGPDELICKNFA
                     DGEKYVRLVQSVRGCNVFILQSTCQPVNENLIELLLMIDACRRAHAFQIIAVIPYSAY
                     ARADRIFDLDSKRREALTSKLVANLICESGADRVILVDIHSPQSCGFFDIPVEHIYAS
                     PVLVDYVQTCLENLGNIIIVSPDIGGVARARAYAKALGDAPLAIVDKRRDSRTKHEVM
                     NLVGDVAGKVAIVVDDMIDTAATVYSAGQLLRSSGAAKVLTLATHAVFSEVALKRVSS
                     GLFEEVIVTDTVPVPPEKQFPQLRVVSCANLIGEAIWRVHEETAHAL"
     gene            complement(<627374..>627973)
                     /locus_tag="CYME_CMM250C"
                     /db_xref="GeneID:16994878"
     mRNA            complement(<627374..>627973)
                     /locus_tag="CYME_CMM250C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537065.1"
                     /db_xref="GeneID:16994878"
     CDS             complement(627374..627973)
                     /locus_tag="CYME_CMM250C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537122.1"
                     /db_xref="GeneID:16994878"
                     /translation="MATKSFGVSGTKLLMGFVQLHRGAGQLETAWGRFRNFSAACSRQ
                     QHIVHHHGTFSPRARGLRLYSAISSQTPSGNSHPDFQPQRKQQPSDADWADVMERIER
                     DVMSSKVVLYMKGEPEAPLCGFSYKAVSILKAMGVPFQSYNVLADPLLREAIKKYSQW
                     PTIPQLFVDGEFIGGSDIMESMYRSGELKQILGVYGKAT"
     misc_feature    complement(627983..630616)
                     /note="repetitive element"
     gene            complement(<632681..>633514)
                     /locus_tag="CYME_CMM252C"
                     /db_xref="GeneID:16994879"
     mRNA            complement(<632681..>633514)
                     /locus_tag="CYME_CMM252C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537066.1"
                     /db_xref="GeneID:16994879"
     CDS             complement(632681..633514)
                     /locus_tag="CYME_CMM252C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537123.1"
                     /db_xref="GeneID:16994879"
                     /translation="MLGTLRSYLLRPLTTRGRSHWHAVPSRALVAVAERPAGPGGVQK
                     RTERVVPSEAARQERTARLRRAVDLLQNRIYPFLEQKVAGEAERKDLLAVLEQDSSRF
                     EDERAIRDWVESQIQEAIRQGAFERLPRGPLQLPQPPLGVDLVTYTMHGLLQRHGLRP
                     VWIECMHEVDAEVKRIRLALERAYRARVATAEDTSPASTAQRAERWEAAARELQEQMH
                     QVNRRIDAFNLMKPERLDTVFRLRMRWEHEFMRVKQRVESEYSAEPRSSLAPEATDPK
                     A"
     gene            <635911..>637083
                     /locus_tag="CYME_CMM253C"
                     /db_xref="GeneID:16994876"
     mRNA            <635911..>637083
                     /locus_tag="CYME_CMM253C"
                     /product="60S ribosomal protein L3"
                     /transcript_id="XM_005537067.1"
                     /db_xref="GeneID:16994876"
     CDS             635911..637083
                     /locus_tag="CYME_CMM253C"
                     /codon_start=1
                     /product="60S ribosomal protein L3"
                     /protein_id="XP_005537124.1"
                     /db_xref="GeneID:16994876"
                     /translation="MSHRKYEAPRHGSLGFLPRGRTKRHRGRVRSWPRDPGPAVPPHL
                     TAFPVVKAGCTHVVRQIDRPGSKVHKKEVAEPVTILEAPPIVICGIVGYSETPRGLRA
                     IRTVFAEHLNDEVKRRFYKNWYRAKKKAFTKYALAKYSMGEYRNDLDTIRRHCSVVRV
                     IAHTQQRKFRLRQKKAHILEIQINGGTIPEKVDFAERLLEKTVSIDDVISNDEMVDTI
                     GVTRGKGFEGVVTRFGVRRLPRKTHRGLRKVACIGAWHPARVQFTVPRAGQRGYHHRT
                     QMNLKVYRIGKKGDGKSATTEYDLTEKGITPLGGFPHYGVIREDWVMLRGAVQGPKKR
                     PIILRKSLFPQISRRAQEKIELKFIDTSSKWGHGRFQTAAEKARYMGVLKRTAIST"
     gene            complement(<637080..>638390)
                     /locus_tag="CYME_CMM254C"
                     /db_xref="GeneID:16994877"
     mRNA            complement(<637080..>638390)
                     /locus_tag="CYME_CMM254C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537068.1"
                     /db_xref="GeneID:16994877"
     CDS             complement(637080..638390)
                     /locus_tag="CYME_CMM254C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537125.1"
                     /db_xref="GeneID:16994877"
                     /translation="MFTNSGWISQFCSAHSIKSNPFARRNHVASPAEVNKAPVSRLYQ
                     AFRSTGARARVTFAGCPVEPGPRFTAPRSRPVEMRKASLLMQQNKTAKTGGRIATRVS
                     SDVLLTTAAYVALSVLNRVVYRMDLQIMYSYTFFLSLFVTLCYVLVYASILWIRVRMR
                     IVPMTQVKWAVNNWRLFALIGALEALTFVIGMFTASRLPGALLPVLNQGILIFIALAS
                     YALLGRRYTLTQIYGMLVVLAGVLISIGPQTVNEAALNLSSGGVWMNAFLFFGSYAFV
                     ALAVVLKERVFKRSGVQPDLFIVNTFSSLMQFAAISLMLPFTTPFAARLAESPSIGDY
                     FSSALSTFAGRESSWMPWLALAYVAVNIVFNITGLRLLKIASALDSVVASLISVPLTT
                     LVFCLPVPLLVQSRFSFMVLLGLGVLLFGIWLYNLPQVKERADD"
     gene            640283..642024
                     /locus_tag="CYME_CMM255T"
                     /db_xref="GeneID:16994860"
     misc_RNA        640283..642024
                     /locus_tag="CYME_CMM255T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461458.1"
                     /db_xref="GeneID:16994860"
     gene            complement(<641636..>643330)
                     /locus_tag="CYME_CMM256C"
                     /db_xref="GeneID:16994861"
     mRNA            complement(<641636..>643330)
                     /locus_tag="CYME_CMM256C"
                     /product="similar to RNA polymerase I specific
                     transcription initiation factor RRN3"
                     /transcript_id="XM_005537069.1"
                     /db_xref="GeneID:16994861"
     CDS             complement(641636..643330)
                     /locus_tag="CYME_CMM256C"
                     /codon_start=1
                     /product="similar to RNA polymerase I specific
                     transcription initiation factor RRN3"
                     /protein_id="XP_005537126.1"
                     /db_xref="GeneID:16994861"
                     /translation="MECAATLASEARDDYDVETSANTQSSLEETVRNLERCLNEQTCS
                     EGTGLLGESTVLAELRDALPARLAKADDSELELFFEIIIRVLPKITNGFWDGVIAALL
                     TAGVCRSTTNKIAFRGFVTSLVLQDVQYLEPVVSFLVQSFPTLSEDGCGTVHDVLSNL
                     ISLIPRTEECYLFYLEKYFPHASRPEKQFIMYVRMLLCSLSYAKTRVSAMLSLLFRRL
                     VILELEYLAALDFPTGLVTSPESFVEKHLSDDGNHDLSVFELGDSERTEASIEQDSST
                     LVDPAIAELSAESLSKKLDTCLDEVFLFCSQITRKQIDTFLDALYVAFEAHVMPVATS
                     RRVPFILFVFLSHSGSAALELILRHLLTFFFDTGRPLSSRSLAVLNAGALVASNAAAN
                     LLMALQWMKTVSSWLHNQLDRAYTSHCPELHSFGEVSEEPVYAGMTGVLYVLGAYASH
                     LSFSDFYREQVRRMRLGRLIHMMPNLMERIPLELLQAITTLPEFAFVFELFVDEVRRV
                     PRFSLDDLMPFRVYGLPRSEQHVRDALRPFKSANVISSEEEIGSQLDDQEIALALR"
     gene            <645848..>646213
                     /locus_tag="CYME_CMM257C"
                     /db_xref="GeneID:16994866"
     mRNA            <645848..>646213
                     /locus_tag="CYME_CMM257C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537070.1"
                     /db_xref="GeneID:16994866"
     CDS             645848..646213
                     /locus_tag="CYME_CMM257C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537127.1"
                     /db_xref="GeneID:16994866"
                     /translation="MSVDQSTAEPGEKANLEEWAASRVEELRKVVASGQAAGVFTAAE
                     VLPALDVDRAVRELERVHARTLRLEQAKHAVRAQRESLALLKAEFALEDIRRTVENLH
                     GKSERLQRCYHFIEQGWHN"
     gene            <648481..>649473
                     /locus_tag="CYME_CMM258C"
                     /db_xref="GeneID:16994867"
     mRNA            <648481..>649473
                     /locus_tag="CYME_CMM258C"
                     /product="similar to longevity assurance protein LAG1"
                     /transcript_id="XM_005537071.1"
                     /db_xref="GeneID:16994867"
     CDS             648481..649473
                     /locus_tag="CYME_CMM258C"
                     /codon_start=1
                     /product="similar to longevity assurance protein LAG1"
                     /protein_id="XP_005537128.1"
                     /db_xref="GeneID:16994867"
                     /translation="MAGKQTRVPRKEFFRRADLLLHRLRYDRVKLLNEIPWQPYNPDY
                     QPRRDWLTVAALLPCALLGRYVLERLILKPFFAKFSERGRKSPRLASKMAENCFYALF
                     YICSLCAGLYVYRSENWRVSFFDGACISAFWELYPPISTVFRLYYLSELCYYISSVIF
                     LLTHDTKRKDFTEMVVHHLATISLITLSYMWGWMRLGLVILMLHDAGDILLYTAKVVH
                     YLGLWPSNIVLFVCFAIVFYITRLFLFPRIILSVSTEPWIEVTREPLANRIWVAYWGF
                     YIVQLIGFALFLNILLYLHCFWFTLILKMMYREVLHPGNAKYSKGDIRSDDEAE"
     gene            complement(<650181..>651248)
                     /locus_tag="CYME_CMM259C"
                     /db_xref="GeneID:16994868"
     mRNA            complement(<650181..>651248)
                     /locus_tag="CYME_CMM259C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537072.1"
                     /db_xref="GeneID:16994868"
     CDS             complement(650181..651248)
                     /locus_tag="CYME_CMM259C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537129.1"
                     /db_xref="GeneID:16994868"
                     /translation="MLFCLSASARLVNKSLGARLQRGLLALGLASRAKSLLHRWGTLR
                     CASTGTCVFDRQVKYLQRQWAAKEADFSEYEYLRSEVAKRLCERLLDFRCSFRRVLDV
                     GAGASYVRRSLVGNKIVSGLELLVEVELSSAMLEHGLERLPLSETPFRTTQLTADEEL
                     FLPALWQGGYLEKAPFDLAISCMAMHWINDLPGMLAQVRAALLPGGVFLGAMLGGETL
                     HELRVSLQLAEDSLLGGVGIHTSPMVEFQDTARLLTRVGFEMITIDVDTMIVPYPDMM
                     TLIKHLQKMAESNALAGRQSWLSRKVLQQASKIYRERFSLPNMQIENARGDGQVSVSD
                     HYNDWIGATFQVVYMVGWVPT"
     gene            <653325..>654350
                     /locus_tag="CYME_CMM260C"
                     /db_xref="GeneID:16994869"
     mRNA            <653325..>654350
                     /locus_tag="CYME_CMM260C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537073.1"
                     /db_xref="GeneID:16994869"
     CDS             653325..654350
                     /locus_tag="CYME_CMM260C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537130.1"
                     /db_xref="GeneID:16994869"
                     /translation="MFTLQYLNPVRVKASVRQGGVAVCRRDQRRVRLVPAIHAQLLRN
                     LKYAIPDEKFKQFATRSGGEFIGFEAYFDATTGEPLEVPERFVPQEYRDWHVRVFGLD
                     ENYSEAIDGATLFGKRQLIDVKVGCQEDAVSAEAKHITIDLSRTDMHAVFPCGCFSAR
                     LSATSAHDEKVLFSLIFRDLKELRRIQIEFTAFPLESKHPFGREIVVRREMYDQPFNG
                     GVQLIGCGGKVESFVTFERRLGSPRGLRRRICSLDDHVSMETIRDLAGDTRQEFREVH
                     FLSLPANISVRRYATRDASTLVYEAAAMISDLSTGPGPALALARNYDASTGQYKGSEL
                     FIEFFEN"
     gene            complement(<654328..>657843)
                     /locus_tag="CYME_CMM261C"
                     /db_xref="GeneID:16994856"
     mRNA            complement(<654328..>657843)
                     /locus_tag="CYME_CMM261C"
                     /product="cation-transporting ATPase"
                     /transcript_id="XM_005537074.1"
                     /db_xref="GeneID:16994856"
     CDS             complement(654328..657843)
                     /locus_tag="CYME_CMM261C"
                     /codon_start=1
                     /product="cation-transporting ATPase"
                     /protein_id="XP_005537131.1"
                     /db_xref="GeneID:16994856"
                     /translation="MRTDGKVITRVTLLKKRGFWQRLDVQPFLVAYVTLGVLFAVKQW
                     SAFSTLLCLGAAVILQILCWLARFWSAHFDRRIGYFVTSDLVQSTHLLVEPRVHRGRP
                     EIVALRKEHDKFFFEFQCRRYYFDDGEHRFCKLRYPDEFPLSFYLHEGVKGLSTAEVS
                     TKLEQYGQNRLQIPMPSFWELYKEQLTAPLFAFQVFCVILWCLDEMWKYSLMTLGMML
                     SFEATVVRSRQRSLRELRDMRIQPYPLLAYRDAKWKRVLSDKLVPLDLVALGTSPQGL
                     AVPCDILLLAGKVVVNESLLTGESVPLMKEALRIEESEAARSAGSNGSELQPRTKDKM
                     HVLFGGTMLLQTETPGNDWGSIPPPPGNYCVGCVLRTGFGSAQGKLLRTIMYSSQTAS
                     ANNRESFLCILFLLVFAVVASAYVLHHGLRDPSRSRYELLLHCVLIITSVIPPELPMQ
                     LSLAVQGSLADLAKMGIFCTEPFRIPYAGMLDVCLFDKTGTLTVDRLDFAGLLCTGQD
                     SLTPAENMPKHAILVLAACNSLVSLSGEVSGDPIESAAFRAIGWTLGANNTVYAREGS
                     CRGTRIQILQRHGFDATIQRMSVAVSVSDGESTRTPYLLSLVKGSPESVRGCLREVPP
                     DYDAQYRQLAMDGMRVIALATKELSAEMTHAEIRRLSRGAIECELQFAGFAAFRCPAR
                     PDSRGAIKALRKSNHLVAMITGDSLMTALYVALETGICSRRKKNLILCTRPGEAATSD
                     FVWVKPSRAMHGKIENSRKFEAAELPKLGSEYNLAMTGDVLNEYRMRGASLKELLQYV
                     QVFARMTPSQKELVITSLKDAGMYCLMCGDGTNDVGALKQAHVGVALLQSVAKQDTLG
                     SPSAQSRPSLDPQLGSTAANASLRAHASTSTRSHNGDHRRSESSHGPRSGSLLELDNE
                     MPIVRLGDASIASPFTSKRASIASCVDIIRQGRCTLVTTLQMYQILALNCLISAYSLS
                     VLYLEGVKFGDRQMTVTGILIAIAFYFVSRGKPLARLAPQRPPRSMFTPSLFISLVGQ
                     FAIHLFALACCTALSQAYLPPDFEVDLKGEFAPNILNTIVFLLSTMQQVSVFLVNYKG
                     EPFMQSITKNKALLYSLLACAFLMLAACLEVSPELNQYMELAALPSWQARWLVFALLS
                     GDFIAAWIWNILVHYLATLSSQRIR"
     misc_feature    657915..659910
                     /note="possible transcribed region"
     gene            complement(<658380..>660500)
                     /locus_tag="CYME_CMM263C"
                     /db_xref="GeneID:16994927"
     mRNA            complement(<658380..>660500)
                     /locus_tag="CYME_CMM263C"
                     /product="DNA topoisomerase"
                     /transcript_id="XM_005537075.1"
                     /db_xref="GeneID:16994927"
     CDS             complement(658380..660500)
                     /locus_tag="CYME_CMM263C"
                     /codon_start=1
                     /product="DNA topoisomerase"
                     /protein_id="XP_005537132.1"
                     /db_xref="GeneID:16994927"
                     /translation="MHQQDPDEIPLSELLGNSGESVPRVVSVARQGGFGAPSIQVAKK
                     SSSAALSEDELPLALLIGTERKKECSRRKGKVEPCRKAPKRKCERMKAEKHRKAKKLQ
                     ATSTKHRAEDESIKWCSLEHNGVLFPPEYEPHGRPLLYDGCEIALPPEAEEVATFYAS
                     KLGTVYLEKETFRKNFFDDFRKTLPVDLRKRIVKLEHCDFSRIREYLDELKERKQSMP
                     PSKRKELREAEAQRVAHYTVAIVDGRKEKVANYRVEPPGLFLGRGDHPLMGRVKRRIF
                     PEDVTLNLGRDAPIPPCPFKGHDWGSIVHNQRVTWLACWRDPISDEYKYVWLSASSHF
                     KAMSDQEKFEKAQQLSKHITKIRNEYTKGLESADRHTQQRSVALYLIDKLALRVGNEK
                     GEDEADTVGCCSLRVEHITLQEPNIVQLDFLGKDSMRYFNRVRVEALVFHRLREFLKG
                     KRVSDNVFDELKVEELNDYLKSLMPGLSAKVFRTYNASYTLDKLLHSVKTPGPDIHSR
                     LLFYNEANKDVAVLCNHQRSLPKTHSLMLERLRDKLEESRAYLEALKMARGKAQASPD
                     SRAQVTRWRRPVVEIPEDCSLAERKRIREEAEKRPKEKQVVNMGLASITRGIAQTQEK
                     IRRLEADLKTRDSLATVSLSTSKINYLDPRITVAWCKRHEVPIERIFPRALQEKFMWS
                     MGVSEDFRFPISNVVSNDPSGAST"
     misc_feature    complement(660531..661944)
                     /note="repetitive element"
     gene            complement(<664073..>665758)
                     /locus_tag="CYME_CMM265C"
                     /db_xref="GeneID:16994901"
     mRNA            complement(<664073..>665758)
                     /locus_tag="CYME_CMM265C"
                     /product="gamma-glutamyltransferase"
                     /transcript_id="XM_005537076.1"
                     /db_xref="GeneID:16994901"
     CDS             complement(664073..665758)
                     /locus_tag="CYME_CMM265C"
                     /codon_start=1
                     /product="gamma-glutamyltransferase"
                     /protein_id="XP_005537133.1"
                     /db_xref="GeneID:16994901"
                     /translation="MEFHSRRSPVLSLRGLCAASQPLASQAGIQVLTAGGTAVDAAVA
                     VAATLAVTEPCSTGIGGDALLLYFDAKEKKVSALLGCGRSPAALTLEAVQRAGLKELA
                     PASPLTVTVPGAPALWCDAIDRFSSGSVPIRSVLDPAIQLAEFGFPVSPLTALQWRSS
                     VDLLKRSPGGSALLVERCRAPRAGEVFRNPGLGRALRLIAERGKAGFYEGPVADAIVS
                     SLASVPMLHEDLRSHRTEEAEPLQAEYRGVRIYEMPPPTQGLATLIALKILDGIDLES
                     LHTAGQDAALLDALIRAMRVGFLVADTYIADRSHAPDSCRCCGQVDCGAVCRLFTDDS
                     MRTWRRIFREGRAQLSQQSSSAAGFAGSDTVQFCVVDEQGNACSFVNSTCKGFGTGIV
                     PEGFGFSLQNRGLGFSLDSRSPNVLGPCRRPYHTLMPGMAVHASSGCLFSAFGVMGGM
                     MQPQGHLQVIVNMMDRKMDAQAALDAPRFFIESRNFRPENIAHAPLLLEQGILPHVAS
                     ELQHLGHPIKMSDVRGPARMAFGRGQVIMRDADAGVFWGGSDPRADGCAIAQV"
     misc_feature    665100..666452
                     /note="possible transcribed region"
     gene            complement(<665780..>666958)
                     /locus_tag="CYME_CMM267C"
                     /db_xref="GeneID:16994903"
     mRNA            complement(<665780..>666958)
                     /locus_tag="CYME_CMM267C"
                     /product="NADH dehydrogenase I alpha subcomplex 9,
                     mitochondrial precursor"
                     /transcript_id="XM_005537077.1"
                     /db_xref="GeneID:16994903"
     CDS             complement(665780..666958)
                     /locus_tag="CYME_CMM267C"
                     /codon_start=1
                     /product="NADH dehydrogenase I alpha subcomplex 9,
                     mitochondrial precursor"
                     /protein_id="XP_005537134.1"
                     /db_xref="GeneID:16994903"
                     /translation="MDSCGAASVRLLRLSLQRNGSAVRYMSSPTNLSEKARLVSPVLR
                     AEGTGGRSSVSGIIATVFGSTGFLGRYVVSQLGRIGSTVFVAWRGDELDNRHLKVMGD
                     LGQINPIQIEARDINSLRRSIAGSNVVINLIGKWYDTRYYSLEDVNIGVAETIARLAS
                     LEQVEHFIHVSALPAYSKANSEYPEDRWSRSKIEGERLVRQAFPRATIFRPADIWGME
                     DRFLARIATSLSRLGFVPVVQGGKSRTQPVWVDDVARAIVSSVRNPESTAGKTYELFG
                     PRVLTRREVVEFVADSTKRELNLLNLPLPIAKVVMRLTGMRLPLVNPSPLFTESDAVR
                     EASDVIASSILSSGEEREALGTFDDLDIIPHDLLSDLGRNTLRQYRKGGDRSSLFYVD
                     "
     misc_feature    667890..668864
                     /note="possible transcribed region"
     gene            complement(<669080..>670180)
                     /locus_tag="CYME_CMM269C"
                     /db_xref="GeneID:16994920"
     mRNA            complement(<669080..>670180)
                     /locus_tag="CYME_CMM269C"
                     /product="farnesyl-diphosphate synthetase"
                     /transcript_id="XM_005537078.1"
                     /db_xref="GeneID:16994920"
     CDS             complement(669080..670180)
                     /locus_tag="CYME_CMM269C"
                     /codon_start=1
                     /product="farnesyl-diphosphate synthetase"
                     /protein_id="XP_005537135.1"
                     /db_xref="GeneID:16994920"
                     /translation="MQRTPGAALETAVPMEKREAFLAAYAKIREEILSDLSSGDFQLP
                     DNILERVKFCLDYNVPHGKLNRGLAVLEAYRAARRCETFEALSEQERQDALLLGWCVE
                     WLQAFFLVADDVMDGSKTRRGRPCYYLLDHIGLSSVNDCLLIEAQIYRLLRRRFRARE
                     SDPELYLDLVELFLDTTYSTEVGQMLDLESSTGSDAMLEKFTEQNLLRIYRFKTAIYS
                     FYLPVALGMRLAGIRNSLYYQQAKEILLEMGAYFQAQDDFLDCFGDPVVTGKVGTDIE
                     ERKCTWLIVEALKCCSPAQREMLRCSYGKQDSDSVARIKALYRELGLPQRFQTYDQES
                     YARIQRKLEALDADFPVEALRFLLQSIYKRSK"
     gene            <670233..>672449
                     /locus_tag="CYME_CMM270C"
                     /db_xref="GeneID:16994906"
     mRNA            <670233..>672449
                     /locus_tag="CYME_CMM270C"
                     /product="magnesium chelatase subunits I and D"
                     /transcript_id="XM_005537079.1"
                     /db_xref="GeneID:16994906"
     CDS             670233..672449
                     /locus_tag="CYME_CMM270C"
                     /codon_start=1
                     /product="magnesium chelatase subunits I and D"
                     /protein_id="XP_005537136.1"
                     /db_xref="GeneID:16994906"
                     /translation="MSHCFVPSTFLWTVNVRNCKTVPQRQTLQKAFGSRVFRLRPGAL
                     ARLRCLDTVPVTLNTISTPEDGDATPRDSIRETFPLVAVVGHDLVKLALLLAAVNPKV
                     GGVLISGGRGTAKSVLARAVQALLPPIEVVLGSPYNEVPRGDLPESKRAIIPAPFVQV
                     PLNATEDRLVGSIDIERSMKLGESVFQPGVLARAHRGILYVDDINLLDESIANLLLSV
                     VSEGRVLVEREGISLGYPCEPLLIATFNPDEGPIRPHLADRMAAIVNADSPPLSIEER
                     IRAVDAVTEFYRNPREFVRKYEQEMDELRQRIIFAREEYRDVVIARKQVEYLCEESIR
                     GAVQGHRAEIFAAELARANAAFEGRLRVNEQDLRIAVRLAIFPRAKVFYRDNNDEENV
                     SQKRPPPPPPPPSNEQDGEEKEDESEQEQEEEDENEIEEAPQVPEEFMFDPEGVPIDP
                     ELLNIAQGQQKQGRSGGRGIIFSDERGRYVKAMFPRGKVKRVAIDATIRSAAPYQRMR
                     RARHAQENGRRVFIEPPDLRAKRMARKAGALVLFVVDASGSMALNRMSSAKGAAIRLL
                     AEAYQSRDQIALITFGGECASVLLPPTRSVSMAKRRLETMPCGGGSPLAHALTVAARV
                     GVNAMKSGDIGRCVLVLVSDGRANIPLKVSLGEKLEQKPTKEELKNEVLDLAKKIRGI
                     NGFSILVIDSENKFVSTGLAKELAQAAGGTYHYIPRATDAAVAGVAADAIKQMRQL"
     gene            complement(<675671..>678316)
                     /locus_tag="CYME_CMM271C"
                     /db_xref="GeneID:16994907"
     mRNA            complement(<675671..>678316)
                     /locus_tag="CYME_CMM271C"
                     /product="ubiquitin-protein isopeptide ligase E3"
                     /transcript_id="XM_005537080.1"
                     /db_xref="GeneID:16994907"
     CDS             complement(675671..678316)
                     /locus_tag="CYME_CMM271C"
                     /codon_start=1
                     /product="ubiquitin-protein isopeptide ligase E3"
                     /protein_id="XP_005537137.1"
                     /db_xref="GeneID:16994907"
                     /translation="MMQSEFSSRRATASKLFDTGGRSAISLRGASNVAPSRESILLKA
                     RLERERRAAQRAQERSAVAIQSLARQYFECRRLSKIIEAELVERVANLAQSEGPLPYD
                     THAAVRFVRALCFLVQLSKAQHDKARLHWYEHRGLIGELVRSTYVSIALKGHIFISAA
                     ALGDEAFLLENARRCATAVQRFANTILALMRGRTTGESAKEICRICGPSAEFGRFLID
                     APTLVMTSDDIDMPATAHLFSESLAKLIAEHGVTLSKSAIRRICDLTLSLPSSKHHVF
                     LLSFVVDRVGPLDELASKLTQSDVFLKSLMHALEWDPENWRRFAELLEKHDAMNHRVC
                     AVLAFSHSRDYLRQMWHSLMISSSGALLRLFCESFRVSTLVMDDDDFYSATNLSFVLE
                     IINELKEQLFWRLYTTSTGARPTGRNKWDLAAADVLQASSRLLLALWARDARRPFTVQ
                     RESLWEVQAARKAPELFVRESVRKNSGMPLLRMAPFSISFETRVRIFHGCIAQEKARA
                     GGGQSFFGMNGIWITIRRNFIVEDAFAQLNSLGSRLRENIRVKFVDEYGLEEAGVDGG
                     GVFKEFMHQLIRFAFSPTHYGLFKATDGGELFPNPASSVIAPSNHLEQFSFLGRILGK
                     ALYDAILVDLPIASFFLRKLLGISNDLNDLRSLDPELHRNLKFLRHADPNSFGDLCLT
                     FTVVDNEFGEAVEKELIPGGSSIPVTWDNRLEYMHRVADYRLNRQIKAQTTAFMSGFF
                     DVIEREWIQMFNEWELRELISGDCSGKIDIDNLRSNVTYSGGYSENSGTVELFWQVVQ
                     EDLSDSERAALLQFVTSSPRAPLLGFQYLNPPFCIQKAGDDASRYPTASTCMNLLKLP
                     PYSTREAMREKLKYAITQNFGFDLS"
     misc_feature    678426..679283
                     /note="possible transcribed region"
     gene            complement(<681791..>682879)
                     /locus_tag="CYME_CMM273C"
                     /db_xref="GeneID:16994881"
     mRNA            complement(<681791..>682879)
                     /locus_tag="CYME_CMM273C"
                     /product="similar to alkane hydroxylase"
                     /transcript_id="XM_005537081.1"
                     /db_xref="GeneID:16994881"
     CDS             complement(681791..682879)
                     /locus_tag="CYME_CMM273C"
                     /codon_start=1
                     /product="similar to alkane hydroxylase"
                     /protein_id="XP_005537138.1"
                     /db_xref="GeneID:16994881"
                     /translation="MTATALVYSVAYIVPLVSFTSFIFKKWSTAFASIFLAFVLIPAL
                     DAVLGLDEENPCDAELHSGRHKLAYRVVLYVWPAVQWSFLFWAARLASEGVDLSVSSF
                     IGLGLTAGLLAAQGVNVSHELFHKRNAAEVALGKAILVSVCYGHFYIEHLYGHHRRVA
                     TPEDPATARYGESFYAFFPRTVVGSFRSAWKIERERLAKRGFQTFCVENRILRYFACS
                     VLWFLTIFFLYGLRACCLFLLHCFTAITLLEMVNYIEHYGLERAVINVLPNGEKIYEP
                     VSNCHSWNSSHRLTNYILFKLQRHADHHRHADRPYHLLVSTVESPQLPAGYPTMIILL
                     LFPALWRKSIHPILDRAKVPCDSRRFLK"
     gene            <685009..>686841
                     /locus_tag="CYME_CMM274C"
                     /db_xref="GeneID:16994862"
     mRNA            <685009..>686841
                     /locus_tag="CYME_CMM274C"
                     /product="lysine--tRNA ligase, cytoplasmic"
                     /transcript_id="XM_005537082.1"
                     /db_xref="GeneID:16994862"
     CDS             685009..686841
                     /locus_tag="CYME_CMM274C"
                     /codon_start=1
                     /product="lysine--tRNA ligase, cytoplasmic"
                     /protein_id="XP_005537139.1"
                     /db_xref="GeneID:16994862"
                     /translation="MELSSGNTIETVTSDQDLRNETVGSDDGSVLSKNELKRRMKAQR
                     LAAERELRQSSRVQQHQAAARDASSGNQEADEELMTSQQYFSHRCRVVEHFRSSGEDP
                     YPHKFYVTCSVPQFIAKYSYLGVGERLDGEEALAGRIRSRRLSGSRLFFYDIFADGTK
                     VQVMADARLDTAGNFATVHSALRRGDIIGVRGYPGRTKTGELSIFPVETRLLSPCLHM
                     LPKPHQMLSDPETRYRQRYLDLIVNREVRPIFELRANVIRFIRKFLDERGFLEVETPI
                     MNAVAGGANARPFVTFHNELGVNMYLRVAPELYLKELVIGGLDRVYELGRNFRNEGID
                     MTHNPEFTACEFYAAYLDYKDLMDLTEAMLSLLVKELTGHLKIKYHPEGRHALENEVE
                     IDFTPPFKRISVMDALREALPSELRPLFPESEQLGTDESRFRLETICERVGVVCPPPV
                     TEARLLDKLFGALVEPKCVSPTFVCDHPEIMSPLAKWHRNRPGLTERFELFVNGRELC
                     NAYTELNDPFVQRERFLSSQRDADKGDAEAMAKDEDFCTALEYALPPTAGWGIGIDRL
                     VMLLADQNNIKEVVLFPALRPRPNSDGDEAAELRDRVQDLKVKE"
     gene            <690205..>691572
                     /locus_tag="CYME_CMM275C"
                     /db_xref="GeneID:16994863"
     mRNA            <690205..>691572
                     /locus_tag="CYME_CMM275C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537083.1"
                     /db_xref="GeneID:16994863"
     CDS             690205..691572
                     /locus_tag="CYME_CMM275C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537140.1"
                     /db_xref="GeneID:16994863"
                     /translation="MNSAFIQPSAHLSRTTSSGQLNLLTSQSQTLGTNSGSQSACPAS
                     PNLGTGPSYAQWTPGLVTPPLQGPPNRIHAAYYHVYHHSNHLANNIVARLGTPTATAL
                     NYWQQPSCPFLSGQERPAVQSDLSFLSGSNCEDENGAGYRLFESVLDQLENTTQQARN
                     ASTFWLTSTDAEHPDRMDTFGAEELEELEQQLYQVPLAESEYGGLAAPSDNFLSANRR
                     ELSHQERSASAPETIQCSSDIYSSDEEATSSEHDSDICYAQFMPAGGATAAQTLSPLS
                     GSSAVGTLAQQALREHSTDNHLGERHLFIRDSDVAFYIALTSPNISKARYTDIIANMK
                     RRGVIDTGNTDWEKKLVQVRASRPVPKHLARAMSGENAIACAERAVLVASAREKDIEG
                     KSVVTECEKLSACMTVPTEWIVPVDASRRRKSISLDQLLPSLNRKVHQSNNVLLFVLL
                     KKQDA"
     gene            complement(<692718..>693437)
                     /locus_tag="CYME_CMM276C"
                     /db_xref="GeneID:16994976"
     mRNA            complement(<692718..>693437)
                     /locus_tag="CYME_CMM276C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537084.1"
                     /db_xref="GeneID:16994976"
     CDS             complement(692718..693437)
                     /locus_tag="CYME_CMM276C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537141.1"
                     /db_xref="GeneID:16994976"
                     /translation="MNAQIRNIALLFVVMHLVNKLDQKDERVILGARTAYATFLLTAL
                     LLNAFVRRLVIKKADGRLLEVPLKPTLQNPTPDPNVRQRLTVQEYDISLLDATRSQLF
                     LQTALLVFLHWKMGSVAPLILQAIMGFVRQLDDPLIKIHLLGHRDTGALERPFKSEPN
                     PLLKLLGLDPSRNQASARQGSDSHIDDTAVQSRSQPGETQHVTPVGDVGNVSDSSADE
                     AIAQDSASDDEQKSMRGKKDD"
     gene            <698219..>699097
                     /locus_tag="CYME_CMM277C"
                     /db_xref="GeneID:16994977"
     mRNA            <698219..>699097
                     /locus_tag="CYME_CMM277C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537085.1"
                     /db_xref="GeneID:16994977"
     CDS             698219..699097
                     /locus_tag="CYME_CMM277C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537142.1"
                     /db_xref="GeneID:16994977"
                     /translation="MWLYAWFERFWLHFTTSFSPFTLHTLFTFAIHEFAYWGVYLPYA
                     LMDRSKFFRRWKLQENTYGYSSSSKQSQKLPKEDAQKFWRCVLYVAANHVFLVLPLIL
                     VTHPLFEKLGTTHGLPLPSLREFIVQILFCLFVEDMCFYWGHRALHTPWLYRYIHAIH
                     HQYTAPFGAVAEFAHPIEVIFLGMSTVAGPLIIGPHLLTLWGYLMVRCWQTVDCHSGY
                     DLPWSLNRWFPLYGGARQHDHHHKTYSGNYASMFIHMDWLFGTDKAWRLSLQKAKAKH
                     VRAVAQELAVSFSAER"
     misc_feature    701426..702072
                     /note="possible transcribed region"
     gene            complement(<703143..>704291)
                     /locus_tag="CYME_CMM279C"
                     /db_xref="GeneID:16994961"
     mRNA            complement(<703143..>704291)
                     /locus_tag="CYME_CMM279C"
                     /product="similar to tellurium resistance protein TerC"
                     /transcript_id="XM_005537086.1"
                     /db_xref="GeneID:16994961"
     CDS             complement(703143..704291)
                     /locus_tag="CYME_CMM279C"
                     /codon_start=1
                     /product="similar to tellurium resistance protein TerC"
                     /protein_id="XP_005537143.1"
                     /db_xref="GeneID:16994961"
                     /translation="MPYQAGERQCFVPVGCKCFTWTQTYKSNLRTLCTSGRVPGTMRR
                     RGLAALQLVRQKERHRGGSLGRSSSGENSKHTAPNEKTLGGEFKDELSSSERQVTSWD
                     RQRTAISVAAGLLVGLIFFGTKGTDRGMEYVAAYVVEQSLSVDNLFVFLLLFRFFRVP
                     KNLQEKVLSYGILGAAVFRAIFVFTGVALMERFRTISLVFAAILLISSGRMLWSSFQD
                     SEADDESNEEGIRENFIVRAVTALLPVSDDYDGDRFFTSLKNGATTATPLLLVLVCVE
                     LTDVIFALDSVPACLGISRDPLVVYVSNLMAIVGLRSWYFVIQEAIRNFRYIEQTLAV
                     VLGFIGSKLALGYFGYEASTTISLSVILGTLAVGYSAGFVFSGTNEKS"
     gene            <706939..>707919
                     /locus_tag="CYME_CMM280C"
                     /db_xref="GeneID:16994964"
     mRNA            <706939..>707919
                     /locus_tag="CYME_CMM280C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537087.1"
                     /db_xref="GeneID:16994964"
     CDS             706939..707919
                     /locus_tag="CYME_CMM280C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537144.1"
                     /db_xref="GeneID:16994964"
                     /translation="MAVDRTAELRALCRERDTRFSKIGGAQADKQLSPKVRFKSGTGE
                     AFRLLSEQLLENLRHFALLLHANTGWLLDARNYDYSPKQRVEFEASCTKLLQGLLANL
                     VALRDLAEWPRGSHHSAQRVQHRLVVVETLSSQIETLNQYLRTLLSTSSERKCSAKSH
                     PCITKHAQRGTSSESVHACNHASIPLREIAASNVSLEKKFQEETPREPSEPEGIPAEA
                     RGAQAMLLMQPPIFTWEQELTERDRIVRDVERNLIQVSELLHDFSVQVAQQDHVVESL
                     LEDAFRSTEFAERANRELDRMRGADHSWHIVLTVIFLVMALSLLALDRLR"
     gene            <707933..>709075
                     /locus_tag="CYME_CMM281C"
                     /db_xref="GeneID:16994965"
     mRNA            <707933..>709075
                     /locus_tag="CYME_CMM281C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537088.1"
                     /db_xref="GeneID:16994965"
     CDS             707933..709075
                     /locus_tag="CYME_CMM281C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537145.1"
                     /db_xref="GeneID:16994965"
                     /translation="MIGQRHSRTFSFVYLTLPSWTMLSHSRELVGSGRCSLRCVRTRP
                     LHVLETTWARKRKQKAGTSGQGGDNEAGEDASPNRRFSRKMSLKQQLLLLRERAAQEK
                     RAAGAAASAAPARTSYRRRLVRTPPEEDNQEETETAESLEAQKPEVAASEGLPKVNAT
                     KERARQKWFIVDGYNVIGAAPELNAYVRDGDLETARRLLIEDVTNLSAIRGWHFSIVF
                     DATTNPQDGYPRTKDTTEKITTALIHPDVNAKAASGTQHQSRARKSAKGEEASTESVE
                     IIYPACKSADSYIISRVRGAARDHNMEVWAATGDSIVQSLVRASGAFVISSELFLREV
                     ENAKTEMRVIHRLATNEPGLALIDCLDQESRDRLLSLKESNVENTS"
     gene            complement(<710257..>711591)
                     /locus_tag="CYME_CMM282C"
                     /db_xref="GeneID:16994958"
     mRNA            complement(<710257..>711591)
                     /locus_tag="CYME_CMM282C"
                     /product="Rub1-activating enzyme E1 C subunit"
                     /transcript_id="XM_005537089.1"
                     /db_xref="GeneID:16994958"
     CDS             complement(710257..711591)
                     /locus_tag="CYME_CMM282C"
                     /codon_start=1
                     /product="Rub1-activating enzyme E1 C subunit"
                     /protein_id="XP_005537146.1"
                     /db_xref="GeneID:16994958"
                     /translation="MHASSAHSAPELLAHADDAGPAALAPEALTRCTTDVRMKHAKSN
                     LQILVVGAGAIGCEALRALALCGFRNLVVLDRDTVAESNLNRQTLYSSADVGASKALR
                     AAQAIKERFPGCTIRGYWASAEQMPVAFYRAFDVIVSGVDTVEARRWLNTVVFHVVRP
                     VTSPNCAVQSKYLPVLIDGGLEGLAGQVRTIRPYETPCIECILDLFPDEAGRQPLCTI
                     AGTPLRPEHCIHYAQAVLWPARDDQAVRSIDPENPEHLEWIYTRAQERAAAFGIEGVT
                     TALVKAVLHRSVPALATTSAVTGAACALAVTRLVWGGSHAQCPWTSFHGSDGLYIDSI
                     FIERRLSCPVCGPGSAVAISVSKNMLVKELIELLERHPVLHCRSPTIVWDYRPVYMSV
                     PQSLKAATSPNLERPLSDIFISDSHPKVPDQVVLSVTDTDTRTCKTLHLFLT"
     misc_feature    complement(712992..714852)
                     /note="repetitive element"
     gene            <715512..>717062
                     /locus_tag="CYME_CMM284C"
                     /db_xref="GeneID:16994959"
     mRNA            <715512..>717062
                     /locus_tag="CYME_CMM284C"
                     /product="similar to DNA-damage-inducible protein P"
                     /transcript_id="XM_005537090.1"
                     /db_xref="GeneID:16994959"
     CDS             715512..717062
                     /locus_tag="CYME_CMM284C"
                     /codon_start=1
                     /product="similar to DNA-damage-inducible protein P"
                     /protein_id="XP_005537147.1"
                     /db_xref="GeneID:16994959"
                     /translation="MAAVTDTLGSRLELERRIVVHIDMDCFYAQVERKRLDLAEDVPL
                     CVVQWNSILAVSYAARAAGIKRGATPQEAKSKCPECVLVHVETVDAAGRKPQVSELDL
                     SEEASIVRAANTVCLDRYRLESEKIFGILSRFSDAVERCSIDEAFIELTDVVDDFDEA
                     VRLVQRMRDAILDELRYTCSAGVACNKMLAKFASSTNKPNKLTAIPWSETNSILARIP
                     LSRVRGLGGKFGAELQRNFKAETLADLSQLSMAALQAAYEPCTAEWLFWLARGYDPSR
                     VEPRDRPRSLLAAKSFAPVDTWQDARRILFLLATRLEQRIERDTSMHHRRPRTLCVSF
                     TSAQAGLQGQRHHHASRSGPFPTCAKEDAAASIAEGAEKLLRSIRSGFRFPCKRFMLE
                     ATNFQPIASGAYSIRSYMGKPGKRALKADVPSGGIAECEREQNPISGYAPAARNECSF
                     AGATPTPEREHQGIANAKLVLRAGSSVSGNEALVSHWKRHCGGATRRIHDGCITCYFS
                     QPKRSETR"
     gene            complement(<717305..>718660)
                     /locus_tag="CYME_CMM285C"
                     /db_xref="GeneID:16994937"
     mRNA            complement(<717305..>718660)
                     /locus_tag="CYME_CMM285C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537091.1"
                     /db_xref="GeneID:16994937"
     CDS             complement(717305..718660)
                     /locus_tag="CYME_CMM285C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537148.1"
                     /db_xref="GeneID:16994937"
                     /translation="MVLQIYSATEFRRVVIDGSREQLVVVDFYADWCGPCRMVAPFID
                     SLATKFHQVLFVKVNVDEVQDVAQLCRVHAMPTFQLFLNGNKVDEIVGADVAALERSV
                     AAQAQPVAFAGPGHTLGTRATSEDTKAATTTNSTPSGTPIARPNAVADGLQTTTGSAG
                     SAGARASQGEGQLPVSASETMPTFVSEKILEELQAMGFPRTRALNACIATDNESLEKA
                     MEWIFAHDEDPNIDKLDPALDVRVTGAEDLLSKSKEEKQLMLKRLQEEARKRREAEEK
                     KLAIEQEKNRIRSGKEIAEAKRKAEEERRKRDIRERLREQREQQMERERLRRLLEDDR
                     QRRLELQRGPTPVRLVEQPPDPNTNQPKAVEKSELETRPTRLQLRLPDGTNVEADFTN
                     ETRLRDVANYVLNNYPSLGERISLMRTYPRRKFLEHELDQMTLQDAELYPRGALFVLR
                     P"
     misc_feature    complement(720050..720628)
                     /note="possible transcribed region"
     gene            <720767..>722239
                     /locus_tag="CYME_CMM286C"
                     /db_xref="GeneID:16994929"
     mRNA            <720767..>722239
                     /locus_tag="CYME_CMM286C"
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase I,
                     precursor"
                     /transcript_id="XM_005537092.1"
                     /db_xref="GeneID:16994929"
     CDS             720767..722239
                     /locus_tag="CYME_CMM286C"
                     /codon_start=1
                     /product="3-oxoacyl-[acyl-carrier-protein] synthase I,
                     precursor"
                     /protein_id="XP_005537149.1"
                     /db_xref="GeneID:16994929"
                     /translation="MFAGAPVYSDISSSSFLGIRGAEKRRFRLDEKPYAAPGSASARR
                     VQRLSPLTVQLAIAAGTKGLYRDMPDNTSRKRVVVTGVGIVSCFGSDVDLFYQKLLKG
                     ESGVRPIDKFECSNWETRIAAWIAPEQFQTEGYIAPKLARRLDSVLKYTIVAGKRALE
                     HAGLGIGSDPYNALRKDRVGVIVGSGMGGLETFAEGCEKLSTGGVRRMSPFFIPYSIT
                     NMGSALLAIETDFHGPNYSLSTACATSNYAIHNAYMHIARGDADMMLCGGSEAAVLPI
                     GLGGFIACRALSKRNDEPHRASRPWDKHRDGFVMGEGSGVLVLESLEHARARGAPILC
                     EYLGGAYTNDAFSVTEPVPEGTEVARCIRLALADASVEPAQVSYVNAHATSTPLGDIA
                     EYRAMSSVLDMKRITMNSTKSLIGHALGAAGALEATATIMAIRTGEVHPTANVEEPEP
                     EIEADLVRNQKKSLNIEVAISTSFGFGGHNSVCVFAPFVE"
     gene            complement(<723511..>725235)
                     /locus_tag="CYME_CMM287C"
                     /db_xref="GeneID:16994983"
     mRNA            complement(<723511..>725235)
                     /locus_tag="CYME_CMM287C"
                     /product="similar to mitochondrial magnesium transporter
                     Mrs2p"
                     /transcript_id="XM_005537093.1"
                     /db_xref="GeneID:16994983"
     CDS             complement(723511..725235)
                     /locus_tag="CYME_CMM287C"
                     /codon_start=1
                     /product="similar to mitochondrial magnesium transporter
                     Mrs2p"
                     /protein_id="XP_005537150.1"
                     /db_xref="GeneID:16994983"
                     /translation="MRRGSLSTTRRNAPHRVSAAELEQLQRPRSATPPLTAAPESVSH
                     QARRIASGQRTLPVLPAVGTFSGGSTTRDGPDTLAAGDWTPKLTSNTPLAGKRPERPG
                     TLGKVLTSAAAFASNRLVNKIADAKFGPDLRLDEQTLRRNGLTFAAAVAHEYLEMVTS
                     RRTSITRNVKEKMWRRDSLIQFLEFDTFGRSVLRAMSKEDLIDELRRPVYPAAEASSP
                     RRRSKVLVEQETPLADALDLDIHPVNTGLTHRERDGIISKCEPVQLRDLRLVDPTFRS
                     EQVLLVRDNAIILVLDDYLRAVIQSHRLLLFNHEAERVQRAIRIITERLQSASLDIYN
                     AFEFIVLESMFIAAYFELEEFYFVIEQQIDRDLRDLNRTLSSSRIENMRLHMRHLTLF
                     LSRIRRLSQLFDRVLGEDDDMSNMYLTDKYYHPETPRHPLDHEYVETLLESYYQLFQA
                     LSNRAELLDEKVNDSEATMDIKLDAVQNRMLAFNLLQHLCTAMFFAMNFIADIFGMNL
                     NCPWYNITDSLAPWLGTVLGTTALATVFLGCFVIFLSRKGLLFGVLSWRKRPAPSWPV
                     AKHPSNHS"
     gene            <727896..>729200
                     /locus_tag="CYME_CMM288C"
                     /db_xref="GeneID:16994930"
     mRNA            <727896..>729200
                     /locus_tag="CYME_CMM288C"
                     /product="similar to mitochondrial magnesium transporter
                     Mrs2p"
                     /transcript_id="XM_005537094.1"
                     /db_xref="GeneID:16994930"
     CDS             727896..729200
                     /locus_tag="CYME_CMM288C"
                     /codon_start=1
                     /product="similar to mitochondrial magnesium transporter
                     Mrs2p"
                     /protein_id="XP_005537151.1"
                     /db_xref="GeneID:16994930"
                     /translation="MSVAGTPQFSELSEENQNSGDGLAKKSPNGLEMTKTSFASEKDT
                     GASWMSSTGSRATTHLECFEFFVDGNRKLRSISRLELLRRAREASADQQVVADVTGLS
                     GMSEAAVLAAVGIDAQRPGEEPLGKKERKRIRRYLKGFLQPRDIRQVDPAFDAKPAIW
                     VRRNVIVFSLEHLRALIFADGLLLFNPSEQRVQAAAESLEKRLTLSIRNEDADQEPFE
                     FCALDALLSLVHEYIESDLSDFEPSMYTLLNELTHKLSAKRLERLRVLKQDLMALVTR
                     MDGVRDVLQALLEEDEDMSRMYLTDIARHPSVTRSPLDHEDVEQLLESHLYQIEDALR
                     RTDLLAAAVDHTEDLVNIQLGTLRNRLLMVDVTLNIMEAVFTAVGFLTGLFTMNLQAP
                     FFKLDNGGTRWFIVVVVLNSSFAIVAVFLLIQWARRARYLNG"
     gene            complement(<731184..>732803)
                     /locus_tag="CYME_CMM289C"
                     /db_xref="GeneID:16994928"
     mRNA            complement(<731184..>732803)
                     /locus_tag="CYME_CMM289C"
                     /product="molybdopterin synthase sulphurylase MoeB"
                     /transcript_id="XM_005537095.1"
                     /db_xref="GeneID:16994928"
     CDS             complement(731184..732803)
                     /locus_tag="CYME_CMM289C"
                     /codon_start=1
                     /product="molybdopterin synthase sulphurylase MoeB"
                     /protein_id="XP_005537152.1"
                     /db_xref="GeneID:16994928"
                     /translation="MNAFIESFGVPPLVFHPDEATVSRYARQLILPEFGGPLAQRRLQ
                     DARVLVVGCGGLGCPAALYLAGAGIGTLGLADRDTVDVTNLHRQIGHTTERVGERKTA
                     SLAKTIAALNPLVNVQLHDCGIDTENARQVVRQYDVVLDCSDNAETRYTVSDACVAEQ
                     RPLVSAAAVGLEAQLALLNYGLDGPCYRCIFPECPPPECQGSCDTDGVLGMVPGMIGT
                     LQALEAVRVLLVQSQIGALGLPLAGRMLLFDALSYRFRLVQLRPRQTAKCSVCATFAP
                     KLSRMVHDTGMRSKTSSSIDALRGDDTSESSPHTRDEIWLAQHGTKSEMVSPETPLNT
                     APHSISETLESNACRTTPQQRNTFHGDRGACELCRSATAETGTKSVGEAADSRLEYRH
                     RHQRNETSNHSGPSWDAREPQSKQSVTETVVVDVRPANQFALCHIRGALNFPMHSWPE
                     AIENQREKLQGQRIRIVCRRGIQSRRAVRMLEALSWPDTHVEDIPGGMEALVRLQQSA
                     DGSRANVTSQTRGDAAVPSQLAQCEPPGGST"
     gene            <734679..>735203
                     /locus_tag="CYME_CMM290C"
                     /db_xref="GeneID:16994925"
     mRNA            <734679..>735203
                     /locus_tag="CYME_CMM290C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537096.1"
                     /db_xref="GeneID:16994925"
     CDS             734679..735203
                     /locus_tag="CYME_CMM290C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537153.1"
                     /db_xref="GeneID:16994925"
                     /translation="MPRPGSKRTHGRHLTAKQESLSHDYEPVQVQAQLEERYRELDAY
                     EAAESTSHGLLASAVATCTLSDDSDDVAEQQEFRLTEDEVVEQGLEEPSVQNFDYWWW
                     LAGLLPLLAEAGHQPQTPGNVNFRHLGERACHVLSTLAADEEIENCTLSRILAQRTAR
                     GAEESSSLDAWLGI"
     gene            complement(<735227..>737488)
                     /locus_tag="CYME_CMM291C"
                     /db_xref="GeneID:16994926"
     mRNA            complement(<735227..>737488)
                     /locus_tag="CYME_CMM291C"
                     /product="cullin 3"
                     /transcript_id="XM_005537097.1"
                     /db_xref="GeneID:16994926"
     CDS             complement(735227..737488)
                     /locus_tag="CYME_CMM291C"
                     /codon_start=1
                     /product="cullin 3"
                     /protein_id="XP_005537154.1"
                     /db_xref="GeneID:16994926"
                     /translation="MTSRKTRLTIQPFKYVSMSEVTLEQAQKSWEKLEKALVRIFARD
                     HQDLSFEELYRTAYNLVLHRYGELLYEGLERGFHYQAQLVRSTVQSRAHRSEVLLESL
                     RTRWQLYKNAVRTVRDVFMYADRSFIRSTGRTPVYELGMSAFRDDVLRDQTFATQLVD
                     AMLDVVTRSRLGEQPPLTLLRDTLDMYIELDMYAEAFEGRFLRVSREFYTLAAARVLQ
                     TCSGRSYLQHVREWFLFEEKLANECLAVRTTRTALQTLLGEILLSEHLNEILDTTDTG
                     FLQLLQSQRLEDLQMMYDLLMRIPEGVDAMRGRLAPYVREKVRADLVRGASALEQPLE
                     WVARAMHLKDEFYNLLAALQMDPKFVRAVQEGFEEALNECPCAQEFLSLYIDKALRES
                     PSISREATRAALEHASGLFRLLRNKDVFEQHYKVHLSRRLLRRFASNTVVPPSANDDA
                     EQHFISKLREECGAVYTAKLEAILQDMRTSDELNAAYRRHQEMIQLYGSRARPMLQVC
                     VITNGIWPVAEAPTAQIPACHPELVEITQEYEKFYHERHAKRRLQWLLHQGSAELCMR
                     LSDEGPALSLKVTSLQMLILLLFNNAEALTVQEMLRLLQFPGLSPELMRALRALCDSR
                     HAILVRAANGPVICNRDVFRVNKAFQSTTLDIDLTDTDHVDENAGVERAARSSELLER
                     DRRPEITACVMRILKRRQELEHSQLVAQVIDELHNRFVPTVAEVKREIEALLEREYIA
                     RESDELTVYRYIP"
     gene            complement(<739425..>741215)
                     /locus_tag="CYME_CMM292C"
                     /db_xref="GeneID:16994897"
     mRNA            complement(<739425..>741215)
                     /locus_tag="CYME_CMM292C"
                     /product="DegP protease"
                     /transcript_id="XM_005537098.1"
                     /db_xref="GeneID:16994897"
     CDS             complement(739425..741215)
                     /locus_tag="CYME_CMM292C"
                     /codon_start=1
                     /product="DegP protease"
                     /protein_id="XP_005537155.1"
                     /db_xref="GeneID:16994897"
                     /translation="MKKRRRGEVGSKKRGSTGALRSPGYDESSDADAATPIVRPQESD
                     EENSHLPSFVLDSILKVFSTHCTPNYSLPWQMRKQEYSTSSGFIIDGNRILTNAHSVE
                     NFTVVRVKKRGSAEKVTARVVAIGDECDIALLTVDDPTFFEDTCPLSLGSLPQLQDRV
                     TVVGYPIGGESISVTEGVVSRIEIQQYAHGATELLSVQIDAAINPGNSGGPALNARLE
                     CIGIAFQSLSAREAENVGYVIPTPVVNHFLTDVQRNGRYTGFCSAGIDWQALENSALR
                     RFLGMDASETGVLLRRIHPLSGATAVLQKNDVLLEFEGNRIGNDGTVQFRKNERINFN
                     FLVKEKYVGDECDLRILRGKTRLDVRYKLDESSSSQLVPVHEKRRQPEYLVVAGLVFV
                     VLTEPYLRSEYGERFEFEAPVKLLNKLMHGEKKFPNEQVVILSHVIHHEITTGYQSLN
                     NLQLLRFNDIEVRNLAHLAELVSKFEGVFMRFHLDYEELVVVETETSRRCTAEILTQH
                     CIPSDRSIRCEEEVSEVDQISMAEVRRLAEQSERAEASAAADVSSKAKQSDQTKEEPT
                     EEAEAEGRSPSRRAPRRGRRTGLRHVTDEP"
     gene            complement(<743365..>744492)
                     /locus_tag="CYME_CMM293C"
                     /db_xref="GeneID:16994898"
     mRNA            complement(<743365..>744492)
                     /locus_tag="CYME_CMM293C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537099.1"
                     /db_xref="GeneID:16994898"
     CDS             complement(743365..744492)
                     /locus_tag="CYME_CMM293C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537156.1"
                     /db_xref="GeneID:16994898"
                     /translation="MVFALQRGDRTRLVRESSRLLLLLLTLLCFIFTVWALIGSKSRG
                     WLREQRASTSGCATTLAAAVEDLSRYNLPLETEFSKMVLNRTQTTPPYFYVTFHSDWD
                     GLVSPAMRANGGLFDAHIHRLFDLLLFREKGVLERCRQGRELVLDVGMNFGAFALYAV
                     NRGCHVIAFEMQPNVAVAVLLASHLNGFSERLQIVPHPVWSESNHTLMYYPRTDNMGG
                     THAIPLSPDAALDHAVQLRTVRIADCVPLQSTIRFMKLDVEGSEYETLLGMLGLLKRR
                     KVLNLVMELQPEPLYSKAVQLLYSLGYQCVELQSLPIDKTHDARSLLPYFKSKPATEA
                     DYWRAFNFHGNDLWCIPWFMGKGIQRFFEASLKIRHRCSST"
     gene            <744912..>746450
                     /locus_tag="CYME_CMM294C"
                     /db_xref="GeneID:16994885"
     mRNA            <744912..>746450
                     /locus_tag="CYME_CMM294C"
                     /product="probable ferredoxin--NADP reductase"
                     /transcript_id="XM_005537100.1"
                     /db_xref="GeneID:16994885"
     CDS             744912..746450
                     /locus_tag="CYME_CMM294C"
                     /codon_start=1
                     /product="probable ferredoxin--NADP reductase"
                     /protein_id="XP_005537157.1"
                     /db_xref="GeneID:16994885"
                     /translation="MRVGVVGAGPAGFYTVQSLLRHAELQHRLRRIDVFESLPVPFGL
                     VRYGVAPDHPEVKRVTNSWTQLMDRYRAIVRFYGNVHVNGRLSLDLLKKRYADGVQGA
                     GLFLCMGAQGGDRKLGIPGETPCIESARAFVAWYNGHPDYADRVFLSQRDGCVAGGGE
                     AVIIGNGNVALDVARMLLQAPARLHVTDCNPVAVDALAAFGAQTLHIIGRRDASNASW
                     TARELRELMTLAPDLKFIVHEAMRWAPTPPGLQPAQPSRTQRRALEVLRRYAGSAVID
                     EVGTRAQVTPRTIHFWFGLSPVRALLGDDQRVHLICAPNELFYDSLGQVQCRTIQDAE
                     PVRITASAGAVFRSIGYVVSAPWGLPLDSNQNCIRNNAGRVVGLEDAVYVAGWLKHGP
                     RGVIANTLVDAQETVAQFVSDLRQAERATQARADGSRTHEPEVEDLLKQAGHSFVDWD
                     GWLRIDAEEQHRGRLCGADRRKILTRSDMLRLAGGASVADYQQNSGEGLGNRSHRTPA
                     DVAF"
     gene            complement(<747206..>747946)
                     /locus_tag="CYME_CMM295C"
                     /db_xref="GeneID:16994886"
     mRNA            complement(<747206..>747946)
                     /locus_tag="CYME_CMM295C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537101.1"
                     /db_xref="GeneID:16994886"
     CDS             complement(747206..747946)
                     /locus_tag="CYME_CMM295C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537158.1"
                     /db_xref="GeneID:16994886"
                     /translation="MLTWLRESGSLSPGGVRRGATGAVAGDRRQGAETNDPKPPMERT
                     SGDWRSFGTGCGTVGDSRDTRTRCAIRVPCSSVSGCRRPGCITRVRNVNRRMQAAASK
                     RHWQDEAVAKPLGRRRVDASIRFPGILERYGSSNQGFHTIDWRFSAMLALAQSPCVEK
                     MLSLRRFQGQSPVANIVFFRLNTCLAVTGISSQDESSRYPGKRGPPPRISYFLDRIPV
                     SQSLAYRVKTNLAGILASVDLHREYRIF"
     gene            <748367..>749362
                     /locus_tag="CYME_CMM296C"
                     /db_xref="GeneID:16994884"
     mRNA            <748367..>749362
                     /locus_tag="CYME_CMM296C"
                     /product="aldehyde reductase"
                     /transcript_id="XM_005537102.1"
                     /db_xref="GeneID:16994884"
     CDS             748367..749362
                     /locus_tag="CYME_CMM296C"
                     /codon_start=1
                     /product="aldehyde reductase"
                     /protein_id="XP_005537159.1"
                     /db_xref="GeneID:16994884"
                     /translation="MTQASHQPLFYGLSDGNRIPSLGLGTWKAEPGQIGEVVQKAIEL
                     GYRHIDCAAVYMNEKEIGGAFRRVFSSGYVKREELFVTSKLWNTCHRPEHVVEACKQT
                     LADLQLEYLDLYLIHWPFAWEFCGSPLNENTWKGVDGAGNIRFDHGVTLQQTWAAMES
                     LVEQGLVRSIGVSNYGLAELHDLLSYARIKPVVNQIEAHPYNSRAEHVQEAKRMGLLV
                     EAYAPLGSGTLGMLRDPAIQNLAKKYQATPAQICLAWNIQRGCVVLPKSVSPDRLREN
                     LDAVRILLDAADMDTLNGMDRALLACDMRVYWPYPVPEEAVRPERFQNTSSNGHS"
     gene            <751623..>752786
                     /locus_tag="CYME_CMM297C"
                     /db_xref="GeneID:16994882"
     mRNA            <751623..>752786
                     /locus_tag="CYME_CMM297C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537103.1"
                     /db_xref="GeneID:16994882"
     CDS             751623..752786
                     /locus_tag="CYME_CMM297C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537160.1"
                     /db_xref="GeneID:16994882"
                     /translation="MFARRHSRRLRRFRRRALSRKKHRYRLRARILSGCQVVDRTAYA
                     QELFYRGLPGSALMHPVTRFSCTSGDRHRTGQQCRHDARFPLKQRPEKSLRREYCAFA
                     LDIRQQRAHREPQAAHPAVTRATRHVHGQNLVQWAWSPSNRDRVLTYITDARIGLRGN
                     DLQRLQHPNWLNDEVINAYLGLLNREYRQHGVYCFHSFFYTRLTSPSYCFAYVRRWTT
                     RARFTIHRDALLLIPVNIAQRHWVLVAIDANRRELRCYDSMHSQDGWCVLPNLRHWLT
                     DECIDKGVEDPWLLSDSWTLSLAHEHERIPRQTDGGSCGVFSLLFAEALAKNWSPARV
                     PSPGKPAPLPLTSLRFQFAQRDIPELRKRLVMALLRQQSSLDAPEASVDRISR"
     gene            complement(<753111..>755456)
                     /locus_tag="CYME_CMM298C"
                     /db_xref="GeneID:16994883"
     mRNA            complement(<753111..>755456)
                     /locus_tag="CYME_CMM298C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537104.1"
                     /db_xref="GeneID:16994883"
     CDS             complement(753111..755456)
                     /locus_tag="CYME_CMM298C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537161.1"
                     /db_xref="GeneID:16994883"
                     /translation="MSPAFISIPINVHRENRSFALGVPSSTEGRCSEEHRALAAWSAR
                     WRRRPRTRTVSRLRMQHVPRGNPRETIVIIGGGITGLSTAVELAQRPAAPQVIVVSRR
                     RSESAAVAAGGMLAPQGERLPPGPLLELCLAARERYAQFVRRVEQAAGGVSTGYDPCG
                     LLAPAFPGDAVHGWRPPADAGEAYFLSADEARQLEPGLTSDAQLAGAWLFPQDGQVDN
                     VALMEALTLACGNLGVRLMEGNEASCLVAARHGKTQRIEAVRLASGNLLYGNAFILAS
                     GAWARQLVPVPVKPQKGQMLSISAPGAATAMDLLVRRVLYGADLYMAPKRLSGKIVIG
                     STVEDAGFDNRCTARGISGLLQRLEKLCPALADWTLDRTWSGFRPLTPDLLPILGPSM
                     EYSNMYYALGHWRNGILLAPLVAQVVADQVLGTSPTLDTQLLRACRFERFTDGAEKAR
                     STSPPHSPRRAAYPADASIGGRAAESPAPTTASSPGSPDAVAGVSLGSDKSANPNESS
                     APAPAAQAGPGTLAADAAPSSPEDESEVLIWKIAEDGSLEPVAPGSGIPAPPDPMKAG
                     KSSGAAVQWPWAVLDALDEERLKQVLEETRVPRTSPKPQNGTSEDASSSKRSTPAPAP
                     STSPDAYQNAKSAASLNAYDDISIAGKNGTTSEASRPAANATGTHPATASAATSREEL
                     FQRMREGIAAALREYEQDWKLDITDDEIGQETQVQMDTQAEAAAAQSQGEKASLPAKE
                     GSQGADAVRQSMFDAFAQIRNFMENPKESRSAPNSDTSPER"
     gene            <757089..>758744
                     /locus_tag="CYME_CMM299C"
                     /db_xref="GeneID:16994858"
     mRNA            <757089..>758744
                     /locus_tag="CYME_CMM299C"
                     /product="dihydrolipoamide dehydrogenase"
                     /transcript_id="XM_005537105.1"
                     /db_xref="GeneID:16994858"
     CDS             757089..758744
                     /locus_tag="CYME_CMM299C"
                     /codon_start=1
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="XP_005537162.1"
                     /db_xref="GeneID:16994858"
                     /translation="MLSNSSFCQRASVTRLVQSVQLLAPNARTWLGRASYDQPLYGAA
                     SGGALVRGQRVPAVSSSAQRHRYSTVAGGSLGEFDVVVIGGGPGGYVAAIKAAQLGLK
                     TACVEKRGSLGGTCLNVGCIPSKALLHSSHLYEEAKHAFPTHGIRIEGKVTLELPAMM
                     KQKMNSVRGLTKGIEALFKKNQVTYVKGTGKLASATQIKVRPPDSDEFAQEIHAKNII
                     IATGSEPVALPMLPFDEKRVVSSTGALSLPTIPQRMAVIGGGYIGLEMGSVWRRLGAE
                     VTVIEFTDRIVPAMDHEIGDRFLQILKKQGLKFKLGTKVTGAKIPAEPSPVTLELESA
                     KDSSKKETFDADVVLVATGRRPYTAELGLEALGIELDDRGRIPIDDAFRTRVPNIYAI
                     GDVVRGAMLAHKAEDEGIACAETIAGHKAHLNYDCIPGVVYTHPEVASVGKTEEELKA
                     AGIAYNKGTFPFMANSRARTNDAGGDFTQGLVKVLAEKQTDRILGLHIIGPGAGEMIA
                     EGVLAMEYGASSEDIARTCHAHPTLSEALREAAMATFDRPIHF"
     gene            complement(<761139..>761945)
                     /locus_tag="CYME_CMM300C"
                     /db_xref="GeneID:16994859"
     mRNA            complement(<761139..>761945)
                     /locus_tag="CYME_CMM300C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537106.1"
                     /db_xref="GeneID:16994859"
     CDS             complement(761139..761945)
                     /locus_tag="CYME_CMM300C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537163.1"
                     /db_xref="GeneID:16994859"
                     /translation="MVVGRRADVCSDRAVGFCSTPVPGNMLVSKQGVPPIDASPCYTR
                     QSMGFVLSPRSWLRSSPPSPRSPRSPRAHGTALSAKASADAEQVGTLVRELRTDPPEE
                     LRVELRSLDSRRRLITGSLNVFAPKAHVWTVLTAFDEMIEFVPHMLSSRFDTESRLLE
                     QVAWVSRRLRLQSRLVMEVEMLPEQGELLFSKRESRDFASWKGVYRIVPRSETETRLE
                     YALDVVPMILFPIALVERKIMKEVPGVLRAFAARAEQRWNDEKRETIPGT"
     misc_feature    complement(761963..765241)
                     /note="repetitive element"
     misc_feature    762259..762702
                     /note="possible transcribed region"
     misc_feature    complement(766114..766409)
                     /note="pseudo-gene of 3-oxo-5-alpha-steroid
                     4-dehydrogenase"
     misc_feature    766968..769201
                     /note="repetitive element"
     gene            <769596..>772370
                     /locus_tag="CYME_CMM305C"
                     /db_xref="GeneID:16994973"
     mRNA            <769596..>772370
                     /locus_tag="CYME_CMM305C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537107.1"
                     /db_xref="GeneID:16994973"
     CDS             769596..772370
                     /locus_tag="CYME_CMM305C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537164.1"
                     /db_xref="GeneID:16994973"
                     /translation="MAFVSTVHCSRFRLYETCGAQRLIAFSVRWRSLKRCRLRPVCEL
                     SSDGQLEPRRNPLNKADDSSEGQERSESERSQWTEEARRQWPEYEPGFVPRSRNDLDA
                     EEYPTSTPGDSSGGAGIAAGYVTGSREVIHDPVVVSRRELLYAVISIAIIVTGILGTV
                     YRRSLRWFSLAGVFGSLRRRYPPPNANLREFMMECEAGAGPVAPALQHCYYIQWLGGA
                     SSALEAAPGHCTGKKLLVLLLWRATDSGTGAALDVLENLRPYMDFIDIVCMHTPKFDG
                     ERPPRFVQLSAKYHEMNFPYGADVSLRLWRDLGVTVWPTAVVLSPRSKRVLFAFEGYR
                     ALPRILLCVRAAIDFYFPRRVATQPPPEPSLRSEQLPSGKSARLGAHSDAFPISAGAL
                     SELLENRRRALASAEDTASLKEQRSSTRTSKRSSRKRDKASPESRLPTRSPLPPQDVY
                     GRQILALLDTSRQALALRFPGKLDVHAESDRLFIADSGHHRILVTKLSGEFIEQIGGR
                     EGAGFRDGTFSEALFQYPQGLVFDPLGNRLIVADSGNNALRIVRFSDGTVSTASVAPL
                     VKETDVQGVMERSISMQDRESGRHRAAVSAAATEPPAASEGTPFWAWQRRWFKPERTR
                     PAVQRQYEQLLSVADADVRFAEVNDRSNNTSSAAKSNSKPGTTHQRTGIAANSSPLSL
                     TPSPRSRFRLPWDVKMHAGSVYVAVAGSHQIWRLDSTGILREYRGSGKPGLVDDAEGS
                     RVPVSFAAPHGVCVQGTCLYVTDSDSSTVRAIDLRAQWTRTIVGGDVFFLESLSTFGD
                     RDGWGRGGHLQYPCGCCALPDGQILLADTLNHKIKVLNLELRDVRTLAGSGEPGLHDG
                     ASTQAAFFAPQGIAYDPTVRMAYVADTYNHCIRQVDVATGTVRTLTLTPPAVLEALAA
                     PAAETSPNGR"
     gene            complement(<773163..>774062)
                     /locus_tag="CYME_CMM306C"
                     /db_xref="GeneID:16994974"
     mRNA            complement(<773163..>774062)
                     /locus_tag="CYME_CMM306C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537108.1"
                     /db_xref="GeneID:16994974"
     CDS             complement(773163..774062)
                     /locus_tag="CYME_CMM306C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537165.1"
                     /db_xref="GeneID:16994974"
                     /translation="MPRHAWSLAQDSRSNVNVLRVASVMASNGIHASARAMFCSFTAI
                     KWQGTHVHRLQQQRCRLFRLHAEQTPALVRKQRSHNRVEQALPLPTRDLAQLFAYGCV
                     GVPAVAHASVTTTAEVANTTAPRIVGGLTFLLTLVGFVRFMVASGRPRIEQTNYTFID
                     TKESDIVTIEKLVGDYLTARKYVPREREASRVLVFRGRTQPSVAIGAFLVFCAAGGLY
                     GFALAAKVLLPGNSDWWYALILLSPLMWFYYWNTNQREEEFRFRVDPVSSDSKAILYV
                     KGPRDEIEAMESELKLVRNRPEE"
     gene            <775947..>778523
                     /locus_tag="CYME_CMM307C"
                     /db_xref="GeneID:16994975"
     mRNA            <775947..>778523
                     /locus_tag="CYME_CMM307C"
                     /product="similar to DNA binding protein, dead ringer"
                     /transcript_id="XM_005537109.1"
                     /db_xref="GeneID:16994975"
     CDS             775947..778523
                     /locus_tag="CYME_CMM307C"
                     /codon_start=1
                     /product="similar to DNA binding protein, dead ringer"
                     /protein_id="XP_005537166.1"
                     /db_xref="GeneID:16994975"
                     /translation="MPPRQRRKRMFPVAPIRCRRSVLVPAGALVSQALVSADAGCRRH
                     LNAWRGIVVAVINDYSWLAITRSVSTLVRMQYQYDLGGFTRAELDAYVRDVGRRFVSQ
                     EMQRKQASGKLDPAATPEDNWYADLWAYLAENNLPRGKLPTLGGAPLDLYKLFVLIIQ
                     RGGLQKTIDARDFKNVAKELALPPTCTAAAFALRQAYERLAYVYEQKFLFNREPHEAP
                     PIRQAVKSSMSFVPRPGGSDGATPEDSVSRIAFRGFEGEQATSRSLVRFGGDGLVSGS
                     HGNATSGSAAGAPLTAPPTGQQHTVRVSKQVLRDALMGAGGLLLPFSGVSVPYRERIK
                     QEVAATESPKRRRSALRGNGRSVGSQRGHWKERAPPWLPYFAENLNSEREKLVLSLQS
                     GVREEVRWALTTLNALCSGAPAGTSVSIGGRSTSGRLELRCALYPGLLDALNDLLDAY
                     LEDLERRRQWSLSMPQELRECRGAHLADLSASALETLEPGAGNNERALDTPESSLQGY
                     RAGLMNCRDTIAKERAQYSLLVTNALRNMSFTTGNEIALATHPALRSTTLRLLRHPDT
                     QPACVDDLLDMWLNIASSVTLVSRTDWANAAGSGVADMNTLRTNAEHAASVIVNGVDE
                     TSRPAAQVDAPAPSSGWRESNTVRRGLAVTGDAHSAHSSRVDALDTIIDWLDATHPNA
                     SVQRLCKAAEIVAQFATRLENETIMITRFPVLLPRLVDMVAPGTGTHLASVQLSMAAL
                     DALASLSAFEWQARERIARTPRLVPTLVRVVAAAVAQQEPELLHRAGVPSPSETSPRV
                     TATIGASLSARAALVLLNLAENPHNRRLLLPYELVLVYGAMTDKVAGTALASVLHELV
                     AD"
     gene            complement(<779416..>780345)
                     /locus_tag="CYME_CMM308C"
                     /db_xref="GeneID:16994968"
     mRNA            complement(<779416..>780345)
                     /locus_tag="CYME_CMM308C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537110.1"
                     /db_xref="GeneID:16994968"
     CDS             complement(779416..780345)
                     /locus_tag="CYME_CMM308C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537167.1"
                     /db_xref="GeneID:16994968"
                     /translation="MRVLDPWYAVWSDAEVCAMIRVLHEQQAQRVAAVVKGVTTLPRP
                     YVPRACDQEIIPVANFGSGLQYFSPAAQQVDHLLLLQERLRPLLESGDLNAWQLLFIC
                     NHRPERLPVLERCLEAGARIFTDLGLDSVDSVAEQAPKPVVHERTAQLLLEAVATCLP
                     PGTNYEEIDNDGNYLPVDPSLSQPFPYAWQLGERRTQLDAEMEQFERVKARRRGDAGA
                     SERPSTTSVDPLSASMQQARLYAQRDSVVERAEAFAGPDLVGAQPIPPEHAMVAVQAT
                     SSTAGRGSTLHTSRKASGSARRSMESKAASTRS"
     gene            <784682..>786283
                     /locus_tag="CYME_CMM309C"
                     /db_xref="GeneID:16994950"
     mRNA            <784682..>786283
                     /locus_tag="CYME_CMM309C"
                     /product="similar to WD-repeat protein aladin"
                     /transcript_id="XM_005537111.1"
                     /db_xref="GeneID:16994950"
     CDS             784682..786283
                     /locus_tag="CYME_CMM309C"
                     /codon_start=1
                     /product="similar to WD-repeat protein aladin"
                     /protein_id="XP_005537168.1"
                     /db_xref="GeneID:16994950"
                     /translation="MELAVSSVHGTGEVGRQPTPWRAPRTHASASGRSAPDAEPLPPL
                     ERITERDAPATGPGRELGTSCWSEPGYDAVSPQRLGLPRLPPLKVASASQSTVEQSSH
                     TLVAASSRSTLAYGNVFRQSVHPERTSTWSRTLSNALEKLLVPRQLQKQQTRTTALAG
                     SLVGMRGTQPGKIALADDWVLLAIITGDDAVYCYRIDREHDTWTCTAVLRTRLVRSVT
                     CLAFRPCMTQSWMLAAGCERGVALWTADAQSAGAAGPAPRSAETAPASVAHAPLYVCF
                     QLLETWGHHHVSSVAWSADGHMLASSTCSDSAVLVWQVGAGSYQALYRIRGGVEHLCW
                     SPSLEDAGVLLSIAHRGSVVRIWSTNPDGEWVSTAWDRPRLDPDLLAWHVKVQVGRDS
                     HRRHYLIGADFTKSLLWCWTLEFQTHASLRPLATFRMPGEPQKLAWDPTGQRLAISFK
                     EPLRFPVQSKTGDPDAADRAPVALYVTEMEPTVQVSLTGFVRAPESNAQVIDLRWHPQ
                     GPRRALALLVISWSNQQVTFYPYVL"
     gene            complement(<786995..>787909)
                     /locus_tag="CYME_CMM310C"
                     /db_xref="GeneID:16994951"
     mRNA            complement(<786995..>787909)
                     /locus_tag="CYME_CMM310C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537112.1"
                     /db_xref="GeneID:16994951"
     CDS             complement(786995..787909)
                     /locus_tag="CYME_CMM310C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537169.1"
                     /db_xref="GeneID:16994951"
                     /translation="MGFVAPFSQSVRHWNLQETKQRSLQRERPRASGNPVWMLTMKRT
                     LVVGGGGRLGRRVVRTLVEQQVPVLVAGRDPERAESAVRAYLREVGLERQGDLAFVAH
                     DITEPAAVQAEQVFRQNDVDVVIDVAGPSRLTPLEPYTVDYKGNRELMRAASAGRGIN
                     HFILVTSLGTGRFGWPAALLNLAYGILFWKRRAELFLIDQVRRTAKRSPEGTESGGIR
                     QFTIIRPAGLERATDNWGETHALQIRPADSIFGGTVSRLQVAQVAVLAALHPDASRNK
                     IFELTTEQGVQQIDPIQQMESVSAQVLS"
     gene            complement(<789544..>790863)
                     /locus_tag="CYME_CMM311C"
                     /db_xref="GeneID:16995002"
     mRNA            complement(<789544..>790863)
                     /locus_tag="CYME_CMM311C"
                     /product="probable phosphatidate cytidylyltransferase"
                     /transcript_id="XM_005537113.1"
                     /db_xref="GeneID:16995002"
     CDS             complement(789544..790863)
                     /locus_tag="CYME_CMM311C"
                     /codon_start=1
                     /product="probable phosphatidate cytidylyltransferase"
                     /protein_id="XP_005537170.1"
                     /db_xref="GeneID:16995002"
                     /translation="MWVSTVHGWQALPHLEGVRQHRRAPCRRPPRTARRSDAGVSLPR
                     TALPTRGRFTAGVPTSADCSAVPRLRCLDATPASSDGADTASTPAAAAGAGAQSVGSA
                     VVASERPADARSAALVAAVATTRPARDLAVRVVSGIVMGLVATTWILAGIWVFTAGLT
                     VVAVLGQLEYYNMVRAKGIRPAQRAGIAASILALWVAAAAPQASEAVFPVSATLICTY
                     MLLHRREKFATIADISTTFMGMFYAGYLPTFWVRMRALGGIEQTRFPAVVSRLPDVLW
                     PGWLPPPEGWTVGAALTWWTWLSVASSDIGALFIGRAFGRRKLSDISPKKTVEGAIGG
                     FLCSALVSILGAFLMRWPLWWLTGTLYGILIGVVGLLGDLTASLFKRDAGFKDSPATA
                     FGGRFRWALPGHGGILDRTDSFVFTAPLVYYFVTMFLPALRAFILKR"
     misc_feature    791496..793756
                     /note="repetitive element"
     misc_feature    complement(791687..793509)
                     /note="possible transcribed region"
     gene            <794029..>797214
                     /locus_tag="CYME_CMM314C"
                     /db_xref="GeneID:16995004"
     mRNA            <794029..>797214
                     /locus_tag="CYME_CMM314C"
                     /product="alanine--tRNA ligase cytoplasmic"
                     /transcript_id="XM_005537114.1"
                     /db_xref="GeneID:16995004"
     CDS             794029..797214
                     /locus_tag="CYME_CMM314C"
                     /codon_start=1
                     /product="alanine--tRNA ligase cytoplasmic"
                     /protein_id="XP_005537171.1"
                     /db_xref="GeneID:16995004"
                     /translation="MAPARGDSEAAPSADAPTTPACWPSSRVRQTFIDYFIDRGHTFV
                     ESSPVVPFDDPTLLFTNAGMNQFKPLFLGRVDPTSPLFGLKRACNTQKCVRAGGKHND
                     LDDVGRDTYHHTFFEMLGNWSFGDYFNAEAINWAWDLLTRVYGLDPDQLYATYFGGDA
                     ANQLPADLDTRDQWLRYLPPERVLPFGTKDNFWEMGETGPCGPCTEIHYDRVRGRPAH
                     QAAALVNAGHESLIEIWNLVLIQFNREPDGQLRRLPARHVDTGMGLERLCAILQGKSS
                     NYDTDMFAPLFAAIQRESGSSEAYAGRLGATDSALTDTAYRVVADHIRTLTFGIADGA
                     VPSNEGRGYVLRRILRRAVRYGQQFLNAPRGFLHRLVPDVARLYQTTFPEVAAKADYI
                     AGVIQEEEMAFSMTLKRGLDRFHETARALVAAGERVFPGKEAFFLYDSMGFPLDLTQI
                     LARERGLEVDVEAYESEMARQRAQSSAAHRKRLGAAEALVLGPEPLAVLSEQWKISPT
                     DDSHKYQWYEPLECTVLAIYAGSEGFLPAAETGDDACVGVILDRTPFYAEAGGQVADT
                     GRLDERFHVINVQSFGGYVVHIGYGRIAVGERVIAHVDYERRALVAPNHTATHILNWA
                     IWQVLGQQCDQKGSLVDEQKLRFDFAYGRGLTAAELERIEQCCREVIARNFVVYTQQV
                     SLTTAKQIRSLRAVFGETYPSEVRVVCIGAPVEKVLAAPVQSDWDQYSIELCGGTHLQ
                     RTGEAHAFCLVEEGAIAKGIRRVVARTGASALECMALARGLASRLPPVPVGSAAENGA
                     SGASVDASMPPVDLLTTLAESLKAITISASEKERLRQRLDYWERMARKQAKQVAAARE
                     QALVDELVRLVNNPQQDAGSPVRQVPVVVAALPIDGDRRILQGMLQSALKRLGSGVWA
                     LLIASPERNDECLVGCVAAYEAQRAGLDCSRWLTETLAPWHGRGGGKPDAARGSCRLL
                     SPIEQQQQQQQQQQQQDADRTASIREGDPERNIYYLDKALIALHDSILTDKKEIAGLR
                     PLLERAARLANAALASSFVSTSTSTRSGSAA"
     gene            <797370..>798173
                     /locus_tag="CYME_CMM315C"
                     /db_xref="GeneID:16995005"
     mRNA            <797370..>798173
                     /locus_tag="CYME_CMM315C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537115.1"
                     /db_xref="GeneID:16995005"
     CDS             797370..798173
                     /locus_tag="CYME_CMM315C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537172.1"
                     /db_xref="GeneID:16995005"
                     /translation="MTLVRRAWVPPPLKPAGALQSLWQDLEPGVVHLWRLCWSRVDLP
                     LDWLSEDERAYAQQSQSARRRREFCTCRAAWRAVLARYYQPQACVPQSVALARTATGK
                     PFLQNGYVRFNTSHTRDWAVLAVTGPTSAIGCDVEHLDRRIRDPLGLARRLGLDTFQA
                     PAPDTLATLSQQLLLTWSEREAVAKALDVSLARIPATPQCSVVRVPVLTGQVLASIAV
                     APAQPVKRIEAFALDTLTPAAWRTLAHAQPSGAMENATASEQQATSPPP"
     gene            complement(<798360..>802733)
                     /locus_tag="CYME_CMM316C"
                     /db_xref="GeneID:16994998"
     mRNA            complement(<798360..>802733)
                     /locus_tag="CYME_CMM316C"
                     /product="homeotic gene regulator BRAHMA"
                     /transcript_id="XM_005537116.1"
                     /db_xref="GeneID:16994998"
     CDS             complement(798360..802733)
                     /locus_tag="CYME_CMM316C"
                     /codon_start=1
                     /product="homeotic gene regulator BRAHMA"
                     /protein_id="XP_005537173.1"
                     /db_xref="GeneID:16994998"
                     /translation="MLLETMTVGPDDKVDLGQTALVSGQDPQDGVASGTEEQFWTLVQ
                     QVSALCGQPPESASAQRLLELLQRLAKLCSVEDFGRFLNDLKTNDWLNQAYGTETNER
                     ELLNGFTALSGTVRKSPVPNTGSLPAHLRAVGTSQQDLLLPLRQNRLLRAALQAIRLA
                     GRGSSVERALIQCLAQPDVAAGERGQLMWPSWALAEHPAGFTDIDGGADAERSLAAGL
                     ASERVAIEQWLDALEQQEQRIERRLQERYELLQHATEEEHDTIKVEIERRALQLHHRQ
                     RNIRRALLNEMYLLVAPVETEAIAAYYRQRRDPLAEYGITSEAVEFGALVAASRRAAR
                     QRENEKLAYQRHRAEQEERRRARHARYLESLLEHGKSFRDARTQINQERQAVNRALHK
                     HFRDRMREEERRARREEQERLRALRANDEEAYLRMLDATKNSRIMEVLRQTENYLSLI
                     TAKVQAQKDVVGVNEAVDAQGLVGLKAREAARKAQAAQRKQLREQERRMRNATEATAA
                     AVDDGVDDNDYDDDGVDDKDDTQAPAENMLDAMRRRREEYYQQTHSIGELVEQQPSSL
                     RGGQLKPYQIEGLQWMVSLYNNNLNGILADEMGLGKTIQTIALLAYLMEYKGVQGPHL
                     IVVPLSTLSNWVREFRAWAPHMKMVVYRGDKSARRMIQQYEMASGQYNVLLTTYEYCV
                     RDQRALSRIFWKYIIVDEGHRMKNTHCRLAMTLGVKYRSRNRLLLTGTPLQNNLTELW
                     ALLNFLLPNIFNSVDTFESWFSAPFQSLGTGDQPELAEEEVLLIINRLHHVLRPFLLR
                     RLKTDVEDQLPEKREHVLRCDLSIWQKILYRQAKSNIGVVLNAGGKPRLFNNVVMQLK
                     KVCNHPYLFYDWEEVSALDPLWIVRTSGKFELLDRMLPKLRQSGHRVLLFSQMTILLD
                     VLEDFCKLRNFSYLRLDGSTKAEERHEMLELFNAPDNDIFLFMLSTRAGGLGLNLQTA
                     DTVILFDSDWNPQADLQAQDRAHRIGQRNEVRVFRLICADTVEERILAEANRKLNMDR
                     QVIQAGKFNQKATDQERRAMLEELLRQQEGNEAAADVPDDETLNELLARTEAELELFE
                     QIDVQRRAQPELYPPLLMDENELPDWVRQNQDQTDSGADGFASGTDTGRRRRSGSSEA
                     DDSTSIDRESRRRRAARTRTVLYDDGLTEGEWLRLLERGKTADDFESAIRERRHRKEM
                     RRLRYQETVRRKRRLLRGLNPDDSTPDTSTSFAENDNDNDDDDDDEEDASAHRSAWHR
                     RSAGQEHPRDRRRHVAARESAAPELPPPPAAAAAVVDTSDLNQQGAVQVVRRRRGRPP
                     GRRAAAATTISARRSAAANASVTASDWPILVDDNTNNNTYDNTTVSASSTATSERSAR
                     TTSTAARVNATRQRQGADASSSVRACIAGTRIETDSIDEHSEHSKHSKHSKHSDDDDA
                     SAPAMIRVRIAGYGMDAQRQR"
     gene            <805056..>810266
                     /locus_tag="CYME_CMM317C"
                     /db_xref="GeneID:16994999"
     mRNA            <805056..>810266
                     /locus_tag="CYME_CMM317C"
                     /product="probable starch/glycogen synthase"
                     /transcript_id="XM_005537117.1"
                     /db_xref="GeneID:16994999"
     CDS             805056..810266
                     /locus_tag="CYME_CMM317C"
                     /codon_start=1
                     /product="probable starch/glycogen synthase"
                     /protein_id="XP_005537174.1"
                     /db_xref="GeneID:16994999"
                     /translation="MPGSTQRGGWREQRPALSRGTPVNQRRWSAWLPRLSSLVDEQPV
                     QDVLDEVQQLLLERSTWVTYEDGARGGASGRGANKPPAPFSSAGWERLQTLLEVEKAL
                     VSALGHHCEDVRDRAVVLLSVLYDGHPLQLAGDALPVAVTCVGEPVTVCIPFASEADR
                     EAFQPQRAVLRLFRPWPNKNKNGYTREVLSKQATNSLQLGGSRPPRSPSSDGPQQRKP
                     SLATETGPNATSTSPSREQTAQDWTNAEEEAEQELPVGTHALWAACHGHWQSYPISVQ
                     GESILVHLGSFEQPGFYDWYIARASDGVASPLVIAHPVVYADVPGMDFRRLRGRFIVQ
                     PRGARAHRLYEIPVDQVGARWDATTGALLSRGSFDAVQELLPRLAASGITGIYVSGCL
                     ERRLDEHEPTPHTVVDRAMPATILGGVHKFRRMCAEARRHQLATIVDCLDRVSLARAH
                     RRYRRIGYVRIVDAKRQVPALPHPGTDCHEVQWEDTALLNYRRLESWYSLIEDISQMA
                     TEHGAGGVRLDNAQCVPCVLAPDVTELARIDNDGIAHYDDEEKAFGDVVLANVEGGYW
                     RTDAAIDGYPNPLLLKLTREMWHWNPSFLVLGESHFHRERNLIVSGLIPHTLRVATIL
                     AGISGKSLRRDGSVRALGENKHPTVDFIARLYRNDAHAIPSGAIMVGGTCSDTSPYPS
                     VLYGRRAWTAVDMLCFLPDIPLLLLGEEDGRAYRINMASVSREVDPDTNLELEVPKSP
                     RLGGHGLPRGSSVASGMSMLHLQQTSMGDVRRLKRSGSRETGLARLSSTNLLGRNTTN
                     RRADSGSMSGAAAAMVRSRSTEDMLKLSIRSVSAEDIRQLDLAEEDIRREIGPQEGYD
                     IRQIRGHYEHRLRLRASYEALREGHMVALVVREQAKYQVLAFARFTRQQIVLLFINVR
                     GGHDGAPFAVPVDTIVDLRPLAEALVAAAFRNGCTYFGPWDRIIELRDCFTGAREPSR
                     YAFEEFLFRRLQITLKPLETRILELCPSSEAAESSTDLHQQTVQRLDEDDEMLLDARA
                     NWLAGYLARHCYDLKAFARALGFLQGLLAPGKQQLTEARARHLMCVCLQRTALLAGEQ
                     EYPPHGFRAVSGERLLAYLMVLSSCGIDALRTVARRILSGNRMGPIVLFSPELGRFSS
                     IGGLGTMVDELSKGLADLGLDVYVISPAYTFNRRGETRYLERDGIRWTRNIDVRIGNV
                     GVATLGIFEGIENSVRLIFFENHSYFPRVYQDLGSQARMMEMLVLANRGVLEICCHKQ
                     LRPSLLVTNDWMGGLVPAYGRLGYFGGYFDDTCFFHIVHNLGDAAYEGRLYPSPAEAG
                     FEAIHQLPRDIVIDPTWNRVVVNPSRAAFKCAHSWGTVSPSYLEELLTNHPLRPVMRL
                     CRAPFGTSNGIRVQDRLALLRRVASSHEEAKSVLQSKYFGVTDPGIPVFAFVGRLTSQ
                     KGVHLILSATDALMNLAGPSKCQILIGGMANRADPYGADCARRCNELKQRYRGYFSAD
                     PDNFFHDGPLVNLGADFCLMPSLFEPGGIVQQEFFVVGTPVIAYRTGGLKDTVIEWDP
                     VELTGSGFVFHEYTMDDFLAACKRALRVYAKPDEYQLLRESTREFVIDVAQVAEAWSR
                     EFHRVKNIIPCRDDVLALDLEAVASELSSAVKDGVCVPAVPVDIDWPDASASSVSVKG
                     SFDGWSREWPLRRDSGKANAWERTFWLPPGTYEIKYRVDGEWLVHPHKPVTNTSGLLN
                     NLLEVPRQTP"
     gene            complement(<812244..>814202)
                     /locus_tag="CYME_CMM318C"
                     /db_xref="GeneID:16995000"
     mRNA            complement(<812244..>814202)
                     /locus_tag="CYME_CMM318C"
                     /product="glutamyl-tRNA amidotransferase subunit A"
                     /transcript_id="XM_005537118.1"
                     /db_xref="GeneID:16995000"
     CDS             complement(812244..814202)
                     /locus_tag="CYME_CMM318C"
                     /codon_start=1
                     /product="glutamyl-tRNA amidotransferase subunit A"
                     /protein_id="XP_005537175.1"
                     /db_xref="GeneID:16995000"
                     /translation="MSCLTSRPTTVNSRLFFSRTSPVQGYVASEVHSVLLQRPQAQCW
                     SCRYPRVTEALTGMRKVSALCIGVRQWQRRRVHRVEKQLAPSDFAPKFSSWTDSCGTA
                     QYRQRTRTRQLPVSRNRWWIGPKPAAAHFASRIVCLGESSSSKLRATRAASVPALGPD
                     PILQASASEIVEKVQTGTWTAMQVVERYLQRLQETEPHIHAYINVDEQFAREQAALID
                     QKRERGEALGLVAGVPISIKDNLLTRALPTTAGSLLLENYQPAEDATCVRRLREQGAI
                     ILGKTALDEFGMGSSSENCAFGVVRNPRDLTRVPGGSSGGSAASVAASSALLSLGSDT
                     GGSIRQPAAFCGVVGLKPSYGRVSRYGLIAYASSLDTVGPIGRSVEDITRCLAVIAGP
                     DPHDLTTLADTGISLDALPDIEEALVEERKPLANIRLGVWTEALEMPQLASEARLALQ
                     EAIATFSSLGASVVPVSMPSFQAACAAYYILASSEASANLARYDGVRYGVRQDGARTA
                     AEMTRRVRTRGFGPEVKRRIMLGTFALSAGYVDAYYRRAMQVRRLVTDDFWRAFQHCD
                     FLLSPVSPTGAFALGAKAGIDLYAEDVLTVPASLAGLPALTLPANPSARLPTGMQLIG
                     RFGDDVGVLRLGRLYERVAGAASLANAT"
     gene            complement(816000..818355)
                     /locus_tag="CYME_CMM319T"
                     /db_xref="GeneID:16995001"
     misc_RNA        complement(816000..818355)
                     /locus_tag="CYME_CMM319T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461459.1"
                     /db_xref="GeneID:16995001"
     gene            <819265..>821226
                     /locus_tag="CYME_CMM320C"
                     /db_xref="GeneID:16994994"
     mRNA            <819265..>821226
                     /locus_tag="CYME_CMM320C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537119.1"
                     /db_xref="GeneID:16994994"
     CDS             819265..821226
                     /locus_tag="CYME_CMM320C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537176.1"
                     /db_xref="GeneID:16994994"
                     /translation="MVPGVAFLACPVPLRWQVTHPASDGTAAPRRLQQSRRWAALWQP
                     RGTRTWLQCSSASLDNSNLGRTERLRGSVTLSSLGDDWVEAFTRAVNALLENPESDVP
                     KQLLESLLAPDARWSGDLIERATTRASIIDKLERAVHFWECAGWYIPPNGVRYRTTAA
                     ERTTASTSATIHVDIEFMVSGLWPLPWRPRVASAGTLSVELELTGDVSRSRLRARNIK
                     DRLEQATLPVLTQLVPSLSDFAAVYVAPMPENDAVFRRRASQSTLLDASAQRPSALKR
                     SPEYIDGSHEQQPSETAAASPPATQAERQRANTLPTGPESVSRGGFRLPPRCYREPPY
                     RPYVECFLLPGMTRPASIKSASGSMFPVLPAFVFNFSRFRNRLVLDPQQFAFVTPVQV
                     RRWLLDELDQNVGALLDRADSVPAPREELYLPEAFDVFDTEDLFDEIQSQIASWSSPV
                     DDHDASVLQWRIPVPIRFGRGRRVVVAPHPYADALGRGETPSDENLNGAPTGAQQFSS
                     AALPRSVFRIPSAVSPVTVERLERTGAPPLPSISANGRVLVRYALSEGTGCVFFARRF
                     RGMLTPGRLARLRYDLLMDLRLAGRVPAGWLPHESRWRLSCYDCSVGFDENAEISVAV
                     YRSSRPLFCIFELALEVPRAFSQADTAAS"
     gene            complement(<821958..>822824)
                     /locus_tag="CYME_CMM321C"
                     /db_xref="GeneID:16994995"
     mRNA            complement(<821958..>822824)
                     /locus_tag="CYME_CMM321C"
                     /product="RNA polymerase III subunit"
                     /transcript_id="XM_005537120.1"
                     /db_xref="GeneID:16994995"
     CDS             complement(821958..822824)
                     /locus_tag="CYME_CMM321C"
                     /codon_start=1
                     /product="RNA polymerase III subunit"
                     /protein_id="XP_005537177.1"
                     /db_xref="GeneID:16994995"
                     /translation="MHALTTRLGSKGEHDRLLRMHWITPSLPLPPNLPECVAYPLDRD
                     AVSDASGKASTWPRKGNRASSKLVCIRNASLPCFECRSCPPKPVRIKQQSKSTEIDRQ
                     IERTSEHSNAPYPPDTLVGGMPSSERGKHIARNSFSFRLEFSVAEGGNTPTAPTVCED
                     LMLYCPVCYERVRTVQHQRRVDQVLTCLLCRRCGYCYTPPPNTTWTEPLHPWTARDRN
                     QVRAGVSQTLQQPEELVVLGAESAGQETSQVRCERCSARKASFYQLQTRSADEPMTTF
                     YRCLECGAQWRE"
     misc_feature    complement(824493..825625)
                     /note="possible transcribed region"
     gene            <825954..>828389
                     /locus_tag="CYME_CMM323C"
                     /db_xref="GeneID:16994997"
     mRNA            <825954..>828389
                     /locus_tag="CYME_CMM323C"
                     /product="ribonucleoside-diphosphate reductase alpha
                     chain"
                     /transcript_id="XM_005537121.1"
                     /db_xref="GeneID:16994997"
     CDS             825954..828389
                     /locus_tag="CYME_CMM323C"
                     /codon_start=1
                     /product="ribonucleoside-diphosphate reductase alpha
                     chain"
                     /protein_id="XP_005537178.1"
                     /db_xref="GeneID:16994997"
                     /translation="MERCVVKRDGRRQPVKFDKITARIKKLAYGLDPLVDVTEVAQKV
                     CAGVYDGVHTSELDELAAETAAYMSTRHHDYSILAARIAVSNLHKNTEKSFSAVMERL
                     YAYRSPKTNDPAPLIASDVIEIVRRHAETIDGAIIYDRDFSYDYFGFKTLERSYLLRI
                     DGKVVERPQQMLMRVAIGIHKEDLDAALETYDYMSQKYFTHASPTLFNAGTPRPQLSS
                     CFLLSMTEDSIEGIYDTLKRCAVISKSAGGIGLAIHNIRATKSYIRGTNGSSNGIVPM
                     LRVFNDTARYVDQGGGKRKGAFAVYLEPWHADIFEWLDLKKNHGKEEARARDLFYALW
                     TPDLFMRRVEANEQWSLFCPNEAPGLADVWGDAFDELYQRYEAEGRAREVIPARKLWF
                     SILESQIETGTPYMLYKDHCNRKSNQQNLGTIRCSNLCTEIVEYTAPDEVAVCNLASI
                     ALNKFVVPGDRERGTCPVFNFDELAFVTRMVTKNLNKIIDVNFYPIPEAQNSNLRHRP
                     IGIGVQGLADAFILMRMPFESDEARALNQEIFECIYYNALQASIELAERDGPYASFEG
                     SPAARGQLQFDLWNVKPTSSRWDWDALKERITLHGLRNSLLVAPMPTASTSQILGNNE
                     CFEPYTSNLYTRRVLAGEFTVVNQHLVRDLQELGLWNPLVKNKIIAHGGSIQQIPEIP
                     QDIRDLYKTVWEVSQRRLLDLAADRGAFIDQSQSLNVYIAQPTIGKLSSMHFHGWRLG
                     LKTGMYYLRTRPAADAIKFTLDQRILKEENHTAVNGSQLPCNLTPRTSAAEQFAALAC
                     SLDKKDDCIACGS"
     gene            <829272..>830078
                     /locus_tag="CYME_CMM324C"
                     /db_xref="GeneID:16994992"
     mRNA            <829272..>830078
                     /locus_tag="CYME_CMM324C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537122.1"
                     /db_xref="GeneID:16994992"
     CDS             829272..830078
                     /locus_tag="CYME_CMM324C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537179.1"
                     /db_xref="GeneID:16994992"
                     /translation="MSGAAQKTKSKHATFTECLQREAERVQRREPAALATWLAELAAA
                     SDDAQQSEELVTEWHKFFQDFVARQQFRVFVTGDQVPDQGGRAIALAVRHSIRRSVET
                     ETKPEVARMTTGACVTGADAAQKLLPGLLRPDVLVLAPAAERVCRAAAAVGALSRFRR
                     SRWTCLKVIARHERLEVSIERCKALARTQERHRNGVIVLGTPHRISELMQRQVLGAPR
                     KALVLDMSLDVKCRRLLRMPGVQQAALHCLRMIAKDLAGDHSLPELVFYA"
     gene            complement(<830603..>832621)
                     /locus_tag="CYME_CMM325C"
                     /db_xref="GeneID:16994993"
     mRNA            complement(<830603..>832621)
                     /locus_tag="CYME_CMM325C"
                     /product="similar to RNA polymerase III transcription
                     factor TFIIIC"
                     /transcript_id="XM_005537123.1"
                     /db_xref="GeneID:16994993"
     CDS             complement(830603..832621)
                     /locus_tag="CYME_CMM325C"
                     /codon_start=1
                     /product="similar to RNA polymerase III transcription
                     factor TFIIIC"
                     /protein_id="XP_005537180.1"
                     /db_xref="GeneID:16994993"
                     /translation="MSTCFRETSPDGSESDVADERAIVPGSAEFQTLDGVETRRPWSK
                     TEFHPATVSSTALAAATNYYLERGPSAAPDEEDVFGARLERQVFGIADETEDAAALSF
                     GRGRRGRQRGRRPAARLAPELEPLLARAHLCYLENQLHDAVVACHEVIVKDPKAVPAY
                     KTLSLIHSARGEWSKALDLALIAAHLNPHDVDWWKYIASESVRMGKPRQAIHCLTKAL
                     SATRGHDEEALRERTYLFLQIGDEKRAAAGFEQLLRMEPADEDAVVNLARLYLERGEA
                     ATAETLLTKWLDDMRRRERVRAGSSNTSALAVGTGFEQALTGLPPLYSGPRSATGLRD
                     SARTRYGLVEPERRSQRPLLAHVRAQEALADAQLLQGKAAEVAATMNYLTLMLTAVRI
                     ARRRSRESTLTVSGTKSLPAGKDGNAPATADEKEQSRMTCSNGITDPADVLPLRLRAR
                     LALAHLLLGDPKPAQRIGALLVCEEQVPLLYFHDLLYHFRRILAQTTEHELEFAILQR
                     LRQFGPYDQDTELRQRFDWLSRVCENSDVAAPAPQAPVKSVQRRAQQRSRDPEEKNAS
                     RGHVKPERSVDKERAPRDDRRRARKDLESGSCAVQDTSSAGASDSTEYDIPKQHTRSL
                     RRRSDAGRGHAPDQAPNGATDAPDKEPNAGALAPDPSSKERKRRRTRQ"
     gene            complement(<834710..>838504)
                     /locus_tag="CYME_CMM326C"
                     /db_xref="GeneID:16994988"
     mRNA            complement(<834710..>838504)
                     /locus_tag="CYME_CMM326C"
                     /product="serine/threonine-protein kinase IRE1"
                     /transcript_id="XM_005537124.1"
                     /db_xref="GeneID:16994988"
     CDS             complement(834710..838504)
                     /locus_tag="CYME_CMM326C"
                     /codon_start=1
                     /product="serine/threonine-protein kinase IRE1"
                     /protein_id="XP_005537181.1"
                     /db_xref="GeneID:16994988"
                     /translation="MGSARRGRFRPFLALLLLTPIVLQCVLFTLGADAFRQHRSTRKN
                     SELSSGDQLFPQGATGSRAGRPTMLIAALLDGTVRALDVPSGQTLWHINTDPVALDGG
                     YNTRAKSDDQLGHSPTSGLARREAAASTQQRQRSGKGTDGPPANTLNRDQSVPSPEPY
                     HGDARVAEVSKPLPSQPAPAPAVPYGIPIQRRETRAFTVRLRDGELLRRISFEDDEAS
                     RRCKWDDATSAGGGATGIGSRPDQRHSEQPLEKENAEPVLVITRTDSGMRFVDPLTGE
                     ASWNVTYADYEMYLLDEPAHYAGEFLAPFLFGRRVLAGESRCPARHMVSSDTLEESPL
                     DPEDPQVPRAARPVQNKARYVAILADNGRFVVVRDADRGTTMWSAEFPYPILSLRAIG
                     DIVLITDTAASSPVALPDGGTSDAVRATRHFWQWSRPVPLQSPDPPTTLRYRDEWQQM
                     CLPPSAELYRKPRGMPQNAYSSFGTSVYDHAPVHGGVLLVVAIFFAGIGPLALALALW
                     TIWRMRRTEREQRHSSERQRTPSPPPVLRRRETKRVMMMTGATQPRAARAQENDRSRG
                     FERSSLVPKPVPIQRVERPRSVTDSATGSEAPLPTGYQKVGRLLISPNVIGYGSHGTS
                     VYEGLLLPGYRRVAVKRLLKSFYQIARREIEVLIELDESCQHILRYYAMEESGDFIYV
                     ALELCAGSLQDRVERGELPATRCPLLDELSTEVDRRAAGPLQLGPPPATVRALRGLLL
                     GIAELHDHGIVHRDLKPANVLLAIGSDDIVKIADVGLAKRLDAGRGSFTAGATAVGSV
                     GWRPPEVLRGASLFEGLNSVHSETSAVDDARERAGDATACESMTHSENGGADAARPAR
                     LTRAVDIFSVGCITYYVLTMGSHPFGELVFQRDANILAGAADLSALRAWPEAFDLVRL
                     AIQHEPERRPSAKALLGHPFFWSDARKLQFLIDVSDALFEHPDSRYLRQEIERGCEST
                     VLGPLGNWSLRMDTSVLLSLRGRSYNGSSIVDLLRLARNKRTHYHQQPDAVKALLGPI
                     PVEDDPMEVRSRDNAVNTSTLETTRAKASTNSNLYTYFASRFPNLFMHVYAFAIRTGL
                     ALSEHFQRYPSRELIQYYEHDESIFSLTTNTSTGPGESSTSAMPDSSSSSSSSSSSAE
                     ADVHTTASVVADERVPSTQTTLPSSRPMPGRRVYSRALFDRVRQEISENPGLSEELDA
                     SLLQLSGPHPLRRRSCEFFLASTVVNKPERDHGAEVDQALMRLPSLLAPVSSASWQSL
                     AS"
     misc_feature    839624..842055
                     /note="repetitive element"
     gene            complement(<842636..>844408)
                     /locus_tag="CYME_CMM328C"
                     /db_xref="GeneID:16994989"
     mRNA            complement(<842636..>844408)
                     /locus_tag="CYME_CMM328C"
                     /product="similar to acid phosphatase 2, lysosomal"
                     /transcript_id="XM_005537125.1"
                     /db_xref="GeneID:16994989"
     CDS             complement(842636..844408)
                     /locus_tag="CYME_CMM328C"
                     /codon_start=1
                     /product="similar to acid phosphatase 2, lysosomal"
                     /protein_id="XP_005537182.1"
                     /db_xref="GeneID:16994989"
                     /translation="MTLRLLALGVLLVLLVGEFGRTGPLVRLPTGDESPNSSNPKGRQ
                     RALSDLDVRSSLEAVLTANSTRSRSSGRLVGADPLERLASRRVESWPPLWAHRVREEV
                     LAANQNTSLIMIIEVCRHGARVPLGTYPRDPLPYHKWPEGIGQLTPIGIHQQFELGRI
                     LRYVYDGFLPVRYNVVDVHVRSSDIDRALVSATNQLLGLFYTNTSDTRVQYQPVPVHT
                     IETSQDIMMLPGVGCARWQELKMQTRLSGAWRELEAANQLWLEYLGRNIMGLGRPATL
                     DDVATAYDVWECDAAQGIELPPEVNHSVRERVRTLYGFCFADLYRSAEAANLTGGPLA
                     LHILNLLRTKIAGLRTEKFVLFSGHDTTLAALLAVLGMHPERAPPFGSTIIVELRELH
                     KQPPNGILKAGSAAISTSDIRTAPNAQRQREQQLPQMQQRSDDFMPREALDKWYVVVR
                     YNWEVFELPGCEPICTLRRFMELVSKRSSSARSSEIRAEACRPSKNDWLTVTNTPDYI
                     ARDTARRKWGVVFILGVLSGVLVFLGCVAIFWLGWRLGTRQKPESLYNPVTVEPLGWE
                     SSRTRSSSEATPATLSPVGAYEIT"
     gene            <844713..>847622
                     /locus_tag="CYME_CMM329C"
                     /db_xref="GeneID:16994990"
     mRNA            <844713..>847622
                     /locus_tag="CYME_CMM329C"
                     /product="similar to ATP-dependent RNA helicase"
                     /transcript_id="XM_005537126.1"
                     /db_xref="GeneID:16994990"
     CDS             844713..847622
                     /locus_tag="CYME_CMM329C"
                     /codon_start=1
                     /product="similar to ATP-dependent RNA helicase"
                     /protein_id="XP_005537183.1"
                     /db_xref="GeneID:16994990"
                     /translation="MVLLHIIDGDAAPEVGPATERRRKANTAKRAKRRQSKDHPAPLE
                     AVGDPEKRATSGSALEARSNARTPRATAVVASCTEVSRQSAIATVEQQPSALHSGALG
                     LDSDSHARTPTGLTAPGTGVEPHSDQERLHATISSKGAPSATGPLGVASLAAFVGATC
                     RGKGTRAGTAVCIGTERKSARRHRNTAGTSGDGTVLTTNAHTTARKPKQSTSLNRSPP
                     QKVDGNESKCAAVLASGTEGLAVQEHARHNHSQGVSLAQVEFRALPLDPSLCYHVQHR
                     LGWQQPTRIQQRAIDALQSSVQRSSDRPTLPLWSIRAHTGTGKTAAYLLPIIHWMLQK
                     HPRMERSYGTVAVVLAPTRELCVQIEDMARAFLRPYHWLVASAFVGGEKRKSEKARLR
                     HGTNLVIGTPGRLWDHLQQTSSWHLEHCEWFILDEADRMLDLGMADTVRSVWTEVLQR
                     HRSGNATRSATALNGTSVPVGPLRTVFVSATMRSEHVEKLCEICALDKLADGGNAPAA
                     TMQCIDDDDAAAAAASTTADTRHRAAVAVDAHAVHERTGHGDCEQAIERGDETRLLVH
                     AASNLYSRARRSTQLDALPGDLSSSPILHCFRLVPTRYRLAELACVLHAFGNGVLQRA
                     LGPLLPCTDEFIRPESRKALVFASTCASVDFLYELFRQLGKRQEPLLPEEQAEVSPPE
                     PVLNSNGSAYSTGLQCQLFRIHGSMTQTERIRTFRAFRKMLSTPCLLFCTDVAARGLD
                     IADLSLSVHYDPPTSDGDQEYWHRVGRTSRMGSVGASVVILQEHESGYLSWMASRYGF
                     EWRSLPCLAQQVQARDGIRSMSGSREAGGAFGEAHHSVRAETYAAHQSFLQEIRYLVE
                     TVPSLEPLARKAFSSYVRSYRTHSRDMRHIFDARCLHLGLLADSFGLRVVPRFAGADH
                     EPPLTRMPSRSTRALPRKRAPVSNALVERSAARQRRRPSDQLLSTTIDRRSEFLA"
     gene            complement(849101..850864)
                     /locus_tag="CYME_CMM330T"
                     /db_xref="GeneID:16994991"
     misc_RNA        complement(849101..850864)
                     /locus_tag="CYME_CMM330T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461460.1"
                     /db_xref="GeneID:16994991"
     gene            <850842..>853259
                     /locus_tag="CYME_CMM331C"
                     /db_xref="GeneID:16994984"
     mRNA            <850842..>853259
                     /locus_tag="CYME_CMM331C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537127.1"
                     /db_xref="GeneID:16994984"
     CDS             850842..853259
                     /locus_tag="CYME_CMM331C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537184.1"
                     /db_xref="GeneID:16994984"
                     /translation="MDSLVTGAHAESEQTKSFPDSTLKSVPDRYNLPGDSGDAKKQRR
                     LLQFSFFRPDRLQPEVDTLTEALVPLDVVDEPDPPVVCAIGWLCTREEDEIASAVERL
                     AVEGRLAEYYGTTDLAEAVDRALSRAQQGAVAASSTRNRMPVLKGTPIGPIRSWCIQF
                     GIEPRIYVETDDAWYHVVYYGASPEYAPLFESARSKFEIAVRADLLCAKNPGVRLRPA
                     VDLTYGYVTFALTLPFAGMRSYTEEHVHEVAPFLLEQAAELDSYLPESHFLSVLARRA
                     PIGGAPSQSLSADALPNEKRRHFMYHLRHLLAEICRRSDARELRELTNPQKYPGYEQA
                     VPVPLDLNLIMHRLHTAEGYTADDPAAVVRDVRQVFHNCRLFLQVSDKESQKILVRAT
                     RVEHFFDERLLQLELALRDGSLPPAVGQLGASLDASTVAYDHALTYEGDGNGQQHAAA
                     GSEGARTPDAADISGPEWSHQLADTGSVEALRGKRTAKRRRPSEQSAGKGIGNGRDPL
                     SAVVDPVTEGTASKPNEDARSGIRGNSGVAAAAAGAAVATLPKPVCAYPICTHEPRRG
                     SKYCSDECGCAVAVLRLAESVETLPRAARKALLAAEVVVRGFAAAGKEAQRAAELLLR
                     EQEKREQEAQTAHASQDAPQNDRGMPPEFRPPPPLAATASAAEKAAYASLNGVIEEAT
                     KLHCQLKRVDAQIAETSVLVAAAPEGYCGFGGYCQWSWRGGQRPSPIAAGLRTADAPE
                     TGSENVQSRPCPIHGNWRVNKPLEYHRERQHVISRLQDLSVMYRRLWEHLKLGIPHQS
                     ESMETNG"
     gene            complement(<856133..>857023)
                     /locus_tag="CYME_CMM332C"
                     /db_xref="GeneID:16994985"
     mRNA            complement(<856133..>857023)
                     /locus_tag="CYME_CMM332C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537128.1"
                     /db_xref="GeneID:16994985"
     CDS             complement(856133..857023)
                     /locus_tag="CYME_CMM332C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537185.1"
                     /db_xref="GeneID:16994985"
                     /translation="MAFTNIFLHYSPKHRKASSVALVRKASTGFVWSSRWLSSHGRSL
                     RRVSPCSLANAKRACRALQITSTLTPPFPVGAGPRDGAGAASQNNGAPAPTSVPKTDH
                     MSRRAQALRAFLRSHKSLLRCGDGFHTEAANTCRKNDTALMFVPIEEIESYRGRRSFQ
                     GADVAAVITTNAEAIIEAGIAAARVKKECYEGKNLATLSRTEAIEEQLANDMRDQLRI
                     VSYAVLAQEENAPPVDFLHRRNVALLLELYHELGLDLSRVKDGWQAMARKIQELCPDP
                     SWYEKRVKPAVEQLLGAFGN"
     misc_feature    complement(857156..859605)
                     /note="repetitive element"
     gene            <860397..>861443
                     /locus_tag="CYME_CMM334C"
                     /db_xref="GeneID:16994986"
     mRNA            <860397..>861443
                     /locus_tag="CYME_CMM334C"
                     /product="similar to mitochondrial carrier protein"
                     /transcript_id="XM_005537129.1"
                     /db_xref="GeneID:16994986"
     CDS             860397..861443
                     /locus_tag="CYME_CMM334C"
                     /codon_start=1
                     /product="similar to mitochondrial carrier protein"
                     /protein_id="XP_005537186.1"
                     /db_xref="GeneID:16994986"
                     /translation="MVDEKGDLCLWEHLVAGGGATLSAVSVMHPLDTIKIYMQRAQVA
                     TAGGSANVRPTMLGAAQEILAQRGPGGFYAGLGANLSGQVPAGAIKFATYELLKQHAV
                     QKRLPAAAQGWGEVASAALAFLACSVVLVPGEVVKSRLQAGLYPSFREALLRIIEQDG
                     VSGLYRGYWATVTRDVPYTMLEFGLYEQFKRACMWSVKRDRLHSSEEWTMGGLAGGVT
                     GWCTTPLDVIKTKLMTCARSQYRGYWDAARDVWHREGLSGFFTGGLARVLWLVPFTAV
                     FFGSHEIIKRFLRSRKRQYSTLRSTRIPRMDPEASASSNCTCRYKSIKWFGSSTLICD
                     VRIKPAYRSPRHPF"
     gene            complement(<861668..>863650)
                     /locus_tag="CYME_CMM335C"
                     /db_xref="GeneID:16994987"
     mRNA            complement(<861668..>863650)
                     /locus_tag="CYME_CMM335C"
                     /product="similar to CCR4-NOT transcription complex,
                     subunit 4"
                     /transcript_id="XM_005537130.1"
                     /db_xref="GeneID:16994987"
     CDS             complement(861668..863650)
                     /locus_tag="CYME_CMM335C"
                     /codon_start=1
                     /product="similar to CCR4-NOT transcription complex,
                     subunit 4"
                     /protein_id="XP_005537187.1"
                     /db_xref="GeneID:16994987"
                     /translation="MAFSGAKLVDTSDSSFSLKRVRQPTGGRARNGRTRRQATHRHAS
                     GKSADEAPCEPSEESSECPLCLEELDAAEKAFFPCACGYQVCLWCLSRLRTACEEGQV
                     PRCPACRTPYDESRFQLREELSDERLAEKERLREINRRKKERQLRQEQLERERQEQRE
                     YELAKRIRTMRQTFIVQRNLICIRGLHQSLWSEHTIRRSDMFGKTGRIQRVLFVQGTG
                     VYVEYADEAAATRAIQLYDGARWQGHEVHVSYGTVRYCEAFVQACEQYLKTFVEWKQS
                     QIESAQWTSGRNPSIRPLDASDTVAVAFAGAKVISRKRASNGAKPPQPPTQKRCVDPA
                     CLYRHEFASNTDAISREAFLQSRYGPPPPLHAFRSATCTQTKKPCSNATLQPLSDIDA
                     RQDAGSISGAEAGPNEDDFVFDEFASPKISAARENDLFKLGCIWGSSSPLSWHAEPGL
                     GTRAASERSTRLVGDAAEGAPPQASGAMVNAWRSFDEYERISLSERDATGNRTALHPE
                     VEPLTQQAFISWDPAIQMASGAIRRSCSVSLGAVGERRKPATGNPCLPDNSPISHSVS
                     SGRSVSIADPHWSVTEDPFAQLTKAFAQIGVTNVRIENSYHVGDTGAPLWTEETRGGS
                     IWKSPRWRSSSVSASLTALQDLGWRPLDANTNLADS"
     misc_feature    complement(863642..865326)
                     /note="repetitive element"
CONTIG      join(AP006495.2:1..866983)
//
DBGET integrated database retrieval system