GenomeNet

Database: RefSeq
Entry: NC_010140
LinkDB: NC_010140
Original site: NC_010140 
LOCUS       NC_010140             852727 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 14, complete
            genome.
ACCESSION   NC_010140
VERSION     NC_010140.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 852727)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 852727)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006496.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..852727
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="14"
     misc_feature    757..3354
                     /note="repetitive element"
     gene            <3831..>5528
                     /locus_tag="CYME_CMN001C"
                     /db_xref="GeneID:16995222"
     mRNA            <3831..>5528
                     /locus_tag="CYME_CMN001C"
                     /product="similar to dolichyl-phosphate-mannose:protein
                     mannosyltransferase"
                     /transcript_id="XM_005537131.1"
                     /db_xref="GeneID:16995222"
     CDS             3831..5528
                     /locus_tag="CYME_CMN001C"
                     /codon_start=1
                     /product="similar to dolichyl-phosphate-mannose:protein
                     mannosyltransferase"
                     /protein_id="XP_005537188.1"
                     /db_xref="GeneID:16995222"
                     /translation="MAPAVKRRAADATAASLPASSPSAERVQAADLDVMHQGRTKEDT
                     PQHEHPGADPQKQQASPLERLVLRSTAHVRANPDAWLTGALVLLGLWTRLYRIRWPPE
                     CVFDEVHFASFAHHYLNRTYFFDIHPPLAKLTLAAVAKLAGDVPNRDWYVDKVYPPDS
                     RYYAMRACAGVFGALLPPLGFRIARGMGMSRIAATSVGVFLLFDMLNLIEARHILTDS
                     QLIFYAALCIDAFVRLWRTPPASRARRWAAVRAGLASGAALSVKWTTLVVPGLFGLES
                     VAGAALAAEPLEWSTCAIVAATALLLYVALWYPHFRILIYNGPGGDFMSAEFQRTLIG
                     RDGYDPQARKPPFLKLVWQLNKEMLLANARILDEHQWQARWHTWPYVGRGLLYWNRWQ
                     EGTLDADGRPLRPHHAMQIYLIGNPLLFWMCLAAVLGTVAAMPFLLRLIRQRKKRGTS
                     TDAWERYLRLATFLLLGYALGILPYMPIQRSTFIYHYLPSLLFAELLFAHAVLDLPAL
                     PSVLQLPLAGIVWIVVFWCFWYFRAWVYGHIALTADDHEAMRWIKYTSSVGDNKGWH"
     gene            complement(<7025..>7540)
                     /locus_tag="CYME_CMN002C"
                     /db_xref="GeneID:16995226"
     mRNA            complement(<7025..>7540)
                     /locus_tag="CYME_CMN002C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537132.1"
                     /db_xref="GeneID:16995226"
     CDS             complement(7025..7540)
                     /locus_tag="CYME_CMN002C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537189.1"
                     /db_xref="GeneID:16995226"
                     /translation="MAAPTSCSAGKGREASASCCLGVLPVDVAFVQLHAFSVVGERLA
                     SGAERTPLSQVLPRRWTPLHPASLQDRKRAWVLGQVLQRHRSSSALQGSRVGRPQAAI
                     VQLRASLDRSALAGMSLAQAGFLVIGAREPVLLDVGPLHQVDVTMLLTGVATVGGVLV
                     GLLIAFIISRQ"
     gene            <11546..>12841
                     /locus_tag="CYME_CMN003C"
                     /db_xref="GeneID:16995227"
     mRNA            <11546..>12841
                     /locus_tag="CYME_CMN003C"
                     /product="similar to high-affinity iron permease"
                     /transcript_id="XM_005537133.1"
                     /db_xref="GeneID:16995227"
     CDS             11546..12841
                     /locus_tag="CYME_CMN003C"
                     /codon_start=1
                     /product="similar to high-affinity iron permease"
                     /protein_id="XP_005537190.1"
                     /db_xref="GeneID:16995227"
                     /translation="MIFWMLNTAAHMRRDLEGGIARALSRRGRWGVALLVFTSVLREG
                     VELIVFLFGITGGVSWSSIPIAAAVGVAVALVVAWAIYRGALAFDLRLFFALSSLLLI
                     AFAAGFLSTAFLDLQKANLFGAFTRNGNEDESIPSTQRPWWNAALWSTEACCADDGNE
                     FFNLLHELFGYVDAPTFVSTVVYFGYWTLAGVLWIIVERRTLERKLCQMHTGYLVSTA
                     FLAVAAVVGLVVAARSPTWNGILVTCLTLVLAIIGVGAASAPHAALPPRARFALQGSC
                     WIGLVLVACLALALQVAQAICSPQIGASQYCSISDFYYWFVIFSPDWIAKTRDDNSFH
                     ALAVLTVSICFTMLFCLGQGLVGFYEWKRSALAMQRAGQAPAALAKQANTSSDLEGGK
                     STPLDDSSIDELTWEALDSTQPPQHASQIEISARRMLAD"
     gene            <13186..>14421
                     /locus_tag="CYME_CMN004C"
                     /db_xref="GeneID:16995233"
     mRNA            <13186..>14421
                     /locus_tag="CYME_CMN004C"
                     /product="similar to dTDP-4-dehydrorhamnose reductase"
                     /transcript_id="XM_005537134.1"
                     /db_xref="GeneID:16995233"
     CDS             13186..14421
                     /locus_tag="CYME_CMN004C"
                     /codon_start=1
                     /product="similar to dTDP-4-dehydrorhamnose reductase"
                     /protein_id="XP_005537191.1"
                     /db_xref="GeneID:16995233"
                     /translation="MHCYRTVKNARAMRIPFLAILKDNGSSSTQYLSMQESRRSHQAA
                     QRLQRPARLPDETPGARPDQIPETRHARETWGSTVSPASRRVHSSDIQNFPQRGHECQ
                     QVASSMPDEIAQVRFLIVGRTGWIANMVAELLEQRGERYAFASFRLEQREACERELDA
                     LRPQRVLNCAGVTGRPNVDWCEDHRRETVRSNVLGVLNLADCCASRGIHLTNFATGCL
                     YHYDDGEHRPTAEGGRPFTEDDPPNFFGSYYSRTKAMVEELLRSAFDNVLILRLRMPV
                     SDDLSPRSFVTKIARYEKVVNIPNSMTVLTELLLVALDMSERGLTGVYNFTNPGSISH
                     NEVLELYRKYIDPKFQWKNFTLEEQAKILKAGRSNCELDVRKLLRDNPGAQIREVHAA
                     MEEVFRRMQAKGVKPLAAP"
     gene            complement(14192..18150)
                     /locus_tag="CYME_CMN005T"
                     /db_xref="GeneID:16995234"
     misc_RNA        complement(14192..18150)
                     /locus_tag="CYME_CMN005T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461461.1"
                     /db_xref="GeneID:16995234"
     gene            <15632..>16762
                     /locus_tag="CYME_CMN006C"
                     /db_xref="GeneID:16995235"
     mRNA            <15632..>16762
                     /locus_tag="CYME_CMN006C"
                     /product="dTDP-glucose 4,6-dehydratase"
                     /transcript_id="XM_005537135.1"
                     /db_xref="GeneID:16995235"
     CDS             15632..16762
                     /locus_tag="CYME_CMN006C"
                     /codon_start=1
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="XP_005537192.1"
                     /db_xref="GeneID:16995235"
                     /translation="MSSQSTALSNGAKSVTGGQPDGNSDALVVYGDRLRFVPRNILVT
                     GGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIRGDIRSHD
                     LVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGKVRRFI
                     HVSTDEVYGGESNMETESSILAPTNPYACSKAAAEFICRGYVKSFGLPVIITRGNNVY
                     GPHQFPDKLIPKSICLLAQRRPCFVHGSGEHARNFLYVEDAASAFDTILHCGETDEVY
                     NVGSEIEKRNIDVVHDIIDLFGLSAEANRHIEFVKDRTLNDMRYRIDSSKLHALGWRP
                     QVSWEEGLRRTKTWYCDPNNLKRWPNYLSGLVPHPSLTEEKH"
     gene            18661..20198
                     /locus_tag="CYME_CMN007T"
                     /db_xref="GeneID:16995236"
     misc_RNA        18661..20198
                     /locus_tag="CYME_CMN007T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461462.1"
                     /db_xref="GeneID:16995236"
     misc_feature    complement(20830..21572)
                     /note="repetitive element"
     gene            complement(<21552..>22358)
                     /locus_tag="CYME_CMN009C"
                     /db_xref="GeneID:16995237"
     mRNA            complement(<21552..>22358)
                     /locus_tag="CYME_CMN009C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537136.1"
                     /db_xref="GeneID:16995237"
     CDS             complement(21552..22358)
                     /locus_tag="CYME_CMN009C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537193.1"
                     /db_xref="GeneID:16995237"
                     /translation="MQSNMQRLWNIFALGLVLFLLARLSQTLLTTTVRDGEAEALIRS
                     TARHELWDDCSSFRRIKGSWARGWRSVVCHGETCARCRVTDRELVSVDGESDSCGISG
                     VCVSPSSELERRSQIPGKKVAGHGEVLRFSNVPTHWKRMDCVHGSLKGNSIPVNVENG
                     KYCILPDGQGFNVLSPAAEIERSESPAERAADELGSHEGTYSSQPARQVVKPCNPERG
                     RLVMKASGATKTLGLKRLKKGDPHITAGLVSNNRRVASATASASLPPRQH"
     misc_feature    23037..27134
                     /note="repetitive element"
     gene            <27221..>28612
                     /locus_tag="CYME_CMN011C"
                     /db_xref="GeneID:16995238"
     mRNA            <27221..>28612
                     /locus_tag="CYME_CMN011C"
                     /product="similar to ubiquinone/menaquinone biosynthesis
                     methlytransferase family protein"
                     /transcript_id="XM_005537137.1"
                     /db_xref="GeneID:16995238"
     CDS             27221..28612
                     /locus_tag="CYME_CMN011C"
                     /codon_start=1
                     /product="similar to ubiquinone/menaquinone biosynthesis
                     methlytransferase family protein"
                     /protein_id="XP_005537194.1"
                     /db_xref="GeneID:16995238"
                     /translation="MWTAAWYRDFGRHGLQRASLAKHLPLRTLVQRSRSRTTGTQRLV
                     RRLSDLRLASVPNPSYRQAQSTTRIERYRLSPLQAVRCGVSLVKYATGTALRSAFFLL
                     FRFAMLQLVASGSQWSSNLNTQQVVFFSRDWRAQLEFVNFFFGELSLLASKEWRHIQA
                     GTYIMPAVPTRHSLDLVPRLVDFIQNLGDSMKLREAGIVDAVPEAFRLNSFYPEYYKQ
                     NFHYQTDGYLSAESAARYDFQVEVLFGGLADMMRRQALVPLLGFLRAEVSKRTPSSNG
                     HPTLSVLNVPCGPGGFLLDLMDNLAADERLRNVKVTSLDLSPFYLQRAQTRVQALPES
                     TPRRNAAFVHANAESLPFPDASFDAIVSIYLFHELPMSARERVIAEWTRVLRPGGRIV
                     FADSIQTGDNPRMEAAMNRFRVNYHEPYYLEYIETNLPQLFKQASGGQLSNREQDISF
                     LTKVCVFEKQGGI"
     gene            complement(<28926..>29234)
                     /locus_tag="CYME_CMN012C"
                     /db_xref="GeneID:16995239"
     mRNA            complement(<28926..>29234)
                     /locus_tag="CYME_CMN012C"
                     /product="mitochondrial ribosomal protein L35 precursor"
                     /transcript_id="XM_005537138.1"
                     /db_xref="GeneID:16995239"
     CDS             complement(28926..29234)
                     /locus_tag="CYME_CMN012C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L35 precursor"
                     /protein_id="XP_005537195.1"
                     /db_xref="GeneID:16995239"
                     /translation="MNFLRIPVLLHPGSLWLKSLCLYRSSALGFAWQYNRWFAGVPGK
                     SHSGAVKRFLVSKEGLVRHTASGRQHLLSGKSAKRRIRLRRPRFLSGADARRVLRLLG
                     "
     misc_feature    29295..32221
                     /note="repetitive element"
     gene            complement(<31244..>33160)
                     /locus_tag="CYME_CMN014C"
                     /db_xref="GeneID:16995228"
     mRNA            complement(<31244..>33160)
                     /locus_tag="CYME_CMN014C"
                     /product="probable serine palmitoyltransferase"
                     /transcript_id="XM_005537139.1"
                     /db_xref="GeneID:16995228"
     CDS             complement(31244..33160)
                     /locus_tag="CYME_CMN014C"
                     /codon_start=1
                     /product="probable serine palmitoyltransferase"
                     /protein_id="XP_005537196.1"
                     /db_xref="GeneID:16995228"
                     /translation="MMELPTWLSSVLSELRGKVTSFLLFHVALEISLALLLAYFFLQK
                     AYAPGQRRERGTPSRAAARFALKSRADDLTEEEIDALCDEWTPEALVPPSTESAILSP
                     RNGASTEATLSLVRTSVSIALGSGELADTETSDLLEAPTVHAYEPGGYCVVQIGDHGL
                     KRCLNFASANYLGFQREPRIEEACRRILLKYGCGACGPRGFYGTMDVHLRCEYEIAKF
                     MGTHEAILYSFGSATSTSIVNAFAKKGDIIFADECLHYALQNGMQLSRAMIVWFHHND
                     PADLERKIVAIESTQPKSRSNLLHRQFIIVEGIYQNTGMVARLDEFAAVRRRHSNLRL
                     FVDESHSMGVLGATGRGACEHFGLQLGRDVDIVVVDVAFSLASVGGFCVGAELSVVDH
                     QRLSSAGYCFSASQPPFLAEAVSVGIQLLCEEPNRSERVRSNAALLRRTLREHLPANV
                     LVEGNVDESPLIYLRLSSRGVQSLLARVLQLVQATEKQLRNRADQLRSTEMNEDGDAD
                     SLSDSGSSISAEATEELGSMVTDAAIRQINHASAVAAAATAHEMVIPGMYQAGAFEEL
                     VTERFWVLARERLIRHGIWASVPGQVLTEHLRLPPALVLHVSASHEPSELVQSGHTIS
                     RVLDSMLSAVKSEQ"
     misc_feature    complement(34645..36919)
                     /note="repetitive element"
     gene            <37384..>38304
                     /locus_tag="CYME_CMN016C"
                     /db_xref="GeneID:16995229"
     mRNA            <37384..>38304
                     /locus_tag="CYME_CMN016C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537140.1"
                     /db_xref="GeneID:16995229"
     CDS             37384..38304
                     /locus_tag="CYME_CMN016C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537197.1"
                     /db_xref="GeneID:16995229"
                     /translation="MQYILKALLCILTVIAVVSSCSNGFLIPRAARDAAVREDGAPRQ
                     AAFAGYRWLPEEEHSLQHLVERGQVYVTQSKPQATKTVEPLVTPKATALAIATKKATK
                     KPEKVQKVKKTVVVTAPPKVIVKPTEVVVTVTAVATVTKTPTPTPVHVTVTALATEAV
                     TVTASVAVAAVSVTQTPIPQKVICRFWMKNCNIQEINRQICFTGENIDQFTCEQIGCC
                     WQPIKSQKAPTCYRAIWAPVCNLQCNFQAYLTGGQGVSETPLVKATSAKTDSTSDAPS
                     GSSNTTQTSQLSSGNVFSGLQNALSGLPSS"
     gene            <38922..>40382
                     /locus_tag="CYME_CMN017C"
                     /db_xref="GeneID:16995242"
     mRNA            <38922..>40382
                     /locus_tag="CYME_CMN017C"
                     /product="dihydrolipoamide S-acetyltransferase"
                     /transcript_id="XM_005537141.1"
                     /db_xref="GeneID:16995242"
     CDS             38922..40382
                     /locus_tag="CYME_CMN017C"
                     /codon_start=1
                     /product="dihydrolipoamide S-acetyltransferase"
                     /protein_id="XP_005537198.1"
                     /db_xref="GeneID:16995242"
                     /translation="MSAQILARVARSVHVLSKSGQWWYLEALVPQRHFRRCFAAASAE
                     LPPHIKLRMPALSPTMKEGNLVNWVKKEGEQVSAGDVLAEIETDKATVEFESQDEGIL
                     AKILVPAGTQNVPVGTLIALLAEEEADVAKLREAPIEPGESEAASVKKLETPAPEQQP
                     AEETPRAPAEARTVTAHGGGPAKPRTEASRNETSSAPSRATPEPDSRRAQVDASRHAA
                     DSTAAQRLKASPYARKLAEESGVDLSRVQGSGPDGRIVAADLEAALRTATRQTVQQLP
                     LDLFVESKRTIPHYQLVSEVRLDSAQAWLTALQKKQERSTDDALELEDFLVKALATAA
                     QRVPSVNASFMGSSIREYANVNVLVLPSDPNSMYRVIPNAQAIGLREIHRIRTGGGSE
                     QTRENDATDLGTIGFSLNTHVLQEMAIIIPPHAAIVVFGKPDQRVIAGSNGTFEIGTF
                     ALVTASFDHRVVDGAVGAQFMAHLAEYTRDPLSMLE"
     gene            complement(<41334..>42584)
                     /locus_tag="CYME_CMN018C"
                     /db_xref="GeneID:16995243"
     mRNA            complement(<41334..>42584)
                     /locus_tag="CYME_CMN018C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537142.1"
                     /db_xref="GeneID:16995243"
     CDS             complement(41334..42584)
                     /locus_tag="CYME_CMN018C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537199.1"
                     /db_xref="GeneID:16995243"
                     /translation="MFVPAVPNLRRKRRSAWCAGKPQRPPVQAPRLRALSLRSASTRL
                     VPLPQATRRLWQDWSARLLSAELFARLALERFPQVVETKLQLNSLVRRFRRLKSTRGT
                     LVVVHGINPRGAFDPRLEHVAKAFAAIGFDVFMPNVPALEQLLVQPSGVDQIEQLVLN
                     LTRQRELCPDGRLSLFGASISGAMSLIAATRPSIRDRIKAICIVGGFASTATVSEEIL
                     KLPPDADDYGRNVMFYNFVEYALGPNDALKHAFYLAIHDNHFLRRGTAAEALPGYLAQ
                     VDAEVASTYWRLQNDVPYRMHIAERVMAETAHLMRILSPVEYVHDLRCSRVVLVHGKF
                     DEVVPVSEAELLYAKLRAAGMDTALCITGFIGHGDKVLPPDSLGVVLQDALRMVDTWA
                     SFIEAAAQRDRRKDLRVHAFDTTL"
     gene            complement(<43752..>45668)
                     /locus_tag="CYME_CMN019C"
                     /db_xref="GeneID:16995248"
     mRNA            complement(<43752..>45668)
                     /locus_tag="CYME_CMN019C"
                     /product="probable inorganic phosphate transporter"
                     /transcript_id="XM_005537143.1"
                     /db_xref="GeneID:16995248"
     CDS             complement(43752..45668)
                     /locus_tag="CYME_CMN019C"
                     /codon_start=1
                     /product="probable inorganic phosphate transporter"
                     /protein_id="XP_005537200.1"
                     /db_xref="GeneID:16995248"
                     /translation="MADAEEYGVAEEERQQYATAVRTSFRESAAYAPIMFGSGVILAY
                     DTDMETDDTGKPIASTPKDIPPRSENGISGFIQYLAASLFTGIGIFIEGYFTVNTGQV
                     KTAWTNAYPTCFGTKPISGTTCQGLAASSCTKGTQKANTYSIFAGLIVGMLFFGLLGD
                     RIGRRFSMLFTVSTYFISAIIITFSISESADTIFVLFAIFYALTGFGIGGEYPLTASV
                     ASEKRATRIMQETGGEGESTIYFTDALARQRARADERARTARRGETIALAFAMQGVGI
                     VFGSVLLLIEFAISKQTSPNTDTALIATNVNNCAGYSTQALGYVWRSYYGIGAFLILL
                     ILLYRFLILRENEIYLSAKRRRDTNESAEGLSVTGRMRRHFGYIFRFYWSRLLATCLG
                     WFINDISFYGNGLYSGPIFTALVPDKNLIVINGYILLKNTVALIGYFISAFIIDRKWC
                     GRVRLQIFGFFWEAVFFFITAGAYVQMQEHSPRALLFCYIMTSLFTQMGPNVTTYIVS
                     AELYPTVIRSTCHGMSSFSGKAGALISTAAFKTKTTNDIRTVFWVNAALCVFGAVFTW
                     VFLPDTTNLSLYEYDLQWELLISGRLNEYGGEGINPKHLSRFERWTGRGKNYQPGWLV
                     RFRNEELQRGGKSV"
     misc_feature    complement(45932..48067)
                     /note="repetitive element"
     gene            <48416..>49351
                     /locus_tag="CYME_CMN021C"
                     /db_xref="GeneID:16995249"
     mRNA            <48416..>49351
                     /locus_tag="CYME_CMN021C"
                     /product="similar to UDP-sugar transporter"
                     /transcript_id="XM_005537144.1"
                     /db_xref="GeneID:16995249"
     CDS             48416..49351
                     /locus_tag="CYME_CMN021C"
                     /codon_start=1
                     /product="similar to UDP-sugar transporter"
                     /protein_id="XP_005537201.1"
                     /db_xref="GeneID:16995249"
                     /translation="MTLAPWASAALYTLTSLLGVIVNKAVFSSFDFAYPLVILLAQLV
                     VTSTALLLVWRRFPPLPANWVPLLLVAATFVLNVFTGLVALETANLPMFSAFRRLSAV
                     AVMIFEAIFLGRRETAAVEKAVAVMTVGSVLAAIGEINADWLGYSYVILNNCATALYL
                     VALKRATPRLGRRQLDSLVITFYTNLFAIPMALVAAWFLEMRRTADAPSALDALATQL
                     ERRGLAFAAALLLSSASALAVNVTTLWCTATNTPLVTAIAGQTKNLLQTALGFILWEY
                     HFTALNAFGLALAAIGSTMFVHAKFMKTPKPFQNT"
     gene            complement(<49317..>50594)
                     /locus_tag="CYME_CMN022C"
                     /db_xref="GeneID:16995246"
     mRNA            complement(<49317..>50594)
                     /locus_tag="CYME_CMN022C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537145.1"
                     /db_xref="GeneID:16995246"
     CDS             complement(49317..50594)
                     /locus_tag="CYME_CMN022C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537202.1"
                     /db_xref="GeneID:16995246"
                     /translation="MFLTCSISKLQLTFVGASTGARLTTPCLGAHGNDTPTRTRFRPH
                     KARGGRRRADVAVSRRLPLDWFQLVASSGCTATTSGVRTGGDPALRLRDWLQVAPPSF
                     APLPQVGSGAGNARVIWWVNQDQRVTDNVALAEAARATRDRARGGLLLAVYTGSVRSC
                     ETRCALRDLRERLVALGSELLVIPEGGGAALVALLSRLRNEFQIQIDRIVFNHAVNWD
                     GALAERAMVEAVEQANELALTLQGYWAGNTLLDEGMVQELSAQAGKRNVSFLAVAGTI
                     RQRRTGKEVSIKLEPAPERLSCPEALCALAADSWRQIGTGMEHGTHRCPSEAEATRTL
                     QAIVRQRNESVTERLARSDHAELSLVLKSALDLGCISVRQVLKRIAEVYQGSYEGYTF
                     SEMMWRSYWAYHMHLKAFGGAGVTYSGKVSVFS"
     gene            <51145..>51819
                     /locus_tag="CYME_CMN023C"
                     /db_xref="GeneID:16995247"
     mRNA            <51145..>51819
                     /locus_tag="CYME_CMN023C"
                     /product="manganese superoxide dismutase"
                     /transcript_id="XM_005537146.1"
                     /db_xref="GeneID:16995247"
     CDS             51145..51819
                     /locus_tag="CYME_CMN023C"
                     /codon_start=1
                     /product="manganese superoxide dismutase"
                     /protein_id="XP_005537203.1"
                     /db_xref="GeneID:16995247"
                     /translation="MSFALPSLLYDYAALEPHIDALTMQIHHTKHHGTYINNLNGAIQ
                     GEHGGSLKGLSLEAICRNVNSAPEAVRTTVRNNSGGHWNHTFFWTIMAPSGTAASAPS
                     GALKNAIESQFGSVDSFKDQFNKAAAGRFGSGWAWLCMNQNKQLFITSTPNQDNPLMS
                     GIAEKPGLPILGLDVWEHAYYLKYQNRRPEYIAAWWNVVNWDTVAKYYDEASSGKAPV
                     LDVPLQ"
     gene            complement(<52558..>57867)
                     /locus_tag="CYME_CMN024C"
                     /db_xref="GeneID:16995240"
     mRNA            complement(<52558..>57867)
                     /locus_tag="CYME_CMN024C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537147.1"
                     /db_xref="GeneID:16995240"
     CDS             complement(52558..57867)
                     /locus_tag="CYME_CMN024C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537204.1"
                     /db_xref="GeneID:16995240"
                     /translation="MATSSLHSSLIESFGGKDDGWIPLLAVAPVRGSGAPPRSSSASR
                     QSGFIFCTLGTSDSSGRCHATLCRRRRNDSVLLLWRQCLDRAPEKSSLSLVRSVRRKG
                     AATGSCIRLVASLEASAPEEPLPAAEAPPDVPGAPAIQRDESTDVWQQLLPLPPTMLA
                     RFTESSFEFHMMLVDRVMNFRFGYKRRHARRLVLQEPNAHPSDIAWDRAIRLSAYLQS
                     RLQRGTPSDSTQQASVPCLSSLRPRAPILKGLIAGGREFEQTLLEALRQHGHEVVCCH
                     SVAETLRAMEAGVAIIAQAPLEHGTLHGRSDLLVREWVQLGDQRGICPADSPWNPWEE
                     ASLPSTALPPEARWIASVPAAQWDRYRLYRYTVAECKLARKAQPQFTMQAMAYLWIVR
                     ALERRQEQTLGYWPRFYLCLDSESDAVVAQVQCWRTADCSFYFEAKLEELLSVVRREG
                     ARLLKTNLAELSLRIAESASSLDMLIAMRECRRRLTQNAYAACALERYHQSPLLVTEM
                     RLHDMRQLWERGFRNLEQLASLPAAEQLQLADIPPWRLSEYMLQARLLLQRYRHGDAS
                     RLPYEPRPHANAEPARLLPPASPYDMYIAYMTSYDGSYFLLGIWCPGQYARPTSFWAY
                     TPEEATSILRRFLVHVRAALFEDPQLHVYHFGELDRHALMEVALATHDAGVQATVDQL
                     PLVDLRQVVRASFLIGDHDPYNLRSLNSLIRGSAIACSTIVMAPQAEATELYERYRIA
                     SRYNNAERARIVRNRLLALSGSICRSLHALAGWLRTHDHVYSAACAGMRAPVLLSSSA
                     ASASASAAAAASQDSNDTLSNESVQTGSDVELADHREWRAAAGSSESGARRCVNVNSS
                     DAGAGAAAAAATAGGNGGDSDADDEDNDEDASGSARFRHAVAPSTPYATMIEMLRTER
                     AAGIPERDAMLLSLHVRQRLPVDDPMRDLVDYILRESKIELQHLAWRQRPQVALDRDL
                     YDHPDVIVDAIVVDWDAASPETSLSASDASAGDRRRRTSSQKTSIVSGRDVDAAERLA
                     STTRSQTAPSAALTPPARLEQPMGVAGGDSVDSIAGMHHDDNGSAGSGVHVQGSSIST
                     MQASSDLSGSPGAAPRVQYADQGPDLPTHSSASKATRPQRKKLQASSMNGPPAETPAR
                     PDRVNLRVCFPAEQRIYSDSGEWQACLLIGERYLMVPLARLRFTGPDSASIQVDRATA
                     ERFLPAGTRLPRIVRRPPFFRRLSSILGLCAAAMHSRQTPLVARYLRRECPFPSLVAS
                     DEPFRTAEQVPQVVESLRQITDGRVLVIQGPPGCGKTHTIAECIAELVLGPQPTGRHR
                     FCIGVCASSHAAIDQALGALVQRLRIRGCTHTAALIWRIGQHKQCSLPTGAVHVTTRV
                     PRMAPTSSEADPPFSVLAGTAFALSHEHLRERLDYLFVDEAGQMARAYFVAMLPNVRR
                     AAVLVGDQMQLAAVSANNSLLPSGRPLVGGESSLTYLLGADTSVAGPAWGWFLPTTHR
                     LCPELCRFIGTTFYQGRLRWHARTEQHQVWDHHLGRARSGLGFLAVDVSSSSSSSTAT
                     FPGSATVRSRWKREVATVLRLVAMLVQGTRFELRLGPQAATEQSAAPRHVSVDDILIV
                     APYNEQVNALKTAFTLWAASRTPQTGADAASSNIPRIGTVDKFQGQERPIVIMSLCAP
                     EQDRTAASGGDAEMRTRASHEGIAFILDARRLNVALSRAQCLAVVVGERHLGLGTVDD
                     VQAMKAMNLFLRLRAEAEPWMLEEDVADVQFSSASSTHGPSRL"
     misc_feature    complement(57897..62388)
                     /note="repetitive element"
     gene            61713..63450
                     /locus_tag="CYME_CMN026T"
                     /db_xref="GeneID:16995241"
     misc_RNA        61713..63450
                     /locus_tag="CYME_CMN026T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461463.1"
                     /db_xref="GeneID:16995241"
     gene            complement(<63436..>66486)
                     /locus_tag="CYME_CMN027C"
                     /db_xref="GeneID:16995252"
     mRNA            complement(<63436..>66486)
                     /locus_tag="CYME_CMN027C"
                     /product="probable chromosome segregation protein CSE1"
                     /transcript_id="XM_005537148.1"
                     /db_xref="GeneID:16995252"
     CDS             complement(63436..66486)
                     /locus_tag="CYME_CMN027C"
                     /codon_start=1
                     /product="probable chromosome segregation protein CSE1"
                     /protein_id="XP_005537205.1"
                     /db_xref="GeneID:16995252"
                     /translation="MDDLYSYVLATLSPVTETRRGAEAVLESASSKPGFLAQLLQLIA
                     SAEADPVAATQAGSAVAVRQAAAIYFKNVVKRRWEDESPTDRAALRAMILPLTTVRQA
                     AVRRQLIEAVAVIAAQDFPHNWPELLPFVSGGLERCVEQPFEHWDSALLLGSLETLEA
                     LVERYRHETRSDPLFQEILLVLQATQSLLLRLFQRLCMFWRSGSNPLETATATLVLSA
                     MQHITEIFYSLNYQDLPEFFEDHMAEWMSEFGWILQADQALSDAPTTAGLSAPAASSA
                     AGAAYNLDSDDEAEPAPLDTLQARIIECLILYAEKYEEEFRSLLPNFLTTICVLLVHR
                     GLRSRYDSVVIAGIRFLTTIARGVDHLLLLHTLIEASESASGTSLLHYVCERVVAPNM
                     QLRQADLDLFSEMPRDFIRLELDGSDVSNRRRAAGELLRALLERFEERIVHVFSGYVR
                     SMLEACESDPRHNWRQKVNAILIVAALSWRAGTRTSGAVNTSEFIDVASFTKTHILPE
                     ITQVVSQTKRQRSPPLLTAEALKFLLMFRTRLTAADLKGLEPYLVRLLDDADPVVHSY
                     AARFLERVLASAHQEPQMQQLKMDSSQIKPCIEAIARQMVRDPENEYLMKLLLQLAAF
                     VPVKEGPAVAQLLVMDLEQHLGGYANALYAHNLFETLVLLLRHAGVSAIESLLFPVFE
                     RILQQDIVELAPYVFQTLGQMVLWRDEGLTPAYQRLVPPLLAPPLWDRHSYIPSMVSL
                     LVCFLRTSPDLLCDAEHLPRVLGVFQRLVAFRAHDHDGLRLLSAIVDACASGDRLDAY
                     LGAILQVLFLRLQNARTPKFVRHLLPFMARFIVRLGAAKILRAADALQPALLEHFLEQ
                     VWVPELAAPERSPVLCDPLMGKTICCAMIMTADARPALWVKLLDTILACCLVVEAQLG
                     PASAPPNSRVQARHAERNLHPDDAADVEEQFILDYSVEHAELRCAQIPPLDPCPEVTH
                     PLRLAFRSLHQHCGSSIDTVKFVTTHCRPECARLALEQMPSDAV"
     gene            67188..70590
                     /locus_tag="CYME_CMN028T"
                     /db_xref="GeneID:16995253"
     misc_RNA        67188..70590
                     /locus_tag="CYME_CMN028T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461464.1"
                     /db_xref="GeneID:16995253"
     gene            complement(<68371..>69816)
                     /locus_tag="CYME_CMN029C"
                     /db_xref="GeneID:16995254"
     mRNA            complement(<68371..>69816)
                     /locus_tag="CYME_CMN029C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537149.1"
                     /db_xref="GeneID:16995254"
     CDS             complement(68371..69816)
                     /locus_tag="CYME_CMN029C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537206.1"
                     /db_xref="GeneID:16995254"
                     /translation="MGSLPEARCNALPLFLDGNVAENEYLLLSLDMLLKTDTPPGDTA
                     NSEDPLANFVHGAFSAGEGLVFDGLLPDEVSFLVERMRHDMGATSRGRGNCDGPTAPD
                     TISSDTGFTVDDEERRSVLCSKNAVFSLWRQETSNSLLVFEPCESASGAKQSRCLRLR
                     AALHSVLQCQRMVPRFRTLIKFMKTFAVYEMDLEGVSWETLLCLSHASESELRASMSE
                     IGIIFDPVSSKYWILDPRGRERLLEHLLDTILVHRLPVTNVSRPLLETALLEMDIIDG
                     NLAAFAIARWFRPNPQTPDMLDLHISDVVRDLVPCLLRRQRNASMDLKELMEQIQRRL
                     PSDTSFDTEHALQSLHGVAIMLPSLERFRNSSKSSPAPEHLVSSEQSSLLSDPATLLP
                     SCPSASMRVQLLEADALPQKPETRLAMLFGLKKQWTRTELDPYIADIPESDLQRFLRP
                     VRGPFGALDQLQRFEWRGLGKPSETSVPHRK"
     gene            <74432..>76915
                     /locus_tag="CYME_CMN030C"
                     /db_xref="GeneID:16995250"
     mRNA            <74432..>76915
                     /locus_tag="CYME_CMN030C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537150.1"
                     /db_xref="GeneID:16995250"
     CDS             74432..76915
                     /locus_tag="CYME_CMN030C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537207.1"
                     /db_xref="GeneID:16995250"
                     /translation="MAKPFCLRAASASTAYARLRMQQDRYPAHDRAYITTGTSERNYG
                     SGNLQVGCSMKDAFSVTNIHPTICDPWSKGSFYRITTKSCAGRRRRPRLYQPQTYALC
                     VGSLLEACRSTLHVLLFPLCVMRKRRSSLGFVENVCLVSGVGSVTRWSARASSQRATS
                     EALVFRQPRVRVTRQPSRRLRHPLDGTGAGLRGAQHMHCVSRLTERSLAVIHPGSALQ
                     TVRQVLTTLLVACSSDAAVVTAAIVCLSVYLSLHVNQARRAEIAQNRPTDGHAQRHAP
                     GLSDKATARLVAIEIGRSSRTLYVDKGPLDTTASERLLLAISDASSFRARGRNVWRAL
                     VGSLLPEGFGDKTRFPPVVSDDYLPYTVLHFMQNLVHAAASVIATQSMLIAIGVAKQA
                     TIGVSAAVQWVLKDGLGRIAAIIFGSLLGNRYDADPKRWRMRGDMLYTLGVGTEIATR
                     LVPQYFLLVGTMANAIKSVSYMMRLPTAAAIRRHFSLRENFGDLSAKANSQEVLSMLL
                     GTFVGIGLSYMIDNSLKALFAFYIIYVQMFILFNYWSLRVLRMRTLNLQRTLIVMRRY
                     WNSGGVETCSVAMANQAENFLLPSRLGPARRVRFGCRLGEAFRTVGEFEEAIARQRLW
                     RGQYLQQTDVSKRNGNADADFTSVPDDVLDERYLLGVDAKRGRVFVVLHRDAKVADEL
                     QALMHATYLVRADWGPPPDMSIDRVRDGYLLACAETPVLVQRMRAVGWNVDEFVHAGG
                     ERARAIWGTEIEQLGTAAADVEHPTSALTRLLHPAVTKQPSSVGSYELLTTVQESAEA
                     TAAEESLAMSPWGPTFPEVSFGSELDIVS"
     gene            complement(<77557..>78210)
                     /locus_tag="CYME_CMN031C"
                     /db_xref="GeneID:16995251"
     mRNA            complement(<77557..>78210)
                     /locus_tag="CYME_CMN031C"
                     /product="similar to glucosamine-phosphate
                     N-acetyltransferase"
                     /transcript_id="XM_005537151.1"
                     /db_xref="GeneID:16995251"
     CDS             complement(77557..78210)
                     /locus_tag="CYME_CMN031C"
                     /codon_start=1
                     /product="similar to glucosamine-phosphate
                     N-acetyltransferase"
                     /protein_id="XP_005537208.1"
                     /db_xref="GeneID:16995251"
                     /translation="MTSVQSIKRTSIAALESLSGQSDLRTLRLQGGCARTRLQLVLAL
                     RHAKRHALRTLLERTTLKQRMDETASYEVRELCETDLEHGFPELLAQLTQTGTLPLSF
                     WRERYRLRQQLPGTYVTLVAVESATKRVTATATLLIEYKFTRSCGQAGHIEDVVVDAA
                     HRRRNLGSRLVRELCARARDQFKCYKVTLDCVEENEAFYAKLGLERKGLQMVRYFPT"
     gene            <78232..>79401
                     /locus_tag="CYME_CMN032C"
                     /db_xref="GeneID:16995265"
     mRNA            <78232..>79401
                     /locus_tag="CYME_CMN032C"
                     /product="similar to isoamyl acetate-hydrolyzing esterase"
                     /transcript_id="XM_005537152.1"
                     /db_xref="GeneID:16995265"
     CDS             78232..79401
                     /locus_tag="CYME_CMN032C"
                     /codon_start=1
                     /product="similar to isoamyl acetate-hydrolyzing esterase"
                     /protein_id="XP_005537209.1"
                     /db_xref="GeneID:16995265"
                     /translation="MASEQPAGVEDPAQAHDAATFNQSEERPVSALASQQRLPWQLRW
                     QRTFNALGGVVSRAHGGITEQFRALFARRMAAATPVLLFLGDSLTRRGLDINEYAGYT
                     SVGWGLRLVHAYNGAADCIFRGLSGYNTRWALPVVRHHLSDVAQERLLLVGIWFGAND
                     AAAPGTAQCIPLDEYASNLYEMLRLILERSHDASLTLTSERHPRRQQHGRTPPSLAAA
                     PAPDASEANEIESVRYPRVLLMTPPWVDEEARRRHIQSSLAAERAAPDAHQPSDSGQR
                     TESDRMCARTRQYAAACRRVAAQIRPRDRVLLLDLFTQIEQLPPAERSGLFIDGLHLS
                     DRGQRFVYDAILELIAREAPELSPSSLGQFAIPWCDINPVRPQEQLAVYDQQRWW"
     gene            complement(<80286..>80711)
                     /locus_tag="CYME_CMN033C"
                     /db_xref="GeneID:16995266"
     mRNA            complement(<80286..>80711)
                     /locus_tag="CYME_CMN033C"
                     /product="thioredoxin-like U5 snRNP compornent dim1"
                     /transcript_id="XM_005537153.1"
                     /db_xref="GeneID:16995266"
     CDS             complement(80286..80711)
                     /locus_tag="CYME_CMN033C"
                     /codon_start=1
                     /product="thioredoxin-like U5 snRNP compornent dim1"
                     /protein_id="XP_005537210.1"
                     /db_xref="GeneID:16995266"
                     /translation="MDSAPLVPVLGSMAAIQQALAEETERLVALRFSSDPAAVDCVFM
                     DEILARSAARVRRFAVVYGVDLRQVPQAARRFGVEAWRPLSLQFYYRKRLIKVDCGTG
                     DTARLTRPVPSVQQLVDLFEVVYRQALRGKGLAMAPFRL"
     misc_feature    complement(80942..83170)
                     /note="possible transcribed region"
     gene            <81906..>82541
                     /locus_tag="CYME_CMN035C"
                     /db_xref="GeneID:16995263"
     mRNA            <81906..>82541
                     /locus_tag="CYME_CMN035C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537154.1"
                     /db_xref="GeneID:16995263"
     CDS             81906..82541
                     /locus_tag="CYME_CMN035C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537211.1"
                     /db_xref="GeneID:16995263"
                     /translation="MLVSLASSPSLGLNYLRYPAKAVRVTRCERLRLANARRGAGPAK
                     LDACAPRPAGGDTLRWRDTVALYAQLSAEQTVEHLLEGLSRRQALTTAQECDEGIEAL
                     YAFANFDVWSIKNEFFGKRIDLGQFERFKRIMMARPYSALLRHKCRCVLSSMRVTPYL
                     YHCRIQVLSSVDDVAVFRFCLSRRALPGAPRAPRRPRLYWMVDQILHEQVS"
     misc_feature    complement(83290..85470)
                     /note="repetitive element"
     misc_feature    86682..88926
                     /note="repetitive element"
     gene            <88960..>89517
                     /locus_tag="CYME_CMN038C"
                     /db_xref="GeneID:16995264"
     mRNA            <88960..>89517
                     /locus_tag="CYME_CMN038C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537155.1"
                     /db_xref="GeneID:16995264"
     CDS             88960..89517
                     /locus_tag="CYME_CMN038C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537212.1"
                     /db_xref="GeneID:16995264"
                     /translation="MTADAAWPALVVSFLLGLFAGRRSKHQRTGASGLDTSASGAPAG
                     SVIDSTPADAPFASLVPLASAPSGTTADVKLMLIVRRDLKMSPGKIAAQCGHASVGAF
                     RGCTDRALLAAWDRNGQPKIALRCSSLKELLAIERAARQLRIPTFAVRDAGRTQVVAG
                     TITVLAVGPAESAKLQRITGHLKLL"
     gene            complement(<90142..>92286)
                     /locus_tag="CYME_CMN039C"
                     /db_xref="GeneID:16995258"
     mRNA            complement(<90142..>92286)
                     /locus_tag="CYME_CMN039C"
                     /product="probable endopeptidase IV, signal peptide
                     peptidase, SppA"
                     /transcript_id="XM_005537156.1"
                     /db_xref="GeneID:16995258"
     CDS             complement(90142..92286)
                     /locus_tag="CYME_CMN039C"
                     /codon_start=1
                     /product="probable endopeptidase IV, signal peptide
                     peptidase, SppA"
                     /protein_id="XP_005537213.1"
                     /db_xref="GeneID:16995258"
                     /translation="MLVSAAAFVAAPAGSASRLRQRSNRSGVQRHRESTSRAPRLART
                     RRGRAPRLPLSASLHEAGASRDPPNSVVSELGEAAGTVNFPEPSAVNHVRVPGALEAH
                     RLEFKPQTGWLWRVWLAWKLVFVRVRLRRYTTITVDLEGPFPDSHAATFPAASSISLE
                     DWKRICRNGAHDPRICAMYVKIGPLACGYARLQEARRYLDYFRQSGKPVIVYMAVASE
                     REYYLALGADEIYMPPEGILSLRGMKVSASFLRGVLDKIGIEPQVKRIGAYKSAGDQL
                     ARRTMSDAQREVLTSLLEQQYEHLCSELSTRVGSEPDPAAVVHRILDDPPMTVAEWKA
                     LGFVDGISYENDLLDKLKMRFVGKAWGLSETSEKESSSSSADRRLRRLLVRPLRAVAA
                     KRYRRVRPSVLGLPEGRRRGVTKIGVIRALGAIQTGRSSSNPLFSPSIGSDTLVEQLE
                     RAKNDRSLAAVILRVDSPGGSALASDLIWNSIRELAKRKPVIASMGDVAGSGGYYISM
                     GCQAIVAEPLTLTGSIGVVTAKPSLQQLFERIGFRREVLSRGRYAELDVDFRPFTPEE
                     DAYFTRSTERVYESFVRKAAESRGRQHHEFDRYAQGRVWSGTQALAVGLVDALGGFDR
                     AVELCRERLELAADRPLRFMEVRPRSTGLLASLLENMGALLLETGFGSLLQSLGANQI
                     AEARLETALPDASTPRVDSVLAALLRFLNRME"
     misc_feature    complement(92707..93925)
                     /note="possible transcribed region"
     gene            <94401..>96623
                     /locus_tag="CYME_CMN041C"
                     /db_xref="GeneID:16995260"
     mRNA            <94401..>96623
                     /locus_tag="CYME_CMN041C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537157.1"
                     /db_xref="GeneID:16995260"
     CDS             94401..96623
                     /locus_tag="CYME_CMN041C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537214.1"
                     /db_xref="GeneID:16995260"
                     /translation="MTQGVSVVGERVAMEPPATEAELRLLPELLAVLKGAPSEVLRHE
                     GETSFFQVANLSHAIDDSVVHLVRSVAEAGWLYAHRIRPFVQPHPLPGSMKERWRVCK
                     DSTPAQESRTRAALRSALVAELQPYHLTLDQAERMLLQNRLCLQQLAMLIEPHRCTLL
                     RWLAMIAEAAAEAANTANDAVSILNLVGRLQNHGDPAVIHTMGRIFSEVVQPLQRMVI
                     SWVAYGDLKDAGFEFFIQLDDRKFPALHPECVPYWIPKPLVERLFHAGLSRFLWDKWA
                     QCATFQNDAVLLDSQYSPPATLARTSSFLAWLGSLCASDGPGSGVPVRSLFLDQYHLV
                     HHLSIHRHFVLLEDGDFALHLTEKLEPVMLRATASVERSALLQALVEALTHTGLHRAG
                     RAATEHLLDRLDVYLARPQTRDQDCIANAFTLTYLFPDPIDYLIRQCPHFGEYKRLYG
                     VFWKLRLTQYQLAVAAHEHSRLYQDLKRWAAPGRRMPAPAAHDRAGSAAIRTPLANCA
                     LFRAHLHQCLQAVIQCFYRDVVDPAWRTCVANLHGEHAQGASWCTLIEALDAYFAQVV
                     HELTPADQNTTDKKRSKVLAPVNHLESPANNATERAGARPSPGKPQQAVSAAAVPHCC
                     RPAPCGLESSTAATTPAIASLCVMIRQFLALNQGICLRLNGYVRSLGYADPTCPNDDL
                     ACLDAALRRQFRQWQRVTCPKWRAALDASPSEALRRLAADVPCPPGPLCALGRTPETP
                     "
     gene            complement(<96670..>99144)
                     /locus_tag="CYME_CMN042C"
                     /db_xref="GeneID:16995261"
     mRNA            complement(<96670..>99144)
                     /locus_tag="CYME_CMN042C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537158.1"
                     /db_xref="GeneID:16995261"
     CDS             complement(96670..99144)
                     /locus_tag="CYME_CMN042C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537215.1"
                     /db_xref="GeneID:16995261"
                     /translation="MSAPSRTEKMMECGVLTTWSAGQIRQTRTLAVSPETSDTECPPS
                     PSGDSMLAYACADSFARTKRAQWYIEVDSEARRWSLRCHHRSADELLSRIIHVLEDIS
                     LEVEGFEWKSAALQHSPEPNETAHGMLQVFGGYQIHKQRAGVERMLRLALYRTDSFDD
                     VLLDDYFAGEDDDDRSASGVQVRDDTAWVHFIDQWRRRGECVVTVRSAACTATALEQI
                     IEYLGQEGFVVRSAEIIAGGYNRRVVTPETPSCPCAECLVQAQQLWAAAQADALNARV
                     PLTLLLGLTGSASHIAHLIGVRLDRLRALCTKLAGPECSVEVYPPHTAVVVAALEDGP
                     GVGRGISLYIPRVSDLESFSEYDDTRSIRTQRMTPYGVEHPCRRSSDGSGTETTCLSA
                     SPPRYCLATTGANGSFSQTAVKVQHCDLGHASEASVLSMAGHEACNEQTAQRTGPVRS
                     DSEAELVTKRRQTSARMRMPDEPVARIPVEKVPVLKTDAVGAGRDISLVSDDTLQESD
                     TTRSSSEEQEVMRGAELAGVSFRSPSAFASSAWSPSETRTPDTITAAEASAALRAPPP
                     GIAAVSNSEIAGTTLNQEHLADALRYLFAPDIPRVSVEHETSTQFRVVVHTHSRPGIG
                     LDLIRAFRALRCTIVRGRLSDPRDTRPPLKRLGASSATDTPQAVVAELLLQVPALASA
                     DMLDTKGGSSGTADSGIERWKARLRNIVFDAVANPICMRNARDGAVTCVALHAYAHTC
                     QLGDLLRFMHAARMRVRRARIRTFGTRIYECVQFTDMVMQKAVPSMLWADLRARMLAA
                     LFHTDCTGLVFPARTKSIHSRSFPAN"
     gene            complement(<101246..>101956)
                     /locus_tag="CYME_CMN043C"
                     /db_xref="GeneID:16995269"
     mRNA            complement(<101246..>101956)
                     /locus_tag="CYME_CMN043C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537159.1"
                     /db_xref="GeneID:16995269"
     CDS             complement(101246..101956)
                     /locus_tag="CYME_CMN043C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537216.1"
                     /db_xref="GeneID:16995269"
                     /translation="MREDWVQRAVEFLQNDVVKDPVQAAQFLRAKGYTEEELAEAWRR
                     AGNKFGEESKPPPPLDLSLGNGYVPPAAVGVGVQSKRAVPGAWTWAWRLALTVGAISV
                     LREFLRKYVVPAYFPQQNKAAKKPASEASVLRRELRQLRQSIEDLSATIRTMSDQAQQ
                     QWRDTQEQLRDLRTEVRQLRSAKPAVFSSAATESTSAGNGPATHGTQPVLGEAQTAAP
                     NPWTLPDFDSIEPADLPT"
     gene            102238..103797
                     /locus_tag="CYME_CMN044T"
                     /db_xref="GeneID:16995270"
     misc_RNA        102238..103797
                     /locus_tag="CYME_CMN044T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461465.1"
                     /db_xref="GeneID:16995270"
     misc_feature    complement(103710..105227)
                     /note="possible transcribed region"
     misc_feature    104649..105520
                     /note="possible transcribed region"
     gene            <106280..>109366
                     /locus_tag="CYME_CMN046C"
                     /db_xref="GeneID:16995204"
     mRNA            <106280..>109366
                     /locus_tag="CYME_CMN046C"
                     /product="sporulation-induced transcript 4-associated
                     protein SAPLb"
                     /transcript_id="XM_005537160.1"
                     /db_xref="GeneID:16995204"
     CDS             106280..109366
                     /locus_tag="CYME_CMN046C"
                     /codon_start=1
                     /product="sporulation-induced transcript 4-associated
                     protein SAPLb"
                     /protein_id="XP_005537217.1"
                     /db_xref="GeneID:16995204"
                     /translation="MFFRPPYLGSSRIDEILDEAEREGRVGDQERSIFHSSDRQASQD
                     RTSPSAGDGRAASSQRQGDVSEESDATASGGTSVDPVRQFQADEQQQSRIRRTVRTIL
                     AEDDLIPECKAMNLRLFEYFSQPTALRSLVQFAIGCDDDEEHKYAGMATEVLCSDVER
                     LNEAFISNVDVLELFLGFVRRKPPLAADLVSNFAKIFLCMLRAKSEELLSAVDEHKSW
                     FFSQGILQHLQHSALSNLIIELLIQNEIVISRKAVHIYAQAELLKRLVDLFVNETESP
                     DDETLSNVMSIIVSLSGRAVPLAEAADIFHSVGGIPDELEGGSILETAARANQQHQLR
                     TAASGQTSICPDERDESSATAMNQERKALKSLDLLRQPELLARLLSAFRQSDAHLLYG
                     LSMLTELVSINKELSHEYETVQHHWEQTSLRLSTANERQDADTARAPLSLPSSSLLRP
                     SSETTAFASSAEDSDTSSTSSSELGRTPAAAHSIRSKMGEFETALQAHLPYLLSRLED
                     DAESGHFGVIRLKLVEFLIQMMLDVSPQLCSRLLAMGIPATLTRLLRAYPWVSVFHHL
                     YHRALQETLLTPFQSFLQAVQPALDEANLQAIADGTLIPDRLRAWFLEANIVQSFVQL
                     QQVALNAESGRISPEDMRALVRAVPQLECTDHAARAPPSRIRVALSAHLAEMILEIYE
                     QVFVPLSKMTATCTSGQEDAALATGAPGWQPATTKEATAGTATVVPLLQRTKRSKVPL
                     LAFLSPLLGLDEEGGTMLAAWAALEAIATGPVYAEKSKQHRQLGGRRPSGLSSHSLSE
                     DLAQLPTLTTDNATSMGEGDDEDGDVGMIGGVEDRQDVLEDRRRPRLQGRPPDGAVFQ
                     EDASSFVEQHDRMDPLFEDMDEDRDEYLPAPPFIDNEQQQASCGAKDAGTGPSSAPEL
                     SVDDMMTGLSEGEQESLTHFTDYLSQRARRTPANSNQSGERSQRKDARDNQEYSVTSA
                     GALDLPTAASRSGAVERESASQPAPRNASQLNAFRQSEAPDNDWVAFADDQHESGD"
     misc_feature    complement(108092..109972)
                     /note="possible transcribed region"
     gene            <110066..>111340
                     /locus_tag="CYME_CMN048C"
                     /db_xref="GeneID:16995287"
     mRNA            <110066..>111340
                     /locus_tag="CYME_CMN048C"
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /transcript_id="XM_005537161.1"
                     /db_xref="GeneID:16995287"
     CDS             110066..111340
                     /locus_tag="CYME_CMN048C"
                     /codon_start=1
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="XP_005537218.1"
                     /db_xref="GeneID:16995287"
                     /translation="MFLHVTRCSSFQERDYVRSTRNQCQTPGFLSSRRRFRSAKRFDL
                     QSATTGFAEGTRQAVAILGAAGYTGSELVRLLLRHPHVEIKALSGTERTRGRPYGQVY
                     PQYAFESIISANGKQGPSPVRSLPPLCLTEEVDFSQVDTVFCCLPHATTQSIVTSILQ
                     SAVGRTPRVIDLSADFRLADVHTYAHWYGTPHRAPDLQAEAVYGLTEFARADIRSARL
                     VANPGCYPTGAQLALVPLIRAQLIALDDVIIDAKSGVTGAGRSAKEANLFCEVTEGMH
                     AYAVANHRHAPEIEQGLSRAAGLGNSGVVVNFTPHLVPMARGILETIYVRCQAGVTPG
                     DLRACLEQAYGEEKFVHVLADPQQVPQTRYVRGSNHVVMNVFPDRLQGRAILVVAFDN
                     IVKGASGQAVQNMNVMMGIPEHTALEQGPLFP"
     gene            complement(<113490..>116741)
                     /locus_tag="CYME_CMN049C"
                     /db_xref="GeneID:16995288"
     mRNA            complement(<113490..>116741)
                     /locus_tag="CYME_CMN049C"
                     /product="similar to formin"
                     /transcript_id="XM_005537162.1"
                     /db_xref="GeneID:16995288"
     CDS             complement(113490..116741)
                     /locus_tag="CYME_CMN049C"
                     /codon_start=1
                     /product="similar to formin"
                     /protein_id="XP_005537219.1"
                     /db_xref="GeneID:16995288"
                     /translation="METNALALVTQRRLCIAEAVARAAFQPETSVLLTVERGDGVSGT
                     TVATNACVNSTLDRVHFHHDNLCLRVSKLHIKRISSTSLRLLLVSGVAAERDFPVAYR
                     IDFAEALEAEAWLRLLHRMQRVAALREELVLLQMDSSSLASSMKAAVGSSAASVASQR
                     AGAFAATDPVSPPNVLRGRTETAAYLYWDGVVQQWRRTLPYSDTETIVERADLEYGPP
                     QARYPVTADDVGCIIAAVLDTGATVRTASVITIHEELRVDVEAVLQRGTWRLPRSWIQ
                     RPPGKPNRRMRTTLTLSQRGIIGLYPKCRPWSESLHIDMRAEDTLQLEIHERPMRAED
                     TLQLEIHERPMRAASAPMRAPAGVHLCVRTPNAYQRDSVLLVFRAFRALALMGCTRLA
                     PELTSTYLSAACLPIGCFGIGHGRHRTVQPKRTRSVQVQTSMLDPLAVATARDHQAAD
                     AFAADHSSEAVVILAPNGDLSVVDHGGQVSISRAACTNVAVEQSLVETSAIAPQLEAP
                     DQSLTVLHFATNVDVIRDTGNPPPDTISERISRFEQRPVGLSISSGKAQQPAAVAAAT
                     RSDARSPVRRPGPRFPSVSRAPLPPLPSPALDLATPAGANGGNGPRTRVWRRLHWNCV
                     PLHQVPGSIWSDLRPLRWIPDMDEMAKLFSQEVASGFGAAAGRSTAPADAPESFAVLD
                     AKHVRNLDILLGRFRNVSSEAVADAFVHGDLDALDPDFFEILAPMLPSAPEQARLLEA
                     FQTRKDIALERLLYPERFMLTMLQRVPRIAAKAAAWSTMRRFTEAFQELDAAVTSVTR
                     ACLEIRQSRRLRLVLEVLLVIGNVLNAGSARANAAGFTIDSVPQLARSRSVISYAGAV
                     LRKSSEHQAADLELGTELASVQTASRIELDHISTGFSELEHDLQELTSECELSANEPT
                     GRALSRCFRRWLEPARAKLQQLAQRLREMNEAVEDTLLLLPMTEQGFVGGPEVATRRA
                     SLRDDLFRYLWQFVELWDQSLAETRALNENTACTWRQRVGADLDEAEKENAHLLWWKT
                     GDGMAPQIATFHAGTTDLATKAPGAIVPPPPPPPPPPPPLIPSPVHGPLQLGS"
     gene            <119709..>120326
                     /locus_tag="CYME_CMN050C"
                     /db_xref="GeneID:16995289"
     mRNA            <119709..>120326
                     /locus_tag="CYME_CMN050C"
                     /product="eukaryotic translation initiation factor eIF-4E"
                     /transcript_id="XM_005537163.1"
                     /db_xref="GeneID:16995289"
     CDS             119709..120326
                     /locus_tag="CYME_CMN050C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-4E"
                     /protein_id="XP_005537220.1"
                     /db_xref="GeneID:16995289"
                     /translation="MSERESPADAGPEKSVHPLQFSWTFWYDMPRGIKPSQENWSNNV
                     KPFAEVDTVEKFWAVMNNIVEPSRLPPGSNLHVFKHGIRPEWEDAMNEAGGKWVVTLP
                     KKELPRIDEFWLNSLIGILGEHFEAKASDDICGLVVSVRKDRGRLALWNKSALREDLR
                     RSIGKRWREILSSGGLPRDLDLEYMVHKDAMAYDRSYVSKALDRL"
     gene            complement(<122301..>122978)
                     /locus_tag="CYME_CMN051C"
                     /db_xref="GeneID:16995285"
     mRNA            complement(<122301..>122978)
                     /locus_tag="CYME_CMN051C"
                     /product="similar to 6-pyruvoyltetrahydropterin synthase"
                     /transcript_id="XM_005537164.1"
                     /db_xref="GeneID:16995285"
     CDS             complement(122301..122978)
                     /locus_tag="CYME_CMN051C"
                     /codon_start=1
                     /product="similar to 6-pyruvoyltetrahydropterin synthase"
                     /protein_id="XP_005537221.1"
                     /db_xref="GeneID:16995285"
                     /translation="MPQCQSSRNGAWRYCAGSSFGAIFGRLIGQRHETVRELCIRCRW
                     ALSLQSRSRPMVHIQRPVVELTRAVTFSACHALRAGKLSPEENERLFGPCARRHGHNY
                     VLEVTVRGPVDAQTGMVLDMRLLKEVIEKHVLEKLDHASIDEDVNEFASENGGYAHAL
                     PATTENLAAVIWGWLEPHLGLLLYRIRLWETEKNVVTFYGEYEAERGASLRSSPAEHL
                     ARNGRHH"
     misc_feature    123998..124869
                     /note="possible transcribed region"
     gene            complement(<127719..>128960)
                     /locus_tag="CYME_CMN053C"
                     /db_xref="GeneID:16995281"
     mRNA            complement(<127719..>128960)
                     /locus_tag="CYME_CMN053C"
                     /product="similar to DNA repair and recombination protein
                     Rad57p/XRCC2"
                     /transcript_id="XM_005537165.1"
                     /db_xref="GeneID:16995281"
     CDS             complement(127719..128960)
                     /locus_tag="CYME_CMN053C"
                     /codon_start=1
                     /product="similar to DNA repair and recombination protein
                     Rad57p/XRCC2"
                     /protein_id="XP_005537222.1"
                     /db_xref="GeneID:16995281"
                     /translation="MDCASTDDAGCADVRLPCELDAAVQQTPPADAFPLALAERLIRL
                     APEGSESALQRLVAREREKTRSGVRTAGSKPFNSDLDAKALLELAAWSSTHGDIGLRA
                     SFLSACERVARETSLVARHAASALCGKLEGERFGALEGSTPAPAPVTLSLGCPLLDQV
                     VCIRCGAVTEVYGEAGSGKTQFLLQLAARNRGMTLYLHTENGRFPSERLVDIARATAS
                     SADNDGNDIARSPESILNRILVETGAHVARSPLSLSRYIRGPFRKFLEHSPDPKLLII
                     DSIAAVIRHAYENRKRGALSKRARWVFRFVNTLRLLMREHRSLAVVASNQVAQRADGE
                     LVPALGAVWSQCVNTRIRLQRSVRGVFPSQSDAASTPAGALRSASVCFSDWGPEPGTL
                     VTFQIDESGVHGQHRGFVRSH"
     gene            complement(<129651..>130772)
                     /locus_tag="CYME_CMN054C"
                     /db_xref="GeneID:16995282"
     mRNA            complement(<129651..>130772)
                     /locus_tag="CYME_CMN054C"
                     /product="similar to cell cycle checkpoint and DNA repair
                     exonuclease RAD1"
                     /transcript_id="XM_005537166.1"
                     /db_xref="GeneID:16995282"
     CDS             complement(129651..130772)
                     /locus_tag="CYME_CMN054C"
                     /codon_start=1
                     /product="similar to cell cycle checkpoint and DNA repair
                     exonuclease RAD1"
                     /protein_id="XP_005537223.1"
                     /db_xref="GeneID:16995282"
                     /translation="MVDSAIESPNPLLLCKLQSGKFLVDALQSLPSAASLSSDLVLVV
                     VPRNQNGLRFVVQESGYFQACVTLPRELFTLFECHPPADVVEDTAFQVPRTELLTCLQ
                     LFVGCTGPVDRSALGAPLRMLYQRRGSPLQLLLQIDPTSYLDCEVQTAAQVPLHDFEF
                     LQVPIYNDAVIMSRVLAICLAELDYTGAAAAQLSMVPYPCPGLRMQALGDQTVSNVRV
                     QIPFFGTGDDEPAEDVAFLEFECVQEQTVAYSALLLKRCLRALQRADLVRLRMNANDV
                     LHMTARVPLPTGHGFRNSVNRKTNAVVEVALAASEGAFPASQHCFFEFLVAPLAFVPG
                     AQPGASLAANEEDPHDMAAARECAPDLGAPGSNEALDVS"
     gene            130832..132573
                     /locus_tag="CYME_CMN055T"
                     /db_xref="GeneID:16995278"
     misc_RNA        130832..132573
                     /locus_tag="CYME_CMN055T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461466.1"
                     /db_xref="GeneID:16995278"
     gene            complement(<131410..>132549)
                     /locus_tag="CYME_CMN056C"
                     /db_xref="GeneID:16995279"
     mRNA            complement(<131410..>132549)
                     /locus_tag="CYME_CMN056C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537167.1"
                     /db_xref="GeneID:16995279"
     CDS             complement(131410..132549)
                     /locus_tag="CYME_CMN056C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537224.1"
                     /db_xref="GeneID:16995279"
                     /translation="MFSCGGAPGATSGRFGAAVRTLVPVSPQEEGVHFRARRTRRASR
                     LGCQPRRGLLMTFPWLQPVPAQVLFVQNRSGVAVQQVLASRTGGSVGGWSRSESSGTG
                     PSDTVLPGRPSRQVYRQETTGDLSFSDSEGTVSVQVPTARGPRTGNSFPWEIAIFGSV
                     IAASTLKSRGDRTKRGISFQPGSIAVARLLVALRGEARDFVRPKLQALAAELDTTQPR
                     DLCHLLRDATLLLERARETGEGWYASAHDVLTFDASEESAAESSFRRMSVQIKANWRE
                     DTVLNLDGVRRIHSDETGDANNAPGEETEPDSFLVVALLVAIRNLTGVARSSGHVLEA
                     LHGVTEDDLLAVEVLWTPDRPNDTLTEEDMIAQFPELVRLSVAPL"
     gene            <132956..>133480
                     /locus_tag="CYME_CMN057C"
                     /db_xref="GeneID:16995280"
     mRNA            <132956..>133480
                     /locus_tag="CYME_CMN057C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537168.1"
                     /db_xref="GeneID:16995280"
     CDS             132956..133480
                     /locus_tag="CYME_CMN057C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537225.1"
                     /db_xref="GeneID:16995280"
                     /translation="MALLKCGFTNSLRALPLVERTFARIPPRRALCATTVLLYCVGQR
                     AFLACLAISSYSSFALCLSTVGEKGIVSDLFPALGDERPPKGSTSMSVTVPWIFYVSN
                     MHVLAYAVGRGPSLRENDLWKIDDMCPDVSPCAERFSDSPSGANLTFRNREHFFGRVE
                     TRSLRRNENQLYPR"
     gene            <134597..>135913
                     /locus_tag="CYME_CMN058C"
                     /db_xref="GeneID:16995267"
     mRNA            <134597..>135913
                     /locus_tag="CYME_CMN058C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537169.1"
                     /db_xref="GeneID:16995267"
     CDS             134597..135913
                     /locus_tag="CYME_CMN058C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537226.1"
                     /db_xref="GeneID:16995267"
                     /translation="MQMTSSETPLYPFSFTIYQGCVETWSEWAREPDVVALETLLRVC
                     GVPDSAVQTLSSGTPYMTDRLVFPVLHIRRNAEQCGEAPLQDFVVSGWYACRGLLLDL
                     GVLSPGQCTPVAESLVSLVRDRLDLGRLYEWWHIDANYSSFTKRYWSTLYQLPWMARW
                     TMPRQERDAVRTRLLMQSAAYRQVLRRTRPTSSSGGATFRSPFPPERRQQQGQERDLH
                     SASWSDASAAPAATAGEAGAAALEAAADAEFWSLEIEPVLDALAAMLGEHRYFQCSKT
                     LAPTTTAMESQNGPTTAPGYVDAVVYGHLLVYLQMELPVASRLRALVAQRPTLQRYVA
                     RMRDTHLHSCAEEQSGAAEGVPPRVASAGDLPRPHPSHASWQATGSARSSNRSKMSST
                     PEEDAAQERQLANRTFVWLAVGSFIFYALFGTALDVRIGDSSYDAT"
     gene            complement(<136408..>137679)
                     /locus_tag="CYME_CMN059C"
                     /db_xref="GeneID:16995268"
     mRNA            complement(<136408..>137679)
                     /locus_tag="CYME_CMN059C"
                     /product="similar to COP9 signalosome subunit Csn5"
                     /transcript_id="XM_005537170.1"
                     /db_xref="GeneID:16995268"
     CDS             complement(136408..137679)
                     /locus_tag="CYME_CMN059C"
                     /codon_start=1
                     /product="similar to COP9 signalosome subunit Csn5"
                     /protein_id="XP_005537227.1"
                     /db_xref="GeneID:16995268"
                     /translation="MLERVAYPSGWRRLRETGSLLERTATLLHESEQGSETTATTFRD
                     VYVSVLALSEVTSHCFEQCSATETQGVLWGFVPPGASSRAVVVWDATPACAPPGTVPV
                     PVSPARDAQLPENRSQLLTPGIALNAVGWYRSHHGYGCWLSRSELASHGAVQESGQGP
                     WVILIVDPVRSRRVGQVALRAFRVYPQGYRPFPRSRPSVQVRHERVPLDYLLEFEQGA
                     PAYYELTVHYFGMPADASMLSWIKQRDWPCILSTSQTVATRASTVQALSDAVAKTEAF
                     EVALRQMLCSRRHAAAAGTMQRLRSRSAASCSAHASTGGDEFASEANAQRTQQATAGT
                     SAVNMSFSPPPAPSSASRRPPPSPNHRVRRMQRLSDQEHPQTCAVVDENVRNAAERVR
                     CLLADTRDLQADDARILLRDIVKEYLFPLMD"
     gene            complement(<138145..>139152)
                     /locus_tag="CYME_CMN060C"
                     /db_xref="GeneID:16995276"
     mRNA            complement(<138145..>139152)
                     /locus_tag="CYME_CMN060C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537171.1"
                     /db_xref="GeneID:16995276"
     CDS             complement(138145..139152)
                     /locus_tag="CYME_CMN060C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537228.1"
                     /db_xref="GeneID:16995276"
                     /translation="MMEPYQTEMEWVQFDNSGVYATGLASFDCDQHRYMRDFSATASF
                     RLSLSAGCEQLGRSFRTGYVCSSRRTLMAAFESQGRRLQQFFMQCMHWRHNRYMFPLL
                     RAFALYESGERIRRGIVRLPQGIPVGLPCRLRLRAPPWGASPLASSPGTCPGLVERAP
                     HDICLSLNAECRTLPIRASSGQSHRRVRCSLHKQAHALPINRGFAERNVLHAQPRTET
                     EIQYGNPVDMGCSFDTPFESIAAMPQVSIQDPSPCNNSSNDDAELSSSSIQQRALSRP
                     RVALDHRNRKPEAYLIRACWYRRDWRRAEPRAYALEDTIIYLRCLCSSVLRITPISLA
                     S"
     gene            <138880..>141714
                     /locus_tag="CYME_CMN061C"
                     /db_xref="GeneID:16995277"
     mRNA            <138880..>141714
                     /locus_tag="CYME_CMN061C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537172.1"
                     /db_xref="GeneID:16995277"
     CDS             138880..141714
                     /locus_tag="CYME_CMN061C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537229.1"
                     /db_xref="GeneID:16995277"
                     /translation="MHTLHEELLQAATLRLERCHQSPSTAANVASSKGTTELFTAGAQ
                     RESKGSGCREIPHISVLITVERSQTSSVYARVVKLDPFHLSLVWLHHNPGPPGVRVLS
                     ITIGRPQFHFRRRQVLLILEPCSAQYQRASRWSDRPWRTFSLARALQMRLSLASLRRC
                     NIFVIVVGSGSGKWYQDGSFLLTRRAWLMTTYFDRLLASLSSALEINAATLSGAADII
                     VIQQPDGRLVSTPFHVRFGKLQLLKSREKVVEIEVSPLDEVEAVAVAKQLERSSTAST
                     GPPPPQSLETSRGTYRAPLTMLLGSAGEAFFVEETSSESTVELEGQTPGEAIWVERAP
                     SEPPSPCSETFRDWRSAAEPSAASSCREESQSAFSDSEQPTGAERLQLPPSDSADLRA
                     SSQPESRWSSRFGSMLRRQRQTGAETRSSSSTPTDVITLGIESLTSSPPAAAQQQAEL
                     LASRASSRSSLEGERSPAAGVESLVFEMDDSGQAMTESSVPEVAAATAPAPAAFTSAT
                     DVHAVGKPPVALSLCGHLITPQMTPVQVHEVFEANRISLDYFRGHVTILNHPDILVRI
                     HDQIYPLRVATPLLYGMLAFNTVLDPHAVDRQTTAPKARPPRARFTWFGLRSSQLEDS
                     STDLLQLGEPLTEAETELKPPMETSTTSTAEAKQHLLPLHRPRYMRKSLYPSSAQLAQ
                     LGLRPGTNLITFTVQSRLQGVQRVCSRIYLWPHDVRLCISDVDGTITRSDVLGQILPR
                     VGKDWSHQGVASLYRAIARNGYKFLYLTSRAIGQASATRSYLTTLQQEGGLGLPDGPL
                     LLSPDRVIESFTREVLRRRPQDFKIAALEQVRRLFPPGNYNPFFAGFGNRDSDRIAYA
                     AVGVPPERVFIVNARGELQVGNHVYSALSSFNALQKLVDSIFPDISTVSGQQKVMEVH
                     EAHAFNDYQYWKRPYSPTGSSSDAVSRFFS"
     gene            complement(<142087..>143340)
                     /locus_tag="CYME_CMN062C"
                     /db_xref="GeneID:16995274"
     mRNA            complement(<142087..>143340)
                     /locus_tag="CYME_CMN062C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537173.1"
                     /db_xref="GeneID:16995274"
     CDS             complement(142087..143340)
                     /locus_tag="CYME_CMN062C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537230.1"
                     /db_xref="GeneID:16995274"
                     /translation="MDAAKQRAPRRVPSLVELQAALGSADAQATGPDISSIAGDPPTL
                     TLPSGSYETDPSTFRRKHLYNTWLQKEAEPETLALYQYAERLYTATAKQERSGFSLHS
                     LQRPETLDEDRSGTSVPETGTSPSGGQLFTSDWYAQQIAEMQRSNMDSSQVAAKPVRW
                     RGSQLILQDFSWRHFAGNLKPGRLGRNVGDMLGRFHQRHLSSRENLKRLLLFAFGVTM
                     LALALFVWPFVVIIIISADRYRHATPCSVSMGVTLYTTAVLWLSVGGYGLILVAFTRI
                     AKRPVEATGLAGIIGAAVLLSYFLSLIITEAIFIVNAVSGKTPFGRCGPDCTCSAAAV
                     ASKLPCCSNVLWWTDLVMLLVSNAAAFLLCCLPYFTLLRENRRQRAHRRAPRYFVQRP
                     AAFWSNLPATSWEERTKHHSDQSDA"
     gene            <144388..>145875
                     /locus_tag="CYME_CMN063C"
                     /db_xref="GeneID:16995275"
     mRNA            <144388..>145875
                     /locus_tag="CYME_CMN063C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537174.1"
                     /db_xref="GeneID:16995275"
     CDS             144388..145875
                     /locus_tag="CYME_CMN063C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537231.1"
                     /db_xref="GeneID:16995275"
                     /translation="MEAVTGSDPSDPLVADVLGCGQLDLTRGLMQRASSGPRLRPGGR
                     FRQHAAALEALTRLRQDLEAEGPESSATQGQNTGVKWDVRHPAFDPRSYLFEVHVDTS
                     YQELERGLEELAQRRQRLEKAYLQAAVHSLPAYLTTIFTLLPELEPSGSTSGRTHPLE
                     QLESTFRGACAQLRDLFETYHNIGVSLSAWQYTSVRMRIDPEIGMMYRRFLTALFESD
                     AAAAAAAAAAAAVSYNTLIELRAQARNGLAQREASSTGTREWTDVTLRSMEFLLQRLR
                     FCPRFQNGAASIPSAAFWKSFDETVEQIWAECTEPRRTVETFYLLRLDVASETLRERC
                     DAHALRLKSTILRSALSAVENTKAEVPAAECKFTSEIPYTEVFAAAAQLVLAYLRKEV
                     IGMSQFVANLLHYVDAARQALLGPILNDAEREASARLVQVLRAFIETCIDISREAMDA
                     NRWKLLAPDALTPELWGSEALAERLKGLLETSLQALGQIPSGRSS"
     gene            complement(<146581..>148617)
                     /locus_tag="CYME_CMN064C"
                     /db_xref="GeneID:16995296"
     mRNA            complement(<146581..>148617)
                     /locus_tag="CYME_CMN064C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537175.1"
                     /db_xref="GeneID:16995296"
     CDS             complement(146581..148617)
                     /locus_tag="CYME_CMN064C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537232.1"
                     /db_xref="GeneID:16995296"
                     /translation="MQRSQRETWSETAPDMHPYGVGGRATRDGRDAALYAPTNVNEDH
                     FRLHETRAPYRRHSKRESLKLREASGSTGIEEHTAGSVYGIGDAPTGTKGRTLYRPLE
                     PQSGCVLSVDLHEPSSFPASEAFPSGAVAARRDSWLPWWSASERWHSQHAPLQLPRVP
                     VALHVAGWMVVWVLVLISLRRRSREREERSALFARSCRKRTPARGRFPESPASAASVI
                     RHVQPCYWLLPLLPLPKPVRLYSARAWPTLKTIACRKLHDPDRLERLWYRRHSRHYAN
                     LHDLSLSATFVALSDSNDDSEDAAIPTNEEYTAHRSELPASELMDHRSANVHTTENLA
                     FPTVFGQIEKNQAPFRARLESKPQIQVLCERNQDVPEKQSKSGPRKGPMGKRASLPAS
                     WDDSIQYSLPMPGAELYAPVFENVSSSSSRSLSALGFSLAEPEKENSDCPWEHLASII
                     GTTFPSGSPSAHSTRSSHEANEHPLEIEACGHARHPDRYAGAMTALSALSISEHEGAQ
                     DGVHAALPCQSSTAAECNAKPVDSFPTGPMQSLPLLSALMWQDARVRRNPDGNWWLER
                     HGEYRLENQPQVLFRFGDKFGVDARILPHNHESQVWYEWYFESRRADSSAEHPQYHGC
                     RWGRNTAGETWHVRYHTDADGHHWEDRLDSTGHRLPPDANICIVQRLAGSLSSD"
     gene            <149799..>150782
                     /locus_tag="CYME_CMN065C"
                     /db_xref="GeneID:16995297"
     mRNA            <149799..>150782
                     /locus_tag="CYME_CMN065C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537176.1"
                     /db_xref="GeneID:16995297"
     CDS             149799..150782
                     /locus_tag="CYME_CMN065C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537233.1"
                     /db_xref="GeneID:16995297"
                     /translation="MEWVQFDNSGVYATGLASFDCDQHRYMRDFSATASFRLSLSAGC
                     EQLGRSFRTGYVCSSRRTLMAAFESQGRRLQQFFMQCMHWRHNRYMFPLLRAFALYES
                     GERIRRGIVRLPQGIPVGLPCRLRLRAPPWGASPLASSPGTCPGLVERAPHDICLSLN
                     AECRTLPIRAPSGQSHRRVRCSLHKQAHALPINRGFAERNVLHAQPRTETEIQYGNPV
                     DMGCSFDTPFESIAAMPQVSIQDPSPCNNSSNDDAELSSSSIQQRALSRPRVALDHRN
                     RKPEAYLIRACWYRRDWRRAEPRAYALEDTIIYLRCLCSSVSRITPISLAS"
     gene            <153244..>154581
                     /locus_tag="CYME_CMN066C"
                     /db_xref="GeneID:16995301"
     mRNA            <153244..>154581
                     /locus_tag="CYME_CMN066C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537177.1"
                     /db_xref="GeneID:16995301"
     CDS             153244..154581
                     /locus_tag="CYME_CMN066C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537234.1"
                     /db_xref="GeneID:16995301"
                     /translation="MLPDTVVPAEIRRETSCTCDAEAFNATTRDMSAVSQVPEVLATA
                     LPVAGSAVAGVAATPDSLTQSDHQVIPGSTLPVTSSTTAGRFQNIEDGTEPTASASSA
                     LRVTLIGRDSLRPEGKGPGQGGPPVRTEVANRVKVLLFKQLQNGIHPGGGHKSAASHT
                     ERLVVNEPEAPHGCFCRRSSSAHRTPKPAVSAPASASQVDDESAPIAACVLFGTDPQQ
                     PWNRSAVHRIRLCVRHLRECRGCETPGILGASGSAGEVERLRLQTAHSGSLPTQADPH
                     SIAGLLKDTLRRTRPALLSSDGYQCFLEMARKSGPGTSWDEAINIFRLWQRISASQPH
                     SYCRDVLVEILLLLNEVSRLNDINKMTSRNLAVVMAPCLCDWDPLRPNALEQLHVMTD
                     MVQYLIERAKFVADMEGHPGTGHERINLAPVSCAYHSSAESLNAATVKPPCYA"
     gene            complement(155869..155942)
                     /locus_tag="CYME_CMN067R"
                     /db_xref="GeneID:16995302"
     tRNA            complement(155869..155942)
                     /locus_tag="CYME_CMN067R"
                     /product="tRNA-Val"
                     /db_xref="GeneID:16995302"
     gene            <156117..>166706
                     /locus_tag="CYME_CMN068C"
                     /db_xref="GeneID:16995308"
     mRNA            <156117..>166706
                     /locus_tag="CYME_CMN068C"
                     /product="similar to U3 snoRNP protein Utp20p"
                     /transcript_id="XM_005537178.1"
                     /db_xref="GeneID:16995308"
     CDS             156117..166706
                     /locus_tag="CYME_CMN068C"
                     /codon_start=1
                     /product="similar to U3 snoRNP protein Utp20p"
                     /protein_id="XP_005537235.1"
                     /db_xref="GeneID:16995308"
                     /translation="MKVLNKSGRGERQFKFLSLRDRLRQLNTSDAERLRRPVLVSEAY
                     ASRKHESALDTYLRNAIAEWSDRDRTRSFQAFAKSVEDWVISLPLLLRNRKRVFRQWV
                     LAVRERSPSSLAALIVCWEALALDLAAEFTPFIRPSLEVLAGALDLENADETSVFFST
                     TARLFRCWTKQRRFGQQQAPQVLRSWAAMLLCHRSEYVRLLAAQSAGVLLRRLPIEDI
                     QPLVATLVTQSGTDAATTETQRRMADGLAATFFYGCCGIRGEPHSKAPVLLEKLQHCI
                     LHHEAHYDTSDAFPQMLLAALWWRLGRALTPSALAQLQESTLLVSLEHAHPKRLVHVM
                     EALGACLYGCCRNAVSSSSERASLLSGTFAASVSTLQLGRGSEPALVWLLASYGDAIA
                     RLGSLAQKRRFLKSLTDDLADVRVAAAVLESLVTQTEVWRSPEAVPLLGEVLGCVYQR
                     LSRTSLSRSAHLSWILRLVTSIRETDQTASDALLSTLQRCPGIWQVSDLEDNDSSIRY
                     LALQLATMVRLTGMDDDQQDRLRCILQDDTSLAALLALCRQFPADKPLLDRCFEAASQ
                     YPVTPGTEAGFDALVRQLLDRDPEGSDLVLWATQTERFRLQRDALFSAAELELCARLA
                     RSSPHPQLESFFQAMAEVYQVASSFTREIDRIDAARLHLRRVLMMLRQQGRANMPQQL
                     VRLELFAILGILQLPLTLYWEEVPALWRAAMEQVDPAALFEQVLLPVFQATQARCSWV
                     SQRSERFAGEERAGALGSHEDAADAASTPESSAAPMLQTTVSGAVCSPEYESASGAAA
                     GAADAASTPESSAACLLPAAEPSGPSSGTQPGEKELLRTAKTARLEAKAARPGTSAPT
                     HTSLAQRRRSDPAKRAALSSAPLWPWLANTKSSSDRIWRRLNLFQPTAEEAAGQWAAP
                     LNAATMTNAASTDSAVATVASSPRTDTCLTRSSVGLGSYPYCVSPAPVQNACLDDEWS
                     SRRLALARQIIPADAFYRNLLQLVVPVQQSNVSKAHQKVLAAVVTAYPVPAGIETLHW
                     RQLGSLLVAQTQSDAPEADRVRYKVLLEQALRSEEAALQRAALEALFQSSTWHQQHRR
                     AYLPPLLVLLQPRADNAPAKAHRTRLVGTRLATLREQVAMLYGALVDLAAVQAPQTKP
                     SDDRQPAAEDGPKQPLLYQLEQRFQQILQSRSSAITLERHQAASADSPGDFTYSRSGS
                     KRAARIREVPPAATVESIVILPNDAPVVMPLVANLLFGRARALARFLGTGSTQGTQKK
                     RYRALFQAIMQCYGFMGRYPQILQDLARLIQQEQREETRLVLAIAVADLIQSGLETPW
                     SLFASITALAWASFCCWYAPEREANKGKRRLAARLLQRMLCLLANDQVHGRVNGWVPV
                     ASAEAAHSTAPSGIGAFVENASTTITSRMEEPGVMVVDDVEASAESASLRAVTGQRVE
                     HSDAFEESSIPGQVEWTQMLPPTWFADLLRLLNNALARLSLGEETQSAPSLFAPLQVL
                     LETECYVQKLVRGYPVETAMLWQYLVNCLLQVRQQNLQCLLLRLMDALLQRTARGQWP
                     PVLVQALVRCLLVSSPRAWKADAKLRVAKRRPEPEGPVQQAALQLLLQLAERLGNELA
                     IDESCVIDQCMDVSASASLLPSYAQEQHAAVPAETRKAMHAQSLAGTSSESSPTQGVP
                     MDTAATARVTGRGALAEPAEAGLVFRQGTAVQVPGEAVPCTLQQAALVLLEALLMLMA
                     RKRIQEATRWTLLDSFHSVCVRLQHRLLPEQWERLLVLLVQLFERAELFPLASRMRWE
                     LARRLVTLCDHIPDPSLRARVGPVASLLERLNRISPTSIGQIDWDSVLGAYAERFDEH
                     HDADWRLLVPHLMAGMQFTDAAIRSAASEALIKLVGSAVSTPRTCSGTESTSVAAPAT
                     RIASATPGEAQAPTKATRQVPCASEASRVVLASGVATSPRALVSPVASRLRKRALTTQ
                     SIRQLDTILKTYGQLVRLATPGLDPVWLDGLRPLTEAVDESEDVFQCLVHQQLATRIR
                     ACRLLDQVLATGSIPVLVRKAFLVPLVEKLIGLASTSSRVHSEIEQLQTSWLASAQAL
                     LAERLLASLPSSWCWQRFALHLHRFERLASSQRSASTREDAHSDARMSANARRLGQAQ
                     VLVVYARALAALPSIPQEVSEAQQIDQAPDTQHAPIMVQNEHRTVSPETQKSGNAPEQ
                     LLERLDALLVATSLRDTAAVEADCPASDRHLERIVWEIVLRLLQALPRQQQQQRAVWV
                     PRLVTRWIRTLGLRNQQRRDDAREALQLLLRILGPEWLWCIARQLTETVQVSASRKAL
                     QHSEGTWRLHVWAYTLHMLLQTTLECDAYPTWHLDLDTLQRVLGLVLLVEFRDPVLEA
                     EKRVSKLYADIREVHVHSAERCLTLLGRVWPMDRLANMVLALELFVRAFRERLAFDTS
                     GSTTTTTTTTTTTTTTTTTTTTTTTTTTGVPSSAERYRAASIAEREQWRRLLHAFVDG
                     IHRQELHAVAPEDAETAVASQALVLRYLLTKPSPRMRTDPGADTVTTTTTTAAAAAAA
                     AAAEKTPRMTTGSGTSETIGFRDTMRESAHLSVRNRTSAGRTQVAASKDAQSPSGERH
                     IQKTPLSIDQARSKHQYVRENVPPEHRSRQALQGERKARLTADHHRDKNATTESSARA
                     DALGLGILDAGQLAIVEQVQQLSPELETFRQTRRSEAAILVEVALYWAWHWRLLREQR
                     PSCGATTRRSSSPRVDVTRRQRTASEEAHEAVELDGTAPGNASLSVEASEASLPGRSP
                     EEVAWQRARLVVWRLLVEPLVLETLRARHDELVIRSLQLLERLWRAPHLVQDKSIRVH
                     LKRLAPTLEELLERQIVSSSAEQAGAALPCSNSVWRSHALPASGTASNRDLFTTLLRV
                     MATLVTLPAPLPTIMGVRKRSQQLLTKAAASALTLDSSPSRLSAGMTVFRLALRAAPE
                     TNAASTAVDWCTRSTLWPLVERLSQLLIQRSDATLRDQCISLLVRYCWNRRTSETERQ
                     RLLDLMVQHLDYTYEDGRVACLLFLQRLVESARTSSNGSSSADDHARLESTASNVALG
                     EYLLAPLAVRLVNEHGSEAYQVLRACVRALFEPLPSSSTGTGVERPVALTPGARSLQQ
                     LVARWLEPGHEPGVRLAAALVFTLVPAGSPRELVTLLFEAMEPFIRGNASAERDDSTP
                     ATARAMRHKEPAHEALPLSASYSEYEEQGETLANNAAADVHRGISRWCLAYAASRALE
                     QTLQPEHVQCSPWTKADATRLVDALAFGLPQTDRVSLLLHPHPWVRASLTRLMELMWQ
                     REQHPQERASAPEWSPAHVSAIAAALCRQLSAFQGRNTEATAVIERLLIAMALVLGQE
                     AGSSWRWLLRRLSGLASRAREQTSTRRVALRVLEQLLRKHTGAASTTESRAAQSTEHQ
                     RESREKPGQLAWSRAIEPFLAAWIFPVYRLDRLRANAENAHLDAELEASAERIRSELE
                     QPDRLGAVRFWEVYHRVTARDRQERAARLAERKRLALVDSVEAAQRKRRRHGASRTAR
                     TLEKV"
     gene            complement(<167367..>168461)
                     /locus_tag="CYME_CMN069C"
                     /db_xref="GeneID:16995309"
     mRNA            complement(<167367..>168461)
                     /locus_tag="CYME_CMN069C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537179.1"
                     /db_xref="GeneID:16995309"
     CDS             complement(167367..168461)
                     /locus_tag="CYME_CMN069C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537236.1"
                     /db_xref="GeneID:16995309"
                     /translation="MSVPGARVPDLESDRTPSASIPESKKARKRRLRHELYLARRAER
                     RTAAKQRRRQRRQLETSQTLAGLDTTGERQSGETHVTDASTRGLERLIRDYLQCTHSQ
                     QISRRFHCIVDLGASALLTSKELRKSIIQLRQMYVVNRRLVREALLRKQEHICTFQVT
                     ICGLDTRALDIRSQVFGEEALRWPSITWTSSDLASYLAETAGAIDAVVLTADATQTLM
                     QVEPNTLYILGGIVDRNRLKGLMLERAQTLGLPARRLPLELLPSWRGSPVLTTCHAFE
                     ALARVAAGQSWSQALNEVLPQRKRSPAASRAEVACLNATGSQVNCERSTSPDSLPDGN
                     DSVQSTRTREQAVVSGGTSWTLDPSDTSAA"
     gene            168348..170720
                     /locus_tag="CYME_CMN070T"
                     /db_xref="GeneID:16995303"
     misc_RNA        168348..170720
                     /locus_tag="CYME_CMN070T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461467.1"
                     /db_xref="GeneID:16995303"
     gene            complement(169555..171238)
                     /locus_tag="CYME_CMN071T"
                     /db_xref="GeneID:16995304"
     misc_RNA        complement(169555..171238)
                     /locus_tag="CYME_CMN071T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461468.1"
                     /db_xref="GeneID:16995304"
     gene            <171526..>174231
                     /locus_tag="CYME_CMN072C"
                     /db_xref="GeneID:16995305"
     mRNA            <171526..>174231
                     /locus_tag="CYME_CMN072C"
                     /product="similar to mitochondrial distribution and
                     morphology mutant Mdm38"
                     /transcript_id="XM_005537180.1"
                     /db_xref="GeneID:16995305"
     CDS             171526..174231
                     /locus_tag="CYME_CMN072C"
                     /codon_start=1
                     /product="similar to mitochondrial distribution and
                     morphology mutant Mdm38"
                     /protein_id="XP_005537237.1"
                     /db_xref="GeneID:16995305"
                     /translation="MVNIVCRRGLLGQLARSGAALLHTVDVGAGSSRRVAVRTVVDWS
                     PAVQQARLPLEANAQSSVQVADERHLRLFDTCRRTCERWSSSQSGTSVTGNDLAGVSL
                     RVFPRRHRAASTATRKCAVVDAAGLRALLQAKPKPPLLTLDWTERVARGRSTSTLAER
                     WRCSWRARPRIEKAPQRCQSTSPSPSSSSSSSSSSSSSSSSSSSSAAGTTGGSSRLFT
                     NRLRGRSQYLGERLHRALHRVRSWLAQLPARTLKTIESFAKRLWREVVACIRQPSRLV
                     MHYRHAKQTITDFIHHFWTGTKLLAADARLSWRIIKRLAQGKQLTRRERNILIGTGSD
                     LARLVPFSFFIIVPFMEFALPLALKLFPNMIPSHFQDKKKKEEDMKRQLKARIELAKY
                     LQDVVEAQALMIRNQASAGDDVRKLASELSEFLQKLREGHPVDKWDVLRFARLFKDEI
                     TLENATREQLVAMCRYMGIAPHGSDSFLRYRLRAKLASIKNDDMLIAWEGGVKSLTDD
                     EVTQACRDRGIRTEGLPIEHQRQMLAEWIEMSQNREIPGSLMILSRAFFYTMDPDKAL
                     EATLTSLPHELVQGMQSSAEAADDAIEGVGTSETGAEHRSESERRLAEVRRHERLMEL
                     EEQNAAEQAAAAAAAAAAASAKPTTDHESEAAAVTLPASAAPEAAAIERIREAELVPP
                     SPRESSVAAASAVETEAVKAGTGPATSSDKLLDRHLAELNVADRKEAVAMISTALEEM
                     LHPIVSKERQEIEQLKMELAQAVANSAGPNAATTAEIERLKRFIARLEEECTLVEQKV
                     GDALKLLDRDNDGFISVKEIADAIAELRYGQPLTAGRSAAGIRPPGLESRVDPDSVAA
                     EVLRRLDLDADGIIQPDDIRRLAAQVAAERLGHRQAASAAASKSE"
     misc_feature    complement(172867..174734)
                     /note="possible transcribed region"
     gene            <176703..>177773
                     /locus_tag="CYME_CMN074C"
                     /db_xref="GeneID:16995299"
     mRNA            <176703..>177773
                     /locus_tag="CYME_CMN074C"
                     /product="box C/D snoRNP rRNA methylase component
                     fibrillarin"
                     /transcript_id="XM_005537181.1"
                     /db_xref="GeneID:16995299"
     CDS             176703..177773
                     /locus_tag="CYME_CMN074C"
                     /codon_start=1
                     /product="box C/D snoRNP rRNA methylase component
                     fibrillarin"
                     /protein_id="XP_005537238.1"
                     /db_xref="GeneID:16995299"
                     /translation="MERDSRRGYGRGAFSRGGSYSRGAGRRGGGNSGAGGGGGGGGSF
                     GGLAPRGGGGFKPGANARREGGGPGRGRGGGGGGGGGSWRGGASRGRASRGRGGSAGR
                     GAPGRSLRGGSRVLVEPHRLPGVFIVRGKEDALCTRNLIPGDTVYGEKRVSVEAVDPN
                     TDEKRKIEYRIWNPFRSKMAAAILGGIERFPIGPGTKVLYLGAASGTTVSHVSDIVGA
                     SGVVYAVEFSHRSGRELVALAQRRPNIVPIVEDARYPARYRMLVPMVDTIFADVAQPD
                     QSRILAMNAAYFLRTGGYFMISIKASCIDSTAAPAAVFASEVENLQKERFRPLEQLTL
                     EPYERDHAVVIGTYRVPPKSKP"
     gene            complement(<178694..>187519)
                     /locus_tag="CYME_CMN075C"
                     /db_xref="GeneID:16995300"
     mRNA            complement(<178694..>187519)
                     /locus_tag="CYME_CMN075C"
                     /product="similar to DNA damage checkpoint kinase RAD3"
                     /transcript_id="XM_005537182.1"
                     /db_xref="GeneID:16995300"
     CDS             complement(178694..187519)
                     /locus_tag="CYME_CMN075C"
                     /codon_start=1
                     /product="similar to DNA damage checkpoint kinase RAD3"
                     /protein_id="XP_005537239.1"
                     /db_xref="GeneID:16995300"
                     /translation="MAASLETSVGVRNEQVGTYLASLLEHVLSTLQKQTAGSTAGASS
                     LEQVALPVLRESASKCPVEFFPASLGRSCEQIADILESEATLRRVLAPLLWVLARRAT
                     IADWRSLEALFQRWHKNRHETVVAPELETIWCNVLGHVQLERAASFRKQEDLRVWQLE
                     LATGALSSAEDVRRWLDRVYILALTGCSDDALLILQQVMQRSPFHYIVEIEKSLWIVV
                     QSLCDPGSSIPQGQSNEAPPDSRATRSRAPTASTISIECERSGPKRSKCSGWRETLNE
                     YIDAAAAGEHWLLLAALLLLLRTCEGPDQTAVIAGRVLAASIDAERPAAARYGALFAA
                     GRHAPFSARLAVAARAAQENASTADHTISAVSTVACIPWLVQPESADEHRQFGEFVAK
                     LRQDPALAPHLARWLCITGTGAAYVDPERILDHLTFAAELIGSIRPRKMPPDVVDTLI
                     HKTITLAEPSWPQMRLLALLLHTQERAAAQRMLLDERLAPFLARCISWAWRAPAAALS
                     PDTACVMRVLATLIQHCCGDEHAPVVMVLVQELDQAMHASLGDWRFIQALGVIARNAC
                     SRLATVALAALIEQASTLERRRRRRSPQSVTVPAIDQISWELERTASPHHVSRLLGEQ
                     GPRLFPLLLHQLLHHEELADLLQSWLQLSDSDAVFTFVYRCSFAFLVSHIHERNLEAL
                     SARVSAAAAALGIEEQVQALADSLLLSNRVKRDKAFALLATYTGSTIHDIARTYTTRV
                     ILRLLTALDTRPEAVVRDALDELAILVDARDTVTLIAHDLLRILDALNRRIFRRQDHQ
                     AIRILDLLFKVIAPELHLFVPKVLATLKNALEIPDLRLHALVIQCWVTFLEQLGWERA
                     APHLGTAFAVLGPYLEGEPALAQVLLDLTRACAASPAKSTYLDEIFLPPADSTSSARP
                     TNWADSAPLEAAHPAETCASAAAAAAAATTTTTTLCPERELQTLSIPTGESSPDTHRP
                     APARTNEVLGAIRTLLNERKQQRQPAEQLIRLLPIATKHHSRLVRLLALRELTSVLRQ
                     YRNQLYVDIVLHQRTQLVSELLQEGLLLAVTDGDANCRDEALLALALLGAVDPARLSL
                     EHRQPPPLSLPSLQQHAVVSQSSGSEGESLLDQVVIPTLLEQCLIPALRRVESAQARE
                     WQNRIGFVIQEVLRLALSLEDTTDITSTAHPLPTSPSSSPKRPQTRSTEERIQQRAFW
                     RALSEHTRQIIRPFLYSRYILRTVAQRKTSSETIGRENQGVAASLLPCTSSGTTVETG
                     APAATLLKHTNTEAHAAASSDAVPASMECTASPATSRAACARCAVAPGKSAAQWICGF
                     AVHLVDVLDQVMCAVDVTFIHSDDMRMDSGIGPEASTVAAAGMEPAAPEAIPSTGSTG
                     VTSATSSTGAVPESVSAAGTKQKPEAAAAIAPTGSPTPNATLSRKYRCWWGLFRACRT
                     LTGHDQHTAIYLLPYLVQTMLQIASDLDSINMDTQLAISDLDVEPSATAPEALAALSA
                     PRDASAQHQTTAAPDSLPLTGGHTHATAAAATKANRSKHWITRISAFLRSHLVAVLSS
                     DLTEAIQLVFLLLDRLAEQRDHDWMSRVRGLDPCALATCEYAALAAAAAQQPEHICPF
                     NALERALPAALLARAALTSGALHRALLYLDQCTGSCSESQRRVLQRLYRELGDLDAMQ
                     AITTRRAPVVVASGGRTPDASPSLLPGTAANGYEQGLSSPSSSSAFVDWESFTLDAEA
                     YHATEEALIGYERGLRAFPTDLAAMRGYLQSLMTLGLWETMLHPILTHPERSAVADLG
                     IEAALRLGRWDALETLSASVEDPAARGTRSALANIAKALHQAQQPGHESGAQLSETLR
                     RARSGLSDTVATAALESYARTYPALVQLHAVADVECILGDHADLEAVLQRYAHDWLAG
                     GADVGAANWLEARLQCVASSWQAREPILAIQRAALLVQVERARHLVARNESAAAAAAA
                     AAAAAPCTSLRVPWTLAGGERANGSSWAAPKNDNDTSSSTSSGGGGGGIERPAPATVL
                     AAGRSQPASVQFPDQTWLVSASTKPAVLVPGTTRPPASFVTPERSAQQFLERALVFQE
                     AADAVTLRLARLARKSGHHAAAIAYLQQLPRASLFQGPACIELAKIYRARGETRRALA
                     QLPLSLTDLQLGRKTASTSNSSSTGTWRSSSGSAARLVSKALCLQAQWMQEDRSAQPQ
                     EIIDCFQRALSIQPETEKIYVLLGRFYDSLTPERDAEPRIQARQQWLYRQSALEHYAR
                     SLRYGCRYVYHSLPRIITLWLDEDSEPVLEEHTNDSSSNSSSSDKRMTPDTASHIERS
                     KVLCAIRTNTRALDSNNNNNSSSSSISRPDIDSYEARDSPSIARRSAAEYLLPIVRRL
                     RTRLPLYIWFVVLPQLLSRVTAHHSAAVRAELCSLLADCVVAYPGQAVWYVVPLAGAL
                     DANRAATARAILDQARQRGDLGLSTLLDAGLELCAQLARVCTQVPPRGLKQMTASVHL
                     RALRRLLRERLQGLAIPVPYQAYLRLFLPTSGRFRDDLHEGFAVSVPTLVDVDEPVWV
                     MNSLMRPKRIGLLASDGHVYPFLCKREDAGDMRKDARMMDLLNVVNRLLAKTADAQQR
                     RLVLRTYAVLPLNEECGILEWMPHLVPLRAAVAMLHRALGYEKTATSSTEEIRLAYER
                     HAKARPEPDQVRWYTEWLLPRFPPVLRHFYSIHFGRRHSPAAWFAARQAFARSCALWS
                     MVGYVVGLGDRHGENVLLDTRSGECVHVDFACLFDQGLRLKVPETVPFRLTPNMIDAM
                     GTAGYQGVFYRSAQIALSVLRNHRETLLSVLETFLHDPLLDWAAAARDARTAAAMEAS
                     ATRGPVLLPGPAAAMRLPREPADTARLRRPADKRGKAAHPGNDMPPRQQRQQCCERNA
                     QALEMLRVVDRKCRGLHGAQSGTPLSVEGDVARLVAEATSARNLARMYIWWLPHV"
     misc_feature    187651..189455
                     /note="possible transcribed region"
     misc_feature    189950..191519
                     /note="possible transcribed region"
     gene            <194965..>195264
                     /locus_tag="CYME_CMN078C"
                     /db_xref="GeneID:16995293"
     mRNA            <194965..>195264
                     /locus_tag="CYME_CMN078C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537183.1"
                     /db_xref="GeneID:16995293"
     CDS             194965..195264
                     /locus_tag="CYME_CMN078C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537240.1"
                     /db_xref="GeneID:16995293"
                     /translation="MSGSLWKQLLTRGSSWIEPSASPEAWETTAELRRKLLYTHLNAL
                     PARWQAAQNEFRALLDKMRAKQVTVEEAGWFGVRCVELYAFYCLGVVIGARSLQP"
     gene            complement(<195694..>196311)
                     /locus_tag="CYME_CMN079C"
                     /db_xref="GeneID:16995294"
     mRNA            complement(<195694..>196311)
                     /locus_tag="CYME_CMN079C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537184.1"
                     /db_xref="GeneID:16995294"
     CDS             complement(195694..196311)
                     /locus_tag="CYME_CMN079C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537241.1"
                     /db_xref="GeneID:16995294"
                     /translation="MTGERKRHTAAVLSLDFAEQYGFYLKYHAHPVNQLVHVVFVPLL
                     LGSALAALAQWRVSLGGVKLDLGLIVAVAYALYYIVLSPLLGASAALVMVLPLYLAGR
                     ALLLRAPDAQVVWSAFLVIQLLGWSAQFAAHEWLEKRRPALLDNLIQAFASAPLFVFV
                     EVLAFLGLDQGLRKRFQRPQRARSTSRERRTPGGAKTPRRRMAHA"
     misc_feature    196354..197535
                     /note="possible transcribed region"
     gene            complement(<199309..>199941)
                     /locus_tag="CYME_CMN081C"
                     /db_xref="GeneID:16995306"
     mRNA            complement(<199309..>199941)
                     /locus_tag="CYME_CMN081C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537185.1"
                     /db_xref="GeneID:16995306"
     CDS             complement(199309..199941)
                     /locus_tag="CYME_CMN081C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537242.1"
                     /db_xref="GeneID:16995306"
                     /translation="MEQACGLNCFARSLNYQLDAGSSVLRSTWVEPHAPPSWTLGTGT
                     GARRRLSGASAWKHAAVAAVQLPSFLPPAGVAILGCGTGCCLLALGWSFESVRRYGIQ
                     APRAFTGCGVGIGFGCVGVGQGFGRYVPWAKDTRPSSLRKDLRQSMDDVVRFFRERFG
                     HESKQKEETSQPAELVPEPNEIVVAPELEQEPLPAPPERPRPRRCIEVRE"
     gene            complement(<206204..>209125)
                     /locus_tag="CYME_CMN082C"
                     /db_xref="GeneID:16995307"
     mRNA            complement(<206204..>209125)
                     /locus_tag="CYME_CMN082C"
                     /product="similar to GTP pyrophosphokinase"
                     /transcript_id="XM_005537186.1"
                     /db_xref="GeneID:16995307"
     CDS             complement(206204..209125)
                     /locus_tag="CYME_CMN082C"
                     /codon_start=1
                     /product="similar to GTP pyrophosphokinase"
                     /protein_id="XP_005537243.1"
                     /db_xref="GeneID:16995307"
                     /translation="MSTGRSSSCFVEPSLQPVRIERVHGFVGSAAALCAANRALLRVP
                     PVRRVFCSGRFEGRRCALRLGIDPVEQGLLPERTPFYGEEGASAAPKCVWNVRHKTGD
                     AQVATGDENTRSEQQDVPERPPSATGKPVGVRLFLHRSRRQGLATTPARHGTYECFGA
                     ARESGALSQRRNEHRRAPERVSKDVSSSDFIQVSSQVSRALQNLEKQRRCSEVAEGPG
                     WPSSTQDLQRFIEDVELRCAYLGPIGSSLVRIALERSLQRSATMQHSPARQPPDADAG
                     STADPANAPPSPPDMNLRTSARGERERLSPDAASAPSTSDRAARRIAAVSTTPWGVAI
                     HEERKHRSFARCRAVLNTVIDLQMDLEAVLAAALLDTPLATREIASEFGRSVADILIQ
                     ERAIRGIIYATSMDSNPAGLRQLLIGVAKDWRALALFFAGTLHELRVYSEAFGLMDDM
                     DAATSSPDTCAAEGNAPQRSCEAASSMDESVATSVVRGTSTASGAYASGAPAVSHTPA
                     DRSLNSMQETAEQAPTCVSPGLLTPREASCETRSHTDGADDQRASLAPARQRLDAMTH
                     ATAQRLALLTLEVVAPLANQLGIYYLQCEMEELAFLLLFPKQSEALRRQVALRFDAGA
                     DILEYARQAIENALSLEPQLHSYIWSWRIRGRVKSLYSTYRKMIRLGSGIDSILDLMA
                     LRVVVRPVHQSSELEACDAVMAIIERLWPSVRERRRDFIRWPKENGYQSLHTTVVIDG
                     FPVEVQVRSERMHRLAEYGRAAHWLYKQNLNLFTDRGFANTTVSPSAMSEREKAVAWN
                     AIAHAAALANTPCAPSVGEFEFESNVAADSDAAVASLADASGAVSTPTAATTAAGPSD
                     TPARVAALPATQPPSGETLASETLTHSESRRADVILDDTVTASLGTTSEYFRVLYHQI
                     VELEQHVVVFDKSSGKLLRLPRGTTLGDVAGVPMLNGDIASPGTVLRTGDQIGGAAFS
                     S"
     gene            209371..211069
                     /locus_tag="CYME_CMN083T"
                     /db_xref="GeneID:16995310"
     misc_RNA        209371..211069
                     /locus_tag="CYME_CMN083T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461469.1"
                     /db_xref="GeneID:16995310"
     gene            <211528..>212511
                     /locus_tag="CYME_CMN084C"
                     /db_xref="GeneID:16995311"
     mRNA            <211528..>212511
                     /locus_tag="CYME_CMN084C"
                     /product="ADP/ATP translocase"
                     /transcript_id="XM_005537187.1"
                     /db_xref="GeneID:16995311"
     CDS             211528..212511
                     /locus_tag="CYME_CMN084C"
                     /codon_start=1
                     /product="ADP/ATP translocase"
                     /protein_id="XP_005537244.1"
                     /db_xref="GeneID:16995311"
                     /translation="MSEATKQQAAVSTEQVQKAKQKAKTSVTSFLKDLAAGGVAGAIS
                     KTAVAPIERVKLLLQISLSNPQIKPEDRYNGIFDTFRRVVREQGFWSLWRGNMANVLR
                     YFPTQALNFAFKDTYKQMFLAGVDKDKQFWRFFMGNLASGGAAGATSLLVVYPLDFAR
                     TRLAADVGKGKDRAFTGLGDCIMKIYRSDGLRGLYQGFGVSIQGIIVYRAAFFGFFDT
                     AKALLLKDPRNAPVWQSWLIAQTVTTVAGIISYPFDTVRRRMMMQSGRVGQREYTGTL
                     DCWAKIIKNEGTSALFRGAFSNVIRGTGGAFVLVLYDEFKKIINPTAVMYK"
     gene            complement(<213903..>216584)
                     /locus_tag="CYME_CMN085C"
                     /db_xref="GeneID:16995312"
     mRNA            complement(<213903..>216584)
                     /locus_tag="CYME_CMN085C"
                     /product="fructose-6-phosphate
                     2-kinase/fructose-2,6-bisphosphatase"
                     /transcript_id="XM_005537188.1"
                     /db_xref="GeneID:16995312"
     CDS             complement(213903..216584)
                     /locus_tag="CYME_CMN085C"
                     /codon_start=1
                     /product="fructose-6-phosphate
                     2-kinase/fructose-2,6-bisphosphatase"
                     /protein_id="XP_005537245.1"
                     /db_xref="GeneID:16995312"
                     /translation="MTPHHFSSSLSVRSRYEIVRGSDPSSSAVRRALRMTLSGLRISQ
                     TRQRFYGSSARLEQRLRVSRFPAGAIMKRIVSYNDSLAFVAEIQSELSRRQKHTGEER
                     TLTEASTDAAAGNARSFSGTLATAPEQGAVASASSCLEQLDLQRVASEPSPPGVVPET
                     HVERNTVASEPAKKAEPPAAEGAPATHWTPLSPAQQTNPSGSGTGDQTAEASGAFPTS
                     QYDTSAAGWRSRWNVGSESPSLAPLAAAPSPRSFSNEREEDAVSADSSLLAGGGRVET
                     ERTPVLAEESFPLAVDFDADNSSEAYGGIQDAFIDRHRAARPQYHRTLAYSGEGEGTG
                     TGNRLADIDPGASCEPPQHLATSRALPPDSRHVPEREQQHHEHQEQEQCTLVEAQAAA
                     GSMHSGTGDEVLAASSTLRRIESQAKRVSSALDLPEMAQPAGQTKYMVRKLVIVMAGL
                     PARGKSHIAQQVARYLNWLGHRTAIFNVGVMRRRLMKSSDCDASFFSPENDEGMRLRW
                     EFARRTLHEMNQWLFGENGQVGIYDATNSTKMRRRFVREYLENLGIRVLFLESIVNDE
                     RIVEQNILATKLNSPDYRDRDADYAVRDFKNRLRNYERANETITEDEGCSYVKIIDGG
                     KKFVLYNLKGHLQSKIVSYLTSVHIVPRLIYLSRHGESEWNVTGQLGGDPPITRRGEA
                     YAKRLSEFLQREFQGRPLPTVWCSQLRRTWLTVRHIPTDICICWRSLNEINAGICEGM
                     TYEQIKRELPDVWEARKADKLRYRYPSGESYLDVIHRVEPIILEIERQTKPLLIVAHN
                     AIIRSIYAFFKGLKQEQVPYVDIPLHTLICLRTRPYGCDERRYKLLTDEVPIDRARTP
                     EPSDSEGHPRDHRDAAEAAPNCAVIERVWFDDIETIP"
     gene            <217635..>219944
                     /locus_tag="CYME_CMN086C"
                     /db_xref="GeneID:16995329"
     mRNA            <217635..>219944
                     /locus_tag="CYME_CMN086C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537189.1"
                     /db_xref="GeneID:16995329"
     CDS             217635..219944
                     /locus_tag="CYME_CMN086C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537246.1"
                     /db_xref="GeneID:16995329"
                     /translation="MALSFWIVTVWLLLFLSIIESACGSILEETLLFGNAAAQEGRRC
                     CWLLRDGALTVTPHREEHAAQAELRIYGTLSRLVSNKQKPLAPEEVEFIFYPSTQREY
                     VGYHAPNGGSTVQYCCPLEADAELDASTPPGCNAATGGHVLVATAVATPLTLPQRKMR
                     TDWHRGALLRARARHGAPAGPSEAQTNRKQHRENVPQGKQSIDRGRPCICGAQQRMEW
                     LRDEASDPMQQRALHDAVQLNAQEQGQEHEELMKPRMPLDLSAVVGQRAVERIAGVWH
                     RLRYRSAAQETLECVERGLATVRVSRDAALALAVPISMERGSSGVALDTAEAKPTVPA
                     AAPGRQQQQTERQAHHDQRNGVQFEYLRHTETRDVQAHEQAPFRVIPVLQQRKQLNQT
                     TATPVYRYRLTLPRSSSRMDFGVLIFPVRESGIHELLVASCTGTNISMHLVAEWQSAH
                     GYLAAELYPLLPFYGWMTVLYVAAGAVWILACYVQLGRLYTAQHVTTFLLVLGLFESF
                     LHFQAYHWANQSGKRICCPPGGLVMIGDFVATVRSTLTRVLVLAASMGLLLLSPRLMP
                     PKALLLKWFALVYTLSAGSLEMLETVSQGRRSGLMVVVPVSVLVSILETLFYFWMLFA
                     LRQTWIALQRRDLSEKRGRFRIFIVMLVAYACSVLAYVGFAFAFLWKGANGRGGITDA
                     NWHLFWLVGPYPGLGTGALGDTASVMILAAIMWIWFPTSTRHEELLGTGGTPTTPNQL
                     MTLPAKSSALRRASGERLESRFELDEEND"
     gene            complement(<222338..>223255)
                     /locus_tag="CYME_CMN087C"
                     /db_xref="GeneID:16995330"
     mRNA            complement(<222338..>223255)
                     /locus_tag="CYME_CMN087C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537190.1"
                     /db_xref="GeneID:16995330"
     CDS             complement(222338..223255)
                     /locus_tag="CYME_CMN087C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537247.1"
                     /db_xref="GeneID:16995330"
                     /translation="MSEDETSLETLEERVSRAVLSFSRWQREHRNYFDADSGAWLVCA
                     ASSSCDEAASEGKRLCMEATSLERETARTAVRFIELLEGAKGLVRNGNQWFALFACWR
                     RLKHACRYRDQLEAPLATPLKQFVGAVMRQIDECPLVIAALGAAEPLPAGLTGVSALY
                     QLHPHRLWIRVAHLVKRIQATMSESAERLEPGVGALRRTRRRWVYAETLHQRALEALR
                     QLFSLLQDRAETIAHFYRPTYSSGIEIGDEETFSQWLTNEEKLRDEATRAAAFLWALS
                     GDDALYAFMNRQDDAASGAFTLHWLHHVE"
     gene            <223470..>225212
                     /locus_tag="CYME_CMN088C"
                     /db_xref="GeneID:16995327"
     mRNA            <223470..>225212
                     /locus_tag="CYME_CMN088C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537191.1"
                     /db_xref="GeneID:16995327"
     CDS             223470..225212
                     /locus_tag="CYME_CMN088C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537248.1"
                     /db_xref="GeneID:16995327"
                     /translation="MPVVSAQERDVVEASSREATHSGYVLRASGELSSTAAESSSAPE
                     VPRTPSGAAGCTALLSATLTPTGSRSNDSGNAETSTRSALGTAVGVVRVAGAPARPPS
                     TTTTVTATAATAATAATAATAATAATAATAATAATAATAATAATAATAATAATAATAA
                     TAASSPQPSTSGSGGAPVTEPSRPRSQRLSWFTIARRLLSHGGKKLELASFLNALLFL
                     GLLTNLHLTYVNRAGCAPTLLEQMAQFHPEARHDPALLLRRYDLVQVQVVPTPLPLQH
                     FHNTWSGLQPLWERLLPRPQRYQFATEKGFLLLSEQARRSHNISELHLELTTKDTCYG
                     ASPFMRGILKYIVGSETVVLNAFAYLLQYGLRHGHSSGQRSLGTDGYVLNVQSGDIYN
                     IGRVFIGELYARSAYFTDVFLLKTGVLLTSAYVMFTIGALIAFALREVQSRIMKLALE
                     IQNARNRTPYAGALFSSSIHALVLVPIITGILFFLFEFFDNQLLAFCVLVVAWIAEVT
                     VMLGWRSGLSIYILPRAFAAYLLAFHIYFFSFPLGFSWLALFTCAAFMQHTVFLVFSR
                     FESPRLRAEATTQR"
     gene            complement(<228221..>232108)
                     /locus_tag="CYME_CMN090C"
                     /db_xref="GeneID:16995328"
     mRNA            complement(<228221..>232108)
                     /locus_tag="CYME_CMN090C"
                     /product="similar to syntaxin binding protein"
                     /transcript_id="XM_005537192.1"
                     /db_xref="GeneID:16995328"
     CDS             complement(228221..232108)
                     /locus_tag="CYME_CMN090C"
                     /codon_start=1
                     /product="similar to syntaxin binding protein"
                     /protein_id="XP_005537249.1"
                     /db_xref="GeneID:16995328"
                     /translation="MRRWCRGWVAILFCLLLALVSVELAGALILDLERQAVQVSELFS
                     LDSFNFSACPCSLPFESLRSYLVLSEGSSASAETSWSLLSDGTLLYEPGPAGSGNATS
                     NTTILESTDFEGALALFVNSTAIAHWTDYTVTAAVNASANSSTVGIVARARDVSDFYL
                     LLWTGPNQTLTLERLRPGFQGRTLATSNATSVPSLNASDSFILTLTAIGRGFQASLNG
                     WSPWGTLVDTATDAMLSGTIGLFASGDSPLLFQNWTVDGTVQVSAATPAASPQSINPV
                     PSVEPSPAWITPVNETHGIRLAYTLYFPAMNLSDYAGAIDVVIRSALDTRLGFQTTWL
                     VGVRAGSVYASYYSLVTDSSPYASANGTALASARLQSYVCGGRLTFDTGILATCPSGT
                     IDVAEVAPTAEPAPSSSSSSQQQQQGSSSSSSSSNAGVIGGVVASVVLGLAAVLGALY
                     YVYRRRQRQRNNAKRRLQRADDEETELEKRTTLSIAALSSACGTVGGGGGGTAPDKHS
                     IPPQRSTGPKRPPETPGVSQTLRSTPSLREALRMRFVGATFGSIRPRHGCWETLVLDA
                     RCTHILAAVCRLSDLADHGITGVESLEEAAQLKNLPSRTNTIFLVTGDDTSLAQVAQV
                     CTGLSPRASSSTPTPTSTRHQRRFDVLLLAIRSITSPLLDVVRTSLGGMHASLQVREL
                     HADLVPIDDYAFSFELPELFGTFYGRNTGPSGNRPEQGDSSTQWKRACKQLGDQLASV
                     LQILGLELPKIEIHTTHIASSVAMGIADALRAAMNAETSRSTAEAVYVTASVPSACTE
                     APSDELRAAGTGTSRSRYRRRSVRLVLIDRATDPLTPLRHDLAYDAFLHDMFPVPVDS
                     HPTSIVVKPQRSLFKTTSIGSIPLTLNTPDDPTWLRLRYLDIHEAASSAHVELDRFLI
                     ETGHASQSSQREFALGSARSRPRNEGSANATLGDKSVVEYQRVVERLSFHLDQLEKCT
                     ALYQSRYMASIVQLEAILVTGKDPRSGKKVRRAEQQQQVEALLQQPNVEPSAKLRLIL
                     LWVACRGADANLLVRWMAKAQIDDRGRASLRAFIECLRAERHSAEPIKRQRRARDGAP
                     LLLEILGRCAAAGNTSENPVSPSIDSSPGADATSTSTSTAARAFMSTTAAPSTTHTRT
                     QRYQEYLPSGLQMRTPPVRSGQPSPLQSIGSVLEQDALLPTGAHVSQSAMEIRSASSE
                     HDACRNCAASSTSALVEARPVSTQSSAPSQDVLMIFFIGGLTRTECRIAATFARQMPN
                     LDVYIGGTHLLTPSLFLDNLADLVHKSKVAESI"
     misc_feature    228680..230400
                     /note="possible transcribed region"
     gene            <234023..>235693
                     /locus_tag="CYME_CMN091C"
                     /db_xref="GeneID:16995325"
     mRNA            <234023..>235693
                     /locus_tag="CYME_CMN091C"
                     /product="similar to iron-sulfur cluster-binding protein"
                     /transcript_id="XM_005537193.1"
                     /db_xref="GeneID:16995325"
     CDS             234023..235693
                     /locus_tag="CYME_CMN091C"
                     /codon_start=1
                     /product="similar to iron-sulfur cluster-binding protein"
                     /protein_id="XP_005537250.1"
                     /db_xref="GeneID:16995325"
                     /translation="MSEHYRNSLRWCIGLHRSLLSWPQKRPGCQRTGLRSPVTGTHKA
                     PVTAHWKTRDHERAVKHTASLWAGGQKRFPWRGDFDVLAPCVPLLRFPSSKRQLVASR
                     HDEAGSEHAPADQHKCEHIATVSLEGALAKDPVSTGVYAAVQDPERSTSTEHTQRAPA
                     SPSGTSRKRPRNMTPYRPVRSEVDYRALVDDELPRIVKGLGLGPTAVLALDPQHPGPT
                     EQAKNAYLSWLTAGYHGSMEYMARTDRIRRALNYEQILPGVRAIVVTTLFYWPGKSGF
                     TAPADAATPNRGTVSCYAWGQDYHRTLGQKLKQLAEEIHAYAGGQGRYYVDTGALLER
                     HIGESAGLGFVGKNSLLIHPQLGSGFFLGEVLTTLPLPSKRPDLSGRGGCGRCRKCRT
                     ACPTGAIVEDRVVDARRCISYLTIELKDAIPEEYREAIGSLIYGCDICQQVCPWNQFD
                     WEGSPTSPLFGEVPQDVREPDLLALLDLNEVSFQERFRDSPIRRIGLERLQRNVLVAL
                     GNVGNPHQSRARLVRFLEENESELLREHARWALDRIERREKAAAPFAG"
     gene            complement(<237037..>241416)
                     /locus_tag="CYME_CMN092C"
                     /db_xref="GeneID:16995320"
     mRNA            complement(<237037..>241416)
                     /locus_tag="CYME_CMN092C"
                     /product="similar to calcium-activated potassium channel"
                     /transcript_id="XM_005537194.1"
                     /db_xref="GeneID:16995320"
     CDS             complement(237037..241416)
                     /locus_tag="CYME_CMN092C"
                     /codon_start=1
                     /product="similar to calcium-activated potassium channel"
                     /protein_id="XP_005537251.1"
                     /db_xref="GeneID:16995320"
                     /translation="MSSSDQDSVRLSDVKGLLFSLVWGSIIFCVVALKPFLLLLLFRA
                     LRRLRLLARRRARGRLAALWLRSRLNRHLLPPALTDRSVFAWLKPYEDADEGQFSGSA
                     ADTDAVFEQPDVLERLLQRETGKTNRASSPLQLSRGVLEAASQKPDFPVDSSLAQLDA
                     GRVATASLHEPDLESVESTAIPDGPVVRHVGASGVVAERVADANDAQNWVNRARALHL
                     SMKVMTPWWSRMIPPVSDRLPIVTEDSLRYSLLVERLEMTMERSRVTLALSWIRLLID
                     LATCVIFYVEGELRRDYIGRVYYWPVGLWFAVDYAFRVFLLPHRGPYYRNHVFTLSAI
                     AESLSIPSALRSAAGNVSFVNFNFLRSITAVQAFFYIYNRDMLREDHMYIGRVGRYVV
                     SLSIHLFAIVFSIAMLMFDIEYASGSNHFTPTSSIYFTIVTVTTVGYGDYVATNVVAR
                     IYVTIVIVIMVAYFAYAIANIVNIYKMSQEGKGSFRAGGYRRHIVVTGRPSLPQLEAA
                     LSVFYAEQRNALAYFIIFLDDLYLSEPQTHVLQHTEATDRVRLLVGNVYEAYDRRRVD
                     LGHAEMCLLFSGVEPRDSYTETHRIADDAALVLRARTVRMHYPRLPLHILFQTPYAVR
                     QLEDLFIQTQCLIDADEHPRDTEDAVQAGLLEYETRTLCQLEFAAYLLAANVHCNGAS
                     TLVRNMLADPRIDRPLCFGDSLSILEYKTGVRHKLRRISLPERLAGVRLGELALELYL
                     RFEVAVAGLLILDSAGAWRVLYNPRHKIGTRGLLFILCARHQFRPVISWLYSTRAVDD
                     LWELRKSLDRDDADTSSNNTRLSKQSRSSGWTRFGLVEVALPEVELGTGRGRLNTAAS
                     AEKLRLQQRRARSRRNTAVSNDSQKRQEAVSASAFPSVLSTERAHDTRAATAGVVKRT
                     SLDATAESRPLADFARRSASESSEPGSEQDAGDQLRNSDDDVDEDEAPKEATVILATC
                     SSTLSTVFLELFTKALRSSVSYVRVNADSSAPSQEPGFSAPNGWKVANFEVLVLVPSL
                     SNESHFAEIAAKYGPLRHVAGSVLRISDLARVQAAHAHAIVLVSNDTAQGFVEPETTL
                     SGLEVFSMVNLDLLLRHYQCDVYVTSELSRHQALEMVPAAAPRRVYLRLGNPFERRPI
                     RHLQVYHPIDVLPTMPPNDDLHTPREHGAYRNHATPSSVPSTVALRVFEAHVGGDEGF
                     RYRNRFASGELTATSIFATALLTREHALPGVVLLTKSLFGMPVSRFDHRGRRIRISRA
                     HLHLANVPAEIHDIRYVELLEIVIRAGALPYGLYRGFHHNVRVSVADLHQMLLSRFSS
                     NDHKDEGSMKPYESILDLVSDLARRLDIDSEEFMERILEPLTELDTGVDGATPGQRRQ
                     RTCFSWLTFWSCGQRRLPFPNRILNLGTPQNSLPYVLTNPPPYVRVSRHDGVYVVTEN
                     FERFLKKFHAICAQSLDDHKANA"
     gene            complement(241676..243140)
                     /locus_tag="CYME_CMN093T"
                     /db_xref="GeneID:16995321"
     misc_RNA        complement(241676..243140)
                     /locus_tag="CYME_CMN093T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461470.1"
                     /db_xref="GeneID:16995321"
     gene            <243321..>244235
                     /locus_tag="CYME_CMN094C"
                     /db_xref="GeneID:16995315"
     mRNA            <243321..>244235
                     /locus_tag="CYME_CMN094C"
                     /product="probable short-chain dehydrogenase"
                     /transcript_id="XM_005537195.1"
                     /db_xref="GeneID:16995315"
     CDS             243321..244235
                     /locus_tag="CYME_CMN094C"
                     /codon_start=1
                     /product="probable short-chain dehydrogenase"
                     /protein_id="XP_005537252.1"
                     /db_xref="GeneID:16995315"
                     /translation="MLQAKEASFGSSQPVAIITGASRGIGRAIALTLAERDRMVLVLA
                     AKSRVSRANLPGTVQSVADECLARGAAAVLPFPLDVRDDQGIERMVHETLQRFGRIDV
                     LVCNAGALWWKPVAETPLERFDLVHGVNARGSFACARAVLPAMVRQKTGLIITMSPPV
                     ELDALPGMTGYLISKFGMTMLVHGLGGELAGTGVTSVALWPATMVESFATKNFQLGDR
                     SQWRKASIIADCVHMLLHDPERNALSGRALIDEDYMRSRGIRDFSQYRCDPDVEPERA
                     WPPRKPWASTAKDPRALPPGVSLAPSKL"
     gene            complement(<245300..>245803)
                     /locus_tag="CYME_CMN095C"
                     /db_xref="GeneID:16995316"
     mRNA            complement(<245300..>245803)
                     /locus_tag="CYME_CMN095C"
                     /product="similar to splicing factor 3a subunit 2,
                     partial"
                     /transcript_id="XM_005537196.1"
                     /db_xref="GeneID:16995316"
     CDS             complement(245300..245803)
                     /locus_tag="CYME_CMN095C"
                     /codon_start=1
                     /product="similar to splicing factor 3a subunit 2,
                     partial"
                     /protein_id="XP_005537253.1"
                     /db_xref="GeneID:16995316"
                     /translation="MDAYALKNRLGAVECKLCRTVHPSEANYLVHTRGRRHRQAVKRR
                     EERDTLRRRFPETGVVSGSVVNTKLESRRSEGTEASPHTPKVECWRLPGNAGFRIATE
                     LSASADVEVLVTPQPRRLGQEIWLIPDVACMRLEKGSFVTRVRTRRFPVCSGAVRFEV
                     DLYVRRD"
     gene            <245836..>248556
                     /locus_tag="CYME_CMN096C"
                     /db_xref="GeneID:16995317"
     mRNA            <245836..>248556
                     /locus_tag="CYME_CMN096C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537197.1"
                     /db_xref="GeneID:16995317"
     CDS             245836..248556
                     /locus_tag="CYME_CMN096C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537254.1"
                     /db_xref="GeneID:16995317"
                     /translation="MAGRSDAEEQHVPSGGTPADFQWPNLRIPGFRLLSPKESSVTQD
                     FSRNTPWEDLVYALEEAAKALVTQVATRGTVPGAVRQSLTVALPPALDRTPWTPWTTC
                     REDASTSTRVSAELYLVCDETWQVAQPLGLVRLFGVPAYWLLRLTPALSSYRDWVQAA
                     VGALFFVATTCLQTDQDQPGESACVLWQSRGAGRQCMTPDCTSDVETGPRRKCTTLNK
                     RNGSTHSVESTEPQDRKHCTSVSMTMMPTTVFVETSATMTEAATEYRGLGIGDGFALR
                     HYEMRVLSTPPANIEDLESLLAFFRQHIVTSSLSPGATETNRSITQERLEIALTYEVV
                     LEPEAVESEGLVTSPLVDADALRLALMLRWPLRSLAAYESMDLLDAPEWILWLPSESL
                     DAEPMSSMPRKVLSVPHWTQMRLLRQLVRRLVQLIRNLRSVSISDTEQYLDLEQPSRM
                     FTSRHLICPLLEALRACVDDALIANSWPKGLHSENDGTVAAELRVTLESLNRLASANL
                     QKSTPEATPLDAAAASVESQRVPVESTCPAARNRGAVASEKSAGAQAPSATPVYALNA
                     GIRGEAGAVALEQTAVAFASDAFGSQAYTVRVPGRALGSVSPGQGVASASLPSPEPAP
                     VPSRPGHLQTAGTRKQLHGAASEHAVKSDPEALGQAEVDSDAQMPVAADDTSTEGIFS
                     VENDPHRCASLYDANPGANGTPTGNATAKAEASFFPDDSEPSRQQWQRLLEFGAMQCV
                     RALWQAICCQSSIERQYVTGFRRCFESTAAACAALFQSSVPETGVLGAHLQHSMDEID
                     QLLTLWVHVQLLRRVFQDRMELLDELLQHGQLTLPGPYASPTAAPVQTALLEYLTRSI
                     FDLDEAAVLETPHMREYVLEARTEDNEERARLLYRLTGEHCVLATVHDSN"
     gene            complement(<249199..>251253)
                     /locus_tag="CYME_CMN097C"
                     /db_xref="GeneID:16995318"
     mRNA            complement(<249199..>251253)
                     /locus_tag="CYME_CMN097C"
                     /product="probable trehalase"
                     /transcript_id="XM_005537198.1"
                     /db_xref="GeneID:16995318"
     CDS             complement(249199..251253)
                     /locus_tag="CYME_CMN097C"
                     /codon_start=1
                     /product="probable trehalase"
                     /protein_id="XP_005537255.1"
                     /db_xref="GeneID:16995318"
                     /translation="MTLKVIEAYVHMAFRLGALAPAFPSSVVYCAANCAETSAGCEKS
                     LLAVVQRLRIFADSKHFVDLPLLPGRIPERIIEYWDAEFGRRVVEEPLAGPGEATSGL
                     REAEREPPVPTFRLARVEGPDTDFEEVRRFLLEHFDYAPGGDLLAWIPRDLPQLELDP
                     EPGTTATGSPPLLHQIWRWMKAQDVDAGNWLMDMVARWRKLGRETSPMVFREPERFSL
                     LPLKHPFIVAGGRFRECYYWDTYFIVRGLLVCGMWETARCCVENLLDLVEQFGFVPNG
                     ARIYYLNRTQPPLLSDMVRCIAEHAHAGWDVMTFLGRALPLLEREYSFMMEQRTVKMR
                     AGGTLNRYHAPAAEGPRPESFYEDSKLASDCSMELLGDPRRSELFIALTAAAESGWDF
                     SSRWLRDRRSMCSIRTQLIIPVCFNSFMLRMERNLAFLYRWYISGSRPETEKGSIFEQ
                     RLPGNEEVPNDPVTRDLLDRVQQRVSTMQKYLYVPSRDQWIDYDLEADTTTLQTVADW
                     RQTVSSSNFFPLWSGILEHIESEQAASIARGVLQSFEESGLLQNGGVVATLVTDSGQQ
                     WDYPNAWPPVQLLLHEAFASLATQFSANEQISNRARELSLQIAIRFLRSVYQGWLRSG
                     DLFEKYHAEKVGESGNGGEYVPQVGFGWTIGVSLALLSSVWQLDRSLLAQVWQRVSDE
                     AT"
     misc_feature    251420..251724
                     /note="pseudo-gene of 3-oxo-5-alpha-steroid
                     4-dehydrogenase"
     misc_feature    252601..255915
                     /note="repetitive element"
     gene            complement(256529..259806)
                     /locus_tag="CYME_CMN101T"
                     /db_xref="GeneID:16995313"
     misc_RNA        complement(256529..259806)
                     /locus_tag="CYME_CMN101T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461471.1"
                     /db_xref="GeneID:16995313"
     gene            <256679..>257731
                     /locus_tag="CYME_CMN100C"
                     /db_xref="GeneID:16995322"
     mRNA            <256679..>257731
                     /locus_tag="CYME_CMN100C"
                     /product="unknown hydrolase"
                     /transcript_id="XM_005537199.1"
                     /db_xref="GeneID:16995322"
     CDS             256679..257731
                     /locus_tag="CYME_CMN100C"
                     /codon_start=1
                     /product="unknown hydrolase"
                     /protein_id="XP_005537256.1"
                     /db_xref="GeneID:16995322"
                     /translation="MFTGGEAFAPAPHRPMSRLGRQRWASAAGESDTHQAQAAQCRGR
                     QHLVALDGATATAAAATEGHFRTAATVLPVRVSSTIPSQLSRKSAARAVTAATVMCSS
                     PYEHRHSAETSPGLQRVASSATTAATSRDQPIVFFFDVMDTLVCDPFFKDMHLHFGFD
                     KREDFLAAKHPETWIRFERGELSVTDLEHLFFRPLHTLPLHLAKHARFNARRFEAYLR
                     ESYRFMDEGIEPLLEWLASRQPPGTLHILSNYPCYYRFIEEKLGLSRYLSWTAVSCET
                     GLRKPDPRAYAEAATRAGASASQCVLIDDQKRNIDGALAAGFGAAILYPGTSSALRSL
                     LEEFLDGNNVGKKVGF"
     misc_feature    259230..262414
                     /note="repetitive element"
     gene            262385..264424
                     /locus_tag="CYME_CMN103T"
                     /db_xref="GeneID:16995314"
     misc_RNA        262385..264424
                     /locus_tag="CYME_CMN103T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461472.1"
                     /db_xref="GeneID:16995314"
     gene            <266938..>268464
                     /locus_tag="CYME_CMN104C"
                     /db_xref="GeneID:16995323"
     mRNA            <266938..>268464
                     /locus_tag="CYME_CMN104C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537200.1"
                     /db_xref="GeneID:16995323"
     CDS             266938..268464
                     /locus_tag="CYME_CMN104C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537257.1"
                     /db_xref="GeneID:16995323"
                     /translation="MLCQVRGSESDLLRLAAENPEGFGPCIRPSGCYFREELDALLAR
                     PPVDGQVRQRSFSGSLLPKLGAAAQGLSACCTGLESRRCVAQLGHVSKPPAALCERLV
                     LFIIDYDDTLYPTSQLGSAVLQLQRLEELAQAQATREASQRAVEVPRSPRCSSLPPSP
                     DTRSSVMLVLDDSIPYPSSMQLDQHPSEAADEMHADAPSAVPSIRPGRSPGTPYATSE
                     ITSIFTQLAYAPAELYALCVELDETVSAFLTLCLDSGRNHHVSIVTNADLRWVFSSSR
                     GALPRTHRLLFDKTVFDAEAGAIHTSTSTSRTCACISARGRYGDLRDDGTEAVGRDPT
                     DWKVACFRDEIERVLGERDALRREWAFWQQQQELRKQVLHGSTLWDDAFETVCEKEPC
                     ERCLDAHRQFESDRRQRGIRMPSVASRACLTKIPFDLFVIGDSEYEMEAARKIHVEFP
                     MARLKAIKMIEEPSMVDIMHQLRELAKELPAFIQARGDLQLELAKSTGTSLDDVHTLT
                     "
     gene            complement(<272512..>274761)
                     /locus_tag="CYME_CMN105C"
                     /db_xref="GeneID:16995324"
     mRNA            complement(<272512..>274761)
                     /locus_tag="CYME_CMN105C"
                     /product="ATP-binding cassette, sub-family B"
                     /transcript_id="XM_005537201.1"
                     /db_xref="GeneID:16995324"
     CDS             complement(272512..274761)
                     /locus_tag="CYME_CMN105C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family B"
                     /protein_id="XP_005537258.1"
                     /db_xref="GeneID:16995324"
                     /translation="MAFVFAVPRVTLHRTSLPRRFPGCAPRAKCTPYQQLLRKPTKEP
                     LARSWRCSAANASKPPTGSPEVFEKLFVPVHDIDECCIDRRLLEPYSLQKQSAFDAEY
                     RTAEELSLPGAQSTFRVFLRYLQALFRHEPDLPRRFMIALVLMVLSKVLLVCVPFLFK
                     RGIDALSSGAATGERWALIAIILFCMHGMLRTLGNVLHELRSIVFIRAAQRIGRQISR
                     ATFKHLLELDHSFLLTAKVGQVTAIVNRGTRSVMTLFRALFLSFLPSMFELLLVCVIM
                     ATRLSWSMSAATLAFFVFYVLFTLRVNRSFIPIRRRLNDLDNEANAKATDSLMNFDTV
                     KYFDRANFETVRFDKVLAAYEECAVRNEGMYALLNAGQATIFNVAYAMINAFGAWGVV
                     QQALTVGDLVMAGSLFQQLSVPLQFLGWQTRELKAALVDLENLFDLLRRRPTVCDAAD
                     AVELELRQGGEIRFERVSFAYPEPVTGQLRPVLSDISFRVPPGKKTAIVGGSGGGKST
                     ILRLLYRLYDATEGNILIDGQSIRNIRQSSLRAAIGFIPQEAALFNDTIFYNIAYGNV
                     TASKTEVEEAARLAKIDETIRAMPDQYDTLVGERGIRLSGGEKQRVAIARAILRNPRI
                     LCLDEATSALDSKTEREITAALDELGQNRTVLVVAHRLATIVNADEILVLHQGRIVER
                     GTHTALLALNGHYADMWRRQTEHALDDQDAPTNGSVFAHPAPATPGFVSAFAVDAEEV
                     DAVLDGQHA"
     gene            complement(<276945..>280886)
                     /locus_tag="CYME_CMN106C"
                     /db_xref="GeneID:16995342"
     mRNA            complement(<276945..>280886)
                     /locus_tag="CYME_CMN106C"
                     /product="similar to regulator of nonsense transcript
                     stability"
                     /transcript_id="XM_005537202.1"
                     /db_xref="GeneID:16995342"
     CDS             complement(276945..280886)
                     /locus_tag="CYME_CMN106C"
                     /codon_start=1
                     /product="similar to regulator of nonsense transcript
                     stability"
                     /protein_id="XP_005537259.1"
                     /db_xref="GeneID:16995342"
                     /translation="MPTRLTSAGPQRWSVLYSFDVHRKSKRWKDGILQSSAVPGNEAR
                     VRLQLLDETVPTDESPESSSSACASRAHQRRRTVFSETVPRTKIDVSGEVFSLGNQIL
                     VQVLEPVESVEEDCKQAPPALRDSLSPRAASSDGESLQTGLQGTVRPANSTRRPLGVT
                     GLRRLGRLPNSINSARSAGESHAEPYERVPPGPAWRQSCFDNAQSLSSTGLDLDQRER
                     SVQASKTAAQFSRPKSSTNHKAGASVGAVKGGSAHEDSAPMQGPQNMIENGKRCPRVQ
                     LSDEQLLSMLAEDSPLDASGTAGAPQGSCFTRPQVSGCGIGPSAFAKDADASTEPPRF
                     RVSASHPRLATCLPSSGAIDSVGVSVRHRSSASRQITNAQDLTLTFPRRSASSRKETA
                     DVGELCPGGRKPAGSSSSTQVSLQTTNTWNSIPAYRQEMLLLLAAQIQKQLDAQAEVL
                     ERACEQLLDHSSKQPAYAHIALPHRQGSALIVRHGVESFAVMSRTAKNAQRTRHGLHD
                     ETKQPPDDQLVPGTKYFLRFRPESRLDEFATCLDRDALWALGTRTAWREHFRSEHSSA
                     VADGVTLVRSLYHGVSTVSGLLEVQPLGRCNRRIWRKQPCSVLVMCCACLPTELLCLD
                     AFLNEEPFGRLHVLRQLVGSPVATTNTKQPQAQNDCLQQVPLRNEDQKSLESCGGQPF
                     ANADIPLVPSSAEPGTRSDSKPSSDPAVQLEGRQRTLFSLDSPCPSSGGVPTELASAC
                     AAQHQRLETVSSAWNLEQQQQQQQVIQACLNGVALIRSKDSQARGVDRPHLVAVHGAF
                     GTGKTRTLVESILAMLEQQPSLRILVAAGTNVAVDNILLGLLQRGFKDFARAGNEGRM
                     HPSVCEFTLKGFKKRFRRATVDNGRDSMQVHPASAGTNIAQAMSHEAPTVAPVDGEFP
                     SPRDSTQVEQSMSALRKRVSGSGCRTGLMKLVSAPQICFTGNATSTKLCPQRRRDSCL
                     DLRAPAEELDSETVEKASREAFRSRSVVGVTCASATQAILHGLRFDVVLVDEASQIME
                     PLALAPILELGADHVFVVIAGDERQLPPLMSGRSSEDVPDQCCISRSLLKRLGERADV
                     LNLYLTVQFRCHPQIAQIASELAYGGAVRSAYPITAFPAAVPRLAPVTFVPIDGHDEA
                     SLDKSRFNRVEAQWIVRFLQRIARCSAMEPTQVGVICLYRAQAAIIQHLANASDNAEL
                     GHRPRISAAKIESSRWSMASVKISTIDAFQGGERKLIVLSTVCSCRSQGRQLLDSLER
                     VNVALTRASHHLIITGHRLTLTSNPIWRRVLEHCEPLPPSLAGTALNTLDH"
     misc_feature    277596..280430
                     /note="possible transcribed region"
     gene            <282701..>283255
                     /locus_tag="CYME_CMN108C"
                     /db_xref="GeneID:16995337"
     mRNA            <282701..>283255
                     /locus_tag="CYME_CMN108C"
                     /product="similar to 60S ribosomal subunit biogenesis
                     protein Nip7p"
                     /transcript_id="XM_005537203.1"
                     /db_xref="GeneID:16995337"
     CDS             282701..283255
                     /locus_tag="CYME_CMN108C"
                     /codon_start=1
                     /product="similar to 60S ribosomal subunit biogenesis
                     protein Nip7p"
                     /protein_id="XP_005537260.1"
                     /db_xref="GeneID:16995337"
                     /translation="MRPLTEDQTRLVFEKLARYMGKNIKLLLDRPDEEHCFRLHKNRV
                     YYAPVRLIRQATRVPKDDLICFGVCVGKFTHSGKFRVEVTFLDYLGNYALGKVWLKKS
                     SEMSFLYGNHVVKGGVARFTEGAVKNQAVVVYNEDDIPLGFGVMARSVVECGMAGPED
                     LVVLNQADLGMYLREEGTLSAAAS"
     gene            <284980..>285717
                     /locus_tag="CYME_CMN109C"
                     /db_xref="GeneID:16995338"
     mRNA            <284980..>285717
                     /locus_tag="CYME_CMN109C"
                     /product="similar to AhpC/TSA family protein"
                     /transcript_id="XM_005537204.1"
                     /db_xref="GeneID:16995338"
     CDS             284980..285717
                     /locus_tag="CYME_CMN109C"
                     /codon_start=1
                     /product="similar to AhpC/TSA family protein"
                     /protein_id="XP_005537261.1"
                     /db_xref="GeneID:16995338"
                     /translation="MNAFVIVSLRLHSALAVRVSTHTCQPPASTFTGGSSARWVQSLR
                     RPFAANRPCLHDPSARPAIGATRRHPTSRREYTNTHMMIKVGDKFPSGTFGIMKNGAP
                     SEITTDEVFKGQTVVICGVPGAFTGTCNARHLPGYVNLADKFHELGAKVACLATNDAF
                     VMDAWMKMRNAEGKVIPLSDGDASLLRQMGLTFDTAKFGGVRAVRFSMIVQDGIVKAL
                     NVEQGGAFTEKSAAETALEQLKALKSA"
     gene            complement(<286092..>287399)
                     /locus_tag="CYME_CMN110C"
                     /db_xref="GeneID:16995339"
     mRNA            complement(<286092..>287399)
                     /locus_tag="CYME_CMN110C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537205.1"
                     /db_xref="GeneID:16995339"
     CDS             complement(286092..287399)
                     /locus_tag="CYME_CMN110C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537262.1"
                     /db_xref="GeneID:16995339"
                     /translation="MAFQWTGALAQPGARFLRQSFSGCWLQSRLRDRAACAPGRRRGT
                     GVEANVRHCFRVRRENGLRRPAALVGCSTSSEELHTRNVERAWHENRHQLSTGERART
                     VLHVCATGTLCTASFKHGGHPFGTHVDFILDEWGRPIFLLAKNAAHSINLRHDPRCSL
                     FAQPRDSSGQGGQRATLVGELYELEGSELEEYAYRYIERFPHAEQALSYPEFRFYRME
                     VQDVYYVGGFGVTATWVDVEEYRNAKPDPLALDAPTLLVRLNREHKEELLRFCRVFLD
                     IEPLDCSIVSLDRLGFDLRVRLCPCEEDAEPSRPDRAANGAQQRNVSSSSNGRASELR
                     DKRVSGSESSADPDCNEYREYRVAFREPVGNTFDVRSELVKTMQEAWEIENGLEDLWI
                     RPFGRRPTVLYYDQESRKVRSIQQEREEAEIVRRRELQVNADL"
     gene            <288813..>290087
                     /locus_tag="CYME_CMN111C"
                     /db_xref="GeneID:16995333"
     mRNA            <288813..>290087
                     /locus_tag="CYME_CMN111C"
                     /product="similar to protein disulfide isomerase-related
                     protein P5 precursor"
                     /transcript_id="XM_005537206.1"
                     /db_xref="GeneID:16995333"
     CDS             288813..290087
                     /locus_tag="CYME_CMN111C"
                     /codon_start=1
                     /product="similar to protein disulfide isomerase-related
                     protein P5 precursor"
                     /protein_id="XP_005537263.1"
                     /db_xref="GeneID:16995333"
                     /translation="MLWCSSPDRLRCIHRHFLWHLLTLSLSIIQGFAVSRALYADHSP
                     VVRLTDDNFRRLVLDSSETWLVEFYAPWCGHCRSLAPNWEKAARRLNGLVRVGAVDCE
                     QNRALAQEYNIQAFPTIKLFTGRKRTTERRQPLDYHGGRSLKDIVRFARRSLVGYVHT
                     VDPSGVDAFLREESSKGHVLLVTTNQRTSAIYRALSERHVDRALFGVMRLAAHDEASM
                     SALLKRLGAQPRLPAVIGVPAGADLDSNTVLVLNDREKMSIRALDDLVRQLVNKTNRQ
                     PTTKPTATANIEKRSSTTAQAAGNSWHDLFGNECTARDSVRLCVILAQPELEKLVDAL
                     NEKYVHDGVHVAMREARVLRSRLKLAPNTLALVIRPRKQRIAVLEHDVVNALPAADGI
                     SAFIDRALGGDLRYRPLSDLLEPSTDATRDEL"
     gene            complement(<290946..>291290)
                     /locus_tag="CYME_CMN112C"
                     /db_xref="GeneID:16995334"
     mRNA            complement(<290946..>291290)
                     /locus_tag="CYME_CMN112C"
                     /product="mitochondrial ribosomal protein L23 precursor"
                     /transcript_id="XM_005537207.1"
                     /db_xref="GeneID:16995334"
     CDS             complement(290946..291290)
                     /locus_tag="CYME_CMN112C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L23 precursor"
                     /protein_id="XP_005537264.1"
                     /db_xref="GeneID:16995334"
                     /translation="MPPRLYFPNFNLRLRFEPALRAEQKQLSKSTADTFRTRFIKLKT
                     VPSLTRVEIKQILEKLYGLPVERVNTLNVYGKRRRYLGRYDWRDQDFKYAYVRLAEEA
                     EVPRDPRPPSSG"
     gene            complement(<294445..>296703)
                     /locus_tag="CYME_CMN113C"
                     /db_xref="GeneID:16995331"
     mRNA            complement(<294445..>296703)
                     /locus_tag="CYME_CMN113C"
                     /product="cullin 4"
                     /transcript_id="XM_005537208.1"
                     /db_xref="GeneID:16995331"
     CDS             complement(294445..296703)
                     /locus_tag="CYME_CMN113C"
                     /codon_start=1
                     /product="cullin 4"
                     /protein_id="XP_005537265.1"
                     /db_xref="GeneID:16995331"
                     /translation="MESNQRAPKKLIIRPLRREPKLPQEFYQESWTHLARALDQVFSP
                     SSRRPLSYEEHYRRVEDLCLHHLAKQLYADLQREVDGYLERVFREQLSDPVLAAMLHV
                     AQGSAQAVEPTERPAFAPVLDVWRAFCERFRDIQAIFLYLDRTYAAESPQVPSLWEMA
                     LELFAKHMLAEQQRVLLPTLGAVLLEIELDRKGKQRGDCSDLRAILREMFAPLGFYRT
                     HFEPLFFQQTRAFYVAKGTEFVTQGTLSDYLAYFEHSTQAEAERCRLHLEPSTEKPLF
                     AILHDVLGRHCVSVMMDRGLESLLDAVSLTDLRRLYVLLRSIDELWRLVPRYSDYIRV
                     RGTQIVNDRARDHEMIERLLALLDRAEQTEREAFQADVRFHNAAQTAFEAALNTRQPT
                     PAERLARSFHDLLRVSSTSIPEPDIRRKIGKLLELFRYLSGKDSFLAFYKKYLAQRLL
                     FDLTASTACEQYVVELLRAECGAVYVNHLVNMLKDMDLSQDLLQEYRMGPGSGSSRLP
                     SFTCKVITQAYWNSSESFLLQVPPGLESQQRSFHRFYHARFSGRRLIWEPSLSSAELR
                     VQFANGEKVLHVTLSQAVVLLLFNERDAWTLAELQQQTGIADSAELERILDSLSSSQC
                     PVLIRERGAEAASSGPVTAPARYRFNADLQTSRRRLRLLDIALLERPPEQVPSGPVAS
                     PDRQHQIDAAIVRLLKKQKSLSHADLVQQLGAELCFGPSVSDVKQRVESLLQREYIGR
                     DERDPNLYHYVS"
     gene            296857..298900
                     /locus_tag="CYME_CMN114T"
                     /db_xref="GeneID:16995332"
     misc_RNA        296857..298900
                     /locus_tag="CYME_CMN114T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461473.1"
                     /db_xref="GeneID:16995332"
     gene            complement(<299459..>301621)
                     /locus_tag="CYME_CMN115C"
                     /db_xref="GeneID:16995335"
     mRNA            complement(<299459..>301621)
                     /locus_tag="CYME_CMN115C"
                     /product="similar to Na+-driven multidrug efflux pump"
                     /transcript_id="XM_005537209.1"
                     /db_xref="GeneID:16995335"
     CDS             complement(299459..301621)
                     /locus_tag="CYME_CMN115C"
                     /codon_start=1
                     /product="similar to Na+-driven multidrug efflux pump"
                     /protein_id="XP_005537266.1"
                     /db_xref="GeneID:16995335"
                     /translation="MGFFTSLYGGRKLRAAFATSCSDPCTSTLASASRTYLSCQQGNL
                     KRPQGSSYAGLRCGFHPCSRWACLRGCSSGSQWLAPARSGHQQRLGRAQHGDLNWNPS
                     RRRGAWTGLAQSGLLRRPWRASHSPSSIRERAHAQTAVVLRFLRSTLQQLVGSSPLDK
                     EISRLALPALGALALDPLMTLVDTLFVARIPRSWTATVWTPDPAPLAGVGVSTMVFNF
                     SIILFQALAIATTPIVARAGAAGNHAEASRALARGLWLACSLGLVLAVTIFLGCPWLL
                     GKLGASGSVLQYGVAYIRTRTLAMPFVVGSMVLSGAFRGYRDTATPFRISLATNVLNF
                     FGDALLIFPLRLHVIGAAAATALAQILTFCCMFLVLTRRRPGTAPVPPQAHGPQPRYL
                     VHRSWTGTLERFQHWLFAQSPAAGILDCRDLRRPPSWAQIRPLLSAGGLVTIRTVSIL
                     VTLTYATSTTAYYGGPVASSAFEVLRQVWVMTAMLCDSLSVAAQSMVASALGGARLLT
                     EKDCVALGVPLDAEVQDPSDVARIQARLAANRIVQLSLRVGLLFGVLWWSPLGHQLIP
                     HIFSPNAAVREATRQGTRVIALMAPLNAITWALDGVAIGAMDYAYIAKAIFCASASSL
                     LALEFIRRQFAAALTCGKTLSAQHVVVQVWHGLNMLMVGRATAMLLRFLMPQSRLPPL
                     RALLKPSKANSEPGGIQPEVEESSGRARNAAAQRDASH"
     gene            <302940..>303839
                     /locus_tag="CYME_CMN116C"
                     /db_xref="GeneID:16995336"
     mRNA            <302940..>303839
                     /locus_tag="CYME_CMN116C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537210.1"
                     /db_xref="GeneID:16995336"
     CDS             302940..303839
                     /locus_tag="CYME_CMN116C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537267.1"
                     /db_xref="GeneID:16995336"
                     /translation="MFALEELPRIPDFTERAICELFELYASIESVQLPPQSSDATNSS
                     SATAPGNIFSAERGPRYLGPRALVRFFTELGVDMRSLAALAFAWLGRWQYPCHCREEG
                     FARGVRYALWALDRRQHNEPRRWEQVQATCSTLLETSIWPRESTALFERLRSAFPDAV
                     LSYTQRSAEAALDFYLFAFDLNRQSPYRRSLSLTDARYLWKQFLSESCYLATPASPGT
                     PAGVANQPWRYLEHFDAYLESRCGMAGTIISRDTWYWVLMFARETQVAGSSFFANYNQ
                     GDAWPVLLDGFVEYLRENKLLSS"
     misc_feature    306009..307966
                     /note="possible transcribed region"
     gene            complement(<306200..>308263)
                     /locus_tag="CYME_CMN118C"
                     /db_xref="GeneID:16995345"
     mRNA            complement(<306200..>308263)
                     /locus_tag="CYME_CMN118C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537211.1"
                     /db_xref="GeneID:16995345"
     CDS             complement(306200..308263)
                     /locus_tag="CYME_CMN118C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537268.1"
                     /db_xref="GeneID:16995345"
                     /translation="MGSDLGASRAAASLYAGRAASGHRRRARHHAEAMQPRQRLWSER
                     RLPAPKSNGSVQTGPQSTRERKKSLLGVEDRATEAVSGKQRRLLPGTLGLAVLVFFAS
                     RGLWRWGSRRRQRRRAGREGAEARSHERRRSSQGEISVVEPAPVTAPSLPELPQRDPL
                     SMLVEATAQDVDASALHVSSHEEPPVSAQPAPPAPEPKLPSKARLPVTNSEKRNPGVV
                     SAFLSLGRIVTGGASNRAHRQNERAKTTKAADRAETATPVSEKNASAAAVESAAAPVA
                     RDAERLPTVELAGVIAEDARSCPAATNENATTGSVPGESEVSNGSRASNASTDANTKA
                     AGERPPLAQVPQSATESRSGPQLRIQSAHPLYSMVRASQLLAAARALELELYGEQALV
                     RDIFAEKLAGARFMAAQRERARTSTTDQLSRIPVRTRYFDDFLMRCLFGKEQGSASNE
                     PPPRQVVILGAGLDMRAYRLDIPRDTVVYELDMPVVLEYKLRILRNDFPSYKPKSLVK
                     YVPSDLTKDWKQDLLAAGFDPGNSSVWLLEGLTYYLPESLCRALFSDMRSLMPVGRAS
                     WTGASFVQEALVRKLQARTASTPRTSEESTEETLQSGELPQRPGLEAHSSRKRATPSN
                     NHKQSENSHTRQTLVFGTDDPEGFLKSFGLYTTTIVYLGEKGANYGRFAKPFRHTMYV
                     IAFAG"
     gene            complement(308705..309790)
                     /locus_tag="CYME_CMN119T"
                     /db_xref="GeneID:16995346"
     misc_RNA        complement(308705..309790)
                     /locus_tag="CYME_CMN119T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461474.1"
                     /db_xref="GeneID:16995346"
     gene            <310128..>310796
                     /locus_tag="CYME_CMN120C"
                     /db_xref="GeneID:16995360"
     mRNA            <310128..>310796
                     /locus_tag="CYME_CMN120C"
                     /product="similar to vacuolar protein sorting-associated
                     protein VPS28"
                     /transcript_id="XM_005537212.1"
                     /db_xref="GeneID:16995360"
     CDS             310128..310796
                     /locus_tag="CYME_CMN120C"
                     /codon_start=1
                     /product="similar to vacuolar protein sorting-associated
                     protein VPS28"
                     /protein_id="XP_005537269.1"
                     /db_xref="GeneID:16995360"
                     /translation="MQRFLDSISAATQAKSPAEHETLVAMADLYAIITCVEYLERAWR
                     ANAVSDEDYTRNCSRLIAQFRATRQLVMDDVPSVISFLEEYHLAARAAMNRLQVGVPA
                     TVEHANSSDETRRRNFTAAAIQATEAFLTFRDALELGERSVDRLLPYLREILLVLGRM
                     GAVFGTADGDATVQRERIVQWVRRLDAMHAYEQITEEDKRQLAHDVDTLYDTFRRRVG
                     ELEM"
     gene            complement(<311033..>312256)
                     /locus_tag="CYME_CMN121C"
                     /db_xref="GeneID:16995361"
     mRNA            complement(<311033..>312256)
                     /locus_tag="CYME_CMN121C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537213.1"
                     /db_xref="GeneID:16995361"
     CDS             complement(311033..312256)
                     /locus_tag="CYME_CMN121C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537270.1"
                     /db_xref="GeneID:16995361"
                     /translation="MTSAPADSFGGEHSKTFVSTLAGSSGAAPAPLFAETGALVSGFD
                     LSREAEQRERPLWAQLFDQPATTYGFTDVDPFLLPEGAVLVPFETLEKPRHVAEGEAP
                     RPEALHLYGVDRLSTRDLKRYFVENECIEPSWIEWINDSSCNAVFADEHTANWVLARL
                     SIGPPMEPDVLRAEEERWLGIQQSSMAEHQRREETAQHDPELKKDAAEVEAPVSRMND
                     DAEQPSMLAATEPQQPLQDAAASASNEHSPKQGALTAPPASATNLKPETGSVFMPAAD
                     PLLWWRPARPFPSSHNTWLPLRIRRATVVDVRPERPNPQSAWSRSVRQPRKQQRRRSY
                     PEESRKRVPRERRFSAAGAAGRIQGRIQKGHRRHPGKARRPLRSSISRADALESSAKQ
                     RESKPSQHAREDASL"
     misc_feature    complement(313138..314542)
                     /note="possible transcribed region"
     gene            <315161..>321277
                     /locus_tag="CYME_CMN123C"
                     /db_xref="GeneID:16995358"
     mRNA            <315161..>321277
                     /locus_tag="CYME_CMN123C"
                     /product="eIF-2alpha kinase GCN2"
                     /transcript_id="XM_005537214.1"
                     /db_xref="GeneID:16995358"
     CDS             315161..321277
                     /locus_tag="CYME_CMN123C"
                     /codon_start=1
                     /product="eIF-2alpha kinase GCN2"
                     /protein_id="XP_005537271.1"
                     /db_xref="GeneID:16995358"
                     /translation="MGAAEARSEELEALQAIYGSELRILSDDDELHFEVDVHVASANQ
                     PANDALGVRLRFHLPQGYPSGGWRARARVGVSAGPASTQKWSLSPNDLEVLRRKIQSL
                     CEEAARARTSVGYEVVELARTFLREYLEASHDLGEAGTIVRPLHEAMLEREQRQFEEQ
                     ERAELERTAQQRERLERLQQQREEAERLQTLEALAAEERLARKLQYQRMAESSTAVDE
                     DGHCTAEGGSGIATNAHPWDVPPSWTILEALRETLQQQSERRVARDLDDVSIWSGHQD
                     DLDAERSEHSDGDATAQPAAAYERVSSVAAWEAASYGVSQGIRSSWLSLGSLRTSSSS
                     PSSSLSHSMRSASSDDSSIAVAEFPRALRKGKHPSQSASVSGSPSTSENTGIFADWCW
                     THSKPHRSSACGTSTDASSASKSGCSASASTKTSPAQQTLPGTAAKSGSERARRSRRR
                     RSRRHHHHHHDRVPSSTYTVQQEHQQQVLKWFLESLCAQMTPDEAAAACARWHRKLGI
                     VLERSAAAASASEDCDDDRIQGIPSAPLMIQLNDDRDVDGSVTNLLSFGEALTRKAPD
                     RLEATVKRVLGSTAWHYCRQFVHGERFRKTSHGRAQQSLQSGQEKERKAPLSLTSHTH
                     AQHTLQFGHGEERRHRSLLQGNVPPAGTRKRTSRFETDFDMLELLGRGGFGAVVKVRQ
                     RLDGRIYAVKIVPLHRKDLEDPRILRETTTLSRLAHPRCVRYYGCWVEPIDVLRFSEA
                     LSSARTGAQDSQRALGAASAANTSAAQYQAQQQQQQPSLSLASLVLREQLSYSMPSSD
                     TTGATSAGPESSSAIVAFLFIQMEYCPRTLRAFIDQDLDAGTDLWQVFRQIVEGVEYL
                     HSLMLIHRDLKPTNIFVGGPRVSSSPSQGTLGDRLSHTWTETESISIKIGDFGLATTL
                     SVASLRRAPGAAEATNARGTADAASADGAGETSAALELTRSVGTAFYRAPELSMRPAS
                     NEQDTEQPISSSPTYDTKVDIYALGVILFELFYGPMQRTAATAAPGCKTSGDGSSSVT
                     EHERFVILTNLRERLQVPAAFAEKLPRQTRLIRLLMAKNPDERPSAKQLLKMLPVKVE
                     HEYWSELLQAVADPVSTVDRRLRTRVIGALFEGALRGAAPLVRKRDIHQAPGESSHAS
                     SGAAHGIVHSCLEASPVAWNCLHQAVAVLQRHQSVAFVLQHHVDASVLDSRIANGLRR
                     VNTTEAHRTRHQLGSNGTGGVESAQRLVRAGTEGVAGYSQAAAAGRRAATPVLLPTGE
                     YVWLPAERFHDFLEQWMSSSAAVEALTRASIAPPLRFHRVATVWGWRSLDAPRSFDDP
                     LAGCAYLEALFEAPGLSKSAPANIRSGERLVQRRSGAMSAAASVHVSSSSSSSSLACR
                     VRSNESSMQASRSSSMGTVASDEQLHGAASALWWHSTSAERHELFATTLLEFDELQLK
                     LRRRRWRRRRRQRQRRGQETTSALLLVDAELLFMATSLLWPYCPSTGPMKLVSTAEQR
                     TSGTSTSTGRRGSKARQRQNRRGTHSASTGAASASASAASGSASVSTTSVEKVLIRIG
                     HTGLTRALTRALLTGSSSSSSSSSSCSNSNVYRALEYEDVGDQAGALAQLRAALHQHL
                     RLGWNGLLRLLATATEHPWNKPSAQTARRHAEQLVHACQQLAPLSMLQQLATSTAVLV
                     TGGQAAFVQAALVQLERVLCQWALLLDHGEWLAPFGVSLEAAATTTTTTATATVVVAR
                     DAADTPGMSKAPVAQPWPPQGPVRVLVDPFLWPVGAASLERFTSSDQVCFEASLITTG
                     ETGTRHVRPVLWGGHWQRGFRAPQPAPASAATKASKGLSMPAPLTLPELYGCGFVVDL
                     SLLAAVATMGLTSSLDLSSRLLASVYVGMLRESTATTVARAASASVMYLVLLGHLWRQ
                     GWCCIPDDNDDDDDNHGDEVDDNNVGDEDDHHDDDDDDDEHSGNDTHGLAGRSLHEHL
                     QRAGARSCRFLVLIRAHDASVLVRECLVATSGAEGDSLSGTGRLEKARQVWFPLEQAG
                     QYTNVAQRVAQTLHDLLQRQDR"
     gene            complement(<321719..>323113)
                     /locus_tag="CYME_CMN124C"
                     /db_xref="GeneID:16995359"
     mRNA            complement(<321719..>323113)
                     /locus_tag="CYME_CMN124C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537215.1"
                     /db_xref="GeneID:16995359"
     CDS             complement(321719..323113)
                     /locus_tag="CYME_CMN124C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537272.1"
                     /db_xref="GeneID:16995359"
                     /translation="MSRTVPWRLPQLRGTNLLLQDLIEIPSNNGAEVPFESSAKRRPR
                     WSLVQRSAAGEAAPETAAKDPFTTLPVELRLRILYHLFVDVDDSFNCDDNHPQSECIV
                     PSAVESRRATERLWLAQRSVYALVSAYPTWAEVLERGQGSCGKRGACAAACETLPYAR
                     WSSFWTTLAAQVFGCSLSRALYTVRSWSRIGGTRVRAGLGRSPAKLAQDGLLRYHEPC
                     HCCGVRQSEPDLFYIWDAWCIAMATDTSSPPCRDCPAQRALCFPVCRSCFLGGADSAG
                     DAREAPSPAAPDDWIHETALADHAYAQHSLARPHWCRSMSAHFGLRQSAVASVSSFAN
                     QPAFITKQQREPAAVAQARRTALVQLLKQHRDGRSDMGYTYAKARDQVHLFFLLVAGN
                     QSATKGSVVSNRSVRELHWDLNDFREYFRSKRALYRVVSDAALPETSSRSSTQLPLIN
                     QRDLLTWVRRQRQT"
     gene            <326455..>326925
                     /locus_tag="CYME_CMN125C"
                     /db_xref="GeneID:16995355"
     mRNA            <326455..>326925
                     /locus_tag="CYME_CMN125C"
                     /product="40S ribosomal protein S27A, ubiquitin fusion
                     protein"
                     /transcript_id="XM_005537216.1"
                     /db_xref="GeneID:16995355"
     CDS             326455..326925
                     /locus_tag="CYME_CMN125C"
                     /codon_start=1
                     /product="40S ribosomal protein S27A, ubiquitin fusion
                     protein"
                     /protein_id="XP_005537273.1"
                     /db_xref="GeneID:16995355"
                     /translation="MRRQLLVQCPNGRIVSTNVLATDSLAVVLSRVTGLDADAVYGTV
                     AGGRPVATLRDALVNFTDPEAPIVIQAHVRVLGGGKKRKKKTYTTPKKIKHKHKKVKL
                     ATLKYYAVDDANKVTRLRKECPNESCGAGVFMAQHRDRIYCGKCGLTYVQEDNA"
     gene            complement(<327170..>327568)
                     /locus_tag="CYME_CMN126C"
                     /db_xref="GeneID:16995356"
     mRNA            complement(<327170..>327568)
                     /locus_tag="CYME_CMN126C"
                     /product="40S ribosomal protein S26"
                     /transcript_id="XM_005537217.1"
                     /db_xref="GeneID:16995356"
     CDS             complement(327170..327568)
                     /locus_tag="CYME_CMN126C"
                     /codon_start=1
                     /product="40S ribosomal protein S26"
                     /protein_id="XP_005537274.1"
                     /db_xref="GeneID:16995356"
                     /translation="MVKKRRNHGRKGGCHGRGKARPVICDGCGGRPRKDKAIQRFVVK
                     NLVEASALRDLAEASCIENYVLPKQYMKIRYCVSCAVHRRTVRVRPKEERRVRTIPRA
                     PRRGDRDVEGILLGTRTEAGAGRPPGERRA"
     gene            <327826..>328383
                     /locus_tag="CYME_CMN127C"
                     /db_xref="GeneID:16995353"
     mRNA            <327826..>328383
                     /locus_tag="CYME_CMN127C"
                     /product="mitochondrial F-type ATPase F1 subunit delta,
                     precursor"
                     /transcript_id="XM_005537218.1"
                     /db_xref="GeneID:16995353"
     CDS             327826..328383
                     /locus_tag="CYME_CMN127C"
                     /codon_start=1
                     /product="mitochondrial F-type ATPase F1 subunit delta,
                     precursor"
                     /protein_id="XP_005537275.1"
                     /db_xref="GeneID:16995353"
                     /translation="MNKWLRPALRTTLRLWRRQWSAEATSGASVSTGASSPSSEEAGR
                     VTLNFFCPHQVIAKNRQVVSVIVPAASGLMGILPNHVPTVAQMRPGVVTIIGDGGAEE
                     RYFVSSGFTFVHPDRTDICAVEAVRVSDIDPEEVSKALADCEAKLASSSSSAAAGTAE
                     AQRAAVAQIGVDVYLAMQGVVSGTR"
     gene            complement(<329462..>330340)
                     /locus_tag="CYME_CMN128C"
                     /db_xref="GeneID:16995354"
     mRNA            complement(<329462..>330340)
                     /locus_tag="CYME_CMN128C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537219.1"
                     /db_xref="GeneID:16995354"
     CDS             complement(329462..330340)
                     /locus_tag="CYME_CMN128C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537276.1"
                     /db_xref="GeneID:16995354"
                     /translation="MDLAFTTIFSAVPRAFHRQAVGDRLPRHLITTSVRRVRERRTSC
                     WWRSLRLQGRSASGADPSRPAHAAREPDEDIDESFSPDIGDSGESPNSLDVTRVSAAL
                     YRLGAVAWWAQLLLSIVAGGITLFAVAILQGTRGAGTTTTTAASTGLIFAGIGLVFAF
                     ISVFWAYGYIRLARRLMRAGKMGYGIRSENIFRTLRIGVFINILGMALTLIGAQSISG
                     VLLAKALSQGVAGPLPFYATGSIQAGGGTVGYVQALDIFVVQANTNALLSHFVGLCVA
                     LWMLWRFRGSYQRRTS"
     misc_feature    complement(332119..332868)
                     /note="possible transcribed region"
     gene            <333288..>336362
                     /locus_tag="CYME_CMN129C"
                     /db_xref="GeneID:16995187"
     mRNA            <333288..>336362
                     /locus_tag="CYME_CMN129C"
                     /product="fusion protein of aspartate kinase and
                     homoserine dehydrogenase"
                     /transcript_id="XM_005537220.1"
                     /db_xref="GeneID:16995187"
     CDS             333288..336362
                     /locus_tag="CYME_CMN129C"
                     /codon_start=1
                     /product="fusion protein of aspartate kinase and
                     homoserine dehydrogenase"
                     /protein_id="XP_005537277.1"
                     /db_xref="GeneID:16995187"
                     /translation="MGNVRRLENSSTEHRLWSALGFTAPINDRFRLRVASPRDSCGWK
                     RSPWTPAVSLTRSPRRPRRGTLTTLCPVATAAANKRGQASSPKMNNFGKDGGRSAGAS
                     LEGTGAFSPLDRHYGGVHYLVHKFGGSSLADAPCFEQVVSVLEKELAAETAALRQLAE
                     AAGREALPCRLFVVVSAVSGVTNTLEHALQCAIERNKDEHYLEVLQKLQERHETLAHA
                     LLDSNEAKQPFFAMLSSTMQDLKDLLRAAFISRSASSAVKDLVLGYGELWSAQLMWAR
                     LRQQQRLHVAAGQNTPGSVVWLDARNVIAVRRIPTMPSERKSVDWDMTQKLFDEWMSQ
                     HAGSGLVVATGFLALDADRRVPTTLGRNGSDFSAAIFARLVRSPTCTIWTDVDGVFSA
                     DPRCVPDAIIIPQLSFKEAAELAYFGAKVLHPDTLTPVVISGTPVRIRNTFRPDAGGT
                     EILPSARMLAGEAALDAANQVNGSIGVAHSFASLAARKAAMGITAGVKGFTSVRDISI
                     VNVEGAGMIGVPGIASRAFAALYAANVSVVLIAQASSEFSICVAVPGTDGTTATEALR
                     RAFRIEIEDQIINSVELLADCCILAMVGENMQNTPGVSSRLFTALANAGVNIRAIAQG
                     SSEHNISVVIQAGDEVRALRAAHAAFYLGDYTISVGIIGRGLVGSTLIEQMREQRAKL
                     HDQYGVDFRIRAIASSSRMWLLSSGENFDEFSAPGRNWMDDFEKRAETLDLDRFVGHV
                     NDGTLPHAVLVDCTASGEIGAKYASWLRAGLHLVTPNKKANSASMEYYREIRDAMRAR
                     NTHFFYEANVGAGLPIISTVRDLLRTGDSFLSIEGIFSGTLSYIFNCFDGSTPFSRIV
                     QQAKELGYTEPDPREDLAGADVARKVVILGREVGLDIELDQISVQSLVPAALDASQGV
                     SVAEFMERLPEFDDELNRQVQEASSRDQVLRYVGVVDVQNRRCAVELRAYPRSHPFGG
                     LEGSDNIVCFRTVRYDAQPLVVRGPGAGAQVTAAGVFADLLRLAGHFGAPSG"
     gene            complement(<337057..>342507)
                     /locus_tag="CYME_CMN130C"
                     /db_xref="GeneID:16995352"
     mRNA            complement(<337057..>342507)
                     /locus_tag="CYME_CMN130C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537221.1"
                     /db_xref="GeneID:16995352"
     CDS             complement(337057..342507)
                     /locus_tag="CYME_CMN130C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537278.1"
                     /db_xref="GeneID:16995352"
                     /translation="MTYKAASTTEFDVRTSDEALPRFTSAASEAVGGDYQPLDLDRVL
                     PQKEQYHVEGEPAVFEAPAADGPEVFGTTYDLLQTEECEVDEEFGALVTALDDTEREL
                     FHVDADAVLERFTALQEDLPATDEQPVHPGLETLTLEQRYGLGAFLVTLIAEKERELR
                     HDDGLVMSTLPSVVTSADAPQCDVDGDQAPAAATQEHRTATSPSKRILERDLPTSNAI
                     EVDRPGAGDRAPVSIEGHSPAPEPHERPSTASTERQSASSRRPALRNLPAYDTSFAER
                     YVQLLLSGLGLTCSQREALMYLWRACLEGELIPAQRCALVASTAALVGAPAVRFAALQ
                     AMLTLSLAPGGYDARCRVFLRDAARELQIPWRKMALVEYAIAALLQQQQQQQQRIRGV
                     TLDAASILSPSTLGQPEESRAPTCPELNGGNVDPQIYATLAKKRYKRKSRRRAFKIAA
                     MAIGGGALFGLAGALAAPLLLPALVGIGITGASALAATGTVASGAVVGSFFGGLGAGY
                     VGHKARKRTRMRLTEFELEPLGIEEAARSWHQQHTKAAKTTALSGEAAAPPSTPRYDI
                     AVGAAHVSSPVQGESASHGPGWTEAEQQLAAAIRESLQVSEQRALPHQHLRALDNGER
                     VRLTAGMYTGSGSSSPCRPTPVSFDAANGVETLQLTALDDDADGKSSEHWGESTMESA
                     AQRGARYPAADTSEQVESLETSRSSPSSLSRANSSSPRESAVQQQRAHLHHSIQQSTT
                     ELGARMSGAIEATRDAPAEKLDVKRSATVQVPESAMEETIDTVDDASVPVPDPVTFQE
                     RQQTQRQHIDDSDLARNTLFADKSHRLRLPEEPSPQQPQLPFASIRTLKSSSHPGGLA
                     PAPMLPEPPTRGTAPLVAASNEDTTGFSGESVGALSTTSLRTASGQGFRHATPASILE
                     KRLAERTWTLRPLHPTTEAHRDDAAATEKASGTSAASDGGAGGAGGAGNQGLTRAIAT
                     DAATADDIDSAAVPSSTHETQSGTEDNGAAELVKQEHPLMATRMVRSRGLHLVIFVPG
                     WLTRSRQEGACASQFYSALGNGRLLPYAERYALRWEPDQLFEMGRAFLKFWTTKAATT
                     AAQQAAPHVLQAVSFAAGTLLSSIAWPLFVYSAADIVDGPWSVLLNRANAAGDALADL
                     LALREQGQRPVTLIGYSHGARVVFKCLEALADAGVYGVVDDAFLVGAPCTGDSRRWQR
                     ASRAVSGRLVNAYCGTDWALALFHRGSSGQFRVAGLSPIRGCGERVENVNLALLGLEG
                     HRSLREALPRILTALGVETGGLSFPPILPRDVALLGETDAPSLKRPPRGVSTSATTAG
                     TSDAATIDEVSSGNAEARRKGALFDRHRHSRRRDEMRFGADQRGRLSKRELYEQDEDD
                     RQLSLDEDAHLHLLRSSTEGSVPASVAKQYSGKAAVSRTYGSMVQQSALPLIDIETSS
                     DLSSEERGSGSAPQTRPLLPSTRGTWGGSASAFPSRAGSSDSLSGYHDRESGCEEAGR
                     TLSGVFAPGTTAAGAAVAVAGGGGGDVAHAASENTSPAVQSSVDAASASTCSADWTEF
                     VGVAPNQTEDQPKALVHALGIEVAGGRFLPLIEAGTCFPCERTVTVTTCVDRQDAIAF
                     FIYQGSRLRLRPLGAKDAHRHHRLLKIVEFHGFKSPVRHRAGGARVELAFTLDEHGNL
                     EVSIRDVRGDAEETRCTIPSTMLVQRRDAFDSDTESNAADEVSFAELDDTLPGDHSEM
                     RFQREAASLSTLRPSERTAEYTAHAAEASATAPGTQWQTQGSSAEKAKRSKWWSWRRS
                     RRHRPHDHPCQPSASRPRAQDGYTTTTWHSGA"
     gene            <343280..>344668
                     /locus_tag="CYME_CMN131C"
                     /db_xref="GeneID:16995340"
     mRNA            <343280..>344668
                     /locus_tag="CYME_CMN131C"
                     /product="similar to monooxygenase"
                     /transcript_id="XM_005537222.1"
                     /db_xref="GeneID:16995340"
     CDS             343280..344668
                     /locus_tag="CYME_CMN131C"
                     /codon_start=1
                     /product="similar to monooxygenase"
                     /protein_id="XP_005537279.1"
                     /db_xref="GeneID:16995340"
                     /translation="MFQVLVVGASVGGLATAAQLQRRGVTNFQVIEATNRSARASASR
                     AVGLWTNAWQVLDALGIAAALRQASPWNTTEFWVQDLPTADLTAHACLRRFALPRGHE
                     FRRVPLQALTDALAASLPAEHLHYGMDMEQWLRQRAAVSEPASTPEMDRGREKLGLWE
                     SPAFPPDLFLVGADGARSVVRHRLVGDDRPLRDAGYVAHTGVAQLPLPGCNAEDPGNA
                     LGSVELTKPGRVLLLLGRGDGTRLGVQRINEHQVFWFYCENCGAASNQPANKSKELRM
                     LRGSETKQRAWERVSRSVARPHGVLWNALEQLFRETPAEAANTFACADLFPPVYDGTL
                     GFDDVPVALVGDAAHPITPNLSQGAGLALEDGWMLANLLADAYIRNGNRDEQQAEQRQ
                     EHWSARVRRKYRQRRRWRASVLALRSRATGAVLQLPLPSSTLVTIRNRILLPLALQPH
                     WFVSHANFSARG"
     gene            complement(<348990..>349553)
                     /locus_tag="CYME_CMN132C"
                     /db_xref="GeneID:16995341"
     mRNA            complement(<348990..>349553)
                     /locus_tag="CYME_CMN132C"
                     /product="box H/ACA snoRNP component NHP2"
                     /transcript_id="XM_005537223.1"
                     /db_xref="GeneID:16995341"
     CDS             complement(348990..349553)
                     /locus_tag="CYME_CMN132C"
                     /codon_start=1
                     /product="box H/ACA snoRNP component NHP2"
                     /protein_id="XP_005537280.1"
                     /db_xref="GeneID:16995341"
                     /translation="MPDKKRPRSALGSDTEDVGADCTLTAAVTEGHVFNQDQTADEVA
                     EELRQKLQCSVIAQPLAGRKLTKRILKLAKKLAGKKQLRRGVKEVVKSIRKGARGFCV
                     MAADVAPVDVIAHVPILCEETGIPYCFVPSRELLGKAAQLKRPTCVLFLPLIEDTDDE
                     EELKLQRKCWRDLATLQKSLDDVLREH"
     gene            349813..351543
                     /locus_tag="CYME_CMN133T"
                     /db_xref="GeneID:16995347"
     misc_RNA        349813..351543
                     /locus_tag="CYME_CMN133T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461475.1"
                     /db_xref="GeneID:16995347"
     gene            complement(<351019..>351984)
                     /locus_tag="CYME_CMN134C"
                     /db_xref="GeneID:16995348"
     mRNA            complement(<351019..>351984)
                     /locus_tag="CYME_CMN134C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537224.1"
                     /db_xref="GeneID:16995348"
     CDS             complement(351019..351984)
                     /locus_tag="CYME_CMN134C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537281.1"
                     /db_xref="GeneID:16995348"
                     /translation="MDASLPNVSDVAAPALTETENDSGVATPSSSVSAQKQGLETSLA
                     HVLEPLCAENSNTVTSKPDAWSSEEPPNTAKSAAVQNGEQQERELVQRVWSELCSMHK
                     SLDRAVRRGEASETTNDSFERAWRSMKRLKQPSRKSTSQLMRRETRWQALRRCQHPVD
                     ATGLDTATRTKDSAELDMLLGLTSSADASTSHPEVSDRRVRAAVVSNRQDPQTFSAPA
                     STLMKRLPKIAAERGRMHRPSTFALTQRQWERFKNEKGLSEELEHYKKSEQRYTDRLE
                     FLVQTDFREWAHEQAQKRRNKTESASGRSELGDTDAILSSSSDEM"
     misc_feature    352259..354170
                     /note="transposon"
     gene            complement(<354648..>354956)
                     /locus_tag="CYME_CMN136C"
                     /db_xref="GeneID:16995362"
     mRNA            complement(<354648..>354956)
                     /locus_tag="CYME_CMN136C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537225.1"
                     /db_xref="GeneID:16995362"
     CDS             complement(354648..354956)
                     /locus_tag="CYME_CMN136C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537282.1"
                     /db_xref="GeneID:16995362"
                     /translation="MPETRFQVLQLYRALLRACEGFADTNVRAYAKRRVQAGFRENRN
                     LQDPQRIDQLLEKAQKDLEMVRRQTTISKLYPPPPYVVEATTRAVRERGAADVSRELP
                     "
     gene            <356367..>357911
                     /locus_tag="CYME_CMN137C"
                     /db_xref="GeneID:16995363"
     mRNA            <356367..>357911
                     /locus_tag="CYME_CMN137C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537226.1"
                     /db_xref="GeneID:16995363"
     CDS             356367..357911
                     /locus_tag="CYME_CMN137C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537283.1"
                     /db_xref="GeneID:16995363"
                     /translation="MFSVLSRNTMHLPVFENAPGAGRARFLRKRLYKVRNVICTRRWP
                     LWLCSFLLIGLVFVLAPRVIRSGASLWEAPNLLHTTVGCPFMFLESNLTLTLNQSLKA
                     PNVSKTMFLAAIEVREQDQGYIAGIFRVRHPFAPHRTYNPSKDDWDISMVANSTLAAV
                     NFTANRLDQIQGGSARQLRLGSEQMHAVYSYGPEDPRIIRCGMRTLALFHQPDIRMFA
                     PMHQRFQYILDIERNELYWIDEPRALTHAGRDSPLVDKNYVPLCVNGDDLYIVTSFEP
                     LRVLGPCTLRKDQVFAQGVHAIAHRAHCPEAFNAFNSSNTFFRDSQIFRGSTQFEEII
                     PGRAYVSLVHARRCGIYDRCSYQAAIAVLVHLSSREWKAVYYPSLLKLYVPGGREKER
                     PRSGRRREHRCLLEQSRHAHQPYRLHVNLVENPVSIIRFEKDESALVSLNVNDEETLI
                     VRVPELYRYASSLARCILEERAEPLLPRISTLWKCSNGAVYATQENAVNSWHKIDPST
                     VARFQG"
     gene            complement(<358865..>360523)
                     /locus_tag="CYME_CMN138C"
                     /db_xref="GeneID:16995349"
     mRNA            complement(<358865..>360523)
                     /locus_tag="CYME_CMN138C"
                     /product="probable AAA protein spastin"
                     /transcript_id="XM_005537227.1"
                     /db_xref="GeneID:16995349"
     CDS             complement(358865..360523)
                     /locus_tag="CYME_CMN138C"
                     /codon_start=1
                     /product="probable AAA protein spastin"
                     /protein_id="XP_005537284.1"
                     /db_xref="GeneID:16995349"
                     /translation="MRETWPRSQPQSVPDSVTEPQVWECALLELEGEHVQLERWALQR
                     LPADAACWAVARRERARRQAVLRHATGLVEALLGSLLPDAESSTRLEVLTTSELVAFL
                     SDASVWQALSLPSNAVEATQDRTDGCAGESGVITSARLRHGFAAALQTRARTWHRDNA
                     GTPTDAPVASKGTAPERVSSEKTAFRSASGNALDEQQPAQKAPSRFSVPRRLGESAQP
                     TPSAKRSREPSSQGPAADGQRPDPNLPSVPNVEPALVETVMQEILDQSPGVNWDDIAG
                     LEYAKRCVMEAVVWPMVRPDLFRGIRGPPRGVLLFGPPGTGKTMIGRAIASLSGARFF
                     NISASSLMSKWVGESEKLVRALFGVARALQPSVIFIDEMDSMLSARSENDAESSRRIK
                     TEFLVQMDGAATNRDDRVLVIGASNRPQELDQAWRRRMARRLYIPLPDRQARRGMLQS
                     LLRDQKHALGEAELERIVDLLDGYSGSDVYAACAEAALGPVRDLGADIANVSVEQVRA
                     IHEDDFKRAAAVVRRSVSDDEVRAYERWNAEYGSFPYDPAPAAS"
     gene            <363016..>364002
                     /locus_tag="CYME_CMN139C"
                     /db_xref="GeneID:16995350"
     mRNA            <363016..>364002
                     /locus_tag="CYME_CMN139C"
                     /product="CDK-activating kinase"
                     /transcript_id="XM_005537228.1"
                     /db_xref="GeneID:16995350"
     CDS             363016..364002
                     /locus_tag="CYME_CMN139C"
                     /codon_start=1
                     /product="CDK-activating kinase"
                     /protein_id="XP_005537285.1"
                     /db_xref="GeneID:16995350"
                     /translation="MLQPVERYEKQRVLGQGTYGVVYLAIDRCTAQPVALKKVRLADY
                     TAGLSMTAWRELRLLPELGGHPNVIALLDVFSTKSSELYLVYEYCETDLEHLITERNL
                     MLSQGDIKSCLRQLLEGVAACHENWVLHRDLKPSNVLVTTDGVLKLADFGLARVYAEP
                     DLGTEGGRRMTHQVVTRWYRAPELLFGATAYGPAVDIWAVGCIFAELMRRVPFLPGQN
                     DLDQLGKIAATLGAPTPDQWPGVDALPAYLPFKSVQRQPLADLFRAAPPSAIDLLSRM
                     LALNPNERISARDALEHAFFHTGAAESDPRELMVRWRKAQAHRRAAKTERHS"
     misc_feature    complement(364436..365839)
                     /note="transposon"
     gene            complement(<366544..>368850)
                     /locus_tag="CYME_CMN141C"
                     /db_xref="GeneID:16995364"
     mRNA            complement(<366544..>368850)
                     /locus_tag="CYME_CMN141C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537229.1"
                     /db_xref="GeneID:16995364"
     CDS             complement(366544..368850)
                     /locus_tag="CYME_CMN141C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537286.1"
                     /db_xref="GeneID:16995364"
                     /translation="MDSNQNRSSSGLVEIISYTEEFHREDLLRFLHEHRLHERGLQYH
                     TVAVLGCQSSGKSTLLNCLFGTNFPTMDASIGRYQVTRGIWLGVDARSGEILVLDLEG
                     TDSRERGEGAASFERKAALFALALAQVLIINVWAQDIGRYNAANLALLRTVFEQDVAL
                     FHREAHRTRLLFVLRDHVNTPLALLEKTLLEDLERIWDSINKPSSVEGASLSTFFDVE
                     CTSLPHKELASGAFEQAAADLRDRFYKGASGIFHESYHRGIAADGFAVFCQQIWQVVR
                     ENRELDIPTEKEALARIRCEEIAQEAASTFDADAADLSAAYERVMMHYQERSARYVPV
                     VAAAKRKQLHDVLSLRAREAYRRRLQRHLETLAERFDHFVNDQLAVKTAAPERSAWKG
                     FMDRLQRQRSELETAWKDVAVIPQCFVEDECWSELLAELSQIYRDRLDAISEAAEHRL
                     ATLLLEEAAVLFSHRLQEPLWEVLDRASAEQEPEVFWNRVEQEVVERVRDESAQHLHR
                     ALISTGITAPEQEHHQQPGGQTQSACGDDALASNLLKLHRAQTMECVWRFLRNQAHSP
                     SALQLHLMKRFEDAFRFESSAHRIPRVWQASDDLRKIWLDALQHAMFLVVLLQHVHLN
                     GNESCLLGEAEVKLLRQGLEERAAMAYSEAVRAQQAARVHRQVPAWMLVLLVLLGWNE
                     FVAVLQRPFLLLSVLIVLGVVVTLGRLGLLVPARRLARVATGRLLAATIHSLREMGAP
                     GDWGVLQVPPASHASAASPNRAPKHHPE"
     gene            complement(369948..371658)
                     /locus_tag="CYME_CMN142T"
                     /db_xref="GeneID:16995365"
     misc_RNA        complement(369948..371658)
                     /locus_tag="CYME_CMN142T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461476.1"
                     /db_xref="GeneID:16995365"
     gene            <371219..>372304
                     /locus_tag="CYME_CMN143C"
                     /db_xref="GeneID:16995376"
     mRNA            <371219..>372304
                     /locus_tag="CYME_CMN143C"
                     /product="similar to t-SNARE SED5"
                     /transcript_id="XM_005537230.1"
                     /db_xref="GeneID:16995376"
     CDS             371219..372304
                     /locus_tag="CYME_CMN143C"
                     /codon_start=1
                     /product="similar to t-SNARE SED5"
                     /protein_id="XP_005537287.1"
                     /db_xref="GeneID:16995376"
                     /translation="MGFLALQDRTEELRSVARLFERDSAAGTSGATAAARPGDAGAAA
                     PQTSLTPERTAELAVKHSPGWQRSNFAVCAAQIGGRIHETSAKLAQLTRLARQRSLFD
                     DHSEEIDRLTSQIKSDIGYINHQLDELQQLARRTADPGSNGERRTGDKRTDATTTTTG
                     SNALAQQHTRIIVDSLRARLLNATQTFQSVLQERSATLRVRPEHKAATQKLPSVSHSI
                     FDLKPNELERGSSFLDLGSGSLGASQQQQQQQQLWYQPQEQQLVHAPPAASLRYYQQR
                     TDAVQRVEATIVELGQIFHQLSRMVAEQGELVQRIDVNIEDSLAHVEGAHGQLLRYFE
                     SLRSNRGLILKLFGVLSLFIVLWVLIL"
     gene            complement(<373974..>375254)
                     /locus_tag="CYME_CMN144C"
                     /db_xref="GeneID:16995377"
     mRNA            complement(<373974..>375254)
                     /locus_tag="CYME_CMN144C"
                     /product="similar to lysyl oxidase"
                     /transcript_id="XM_005537231.1"
                     /db_xref="GeneID:16995377"
     CDS             complement(373974..375254)
                     /locus_tag="CYME_CMN144C"
                     /codon_start=1
                     /product="similar to lysyl oxidase"
                     /protein_id="XP_005537288.1"
                     /db_xref="GeneID:16995377"
                     /translation="MHFKHVSGTSKKGSEKKSAIQEQYLQVLMPHAHLPNLSTTQRRS
                     TTTCPPHLEAALQRLVPGRRMHATRRHQRSSVHQLTGLRRGERPSPGDRRPARPVQLA
                     TAAQQARAIEDRRSACRRARNANTNLVARDACVCAHSADDAQIWMWPAGGPARVGSKC
                     RFCHRSIGAPWHRSGFSSSTSCQSQLVVSRKQRLWAFTLNSGIGPLAMYKRISTLFAL
                     CLVCLAAVASSVRAQAKFDLEPSLKILQGSLMIKTESFTPHDCAFEMGCVLGTGPRKL
                     LKLAGAIGNNGPDDFVVGNPADHPNIYTWDTCTGQFITRKPMLNYSIWDSAGNLVRSG
                     KKESFCMEDLARFPEYTGNPALVPAEPVHTCTFQGISVGWCDIYDDSLPCQWIDITGV
                     PSGHYTLRLECNAYHIFKETTYANNVVETPVTIT"
     gene            complement(376375..378121)
                     /locus_tag="CYME_CMN149T"
                     /db_xref="GeneID:16995378"
     misc_RNA        complement(376375..378121)
                     /locus_tag="CYME_CMN149T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461477.1"
                     /db_xref="GeneID:16995378"
     gene            complement(<379911..>380903)
                     /locus_tag="CYME_CMN150C"
                     /db_xref="GeneID:16995368"
     mRNA            complement(<379911..>380903)
                     /locus_tag="CYME_CMN150C"
                     /product="probable adenylate kinase"
                     /transcript_id="XM_005537232.1"
                     /db_xref="GeneID:16995368"
     CDS             complement(379911..380903)
                     /locus_tag="CYME_CMN150C"
                     /codon_start=1
                     /product="probable adenylate kinase"
                     /protein_id="XP_005537289.1"
                     /db_xref="GeneID:16995368"
                     /translation="MIDRQLPGSLAIASKMRFRWVSLAFLSGVHAPMSVSVLRWVILG
                     APGVGKGTYASRLARKFGLKHINFGEYLRESQLNGRGATAAAEAMRVLQQQGDLLPDS
                     FVEPLVKDLLSDLERRSSAQQGWILDGFPRTAAQARWLDGVFPVQGALLLTLPREVLI
                     AKLAGRRVCVTCGKTYNFMYINEAGMRMPPLLPPGCRWAPCVSPDTTVCTCPRDDTEN
                     GVPLLCEALPKGCERGTACSGRLHCRDDDRLAVVRHRLEVYESQGASVEHYYDTTGRL
                     HRFALTGGVDAIIPHLEAFYGERAIASVRGSRHQHAAHTSMGQAPSAAATSDER"
     gene            complement(<381019..>383805)
                     /locus_tag="CYME_CMN151C"
                     /db_xref="GeneID:16995369"
     mRNA            complement(<381019..>383805)
                     /locus_tag="CYME_CMN151C"
                     /product="probable ribonuclease R"
                     /transcript_id="XM_005537233.1"
                     /db_xref="GeneID:16995369"
     CDS             complement(381019..383805)
                     /locus_tag="CYME_CMN151C"
                     /codon_start=1
                     /product="probable ribonuclease R"
                     /protein_id="XP_005537290.1"
                     /db_xref="GeneID:16995369"
                     /translation="MWVSLATHTRVSFVTVPTCGWTSKARTPRVSASTWCSVPLGRSR
                     RKPRARLVATAETAAAPDAHAAPLPGTVQDSEFERAEACSVVEVFHDRAVHIGVLRTT
                     PAEAACATSFRVHLVSADNQEVSVAPDQVIANWSETLVPPLLFEELSTAGEQPEAWLP
                     PVRFSQTRLQHAWDTARLWLQPHSTESWLALQSADRLGILALLSEGLYELHQEVSCRG
                     ARRGGPFTSAVELAARYQLRLRERFRRRLWPADETTSPVAKSLCDPFVLRILAAITLG
                     SDNFRFRRVPRYGGGWRALPEPMVRARIVESFCERVHATRQSLDRTWHPEHLAVLREL
                     EMLAASRSEHRRNLEPSLRTKRQGMSAPSTRLERLYPLAAAVCRRVASEVSPNTAISI
                     LVKLGQWTLSETSKESASTPPATLKRRPNVCPEPKIGQKIIAAFPDAVMTAARALRSR
                     ILSGRTRNQRSVWSHQFAFCVDSSSARILDDAFSVEIEQRCDPSSGASGHRPGDLQVT
                     WHVHIVDIGRWLPAGHPVDQIACQRAQSLYLPGRPLHLLPPPLANAASFSEHLATDAI
                     TVSLRFRERSNDQHTGSDDLGAIEWFTVRRSVIPPVQRISYEELDRLILSNRRVRASS
                     SSAAAAAAAAAAASASASASSPTDTSTETLLQRASNPLTILQKALNSAALEQRMRARM
                     HARQRRNAGRIARVAHRRDGSLAVAEFALSPGYCLVDALLAAASEALIRFAAQHKIPV
                     PVTRWTRVQNTELGTLAAQKVTASEPNAVQAYRPQRFGTAPLRRYLDLMTLRQISLYL
                     EYGAEAPLLTRAQVARIAAQVQRNASAGMQKVVASRQSLMLDVLAERQSQVQRLGPGE
                     LVLNGLVASVSSNGRTALIILEDDQMEATVTLERSQRLRIGERRAFRLVRLDRTQCGA
                     RAIQLALVVDSVSV"
     misc_feature    382511..383822
                     /note="possible transcribed region"
     gene            <384131..>384895
                     /locus_tag="CYME_CMN153C"
                     /db_xref="GeneID:16995384"
     mRNA            <384131..>384895
                     /locus_tag="CYME_CMN153C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537234.1"
                     /db_xref="GeneID:16995384"
     CDS             384131..384895
                     /locus_tag="CYME_CMN153C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537291.1"
                     /db_xref="GeneID:16995384"
                     /translation="MRSPSSAPVTWDMTVPSVEEVAQLLEEAESQLKRFDSVSEALER
                     DVHALRALVEQVPAAAHLERTSETSTGQPLVFQWNQQHSAHLDRLVTQERATEASDMS
                     VWRRVADALKPALPLVREAFAPESLAEACRTRYLAVEAYRKRADWADEQLTTMLLGLD
                     AVPGVSRQALLLAHQLRRPAQAKQISALIGRRKKLIDRCLAIEAELEQQRVQLGLLPT
                     DKNGAEPMRSAAESTTSSSTSTSAASSHTALEPDPD"
     gene            complement(386113..387795)
                     /locus_tag="CYME_CMN154T"
                     /db_xref="GeneID:16995385"
     misc_RNA        complement(386113..387795)
                     /locus_tag="CYME_CMN154T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461478.1"
                     /db_xref="GeneID:16995385"
     gene            <387896..>388882
                     /locus_tag="CYME_CMN155C"
                     /db_xref="GeneID:16995399"
     mRNA            <387896..>388882
                     /locus_tag="CYME_CMN155C"
                     /product="probable beta-alanine synthase, closer"
                     /transcript_id="XM_005537235.1"
                     /db_xref="GeneID:16995399"
     CDS             387896..388882
                     /locus_tag="CYME_CMN155C"
                     /codon_start=1
                     /product="probable beta-alanine synthase, closer"
                     /protein_id="XP_005537292.1"
                     /db_xref="GeneID:16995399"
                     /translation="MSSLGTTATTMKNRQVQLIALQMSMVPNEPAKNVARAVQTLQSS
                     LTEAGAAPAGVQRIALLPELFAAQYFPVDGGEPRHYSLAVPSPFTEPEHWFWREMASL
                     CRQTEVVLAVSFFEQAGGWTFFNSLAVLDPGAADLFVQPVYRKLHIPHSPGYHEKFYF
                     SPGDTPPTVYQTSRGIRIGVGICWDQWFPELARCLALNGAEVLLYPTAIGSEPQDPTL
                     DSREHWRRTQQGHAAANLMPLMAANRTGIELAQDGSMQIRFYGSSFITDNTGAIVAEA
                     SRDADPVVLFSPVMDLDAYREARLAWGVFRDRRPDMYGSLLALDGVAKRAPV"
     gene            complement(<390280..>391953)
                     /locus_tag="CYME_CMN156C"
                     /db_xref="GeneID:16995400"
     mRNA            complement(<390280..>391953)
                     /locus_tag="CYME_CMN156C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537236.1"
                     /db_xref="GeneID:16995400"
     CDS             complement(390280..391953)
                     /locus_tag="CYME_CMN156C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537293.1"
                     /db_xref="GeneID:16995400"
                     /translation="MDSSQTGRLNSSASGPGGAYAFHVRDAFLGVGVVSSVRDACETS
                     TIPAVPEQSLVHCASTSETASLNEWTSDGYTKLWGGCENSRINEYGTLCVTAPQPHSA
                     PADDRLPTTPISSDSEGGERGVALTSGPTSVVRRYTHTDSAPMKGGSDPLAAMADWLP
                     KLFRTSFYSICGVHKSAGHDSRKVNQRWIERTVFCLHCCEAVCRLCVDRQRQLEFGDA
                     PHASHPHIGICRYMYHDVVLAKDICKEMDVSQVQSYLNNGQRVMYLVRGSGSDTGAAH
                     VPTSWQGASSSASRCRTCWRPLQKDYAFCSIFCLVTQPDDSRKRFDLNPSFRRETLSE
                     FCARAKREGRLRHVKPGNVQHQVMYERAFQDAPGMRDSGTTSQSTEHHSARGRRMRPP
                     RSVATGRAIKSLAKRVANGRGSKRVQDRTSGTPGGTVWIGSSSRGCGRDAGDGHELSV
                     SCCTKSGSTSAERNWLPQYSPGSVFGVFHWPWRSASGSDTWTGGCGANPAHAADDRRT
                     GGDASLLAMDGCDPNLNFETRLLRLSGVRKSRRKAWPVPAVSVCNVLNA"
     gene            complement(<394706..>396529)
                     /locus_tag="CYME_CMN157C"
                     /db_xref="GeneID:16995390"
     mRNA            complement(<394706..>396529)
                     /locus_tag="CYME_CMN157C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537237.1"
                     /db_xref="GeneID:16995390"
     CDS             complement(394706..396529)
                     /locus_tag="CYME_CMN157C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537294.1"
                     /db_xref="GeneID:16995390"
                     /translation="MRRLHCSACERKSAFVAGFPSSSARSQRCFVVPLVSRGCRSSLR
                     KRLGTQRALLVGVNSEPAITKAQRQRLERIASWSAVPDATCNFEALTESLRTVYADTS
                     SLPPCLPQTVEFSILQAQYATLHVLRKVPDWGVWSIELPMGRTKDKWYHAVPANELRR
                     YSRDLFHDYVEVFTQQRGARVCVCVAPLDATARQLGGGALMPLRRWRGTQARHGVAAD
                     SPGTRDADSLRGSAPKLLTYYEDIDPNEEIARCLMRAVFDSARNVLEASHTADDASFL
                     DVIGIADAAADPERNLLGLTALDTHPEAAVAAGSTSPWMLVPRDRRCRLRTLFAVRNA
                     LLADAGCTHVAQAFDGDYGDDLLAALPDVVVITNAVASRHLGSVLRIVDACRAVGVPV
                     VLFNCFLDLARLTDVRRTRLATHEEAALEASAHVQLARQQLGEPKLPLPDVLRRIRDG
                     SVLGAEACYVCRCLPHVGALWRMRGAHEVGLGAFHGSTALGETRPAASLSGSLDADPW
                     HLFAEVDWLEYEYATSVSYTLRPTLMASELEDILLHDCGYSRRQPERLLWSPTNSDSE
                     PLWSRRGSVHHAGYWPSMVPAMDFDQWAPPLDAGIDTWMWR"
     gene            complement(<399136..>399684)
                     /locus_tag="CYME_CMN158C"
                     /db_xref="GeneID:16995391"
     mRNA            complement(<399136..>399684)
                     /locus_tag="CYME_CMN158C"
                     /product="chloroplast ribosomal protein S15 precursor"
                     /transcript_id="XM_005537238.1"
                     /db_xref="GeneID:16995391"
     CDS             complement(399136..399684)
                     /locus_tag="CYME_CMN158C"
                     /codon_start=1
                     /product="chloroplast ribosomal protein S15 precursor"
                     /protein_id="XP_005537295.1"
                     /db_xref="GeneID:16995391"
                     /translation="MAFILPSTCSAFSVLGSKRVTSPQCATRRARVCALAGLRLQTGE
                     DTFDFFLGKSERTTESLLPMDGSDLPEGGGNKTWLNLQRVRAASARFRVHERDTGSPE
                     YQIAALTERVNIITEHLKEHPKDLSSTRGLQLLNSRRRRLLRYLQSQDLERFDRLVKA
                     LNIRVRRGDTALSRRRDLAGGR"
     gene            <401280..>402794
                     /locus_tag="CYME_CMN159C"
                     /db_xref="GeneID:16995392"
     mRNA            <401280..>402794
                     /locus_tag="CYME_CMN159C"
                     /product="unknown kinase with aarF domain"
                     /transcript_id="XM_005537239.1"
                     /db_xref="GeneID:16995392"
     CDS             401280..402794
                     /locus_tag="CYME_CMN159C"
                     /codon_start=1
                     /product="unknown kinase with aarF domain"
                     /protein_id="XP_005537296.1"
                     /db_xref="GeneID:16995392"
                     /translation="MFEVRQQTRPLTRFTGKPPESRMPWDVRFRLWRRSTEFWWRAGS
                     IYCSYKWSQFFIGALGRLGALNRDAAWSSQHERASKAMYNMCSEMRGFLIKAGQFLAT
                     RADFLPEPFIRRLSKLHDDVEPITAAAAQRVVASELGIQHLDDIFECFESDPLGAASI
                     SQVHRAKLRKSIASAALGKRHRDTWVAVKVQYPDAENMMLNDLASLLILARFLQRYEL
                     KFDLESPVLELQSQIRQEFDFIREAANTERIRSLVLGSRKLRARIQVPRIYHATKRLI
                     IMEYLDGVPIPQLEEELRRRRVRIPARLERMLERNLMDSIALVYGKMLLGKGFFQADP
                     HPGNMLVLQRNWSGNRSFFKGTLAYLGLVEPTIQLGLLDFGQCKQLTPERLRQLRALM
                     RAMYRGHHVAAAFFDLGIALEREPEFYDPNDVAILAYSMFDTRPLPAGRSISPFDPNC
                     PLKQTPVRHLPGDLFFVLRTIQILRGLQSRMQSRQCLNTSLAKEWCGRWGLCAD"
     gene            <404277..>405311
                     /locus_tag="CYME_CMN160C"
                     /db_xref="GeneID:16995393"
     mRNA            <404277..>405311
                     /locus_tag="CYME_CMN160C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537240.1"
                     /db_xref="GeneID:16995393"
     CDS             404277..405311
                     /locus_tag="CYME_CMN160C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537297.1"
                     /db_xref="GeneID:16995393"
                     /translation="MLYWVGVFRPSRFLVSVCAFIGLVAAILIHLEVLASPLEAVIVA
                     LLLGFGVVTFRAFWDHVTEDCFEQNGQNESVVEFMSFSHLAVSVVLNVLCVALVAARG
                     RADHHWAQVSTIVCLLSMLYMACAGGHIYDALVHHNYEQENAAVELVIIYDTWFPLAM
                     NLLLLARLAGAQAFFLQRIVWEPFAFAERVLEWTTLLTQRQLQFQLGRNFFLRLLQQS
                     AHASSQQIMRALEVVMRAARQGDFHLALHVGCIVAGFLLTSVYIVAVLPVLARCHGKF
                     AAASAEEARLAGALKTPAGALTPAKAASTARTPATTTTARKSRPRVPTPMTLRRKNLR
                     SQSVRRGLQF"
     gene            complement(<405610..>407862)
                     /locus_tag="CYME_CMN161C"
                     /db_xref="GeneID:16995381"
     mRNA            complement(<405610..>407862)
                     /locus_tag="CYME_CMN161C"
                     /product="similar to vegetatible incompatibility protein
                     HET-E-1"
                     /transcript_id="XM_005537241.1"
                     /db_xref="GeneID:16995381"
     CDS             complement(405610..407862)
                     /locus_tag="CYME_CMN161C"
                     /codon_start=1
                     /product="similar to vegetatible incompatibility protein
                     HET-E-1"
                     /protein_id="XP_005537298.1"
                     /db_xref="GeneID:16995381"
                     /translation="MQQAANEQAAHADGLEPATQTTAFGALQPESQPQPQPQRPLSVV
                     ATESVLIDHGPRYTRGLRDALELLGARRLSLPTQAGFTAPPGRRLDAGEQMISPSRMH
                     WTDATESATGSRALWSGVPQGPALAGVHVGNNTRPLVREGAPRLGLVFDPEDPCIQRD
                     MLRMIRQYLEDHGYVLSSMVVNDEANLMEREARSQQWQARRIRSAILTGDWSEVERLC
                     QKTPLKNLKVFLYALYRQQFLELIERHETEKAYAVLMKRLKPLEGHAPRGPAEFRDLC
                     YLLTCKSVHEAHAASIPLSLDWGGSQAGRELLAEQLTRLLDMEQEAECVFGDPQGTSP
                     QRREVPPHRLEQLVQQAYAYQIEFARYHPLVLPRIRTLLEDYHCFAIPNAERPPRLCG
                     HEANIKCVTFVGKEGLMLATGSSDRRVGLWDTDSGALLGMLSGHSSRVWDVSASPSGR
                     VLASGSADGRIGLWVSEAHAPGFRLGAMLAHHPAVGHGSVATSAAMQGSSISSIGSIG
                     NSTSVRPGGGLSGAGPGHALTKLPTTGGDVYTVCVHPAETHVLSGGYDKTLRLHDIRT
                     GQIVRSFVGHQAAVTRAVFNPHGNLIVSGSKDSTIKFWDIISGVCVRTFSFHFGEVTS
                     VELNSTGTLLLSSSKDNSNRLWDLRASRPIRRFKGHQNTSKNFIRACFGPNELLVVGG
                     SEDGQICIWDVESATLIQRLTACRRGPVFSAVWSQQQSLLASCGNDGDARLWWYDPSR
                     PLSVPDGAAA"
     gene            <408595..>410466
                     /locus_tag="CYME_CMN162C"
                     /db_xref="GeneID:16995382"
     mRNA            <408595..>410466
                     /locus_tag="CYME_CMN162C"
                     /product="similar to oxidoreductase"
                     /transcript_id="XM_005537242.1"
                     /db_xref="GeneID:16995382"
     CDS             408595..410466
                     /locus_tag="CYME_CMN162C"
                     /codon_start=1
                     /product="similar to oxidoreductase"
                     /protein_id="XP_005537299.1"
                     /db_xref="GeneID:16995382"
                     /translation="MAQVLALSDRCCGCLERRSLLLYSLVLGSEINEGFQERPLSVRT
                     GDAFRVHCDSHMNPTTLFVLHAGADAGASVQVLGSSFSASRKHPRCLVRKRQPERRGR
                     LQRFSSPAWRQRLRRQVLQAQVELPQVRIVGAGLAGLTTAIALIEEYGWDPASVSIFE
                     ASDTVGGRVRTDRLPEGYLLDRGFQVVLEAYPEQKRLFRVTGAAYPDELKLRRFLPGA
                     TVRLPNGTWAYVGDPLRSDLGDVWTTLLAPLGTIQDKARVGWMRLQTQLRYTSNPNSI
                     LEQVNMNGNREETAEEALAALTPGLRQSFFSPFYRGIFLDELYNISSRLFRYVYHMLA
                     VGYASLPDNGHGIGALPRFLAQRLRDEHGLTIHYGQRVTDLSTLADRAVLVLAADVAS
                     TKKLLEQASVANRFSPKAQADIRKLLCGWLAAGADGVHETLQRVSTCLYFGGEGAEPP
                     EALITRPRSLVLAADAPSPSGMPRRPLVNNLCFPSAVARSYAPSNKYLVSCTVVETAL
                     HQQLDPKDNDLLPGGELEALVRTQLYKWYPSQRHLLDDWSFLRGYRVRGAQPRQRLNG
                     ERFVMPNEDGCLDAGRLYVCGDWCDTPTANGAIHSGYRVAGGIAKAFGVHSRSTSSR"
     gene            complement(<410707..>412299)
                     /locus_tag="CYME_CMN163C"
                     /db_xref="GeneID:16995397"
     mRNA            complement(<410707..>412299)
                     /locus_tag="CYME_CMN163C"
                     /product="similar to variable flagellar number protein"
                     /transcript_id="XM_005537243.1"
                     /db_xref="GeneID:16995397"
     CDS             complement(410707..412299)
                     /locus_tag="CYME_CMN163C"
                     /codon_start=1
                     /product="similar to variable flagellar number protein"
                     /protein_id="XP_005537300.1"
                     /db_xref="GeneID:16995397"
                     /translation="MDSDERQLRAGEHRNPSADWEDFFRALEHALDSCQQCLTKERDQ
                     KRAIMDTLRAKQERERALEQSLLRLEEEYARLEGAWLNAETSAAEASSRASELEKLLA
                     EQESALEDLKRREATLLARTSELDVHSEVTSRLAAAEREIEQLQRALTERTRELAEVR
                     KAHIRSTADTEAQIHTLESTCEQLEARLAEERSRVRIAREEQQELERERVRLEGEVAA
                     ARAQLEDVLSKAGEEVCVWKDTCAALEKERDALHARVLAFEKASSSSTTMNAGADAGP
                     TTGPATMSPLGKRPRRSLLASPAQRVPVETRDPRSGRPSPFFGSVQRRLLQTPTLRSP
                     VSYVFAEDGIAGAAADKATPATVAAIPSEASWERLAREGRHLSYMRSLLGELEARLPL
                     LEEQKRRFQFVIAQFDRMHRALQESELATEHWKQRAATVEREQAQLNEQLQQYKDAFE
                     HQKQRIQELEGLVASTEASTGATASMTVPAHQLAQLEAELEHIRRQRQEFEAVVNAVV
                     KQRDLYRQLLLRSLRGEQVAPP"
     gene            <412894..>413829
                     /locus_tag="CYME_CMN164C"
                     /db_xref="GeneID:16995398"
     mRNA            <412894..>413829
                     /locus_tag="CYME_CMN164C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537244.1"
                     /db_xref="GeneID:16995398"
     CDS             412894..413829
                     /locus_tag="CYME_CMN164C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537301.1"
                     /db_xref="GeneID:16995398"
                     /translation="MRFDWSVTVAMEKRLNKLASQMSGDNLERTLRTLGTPECTREPA
                     FVCGAARPTRQVWLPNAGLLCERSRRTGRSTFERQGRVTVGAFRCWCQQEPTAGEERS
                     PATNRPGGKVETAAVGAGAASLVKVRFINTPGGLELETMAPPGSIVLAVADELGLRIP
                     RGCTSGVCGACTCDMVHPSLPGGRQTVRVCSTKVATFPGIDEIVIDVYRMKESATRDA
                     YQSSTLRALNRFDNIDFEYKAGAQPRAIMNPANPFARPRTVRCEKCKGTGKHVCEACE
                     GTGKSTATLMCYVCVGLRRTRCAECQGTGSRTLRR"
     gene            complement(<415495..>415905)
                     /locus_tag="CYME_CMN165C"
                     /db_xref="GeneID:16995386"
     mRNA            complement(<415495..>415905)
                     /locus_tag="CYME_CMN165C"
                     /product="histone H3"
                     /transcript_id="XM_005537245.1"
                     /db_xref="GeneID:16995386"
     CDS             complement(415495..415905)
                     /locus_tag="CYME_CMN165C"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_005537302.1"
                     /db_xref="GeneID:16995386"
                     /translation="MARTKQTARKSTGGKAPRKQLATKAARKSAPSVGGVKKPHRYRP
                     GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLV
                     NLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA"
     gene            <418237..>418548
                     /locus_tag="CYME_CMN169C"
                     /db_xref="GeneID:16995387"
     mRNA            <418237..>418548
                     /locus_tag="CYME_CMN169C"
                     /product="histone H4"
                     /transcript_id="XM_005537246.1"
                     /db_xref="GeneID:16995387"
     CDS             418237..418548
                     /locus_tag="CYME_CMN169C"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_005537303.1"
                     /db_xref="GeneID:16995387"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEETRNVLKVFLESVIRDAVTYTEHGRRKTVTAMDVVYALKRQGRTLYGFG
                     G"
     gene            complement(<419155..>419508)
                     /locus_tag="CYME_CMN170C"
                     /db_xref="GeneID:16995418"
     mRNA            complement(<419155..>419508)
                     /locus_tag="CYME_CMN170C"
                     /product="histone H2A"
                     /transcript_id="XM_005537247.1"
                     /db_xref="GeneID:16995418"
     CDS             complement(419155..419508)
                     /locus_tag="CYME_CMN170C"
                     /codon_start=1
                     /product="histone H2A"
                     /protein_id="XP_005537304.1"
                     /db_xref="GeneID:16995418"
                     /translation="MAPKGKAKSRSSKAGLQFPVGRVHRYLRDGGYAERIGAGAPVYL
                     AAVMEYLTAEVLELAGNAARDNKKTRIIPRHIQLAIRNDEELNKLLADVTIASGGVLP
                     NIHAVLLPKKKAKGE"
     gene            <421273..>421629
                     /locus_tag="CYME_CMN145C"
                     /db_xref="GeneID:16995419"
     mRNA            <421273..>421629
                     /locus_tag="CYME_CMN145C"
                     /product="histone H2B"
                     /transcript_id="XM_005537248.1"
                     /db_xref="GeneID:16995419"
     CDS             421273..421629
                     /locus_tag="CYME_CMN145C"
                     /codon_start=1
                     /product="histone H2B"
                     /protein_id="XP_005537305.1"
                     /db_xref="GeneID:16995419"
                     /translation="MAMKGKTVAKKVAKAPASIDKKKRKRLETYSIYIYKVLKQVHPD
                     TGISSKAMSIMNSFVNDLFERIASEASKLAQYNKTKTLTSREIQTAVRLLLPGELAKH
                     AVSEGTKAVTKYTSSQ"
     gene            complement(<422467..>423093)
                     /locus_tag="CYME_CMN146C"
                     /db_xref="GeneID:16995374"
     mRNA            complement(<422467..>423093)
                     /locus_tag="CYME_CMN146C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537249.1"
                     /db_xref="GeneID:16995374"
     CDS             complement(422467..423093)
                     /locus_tag="CYME_CMN146C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537306.1"
                     /db_xref="GeneID:16995374"
                     /translation="MDRPLVGLRVRLVLDECVPDAPTEPSVPAGIEGIVFAYDERRNL
                     LVVCTPSSSGADLYDVHVLRASHVAEVQVLSEGIEASQRQSRWRSGRERALFSGGSLP
                     ALSIEALRQRESRSLARARERSSKLGRGVSVLGQLVFDALDRTLPCRWDEPNIIVLDS
                     VYVPPPYTAEGVRSLDDDEAAAQRVRLVLERELPRLVAGSAALDPQDG"
     gene            <425489..>425953
                     /locus_tag="CYME_CMN147C"
                     /db_xref="GeneID:16995375"
     mRNA            <425489..>425953
                     /locus_tag="CYME_CMN147C"
                     /product="actin depolymerizing factor"
                     /transcript_id="XM_005537250.1"
                     /db_xref="GeneID:16995375"
     CDS             425489..425953
                     /locus_tag="CYME_CMN147C"
                     /codon_start=1
                     /product="actin depolymerizing factor"
                     /protein_id="XP_005537307.1"
                     /db_xref="GeneID:16995375"
                     /translation="MASGVSVDPACSAELLTLIRACPRQYRAVIYRVSPDLRTIIVDR
                     VLPSSNITGRSAVEDWKEFTSDKYLPRDDCRYAVYDFEFDTAETGKKNKIIFLLWSPA
                     SAPIRSKMVYTSSRQAIVAVLDGVQKEVQATDEEELEYAWVESQVRLASSAR"
     gene            complement(<426874..>428148)
                     /locus_tag="CYME_CMN344C"
                     /db_xref="GeneID:16995372"
     mRNA            complement(<426874..>428148)
                     /locus_tag="CYME_CMN344C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005537251.1"
                     /db_xref="GeneID:16995372"
     CDS             complement(426874..428148)
                     /locus_tag="CYME_CMN344C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005537308.1"
                     /db_xref="GeneID:16995372"
                     /translation="MWPSVSEETTGCGSSGTRLTPVTRRPRKPYRLMKPREAWTAEEH
                     ELFVEALRLYERDWKRIEQHIGTKTVVQIRSHAQKYFLKLQKSDQSAWIPPARKRRTA
                     GGGSSAASTEASDGGAASSTGSRPETRATAATVDKAPVRTTNESDSALSPQERTLLRP
                     HAAEDVSSVSASGGGANFSTSASLAHAAARDRGWRWALAGNARIRAASADTCAHASPL
                     DSVALDATPAAPAAPAAPAAPAAPAAPAAPAAPAAPAECGAGSGGGANGVRALKRRLP
                     NVSLKGVPDAAPAGIAELHRGASHADALGSAANFRAIYGFLAYLLMPYEETGGESARH
                     SDLCVNASWSDAQAAEAGTGPPLGRDLRGCAESRKDWRERYRSLSALEQDIVRQMLRR
                     LCSNLLDRRFVEGALRRFREAALEENALAMRR"
     gene            complement(<430685..>431473)
                     /locus_tag="CYME_CMN148C"
                     /db_xref="GeneID:16995188"
     mRNA            complement(<430685..>431473)
                     /locus_tag="CYME_CMN148C"
                     /product="40S ribosomal protein S3"
                     /transcript_id="XM_005537252.1"
                     /db_xref="GeneID:16995188"
     CDS             complement(430685..431473)
                     /locus_tag="CYME_CMN148C"
                     /codon_start=1
                     /product="40S ribosomal protein S3"
                     /protein_id="XP_005537309.1"
                     /db_xref="GeneID:16995188"
                     /translation="MEAGRRQVSWKRKFVADGVFFAELSELLTRELAEDGYAGVEVRV
                     TPRGHEVIIRATRTQTVLGEKGRRIRELTALVEKRFGFPENQVSLFVERVPNRGLCAM
                     AQAESLRYKLLGGLAVRRAAYGVLRFVMESGAKGCEVQISGKLRAQRAKTMKFMDGYM
                     ISTGQPKLDFIDRAVRHVLLRQGVLGIKVKIMLPHDPTGRQGPRKPLPDSIVILEPKE
                     EDTLGKVVATHTTYGPAAMPAAPVGVAPGVMGGAPVIGVGAARP"
     gene            <432169..>433698
                     /locus_tag="CYME_CMN167C"
                     /db_xref="GeneID:16995373"
     mRNA            <432169..>433698
                     /locus_tag="CYME_CMN167C"
                     /product="RIO-like serine/threonine protein kinase"
                     /transcript_id="XM_005537253.1"
                     /db_xref="GeneID:16995373"
     CDS             432169..433698
                     /locus_tag="CYME_CMN167C"
                     /codon_start=1
                     /product="RIO-like serine/threonine protein kinase"
                     /protein_id="XP_005537310.1"
                     /db_xref="GeneID:16995373"
                     /translation="MRNHERVPVELVGALSGNRGARRALQVLLRHKLVHHESRPYESY
                     RLTPLGYDYLALRALRERSSVCSVGGLIGTGKESDVHEVLGGVDGSELFVLKVHRLGR
                     TSFRRARTKRGYCERTPFVPEEATSDVAAGSSGRLLPTVEGVSESERASEGVPADRLD
                     GNIVRFTSQSSDRRVVANWLYLSRLAAQREYEALVFLYGQGLPVPEPIDANRHCVVQR
                     LVQGALPLSHARSLRDPRAVFERIWEFQERLTELGLVHGDLNEFNVLVDCETEQITVI
                     DFPQMVPLGHRDALEMLERDRRSLVSFFYNRFGLPLCIERGLLAEASSVSEHLVTARA
                     EDVTDASNATLSLWRQADSGAEAASRPDTAGSDEATICGKQLANAVSQLASLAHMRTL
                     GNAPYISECASASVWSGLREARDPTRFSAANGSADEASAPLREGWHGRAASVTEADVG
                     VASARSAGVERKFDTRAISRQLQAEHARCHRKLLLREATRLGKAHPRAARRAIPTTDW
                     S"
     gene            complement(<433891..>434202)
                     /locus_tag="CYME_CMN166C"
                     /db_xref="GeneID:16995380"
     mRNA            complement(<433891..>434202)
                     /locus_tag="CYME_CMN166C"
                     /product="histone H4"
                     /transcript_id="XM_005537254.1"
                     /db_xref="GeneID:16995380"
     CDS             complement(433891..434202)
                     /locus_tag="CYME_CMN166C"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_005537311.1"
                     /db_xref="GeneID:16995380"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEETRNVLKVFLESVIRDAVTYTEHGRRKTVTAMDVVYALKRQGRTLYGFG
                     G"
     gene            <436875..>437285
                     /locus_tag="CYME_CMN345C"
                     /db_xref="GeneID:16995379"
     mRNA            <436875..>437285
                     /locus_tag="CYME_CMN345C"
                     /product="histone H3"
                     /transcript_id="XM_005537255.1"
                     /db_xref="GeneID:16995379"
     CDS             436875..437285
                     /locus_tag="CYME_CMN345C"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_005537312.1"
                     /db_xref="GeneID:16995379"
                     /translation="MARTKQTARKSTGGKAPRKQLATKAARKSAPSVGGVKKPHRYRP
                     GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLV
                     NLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA"
     gene            complement(<437898..>438296)
                     /locus_tag="CYME_CMN171C"
                     /db_xref="GeneID:16995189"
     mRNA            complement(<437898..>438296)
                     /locus_tag="CYME_CMN171C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537256.1"
                     /db_xref="GeneID:16995189"
     CDS             complement(437898..438296)
                     /locus_tag="CYME_CMN171C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537313.1"
                     /db_xref="GeneID:16995189"
                     /translation="MAACHFYKMSLLLFSADVTSAGWDLSVSVGAGACCFADVARRET
                     GSSGAYPVSRSENLPLYLNKSRCTWHLPRHPAQRPRAAVLAHYSSTAGNRYSAAAFAR
                     YFRDQSDSLFHKTECTETRTSVPPFRQRAL"
     misc_feature    437957..439034
                     /note="possible transcribed region"
     gene            complement(<439037..>439393)
                     /locus_tag="CYME_CMN173C"
                     /db_xref="GeneID:16995413"
     mRNA            complement(<439037..>439393)
                     /locus_tag="CYME_CMN173C"
                     /product="histone H2B"
                     /transcript_id="XM_005537257.1"
                     /db_xref="GeneID:16995413"
     CDS             complement(439037..439393)
                     /locus_tag="CYME_CMN173C"
                     /codon_start=1
                     /product="histone H2B"
                     /protein_id="XP_005537314.1"
                     /db_xref="GeneID:16995413"
                     /translation="MAMKGKTVAKKVAKAPASIDKKKRKRLETYSIYIYKVLKQVHPD
                     TGISSKAMSIMNSFVNDLFERIASEASKLAQYNKTKTLTSREIQTAVRLLLPGELAKH
                     AVSEGTKAVTKYTSSQ"
     gene            <440794..>441429
                     /locus_tag="CYME_CMN174C"
                     /db_xref="GeneID:16995414"
     mRNA            <440794..>441429
                     /locus_tag="CYME_CMN174C"
                     /product="histone H2A"
                     /transcript_id="XM_005537258.1"
                     /db_xref="GeneID:16995414"
     CDS             440794..441429
                     /locus_tag="CYME_CMN174C"
                     /codon_start=1
                     /product="histone H2A"
                     /protein_id="XP_005537315.1"
                     /db_xref="GeneID:16995414"
                     /translation="MIDTCASRAAAADREQTRAPGSRSRRHHGTARLCRSQPLLQHLA
                     FSYSRLIPCDTALCVAPALVSLLCRRRVYRCGCCFSRGRSLAFSLEAFSTMAPKGKAK
                     SRSSKAGLQFPVGRVHRYLRDGGYAERIGAGAPVYLAAVMEYLTAEVLELAGNAARDN
                     KKTRIIPRHIQLAIRNDEELNKLLADVTIASGGVLPNIHAVLLPKKKAKGE"
     gene            complement(<441662..>442660)
                     /locus_tag="CYME_CMN175C"
                     /db_xref="GeneID:16995415"
     mRNA            complement(<441662..>442660)
                     /locus_tag="CYME_CMN175C"
                     /product="similar to cyclin C"
                     /transcript_id="XM_005537259.1"
                     /db_xref="GeneID:16995415"
     CDS             complement(441662..442660)
                     /locus_tag="CYME_CMN175C"
                     /codon_start=1
                     /product="similar to cyclin C"
                     /protein_id="XP_005537316.1"
                     /db_xref="GeneID:16995415"
                     /translation="MDVDTEEADYIQRHRLPPKPRPEDWLLEWDVIERSPLGLASNRA
                     VHVAVQQFLVEVAKQLGLGSYVRATAHVLYMRYYLYSDHIVPVTRAELEPGSGRGTSE
                     WTAPAAVPFDPYQMASAAVFLAAKVEECPCSLSKVIYLSVKTRTRNSRTHPGGLEVYE
                     GTERFVEEKQQLLFAERALLRATHFDLRMDHAYRYLGAVRDLLQRSDCIGECPASWWE
                     RVYARAWAAVTKSFGTVGCLHFRGRDLAAAAMALEAVDTAAPERVDEAGLEALERWAG
                     WEVLGRHEHPDVKRHPYQILSLEHVPLCDYGLGISREEAIEAIRRGVIRRVYEQHT"
     gene            <444055..>444465
                     /locus_tag="CYME_CMN176C"
                     /db_xref="GeneID:16995409"
     mRNA            <444055..>444465
                     /locus_tag="CYME_CMN176C"
                     /product="histone H3"
                     /transcript_id="XM_005537260.1"
                     /db_xref="GeneID:16995409"
     CDS             444055..444465
                     /locus_tag="CYME_CMN176C"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_005537317.1"
                     /db_xref="GeneID:16995409"
                     /translation="MARTKQTARKSTGGKAPRKQLATKAARKSAPSVGGVKKPHRYRP
                     GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLV
                     NLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA"
     gene            complement(<445050..>447179)
                     /locus_tag="CYME_CMN177C"
                     /db_xref="GeneID:16995410"
     mRNA            complement(<445050..>447179)
                     /locus_tag="CYME_CMN177C"
                     /product="arginine--tRNA ligase"
                     /transcript_id="XM_005537261.1"
                     /db_xref="GeneID:16995410"
     CDS             complement(445050..447179)
                     /locus_tag="CYME_CMN177C"
                     /codon_start=1
                     /product="arginine--tRNA ligase"
                     /protein_id="XP_005537318.1"
                     /db_xref="GeneID:16995410"
                     /translation="MQRTLGFACEATRASARRHPTSLYCRGRAASVCYRHSGLRSLIS
                     ARAGRRTLDQCFGVGARGGPFRKQVRRLEGPVNLRMAREVKHSAGLAGMAPDAPAESY
                     RLGPLEYLRRSVIEVLSKEYGDALPEVVDPMVVFSSRPEFGDFQCNVAMSLARQLKSK
                     PRDVAERLRVGLEQKVAGMCATPLEVAGPGFVNFRLSDGYLASVIRQMMSDPRGKLNV
                     PEPPKLQRIVVDFSSPNIAKEMHVGHLRSTIIGDTLCRVLEYLGHTVIRLNHVGDWGT
                     QFGMLIAYLAEVAPEALTGERPPDLGDLVAFYKQAKKRFDEDPVFQNAARAQVTKLQS
                     GDEASLRAWRLLCELSRREFEKIYQLLDVQLTERGESFYNPYLPDVIERLERKGLVQV
                     DQGALCVFLEGFKNRDGSPQPLIVRKSDGGYMYSTTDLAAILYRVQEDRAQRILYVTD
                     AGQATHFAQVFQVARRAGFFDPAEVSLEHVPFGLVLGDDGKKFKTRSGDTVRLMDLLE
                     RAIELARHDLEQRIAEQPGRTESPEYLERAARAIGIGAVKYADLRTTRTADYRFSYEK
                     MLSLNGNTAPYMMYVFTRVSGIARKAAGLPADAEVCMQELVANCASEQQLLLCVTEPA
                     EGALARQLLRFPYVLLDLERELMPHVLCEYLFELSQRFNQFYEHCPVLGAEDDSVRHS
                     RLALCALTGYVVESGLRLLGIEVLPRL"
     gene            complement(<448758..>450188)
                     /locus_tag="CYME_CMN178C"
                     /db_xref="GeneID:16995416"
     mRNA            complement(<448758..>450188)
                     /locus_tag="CYME_CMN178C"
                     /product="serine--tRNA ligase, cytoplasmic"
                     /transcript_id="XM_005537262.1"
                     /db_xref="GeneID:16995416"
     CDS             complement(448758..450188)
                     /locus_tag="CYME_CMN178C"
                     /codon_start=1
                     /product="serine--tRNA ligase, cytoplasmic"
                     /protein_id="XP_005537319.1"
                     /db_xref="GeneID:16995416"
                     /translation="MLDIRLFRAEQGGNPELVRESQRRRFADVKLVDRVIELDERWRQ
                     AQFRVDALRRELNESSKRVSGLIKSGADASELISSVADLKRSIPAAEREAAALEQERD
                     ALLREIGNLVHESVPVSVDEADNRVERLWGYPELADERVKNAHRSHVELLLALGAADY
                     ERGARVAGSRGYFLIGPGVRLNLALVQYALNFLRERGFREMQPPYFMTSDAMARCAQL
                     SDFDEQLYKVTVRSRGAAAGEPESSGTGGTNATAAAAEDDKYYLIATSEQPICAYHTD
                     EWLDPSTLPLLYAGFSTCFRKEAGAHGRDQLGIFRVHQFEKIEQFAVTSPLDGASWEM
                     LERLLGNAEEFYQSLGIPYRIVSIVSGALNNAASKKYDLEGWYPASKAWRELVSCSNC
                     TDYQSRRLLTRYGMKKGGDREKRFVHMLNSTLCATTRVICCIVENYQRENGVEVPAVL
                     QPYLGGETLLPFVNLPQKGSLADQSG"
     gene            <451352..>452566
                     /locus_tag="CYME_CMN179C"
                     /db_xref="GeneID:16995417"
     mRNA            <451352..>452566
                     /locus_tag="CYME_CMN179C"
                     /product="mitochondrial presequence translocase subunit
                     Tim50"
                     /transcript_id="XM_005537263.1"
                     /db_xref="GeneID:16995417"
     CDS             451352..452566
                     /locus_tag="CYME_CMN179C"
                     /codon_start=1
                     /product="mitochondrial presequence translocase subunit
                     Tim50"
                     /protein_id="XP_005537320.1"
                     /db_xref="GeneID:16995417"
                     /translation="MLVDRYAGLRALRPIGSALLRPGRVLRCLTSGNGGRAAGEAGSK
                     PTSGPIHPEEGAAAASDGAAESKRPQHSRWRALFRPGRLLGFVALGSAATVLTFWVVD
                     PEGTVARLERLRHELESRIRYYVEPSREKLLPDPVAPFPGSLPPRTLVLDLDETLVHS
                     DWTRSTGWRTSKRPGVDAFLAYMAQFYEIVVFTSALPGYADPILDRMDPNGYITHRLY
                     RHETKYRDGLHMKDLAKLNRDLRRTIIIDNDPRVFALQSENGIEIAPWNGTDPDDKEL
                     LRLTAFLEWVVRNDVADVRPIIATVRNCDRTTSRSFAERFEACRQQVESVLASQKLAA
                     VAGAATASSSSADGHLSGNGVRAPVRGLGIFAIPRRDPAEQSATTTSEASSPAAPAQP
                     VPDQSIWTRLRR"
     gene            complement(<453941..>454615)
                     /locus_tag="CYME_CMN180C"
                     /db_xref="GeneID:16995411"
     mRNA            complement(<453941..>454615)
                     /locus_tag="CYME_CMN180C"
                     /product="similar to methyl transferase"
                     /transcript_id="XM_005537264.1"
                     /db_xref="GeneID:16995411"
     CDS             complement(453941..454615)
                     /locus_tag="CYME_CMN180C"
                     /codon_start=1
                     /product="similar to methyl transferase"
                     /protein_id="XP_005537321.1"
                     /db_xref="GeneID:16995411"
                     /translation="MRGSVPSVREIETLLSQLPWRQFQSPRVHLEQYTTPVHLAARIA
                     HHVALCIDEDERRSVQAVDLGTGTGILALALCLAGLNHVLGVDVDSEALELARANAAA
                     LWELCPQSVGAVLEFAAVDVQPNSLALAPKSFDVAVLNPPFGTRQRSADIAFLDVACH
                     LSRRFVYSLHKSSTRSYLSRRLERFGCTAQVYARLRFDLPATYVFHRERAVDIDVDLW
                     QIEVKR"
     gene            <456715..>458154
                     /locus_tag="CYME_CMN181C"
                     /db_xref="GeneID:16995412"
     mRNA            <456715..>458154
                     /locus_tag="CYME_CMN181C"
                     /product="branched-chain-amino-acid transaminase,
                     mitochondrial precursor"
                     /transcript_id="XM_005537265.1"
                     /db_xref="GeneID:16995412"
     CDS             456715..458154
                     /locus_tag="CYME_CMN181C"
                     /codon_start=1
                     /product="branched-chain-amino-acid transaminase,
                     mitochondrial precursor"
                     /protein_id="XP_005537322.1"
                     /db_xref="GeneID:16995412"
                     /translation="MPLSEGGLYSGFRAVRGSFGGCLQWVRKFATEVPLSPTMRRALA
                     LAERTDGALCGPDASKLVVDRAPVVDSSGHSVRAREVLGVHSFYARGSNFQIRQPAGS
                     QEFGVTFTDHMLLVRYRGGHWMDPLITSRRPLELDPASSSLQYGLQIFEGLKAYRPDP
                     VGPETEDVVRLFRPQENLQRMYRSAARLALPLFDTGSMLRLIEEYVRIEADWVPVRAP
                     DENFRAVSLYLRPCLISTDARLGVRRAEEALFYVIASPSLGGYYSAANNAGVTLLATE
                     EFVRAWPGGVGDTKCGGNYALSLVAQELAHAEGCHQVLWLDPDRNVTEAGVMNFFAVT
                     SSGEVVTAPLSKGLILPGVMRSAVIQLIEQGRFPPGANHSSWRLVERSLSVDELVQGI
                     EQGRIVEAFGTGTAAMICPVAAVKYRGRTFRLPEASDAKRRLTWQLSRALEHLFFDPD
                     PHFAAHPWIHTVHVSRIPQHASASHTQFG"
     gene            complement(<458100..>459269)
                     /locus_tag="CYME_CMN182C"
                     /db_xref="GeneID:16995421"
     mRNA            complement(<458100..>459269)
                     /locus_tag="CYME_CMN182C"
                     /product="queuine tRNA-ribosyltransferase"
                     /transcript_id="XM_005537266.1"
                     /db_xref="GeneID:16995421"
     CDS             complement(458100..459269)
                     /locus_tag="CYME_CMN182C"
                     /codon_start=1
                     /product="queuine tRNA-ribosyltransferase"
                     /protein_id="XP_005537323.1"
                     /db_xref="GeneID:16995421"
                     /translation="MFTLQATDGSARAGVLHLRHGTTRTPVFMPVGTQATVKGLTPDQ
                     LLDLDLDIILGNTFHLGLRPGGEVLSALGGVHTFAHWPRNVLTDSGGFQMVSLLRLAT
                     VSEAGVHFQSPVDGSQVLLTPELSIQLQNQIGADIIMALDDVVPTTASNVERFREAAA
                     RTVRWLDRCIGAHARPSEQLLFAIVQGGLSPELRRYCLRELVARELPGYAIGGLAGGE
                     EKDKFWQVVQLCTRELPHDKPRYCMGVGYPEDLLVCVALGVDMFDCVYPARTARFGSA
                     LVDAEAPGMLKIKSAAMFKDSRPIEPQCPCECCRHYSRAYLHVLVNRDPAVVGHLLTV
                     HNISYLTRFMRGAREAIFKNTFADYVHKWFARRYPSGAYPNWVCDALACCGIRLT"
     gene            <461399..>461911
                     /locus_tag="CYME_CMN183C"
                     /db_xref="GeneID:16995422"
     mRNA            <461399..>461911
                     /locus_tag="CYME_CMN183C"
                     /product="similar to histone H1"
                     /transcript_id="XM_005537267.1"
                     /db_xref="GeneID:16995422"
     CDS             461399..461911
                     /locus_tag="CYME_CMN183C"
                     /codon_start=1
                     /product="similar to histone H1"
                     /protein_id="XP_005537324.1"
                     /db_xref="GeneID:16995422"
                     /translation="MPEKASHPKYLDMVKEAIRKNYSVKGTSRQKIKSFIEQTYHIQA
                     LNSILRATLEKAATEGVIEKTSDGSRYRLTSKGRLSMEKKKEKKIRKPAKVTKSAVKK
                     ATTSKAKKPRKAAVKVKKVIKPSMKKTSAPKAKKLAKPSKKASGAVTKKSAAKPAKKV
                     SMKKAPKPSK"
     gene            <463439..>464347
                     /locus_tag="CYME_CMN184C"
                     /db_xref="GeneID:16995423"
     mRNA            <463439..>464347
                     /locus_tag="CYME_CMN184C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537268.1"
                     /db_xref="GeneID:16995423"
     CDS             463439..464347
                     /locus_tag="CYME_CMN184C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537325.1"
                     /db_xref="GeneID:16995423"
                     /translation="MSYIRTCSSLFLKLHHRAPQLVVLSCRPELVQRNPAQSAPAFVL
                     RSERRSMSPAFVLNSTFSVIGHYQTTRRIGYFLFQHSEQIGECTHLANVQPEALTTPV
                     RYHELLLNLILICNFDARILPESSDESTPSARYGAQSVGTGPDGIPQSVGMSRGVYDA
                     QLQMILNAGNHEQLPVISVRIFGSFIMVWRYVDAHDIAGPWMHAHHEEFLITYREQLD
                     TTRIVRLMIRFPMNSMEIKPSLVCNVTVCFVPFSPGLGEILSELYQYISRTRLNSSHL
                     LPGVRPNPLRRPHNIVDTHLWRCNEH"
     gene            complement(<467418..>468938)
                     /locus_tag="CYME_CMN185C"
                     /db_xref="GeneID:16995424"
     mRNA            complement(<467418..>468938)
                     /locus_tag="CYME_CMN185C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537269.1"
                     /db_xref="GeneID:16995424"
     CDS             complement(467418..468938)
                     /locus_tag="CYME_CMN185C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537326.1"
                     /db_xref="GeneID:16995424"
                     /translation="MSGVSTYTFYGRDFTPTNQARLLSQARNQSTGSARALFRHFEVQ
                     SSALAFSEERERALRHSGLTEALFVFARELDATGRRDYFVGTLDSFLYKSWRYVPRCF
                     SEVLREGFACKLFFDLEQRLCPDWADEHRSRVVQQLDAAVERLVRVVREAVRECAGAD
                     VGSRFLEVLELDSSIPAKYSRHLIFPGVLLHDNMAVGCFVRTRVLPRLENELPEGFID
                     ISVYSRNRCFRLPYSQKFGRDKVFEPTARWMGSILCALSTEEQRAQVLRTAMLTNAFY
                     ETSCSLELPLPRTGGTAPPVHSAKHTPSAPMPVSGLEPGRLRSLFPAIEDYVIEYARS
                     KDTSTWPRIRNWMYFASSRTLLLSMANHRYCARVRRQHQSNHVIYVVDLNQSVMFQKC
                     LDPECANWRSELHALPLVVLGPSCAAEAASATGAEDALDRAALEALTIVEACSGSEDA
                     LLYDLVTAAEVQYGGAKQWERATPVNDDGFLGLVEVCELSEDLCAIQMHVNADEFS"
     gene            469065..469148
                     /locus_tag="CYME_CMN186R"
                     /db_xref="GeneID:16995223"
     tRNA            join(469065..469100,469113..469148)
                     /locus_tag="CYME_CMN186R"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:16995223"
     misc_feature    469148..470792
                     /note="possible transcribed region"
     gene            complement(<470679..>471167)
                     /locus_tag="CYME_CMN188C"
                     /db_xref="GeneID:16995406"
     mRNA            complement(<470679..>471167)
                     /locus_tag="CYME_CMN188C"
                     /product="similar to steroid binding protein"
                     /transcript_id="XM_005537270.1"
                     /db_xref="GeneID:16995406"
     CDS             complement(470679..471167)
                     /locus_tag="CYME_CMN188C"
                     /codon_start=1
                     /product="similar to steroid binding protein"
                     /protein_id="XP_005537327.1"
                     /db_xref="GeneID:16995406"
                     /translation="MDAVGLWLLLGGGVFVLGALRLMGNHVENPAVQPPPRHHERPAP
                     RAFTGEELAQYNGTKGQPIYVAVQPRPGARAEVFDVSDARSFYGPGGPYFVFAGKNAS
                     RGLAKMSTEPGEVCGAIDDLTEHEKETLYQWFEKFLQKYEVVGHLREDPSGSGSSTNC
                     TA"
     misc_feature    complement(471355..472479)
                     /note="repetitive element"
     misc_feature    472481..473218
                     /note="repetitive element"
     gene            473166..475690
                     /locus_tag="CYME_CMN191T"
                     /db_xref="GeneID:16995407"
     misc_RNA        473166..475690
                     /locus_tag="CYME_CMN191T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461479.1"
                     /db_xref="GeneID:16995407"
     gene            complement(<473635..>476343)
                     /locus_tag="CYME_CMN192C"
                     /db_xref="GeneID:16995446"
     mRNA            complement(<473635..>476343)
                     /locus_tag="CYME_CMN192C"
                     /product="mutS family DNA mismatch repair protein MSH5"
                     /transcript_id="XM_005537271.1"
                     /db_xref="GeneID:16995446"
     CDS             complement(473635..476343)
                     /locus_tag="CYME_CMN192C"
                     /codon_start=1
                     /product="mutS family DNA mismatch repair protein MSH5"
                     /protein_id="XP_005537328.1"
                     /db_xref="GeneID:16995446"
                     /translation="MSSTMHSLGCGAPTRQSLIDETDGGEEIFLMTTVRKQRVGIAWC
                     STISLVIRFCEIGDSAPFSQTERTLRAIEPNLILTPANAIDEFRAMLTRVASQAVRDM
                     HRSEVQQIEAFPAERLTAVSGGLGDCLELADGGGPLVLLAADDVAPQRIEETIRWWQN
                     PVDAFAQHQLSVDVSGSSSPDRRAPLDDQGPVGQTCLGALLSFLAMRCDVDIHTVRAE
                     PFYMEQLAISPMSLLRELRVLPAKVSAPRSGARVHQHGLTLYQIISSFGASAPGQRKI
                     REILTQPICDPARIRERLEVVQALAGALASIDMILFRKLLKAVHHPQNLWRRLVSGAA
                     TAEDWAALHGCNVAVAGLFNGFSDLVQIVLPVWRERSAFLQENAQELTPVLDPEWYTS
                     VATRIGACIDMSGSKSGWNPAVKTGFDENLDNMRLALESLDSFLESVAQSEKSRYFGS
                     SATERSICVQFHPRLGYVMKISRSDAAQMESDASLEHALDTDTDAYVKNDRTRQLDEE
                     LGDLPGAINDLEKSIIRDLEAAVIPTIPVLSRTCDLLAEIDCWLSFALSAMRYEWTCP
                     QVLGAESACHIDVIDARHPIQELTVDSFVPNSLSVRRGDVCVVTGPNASGKSVLLRQV
                     ALIVHMAQVGSYVPARSARIGVTDRIFARVKSFDSTGRETSTFMNDCIQMAQTLRYAT
                     SRSLAIVDEFGKGTSDEDGRALAAAVLSELATNVTGQMTVLFATHFHEVTGTLYAQAH
                     ANSRLRFFKLEVLVQENRQTGDAPDQNDDVVLTALYKLSEGAPCLDSYALACARANGM
                     PDAILSRARKIRRFLQARALPPEASLESAATLQLPIRDACPARRYVRLQHIVRQVGIV
                     ASTAAAGSPNQAHATSPRVLHAVQQLLQDVSTGRIWACSESRPGNV"
     gene            complement(<477889..>479583)
                     /locus_tag="CYME_CMN193C"
                     /db_xref="GeneID:16995447"
     mRNA            complement(<477889..>479583)
                     /locus_tag="CYME_CMN193C"
                     /product="pepsin A precursor"
                     /transcript_id="XM_005537272.1"
                     /db_xref="GeneID:16995447"
     CDS             complement(477889..479583)
                     /locus_tag="CYME_CMN193C"
                     /codon_start=1
                     /product="pepsin A precursor"
                     /protein_id="XP_005537329.1"
                     /db_xref="GeneID:16995447"
                     /translation="MIRALAVLLVSVLCLAGAVGLLDNMVLGRGPAAVAELAGRDGIV
                     LPLEKRPGTVERIYSAPRRHGELAALLRPAVSGVPGGSSQEDKLPVNPLAGGIVNVGE
                     YYVAISVDNQTVHVQIDTGSSAIAFPLSQCKNCLKGDRRVTLANPDLTRISCSNESIC
                     KPSTCNSLCGACSEASKACCAPVDTKACGFRLIYGDGSFAIGALHVGRITLTQTGLSV
                     YPAYFGGILLDSASFEHVDVDGIWGLAYPSLACNPSCVPPVFDTMVRTGVVPRDMFAL
                     CLTDTSGALVFGGAAGPEMRKGEYRWVPMVNRAVRTYYEVGVESVRFGTDESAGLPEI
                     RSAIVDSGTTLIVISTSAFGTLREHLQSRYCDQVPGLCGEKTWLETGRCATLTDRHVS
                     RLPPINIRLAGGVELSVPPELYMLRAQKNGRTFRCFGIQHVTGELVNGRVILGDTFMR
                     AYVTVFDRENSRIGFAPAAENCGMPAAGDRGIVYTSSNATDMLPRAGSTKDIAIFGFH
                     VSRSAALLFGLVLAVALLLCLAAVIVRCIRSRRAAAQTDDPGPRADGSRTALLSDV"
     gene            complement(<482860..>484287)
                     /locus_tag="CYME_CMN194C"
                     /db_xref="GeneID:16995440"
     mRNA            complement(<482860..>484287)
                     /locus_tag="CYME_CMN194C"
                     /product="cathepsin D precursor"
                     /transcript_id="XM_005537273.1"
                     /db_xref="GeneID:16995440"
     CDS             complement(482860..484287)
                     /locus_tag="CYME_CMN194C"
                     /codon_start=1
                     /product="cathepsin D precursor"
                     /protein_id="XP_005537330.1"
                     /db_xref="GeneID:16995440"
                     /translation="MHLTSSAVRLVLAVLLWAVMLCEALTLAAAAATRVLPLEKRHQK
                     VAEVRPALLKYQHVRAGLEGALGSSAGGANFAPAVQRASAAAVFRAGAVEPLHGELLP
                     LGEYYARLGVDGQEIGVQIDTGSANLAFAVSRCLDCPRSDGIIRLSDWNATRVPCSDS
                     SVCLSGTCSALCGACSRRNEACCSFLDPESCGMILSYADGSYVFGALHQGPVSLPGAG
                     LSVRKAFYTAILYDSPTFERRNVGGIWGLAFQEAACSPSCPKPLFDIMFEEGVVARNI
                     FSICLSDTGGALILGAEADTRFRRGPYSWVRYLPRSLVPYYAASVKEFRVGPNGSNLR
                     SYADPVVFDSGTTLMALGGEAFTKVIQEIKSVVCAADAHLCHSRFWSEAPSCTLLSDA
                     AYRSFPDITIRFDSDATLNISRDTYLIRVELAGELYYCLGLEVLSPTGALVVIGDLVL
                     RRFTTVFNRENSSIGFAPSVPGCGQ"
     gene            <484766..>485695
                     /locus_tag="CYME_CMN195C"
                     /db_xref="GeneID:16995441"
     mRNA            <484766..>485695
                     /locus_tag="CYME_CMN195C"
                     /product="probable glycosylasparaginase precursor"
                     /transcript_id="XM_005537274.1"
                     /db_xref="GeneID:16995441"
     CDS             484766..485695
                     /locus_tag="CYME_CMN195C"
                     /codon_start=1
                     /product="probable glycosylasparaginase precursor"
                     /protein_id="XP_005537331.1"
                     /db_xref="GeneID:16995441"
                     /translation="MGTAHESLVVATWEFSQSGVESCFDCLRKGGKPLDAVETGIHVV
                     ELEPTVTSVGYGGLPNANGELELDAAITDGAHFGAVFALRGYRSAIGIARGVLERSEH
                     TALAGNGAVNFAQEVLGEAPLPDSELLTEHARRRLAEYRAGRFQGRPNESHDTVGMIA
                     AQSTGDIAAGCATSGYPFKRPGRVGDSPLPGGGLFCESGLGAAVATGDGDDLMRLCPT
                     HLIVELMRNGQSPQRACEEAVQRVMRYREQTGRDCRGAFIAVRCDALAWGAHATHEGF
                     VVAHADGRRMDQSLLIPVEVPEARNKPWRRVCV"
     gene            complement(<486786..>487412)
                     /locus_tag="CYME_CMN196C"
                     /db_xref="GeneID:16995401"
     mRNA            complement(<486786..>487412)
                     /locus_tag="CYME_CMN196C"
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /transcript_id="XM_005537275.1"
                     /db_xref="GeneID:16995401"
     CDS             complement(486786..487412)
                     /locus_tag="CYME_CMN196C"
                     /codon_start=1
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /protein_id="XP_005537332.1"
                     /db_xref="GeneID:16995401"
                     /translation="MHAANLVSLARLVTAPVIGGLIVNDYYSIAALAVAAAGVSDVLD
                     GYLARKYQKVTTLGSILDPVADKVVINATAAALSAKGVLPLGLVGVFLARDSLLILGG
                     AYFAVKLYREARRRDAAVGQPARSQSSDAWPYRVAPLFISKLNTFGQFCTISYASLGA
                     AMGTGDDDPVLQALCWVVGSTTVLSGALYARAVLKAPSGYPSSILRKV"
     gene            complement(<489580..>490053)
                     /locus_tag="CYME_CMN197C"
                     /db_xref="GeneID:16995402"
     mRNA            complement(<489580..>490053)
                     /locus_tag="CYME_CMN197C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537276.1"
                     /db_xref="GeneID:16995402"
     CDS             complement(489580..490053)
                     /locus_tag="CYME_CMN197C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537333.1"
                     /db_xref="GeneID:16995402"
                     /translation="MPWTLFFGFAVADCAAHRTSYVPKACARLKRLRCPVKRLSLRCR
                     GKSRGSTHLHLQLREPPLRRRTVRAAAQDALQVYRALKPPWCQPWTILLFGEACITFS
                     WCLLPFRPYSAIITSVLILVWWYVFLWEYPRIAKATLHSFRSTASRGRKNPQDDP"
     gene            <492106..>493344
                     /locus_tag="CYME_CMN198C"
                     /db_xref="GeneID:16995435"
     mRNA            <492106..>493344
                     /locus_tag="CYME_CMN198C"
                     /product="galactokinase"
                     /transcript_id="XM_005537277.1"
                     /db_xref="GeneID:16995435"
     CDS             492106..493344
                     /locus_tag="CYME_CMN198C"
                     /codon_start=1
                     /product="galactokinase"
                     /protein_id="XP_005537334.1"
                     /db_xref="GeneID:16995435"
                     /translation="MPTLETVSTEALVQRGITLFRKCFPNSGEPTVASAAPGRVNLIG
                     EHTDYNEGFVLPMALEDRETVFVGTSFLDSGFGSLPRARLVSELCPDQPVEFALRNIS
                     PGEAYAGPAWANYIRGMVAQFLERSVRVPSFDAVVVSEVPLGGGVSSSAALEMACAVF
                     LQEITGVSLDPVERARMGQRVEHLYAGVPSGIMDQLISAAGVAGSALLIDCRTLETRA
                     IPLDDPEMVIVVVNSNVKHSLADGEYGRRRRTCEQAAAALNVASLRDATREQLEASRT
                     RGILGPPEEKVYERALHVIEENNRVLHAVSALQERDYVRFGKLMYESHESLRTNYQVS
                     CDEIDALVEIARQVPGVYGSRMTGGGFGGCTVTLVRADAVAMLLERIEALYPKRTGKH
                     PTSFISKPGPGSRPLAIEHS"
     gene            complement(<493375..>496629)
                     /locus_tag="CYME_CMN199C"
                     /db_xref="GeneID:16995436"
     mRNA            complement(<493375..>496629)
                     /locus_tag="CYME_CMN199C"
                     /product="DNA polymerase delta, catalytic subunit"
                     /transcript_id="XM_005537278.1"
                     /db_xref="GeneID:16995436"
     CDS             complement(493375..496629)
                     /locus_tag="CYME_CMN199C"
                     /codon_start=1
                     /product="DNA polymerase delta, catalytic subunit"
                     /protein_id="XP_005537335.1"
                     /db_xref="GeneID:16995436"
                     /translation="MVPQQFSPDPYEPNDALDDDSFEVDVDEAAYLTNCEPVLETTGG
                     ALSGHETDQESIEFFRRLCGRPAARTSLLSASESLLFNQVTCDYVVERHRAAEPHTTV
                     RVYGVTLSGESVLLCVQGFAPYFYASAPKGFGDGALGELRAELEHKCRTMGRVADCSG
                     DCILGVERVRRRSVLYYKPGEDDSEFLRITVRTPDLVRVAAGLLSQGSVLGRVFDVFE
                     SSVDFVLRFMIDTKMMGCSWIEVPAGSYTVVSNALSPSYAQIVAEAHWQSVVCHPPSG
                     EWLRTAAFRILSFDIECAGRKGIFPEPENDSVIQIGCHLGEYGKTEPLVRAIFTLGSC
                     APVAGVQVISLNREQELLQSFRNFLVAADPDIITGYNIVNFDLPYLLNRASAIGASRF
                     PYLGRICRERTTMRRTRLSSSAFGTHESMTFSIEGRVIMDMLQVIIRDHKLRSYSLNS
                     VSSEFLNEQKEDVHYSIITDLQAGNEHTRRRLAVYCLKDAYLPLRLMDKLMSLTNYME
                     LARVTGVPLDWLLSRGHMVKVVSLLHRKAHEADLLVPDLPRTEAGGRSGDGGPQYEGA
                     TVIEPKKGFYRTPIATMDFASLYPSIMMAYNLCYSTLVHESDVPKLKPDDYIRTPLGH
                     CFVKPSVRKGILSEMLEEFLASRKAAKRDMQNATDPFLREVLNGRQLALKISANAVYG
                     FTGASVGKLPCMEISASVTSYGRNMIELTRSTVERLYPGAEVIYGDTDSVMVKFNDHA
                     TLEQVMELGREAAKQLTNIFPPPVRLEFEKVYYPYLLISKKRYAGLYWTRLERHDKMD
                     CKGIESVRRDNCRLVANVVDTVLQKLLIEQDVDGAIEFVKKIVSDLLQNRIDLSLLVV
                     SKTLTRATTDYEAKQAHVFLVEKLRKRDSGSAPSLGDRVPYVIIKGATKNEKAYTRAE
                     DPIYVLENSIPIDAHYYLENMLRKPLERIFSAVMKRPETLFSGAHTRSIQVATPRTGS
                     GIMKFAKFRLQCVRCRAGINEAELQKRGLKGSALCEHCRDFEAETYLRHLKQTAELEQ
                     LFSALWTQCQECMGSCIQDVLCSNGDCPIFYRRRKVQKDITEAQTILGRFGDVW"
     gene            <499329..>500360
                     /locus_tag="CYME_CMN200C"
                     /db_xref="GeneID:16995433"
     mRNA            <499329..>500360
                     /locus_tag="CYME_CMN200C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537279.1"
                     /db_xref="GeneID:16995433"
     CDS             499329..500360
                     /locus_tag="CYME_CMN200C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537336.1"
                     /db_xref="GeneID:16995433"
                     /translation="MVSVTVRLRDPRGTRVLQIDENQTVEGLKALLKEQTGLKSFRIL
                     RGFPPNLLIAAPEERVGNVLESGDLLTIEAAQQQEQDVYSAASGSGSAGSSGFGAYGA
                     DRSIHDPACQEASTQAGPSPVRSAVASPHRPLAATAPSFERVVVPDDNSCLFRAVAFV
                     LKQLLGGIELLPEELRELVAQAVAADPWTYNDAVLGKTNEEYQDWIKRPTSWGGAIEL
                     GIFANHFGVQIASFDVRTTRMDVFGEAAAYPSRVYLCYDGIHYDPLALRSHPDESTDD
                     LLTVFPSSDGESEALAAELIQTLHASRSFTDTANFLVTCRECGAQLRGEAGALEHARS
                     TGHAGFIEQ"
     gene            complement(<500652..>501803)
                     /locus_tag="CYME_CMN201C"
                     /db_xref="GeneID:16995434"
     mRNA            complement(<500652..>501803)
                     /locus_tag="CYME_CMN201C"
                     /product="GTP-binding protein of Era family"
                     /transcript_id="XM_005537280.1"
                     /db_xref="GeneID:16995434"
     CDS             complement(500652..501803)
                     /locus_tag="CYME_CMN201C"
                     /codon_start=1
                     /product="GTP-binding protein of Era family"
                     /protein_id="XP_005537337.1"
                     /db_xref="GeneID:16995434"
                     /translation="MMFLQASGLLLGFPYRQSKNKFLCISRVVPVRGSRFLRPQRHPG
                     GVLKVRGEGRSDLEASETRRGDLSVAPESRCCFVSILGPSNTGKSTLVNAMVGSKVAI
                     VSPKVQTTRFQVRGIAIEETLHAQIVFIDTPGVFLPKRKFDQAMVKSAWEASRGADIV
                     LVMLDGNRYHHFRKLSHAETSIAERLSRIDKEELAKTPILLAVNKIDLIPRKDLDAVR
                     DGLLHEMGGPERIREVHQISARTGEGVFELRRRIAELAPLGPWHYDREQLTDIPERLL
                     AAEVVREQLYLQLRQELPYECAVETERWESKEDGSVVIGCVIYVKRQSQKAIVTGAGG
                     VRIKSIGVKARMELERLLGRRVHLLTLIKCRKWDENPVLYRQMGLDFRA"
     gene            <501918..>503159
                     /locus_tag="CYME_CMN202C"
                     /db_xref="GeneID:16995428"
     mRNA            <501918..>503159
                     /locus_tag="CYME_CMN202C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537281.1"
                     /db_xref="GeneID:16995428"
     CDS             501918..503159
                     /locus_tag="CYME_CMN202C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537338.1"
                     /db_xref="GeneID:16995428"
                     /translation="MFIVSATCCSLGKRQARSFLGRCWKGTGAGCAFRSGNCGLRAAT
                     GCSLRACSSELDASSDAVRAGDNFGQRASDADQGRPVHQVGRQTEGERFAVRRALRVF
                     LKFTRPHTMLGSAVSICSLSLMGSVSAGQALGAATLPLWTQLFPVLLVGLVPALLMNI
                     YIVGLNQLCDIPVDRVNKPYLPLASGELSVPAAVSLVGMCLLGSFSLGFWLPQSTAAL
                     RFALVASCILGTLYSLPPIRLKRFPLLASLCILVVRGAVVNIGFYLHARSAVMSLRGP
                     WLAELSPLIKFTTVFFAAYGIVIALMKDIPDAKGDNQHQLSSFTLQFGERNIFRFCVT
                     MLIFMFIAGGIFCMSSALATVPRHRAFAAGGFHFVAAAWLRWRSRASMMEAHRSEVVY
                     NFYMDIWKLFYLEYVVLPLLL"
     gene            complement(<506992..>507954)
                     /locus_tag="CYME_CMN203C"
                     /db_xref="GeneID:16995429"
     mRNA            complement(<506992..>507954)
                     /locus_tag="CYME_CMN203C"
                     /product="cytochrome c reductase Rieske iron-sulfur
                     subunit"
                     /transcript_id="XM_005537282.1"
                     /db_xref="GeneID:16995429"
     CDS             complement(506992..507954)
                     /locus_tag="CYME_CMN203C"
                     /codon_start=1
                     /product="cytochrome c reductase Rieske iron-sulfur
                     subunit"
                     /protein_id="XP_005537339.1"
                     /db_xref="GeneID:16995429"
                     /translation="MQTTAALLRAFRRSVQTTHILSRSGFLGCVGLCAVEAPRAANEP
                     VRCGPERRLLYEAAATARLLSSSVTCAGLRLSSPETSSSHLSSVQNGALLAAEALRKS
                     QRAALTSSSSDSVAPLAGDGAVASRAPQSTALPVGYADEYFREPHLLPRGDPTRRAFT
                     YMMLGSAKLVAASAVRVLLLKFIYTMSASADVLALGTVEVDLSAVPLGQTATIKWRGK
                     PVMIRHRTPEEIEAARRDDNAPLRDPETDASRAINPEWLVVVGVCTHLGCVPIANAGD
                     WGGFFCPCHGSHYDVSGRVRKGPAPLNLEVPTYSFTDDGKIIIG"
     gene            <508054..>508470
                     /locus_tag="CYME_CMN204C"
                     /db_xref="GeneID:16995403"
     mRNA            <508054..>508470
                     /locus_tag="CYME_CMN204C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537283.1"
                     /db_xref="GeneID:16995403"
     CDS             508054..508470
                     /locus_tag="CYME_CMN204C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537340.1"
                     /db_xref="GeneID:16995403"
                     /translation="MTTSNALSGGKPSRPSPPEKGSFPLDREGLCADFARAVIRCLRE
                     REGRTAACRGEELAYLECRMNHGLMTPESPADLGFDEENDRALSAVNERDDGKEQLKV
                     SDGAYVAGLRYHRSRRRHREQEGQRPGSSREESPEG"
     gene            complement(<508624..>510693)
                     /locus_tag="CYME_CMN205C"
                     /db_xref="GeneID:16995404"
     mRNA            complement(<508624..>510693)
                     /locus_tag="CYME_CMN205C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537284.1"
                     /db_xref="GeneID:16995404"
     CDS             complement(508624..510693)
                     /locus_tag="CYME_CMN205C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537341.1"
                     /db_xref="GeneID:16995404"
                     /translation="MDSTALGRRGTQTYLAEAGRNIPELETGTRAAEELGTVSLSPWV
                     AQLGNSNGSLFGLGLDKGLSLHQLPSLLFGSSTLLGHTQTGGAVQKLGSDTGTDWCLA
                     IEGTSRDHPAPGLTRVAALPRTENSNNANFGTGSSLRPDMQGAGTAGSTWKRSAGWMR
                     WRGAGLKRQEVTAAHRSPAAARAATTASELASDGTKHLPKTDGAPSVNIGVWSEHEIE
                     MFYKALLQVGRDFQAMARIIRTRSASQVTGVFHRCLRRAIDPVKRAAMISPEIAEIAE
                     SMHLFDRVLQPDLQIRTLLAARQLETRGIQNKDGVRSIADQTATAFGKCASTSDACSW
                     AAALLSLLRQEPTAETAASARPESSAAWLNRAGAGAYAALRERDSHHTEPGHMVDIEP
                     DRILRKALTNTRDGKNLNMEVSLQIVPLPRSPEEIKLEQWNRNPRILLTLRLKKRFAA
                     VFDHLAEKWASCIASSVQTSNEMREQLPPAHLLRLRVCTDEAYRTGTAEFDELWNANA
                     CRMARANGLGHWMRRSDEGEQLLVSEIHRLCGSPSHIRLQYAWISACGDSESALAPES
                     FEPRTAVANACDAACVAYSKPPAVCTSCTPPRFPQDAVETGAKLEMSSRENNQQWGRN
                     DVHREGRDGVGSTSIQTAGQRTLDDAQASTDSLLRSLLYGVQASESNFTNDGYTSGNA
                     SNMVYVP"
     gene            <511296..>513164
                     /locus_tag="CYME_CMN206C"
                     /db_xref="GeneID:16995431"
     mRNA            <511296..>513164
                     /locus_tag="CYME_CMN206C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537285.1"
                     /db_xref="GeneID:16995431"
     CDS             511296..513164
                     /locus_tag="CYME_CMN206C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537342.1"
                     /db_xref="GeneID:16995431"
                     /translation="MACVQGTFGYRSGTNEGSAASEQICCFAGEAAVVLSALQQALRD
                     RLLRQAETITDSGPQAAGVGASAVPEGLGHDVAGRVAAQLDLGDLDPEQRRLFLERLV
                     EHQRRFVQYAQRELSEKVAKIQSVYPYLCHEECVAAMNLISEERRELDDNIAVLGVED
                     EAVTRLADRGFELVVRQEVAFRYMKEVSAAAASGGALAPGPPLDARAGGSGMRRKPSN
                     RGTSRKSNSELMLEGVRIGRRQDGRLCLDEALRRMQQTGSFDGWSEARIKAWLNKDAN
                     PNAYYYRFNDPGEEQRNGKWTKQEHERFMQRLKECHIGENYEWGIFSMALPGRVGYQC
                     SNYYRTLLKRGIVKDDNYYFNEKGEPKFRFKTKSGVQLTSDENGTSCAVSNAARVATK
                     RSGQRRLAKRKQSLWDSDDSDSAADDDETEYVPNHAVSAQSVRRSARSRRIVNYADVE
                     DGAPANAGEMEMHPDGTAAVGSGTNPKRSRRDTESGAPNNELRMISQVTASASDSGES
                     SLRSSLKDSSTPSEYSDKAGALCELNGNEFRSRSHARDSDNPLPDFIDVITMEPVRRP
                     AISPSGHVLGYLTWRRLLQQHPRNTCPFTKKPLRLADLTLLTHENIHEYTHRIVGR"
     gene            complement(<513170..>514873)
                     /locus_tag="CYME_CMN207C"
                     /db_xref="GeneID:16995432"
     mRNA            complement(<513170..>514873)
                     /locus_tag="CYME_CMN207C"
                     /product="similar to ribulose-1,5 bisphosphate
                     carboxylase/oxygenase large subunit N-methyltransferase,
                     chloroplast precursor"
                     /transcript_id="XM_005537286.1"
                     /db_xref="GeneID:16995432"
     CDS             complement(513170..514873)
                     /locus_tag="CYME_CMN207C"
                     /codon_start=1
                     /product="similar to ribulose-1,5 bisphosphate
                     carboxylase/oxygenase large subunit N-methyltransferase,
                     chloroplast precursor"
                     /protein_id="XP_005537343.1"
                     /db_xref="GeneID:16995432"
                     /translation="MVCAFAPAGGCHGSSIVGIQQRSSLWRSNDRARFSAGRHSRPTE
                     FFRAARSKRWRRELRAVAEMPGASKTSSRLEAFVKWLAANEVFVSDKATWGRASHPLV
                     VAEQTLIESEPAGRGFLARRDIQAGEVLFQVPFHLCFTKDVAVRRFAALNVPELADEE
                     EFFALATLLLYERGLDESWKKSGRGPGSFWGPYLDILPPVPWEFKGAEPAESLSMDPL
                     DALWLWAEDEMQWLQGSPTLLSARALRSKVEREYAEACERLYRRHPHIFDLEGAFRLE
                     RFLWAFGVLFSRAVSLPAENGMLALVPYADLANHSAFCVSFIDARTAAFPYAFRASSK
                     QKRGQWWQRFLAPNSDDAGAVANTDSSHYREDAQREVVAYADRFYDKFEQVYVSYGQK
                     SNAELLLLYGFVSDRNPYNSVEVCVSLSGSEAAGAGLLDRKRSFLLACGRDPDKPECF
                     PLYADRYPLELMQLLRFASLTEQDAAGYSDLEQIDVAQPVNRENEIAAKSALLQACKI
                     ALQAYPTSADEDDAALKDKSMAQLLSRKQRLSVRLRRSEKRILERTIAGLEREIQDLR
                     C"
     gene            complement(<515227..>516066)
                     /locus_tag="CYME_CMN208C"
                     /db_xref="GeneID:16995430"
     mRNA            complement(<515227..>516066)
                     /locus_tag="CYME_CMN208C"
                     /product="20S core proteasome subunit alpha 1"
                     /transcript_id="XM_005537287.1"
                     /db_xref="GeneID:16995430"
     CDS             complement(515227..516066)
                     /locus_tag="CYME_CMN208C"
                     /codon_start=1
                     /product="20S core proteasome subunit alpha 1"
                     /protein_id="XP_005537344.1"
                     /db_xref="GeneID:16995430"
                     /translation="MSRGTSAGYDRHITVFSPEGRLFQVEYAFKAVKLPGTTAVAVRG
                     TQCVCVAVQRKLPDRLVEPDSVSSAARISEQHGVVFAGLATDGRAQVQRLRAEASEFR
                     YENGYEAPVSYLATRLADINQVYTQHAYMRPLGVTLLFLGWDDHEGGYSGPRLYKVDP
                     AGYCIGYRACAAGAKDVEAQNWLEKRLREKQEELSEEQRDRLAVSGAAVQAGYGAPLC
                     DIPLSDDETLELAIGALQSVTSAELKPSDLEIAIVTKEKKRFRVLTEQEVDGVLHRLS
                     ERD"
     misc_feature    516386..518919
                     /note="repetitive element"
     gene            complement(<520168..>521142)
                     /locus_tag="CYME_CMN210C"
                     /db_xref="GeneID:16995426"
     mRNA            complement(<520168..>521142)
                     /locus_tag="CYME_CMN210C"
                     /product="eukaryotic translation initiation factor eIF-2
                     alpha subunit"
                     /transcript_id="XM_005537288.1"
                     /db_xref="GeneID:16995426"
     CDS             complement(520168..521142)
                     /locus_tag="CYME_CMN210C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-2
                     alpha subunit"
                     /protein_id="XP_005537345.1"
                     /db_xref="GeneID:16995426"
                     /translation="MVNLQCRMYENPFPDPDDLVIAVVRDIQEMGAYVTLPEYADCQG
                     MIMLSEVSRRRIRSINRLLRVGRQEVCMVVRVDQEKGYIDLSKRRVSPEDVQKMEEKW
                     SKSRTVHSIMRHTAESVGVDLEDLYKRVGWPLYRKYGHAFDAFRLMVADGNIDNPVAV
                     EANVSSVLGSLDIGPEEKEELLKSIRRKLTPQATKIRADIDVTCFDFEGIDAIKEALR
                     LGTECITQTSNSVKIRLLAPPTYILTTSALQRQEGLEALAKVIEVIRNEIEARRGKCV
                     VKVAPRVVSERDDRLLSNLMEELELRNREVPADDEGDDDSESSASDSD"
     gene            complement(<524281..>525576)
                     /locus_tag="CYME_CMN211C"
                     /db_xref="GeneID:16995427"
     mRNA            complement(<524281..>525576)
                     /locus_tag="CYME_CMN211C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537289.1"
                     /db_xref="GeneID:16995427"
     CDS             complement(524281..525576)
                     /locus_tag="CYME_CMN211C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537346.1"
                     /db_xref="GeneID:16995427"
                     /translation="MGAVEQLVYAELQARIIRNKYSPSPEERETLEKCRSKALRSAFF
                     GGGAAAVIAWLFLSRPLSTSWGALGLLRFNLWRQSPLGRNGGGWQSRSSGSVAPDSLG
                     RSGFGETGGSPSSGPAADAGPHPEGSQTLPHSAASRVTRADRAPAWRRGVLVTCGTLI
                     GAYYGAQRTGTYCLEDLLALGPRSAMANEIRFILQDAKQSLELVGSSPNYSSTAAESG
                     ELADGASSPELAANEDAPMAGPGRTGAGLLTERAMKILQQSIRRDEIEHWLRQHDTTA
                     PFDNDQVSLEIETPWQLETDRASGSAWHATDAPGTLSVEDTPSARAEDSLTVGFGRSR
                     PDGGAVAGLRPRIGPSLPERPVSSVAPKRREAVRGGELPNLVESQVQSRTDILSASDA
                     HANDGVDDSVEDQVPGRVPWSVQTAEPKPSLADEVRKAE"
     gene            <527594..>530344
                     /locus_tag="CYME_CMN212C"
                     /db_xref="GeneID:16995444"
     mRNA            <527594..>530344
                     /locus_tag="CYME_CMN212C"
                     /product="similar to diaphanous-related formin"
                     /transcript_id="XM_005537290.1"
                     /db_xref="GeneID:16995444"
     CDS             527594..530344
                     /locus_tag="CYME_CMN212C"
                     /codon_start=1
                     /product="similar to diaphanous-related formin"
                     /protein_id="XP_005537347.1"
                     /db_xref="GeneID:16995444"
                     /translation="MWLRTVRGKANRRQHEQQLAPQQTESALLNALTVRDEGERGVSK
                     QGTATADPSDAERQLRLALAASQQEVSVLQRVLRDMEIDQSRKVASARHTWRPGESRA
                     PDSRRSGREELRAVTLELQELRERNAQLEREIERAHSKDGQLVQRTSDDGYVRQMRAR
                     LRQKEAIMEAERERFQCLEREHRQLQKETLALQQDTELLLNEYESAQQIILSLRKELK
                     HYALQEQHQSIPEARKRDAPAQQLKAGGPHERGKAHALKDFAQQEVGSASVLDHMMQP
                     MLEKEFGEECIRCERCGARMRLPVCNIRSAGATADVPTRDTTQTGAHNKFSQEAPSEQ
                     KENPQGQCPEAGSSLGPQDIRSCSATDPTPPPPPPPPPPPTSLGAQAGRLSGQEVESA
                     GGPPPPPPPPPPPPPPPPPPPLHDAPKSIQNEEKHFVRKSGSMDALQPRKPPIHPRVE
                     MRSFFWKRIILPASSSSRSSNDQAANKPDETIWSQIHEVPFDLDEFESLFARKPPSKN
                     KQAVIPGNGSEKTMPLQGNRDQRSRALDQSSVLLEHSGLLNASSSGTGSRRTAADEPA
                     LLDPKRAHLIGLLTASLPPIERVKEALLRMDEQALSRGDCDALMKIIPTDEEASRLLQ
                     VHPGRALNKTEQYLRELARLRSAPIRLRALIYRQSFEERAEQILAPLETIQTACRSIR
                     SSDALRTILAVMLSLGNYMNGGTSRGQADGFELISALDKLGDTKALDGQMTLLTYVAC
                     ICGRFFAEERPPNDSRGEQRRAGQRTNTDGECKALSSLEKLQRSCRAAARESLKDVQT
                     EVAGMRTELEALLDSIHLAVNDTKQCPRGSSDAHENSQLAHCMEAFAREAREALHDIQ
                     ETVRLAVQEYQRTLRFLGYSSAEAQSIQPEEFFGPLSRFLERFRNCLGGRLTRKEAVT
                     GR"
     gene            complement(<530403..>530957)
                     /locus_tag="CYME_CMN213C"
                     /db_xref="GeneID:16995445"
     mRNA            complement(<530403..>530957)
                     /locus_tag="CYME_CMN213C"
                     /product="similar to molybdenum cofactor biosynthesis
                     protein C"
                     /transcript_id="XM_005537291.1"
                     /db_xref="GeneID:16995445"
     CDS             complement(530403..530957)
                     /locus_tag="CYME_CMN213C"
                     /codon_start=1
                     /product="similar to molybdenum cofactor biosynthesis
                     protein C"
                     /protein_id="XP_005537348.1"
                     /db_xref="GeneID:16995445"
                     /translation="MLRHWAFAGTFGSLRQSLRRYSVLSHLNERGEARMVDISTKEAC
                     FRKAQAEASLNIGDQGVFTALLQGALPKGDAFAVARLAGIQGAKQTSTLVPLCHPALP
                     LDMVNVELDPDPQTLSVRIRVQVSATAKTGVEMEALTGAAAAALALYDVCKGGFKACT
                     EIPHGTLCIQRITLLSKEKRKQYE"
     gene            530594..532328
                     /locus_tag="CYME_CMN214T"
                     /db_xref="GeneID:16995455"
     misc_RNA        530594..532328
                     /locus_tag="CYME_CMN214T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461480.1"
                     /db_xref="GeneID:16995455"
     gene            complement(<532403..>534031)
                     /locus_tag="CYME_CMN215C"
                     /db_xref="GeneID:16995456"
     mRNA            complement(<532403..>534031)
                     /locus_tag="CYME_CMN215C"
                     /product="phosphatidate cytidylyltransferase"
                     /transcript_id="XM_005537292.1"
                     /db_xref="GeneID:16995456"
     CDS             complement(532403..534031)
                     /locus_tag="CYME_CMN215C"
                     /codon_start=1
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="XP_005537349.1"
                     /db_xref="GeneID:16995456"
                     /translation="MRSGGPDAAGMEARRTRNGRKELSQVPKAFVNQSLHICSETEPD
                     TTSGSDTDDTAETNEHRRQPEVETPYSARKLHTRTAEHAWEAGESTPPGSLRRQALPW
                     EQRRVRSRPVDTATGDGSTALQGLRGGHSLREVRAKSDGLLQKLRSFAVRAVFTLVML
                     TIFTRIVYLGHQKVALMVFVLQALIAKEVLSIGYLQASKRRIPLFRTINTWFLLSAMY
                     FIYGKRTLSHFYDKRFAFMTKRPLVFLLMHHTFVSFWLFLIGFMMFVLSLRPGCYRHQ
                     LNEFARMLMLLLVVVAQANFIIFNIKEGLIWFLLPALMIITNDIMSYCVGFFFGRTRL
                     TALSPKKTWEGYIGGAIFTFVAGILLTHHLSRFEYMVCPKTDFGDCDILRPDPPLHCS
                     VPPTFLPQPFAVPSWARPFLKRDVLLIKPIIIHGMVLAAFASTLGPFGGFFASGVKRA
                     FRVKDFADLIPGHGGVTDRMDCQLLMGAFTFVYRLNAVSVSAPDVGNLLAYIADLSFQ
                     EQLELHRALSSMLESRGLIRSAQWSVPSGNASVT"
     gene            534330..536227
                     /locus_tag="CYME_CMN216T"
                     /db_xref="GeneID:16995457"
     misc_RNA        534330..536227
                     /locus_tag="CYME_CMN216T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461481.1"
                     /db_xref="GeneID:16995457"
     gene            complement(534397..536448)
                     /locus_tag="CYME_CMN217T"
                     /db_xref="GeneID:16995452"
     misc_RNA        complement(534397..536448)
                     /locus_tag="CYME_CMN217T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461482.1"
                     /db_xref="GeneID:16995452"
     gene            <536233..>536877
                     /locus_tag="CYME_CMN218C"
                     /db_xref="GeneID:16995453"
     mRNA            <536233..>536877
                     /locus_tag="CYME_CMN218C"
                     /product="similar to maf protein"
                     /transcript_id="XM_005537293.1"
                     /db_xref="GeneID:16995453"
     CDS             536233..536877
                     /locus_tag="CYME_CMN218C"
                     /codon_start=1
                     /product="similar to maf protein"
                     /protein_id="XP_005537350.1"
                     /db_xref="GeneID:16995453"
                     /translation="MILHKLEYLRKKTILLASQSPRRREILRLLGLEPVVVPSGFDEE
                     SLDKGVFVTPAAYAEENSRRKAFAVLEKLKDRNALKVETEPLKPDFIVSSDTIVVLDG
                     HILEKPTDEGDAFRMLQLLSGRKHLVISAVTVLNVINLESRTFHMETEVEFAELTPEE
                     TWAYIRTGEPMDKSGAYGIQGYGGALVRRIEGDFFCVMGLPMHEFCKVLSEMLD"
     gene            complement(<537925..>539115)
                     /locus_tag="CYME_CMN219C"
                     /db_xref="GeneID:16995454"
     mRNA            complement(<537925..>539115)
                     /locus_tag="CYME_CMN219C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537294.1"
                     /db_xref="GeneID:16995454"
     CDS             complement(537925..539115)
                     /locus_tag="CYME_CMN219C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537351.1"
                     /db_xref="GeneID:16995454"
                     /translation="MIGFAYPGAWSLCPSVAVAARSSSRVDAKGTGRRRRGATAPLIT
                     LQESSSIPSSDSGESHADIPSVLPMRPRKTQEQLKAELRAISERRERMRKQAMKALDD
                     LRSQLDELLQEVRAKMRPEEGKAASGQEAVRAQVGRKVAVSDAELFVEPEQDTTGWYQ
                     LPRTGLNDAGDDYANSVTYTAASTPNLDEMGQQLQGDEYSAPAMELPIQKSEPAQMIV
                     ECDINGCCSLIVRDGDHSAPRGVRPQYVFSGPGFKIGHDPAAPPSDCALVGDDHWTIA
                     LSREEFRHFRRLVQALQYKMGDIMNGVASKPTAQGVPVHSGDGFCKERISWNASDGES
                     SRIVAEFESSLMWLGASGSPYSYDLRLILLGRERIVEGLWPAQVVPSLCAKLMELEEP
                     EALM"
     misc_feature    539661..541126
                     /note="repetitive element"
     gene            complement(540812..542588)
                     /locus_tag="CYME_CMN221T"
                     /db_xref="GeneID:16995448"
     misc_RNA        complement(540812..542588)
                     /locus_tag="CYME_CMN221T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461483.1"
                     /db_xref="GeneID:16995448"
     gene            <541695..>544391
                     /locus_tag="CYME_CMN222C"
                     /db_xref="GeneID:16995449"
     mRNA            <541695..>544391
                     /locus_tag="CYME_CMN222C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537295.1"
                     /db_xref="GeneID:16995449"
     CDS             541695..544391
                     /locus_tag="CYME_CMN222C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537352.1"
                     /db_xref="GeneID:16995449"
                     /translation="MVAFLQSGAFPLNGKLWSWTASPKGRPLRCERTRKLSWRRGRGS
                     WSVRASHSGETDPRLVQLGGTDRTGTSGDHERLLWEALERDVSEAETVGKLPQPLRTE
                     LLSKIREFVEEVAQRQSVHDLKSADFALKDEALAPDSQWQLVEPNEPSDAVRSTQPRR
                     ASSFGPAADCLTQSPRDRLASQPGGADFNQNGQERLAGINTSGVDSPEKRSVCPPTAV
                     HRRSTVSVHAEEWTWSDDSAYDPVDGANEYRPEQQLNSDTPNPIRGSAKDPSERDIKA
                     QESAHHATEDREILSELSEVEHANDDRTLDTRDAYGRMQQRLRPASRTQMRMDVPGND
                     TQRAREDARIGPEQPVSQASMRPGKRYRRRTGNGTRVGIATPEPEQPPASRALPERLA
                     KDAHDSATDEEVFRLARMYYAQFRGMLSLALREVSECNAERWNRRERLTSRLRSTLEG
                     AIALLGEAGTERLVTTNDMNDLLSCLAGLRFLDELEEVLELMESRNIPRDNRTYTLVL
                     DALCKAKRIDTAIDIFENYVVRGAAQDGAPCGGRHQRASRVHPTLVMYNILIGGCART
                     LRLDKAFEFFERLQSPPDNFSPDTHTYCALLDACARCSNTELALHVFEEIERKGEQID
                     SAVYGALLAAVARSGDRRLAFAVRGLMRRRGLAPTTAVFANLMELCAADGDYLSGFAL
                     LREMRAWGRDPTHPIYVNLMNACGRSGQPEYAMAVLDLMKSNGVAPSESAYCALIDAW
                     ARIKRLDRAFGVWRDMRAGGFEPRLRTASALLSACRRCKNLQVAHWLYQALRAELARE
                     RRTAETSEDGTNSLASQQVQIFRTMMELACDVGDYRHAVLIYLTDAAQSGLLESKHAR
                     LALRSSLRRLRQAVFRCSASGDDMETLRNAFRNLVDARAAQI"
     gene            <546799..>547050
                     /locus_tag="CYME_CMN223C"
                     /db_xref="GeneID:16995464"
     mRNA            <546799..>547050
                     /locus_tag="CYME_CMN223C"
                     /product="mitochondrial F-type ATPase F1 subunit epsilon,
                     precursor"
                     /transcript_id="XM_005537296.1"
                     /db_xref="GeneID:16995464"
     CDS             546799..547050
                     /locus_tag="CYME_CMN223C"
                     /codon_start=1
                     /product="mitochondrial F-type ATPase F1 subunit epsilon,
                     precursor"
                     /protein_id="XP_005537353.1"
                     /db_xref="GeneID:16995464"
                     /translation="MPQYWRVAGLSYLQYANVCAEYVRRVLKEPERTKALSRAGYSMI
                     KATWKDGKVASRVTLESALLDDPVKSISAAAAASEKNNS"
     gene            complement(<547307..>548335)
                     /locus_tag="CYME_CMN224C"
                     /db_xref="GeneID:16995465"
     mRNA            complement(<547307..>548335)
                     /locus_tag="CYME_CMN224C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537297.1"
                     /db_xref="GeneID:16995465"
     CDS             complement(547307..548335)
                     /locus_tag="CYME_CMN224C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537354.1"
                     /db_xref="GeneID:16995465"
                     /translation="MISGASAYELQRQQRIERNKELLHQFGIHDLGLQRVRSVTLAKR
                     PCKAACEASPSHVLEDNPEANAESTETRNTSFTLRRSTRLRERELVACTNQEQPLNSR
                     IVARLHGVRCKRLRTSVSDPRETASVSLSASNSTKYLNCDVDKLSTYLGGFVPVPPRL
                     GGQVKRSVIEAACAAAVRPVFNRMSGICEWWNAVMLFVNLPAGDRALQNDKPSIPNAS
                     LGRGYVNVFYGSGEYIVWYAQRTQDPEHPTLRRLIVDSERRGASETNILLFCRMPKPY
                     DSHYLYCGRLRYVEHSNKTHPIRFNFQLMDFASLIEPKSSCGTPASAYSTAIRGDYAA
                     AWELASRR"
     misc_feature    complement(550752..551916)
                     /note="repetitive element"
     gene            complement(<555252..>556316)
                     /locus_tag="CYME_CMN226C"
                     /db_xref="GeneID:16995450"
     mRNA            complement(<555252..>556316)
                     /locus_tag="CYME_CMN226C"
                     /product="similar to N6-adenine-specific methylase"
                     /transcript_id="XM_005537298.1"
                     /db_xref="GeneID:16995450"
     CDS             complement(555252..556316)
                     /locus_tag="CYME_CMN226C"
                     /codon_start=1
                     /product="similar to N6-adenine-specific methylase"
                     /protein_id="XP_005537355.1"
                     /db_xref="GeneID:16995450"
                     /translation="MSSCGLSERAAGFIPAGPVSCSARQLCTLREVCKQHPPGQQALV
                     PLALRHGRANVARHFVVGRQGRPQLRDFWLHMAVSADPSGDGVPAEEPGAPQQAKPKR
                     FPRGRYEQMRKYKVIRQGVTLPGGRRRWQKVAIPLEPRLRITGGTARGRRLESPPVYV
                     RPAMAQVREACFSILRELQILPSRQPVRFLDLFCGAGTMGFEALSRGASSAVFVDRSP
                     ECCACVRRNMSKLGVGEGIALVRETTVEEYLATAPDGVLQIVALTPPYEEISYDELLR
                     TLSQSAVISERTVVMLEYPYELGSLPPVIENRLIGMRNRRYGRTVLGMYACQPDPNWD
                     MRTEEFTDAFIRRRRNYLTS"
     gene            <557638..>558819
                     /locus_tag="CYME_CMN227C"
                     /db_xref="GeneID:16995451"
     mRNA            <557638..>558819
                     /locus_tag="CYME_CMN227C"
                     /product="S-adenosylmethionine synthetase"
                     /transcript_id="XM_005537299.1"
                     /db_xref="GeneID:16995451"
     CDS             557638..558819
                     /locus_tag="CYME_CMN227C"
                     /codon_start=1
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="XP_005537356.1"
                     /db_xref="GeneID:16995451"
                     /translation="MTATEEVRRFFFTSESVNEGHPDKLCDQVSDAVLDACLAQDPFS
                     KVACETATKTGLIMVFGEISTKATVDYEKVVRETVREIGFDDEEKGLDFRSCRVLQEI
                     HEQSREIAASVYGGRDTLDIAAGDQGIMFGYATNETPELMPLSHSLATKLGKRLTDVR
                     KQGILPYIRPDGKTQVTVEYERRGGALKPLRVDTIVISTQHAPHTSQEKLRADLREHV
                     IRPVVPAEFLDDRTRYVLNPSGSFTVGGPAGDAGLTGRKIIIDTYGGWGGHGGGAFSG
                     KDPSKVDRSAAYMARWMAKSVVAAGLAARCLIQLSYSIGVAEPTSIFLDTYGTAKPDW
                     TDDQILKVVERNFDCRPGAIIRELDLLKPKYRKTAAYGHFGREDDPDFTWEIPKRLQV
                     D"
     gene            <560795..>562738
                     /locus_tag="CYME_CMN228C"
                     /db_xref="GeneID:16995458"
     mRNA            <560795..>562738
                     /locus_tag="CYME_CMN228C"
                     /product="anthranilate synthase component I"
                     /transcript_id="XM_005537300.1"
                     /db_xref="GeneID:16995458"
     CDS             560795..562738
                     /locus_tag="CYME_CMN228C"
                     /codon_start=1
                     /product="anthranilate synthase component I"
                     /protein_id="XP_005537357.1"
                     /db_xref="GeneID:16995458"
                     /translation="MELAAFASAATGTSPILGGSACARVQQTRASCGTLEGRCAHPRA
                     ISVKDQRRDSWGRSKSILAPASSASKGLPLCGRRKNSARRFTLRAQGSGRLSDMFIEY
                     YERNRVTLPAGIGKQTLLPVYRRIFADDLTPVMAYRRLVHDASGDPRPSFLFESVVGG
                     DQIGRFSYVGSSPCMQIIAYQNDIQIIDSSEHLQHKLHVPDPWVFMRQLTEQIKVAEK
                     GPVPEAFCGGWVGFGGYDTVRYSEPKKLPFSAAPRDDRGLPDLHFALYQEVVIFDNVT
                     KTVYIVVWVPLEDHRSIEAARAHGWSRSEQLVRVLTCAERDHLLLPSSEVLLDPVEKP
                     EPMRSNMTKEQFFHALERISEYIYLGDTFQTVFSQRFERDTFADPFQVYRALRIVNPS
                     PYMLYMRARDCILISSSPEILCKTRGRKVWNRPLAGTRPRGSSPEEDARLEQELLADE
                     KDRAEHVMLVDLGRNDVGRIAELGSVQVEKLFEIERYSHVMHISSTVTGKLRAELSCW
                     DALRATLPAGTISGAPKIRSMQIIDELEPTKRGPYGGGIGYVSFDGNEMDVALALRTM
                     VIPTAMRSSNGAWRVHIQAGAGIVLDSNPESEYLETINKAAALGRAIDVAEHAFVQSP
                     TEQIAEDLLNSSPDAASVAPSRD"
     gene            complement(562779..564375)
                     /locus_tag="CYME_CMN229T"
                     /db_xref="GeneID:16995459"
     misc_RNA        complement(562779..564375)
                     /locus_tag="CYME_CMN229T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461484.1"
                     /db_xref="GeneID:16995459"
     gene            <564716..>565642
                     /locus_tag="CYME_CMN230C"
                     /db_xref="GeneID:16995460"
     mRNA            <564716..>565642
                     /locus_tag="CYME_CMN230C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537301.1"
                     /db_xref="GeneID:16995460"
     CDS             564716..565642
                     /locus_tag="CYME_CMN230C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537358.1"
                     /db_xref="GeneID:16995460"
                     /translation="MRRAFHERLRRSRVLSLVVLVLFAASALSLRLRFKRLSPAGWKA
                     EIHDLQKCPEGGLCRLRIYAIAVKNRRKTIERALQRIRANYTIIDAVLTDSELVSWYH
                     WHIVPSEQVHLHEQGAGGYVAGPWQTVVACFLSHLKALKTLIDDPDAEAAMILEDDVV
                     FLRDVELLWQRISDAFKLLNDADVVRLSYLDHAKHISPRTQAEFQLNGTWSGAQAYMI
                     SKQFAKLAVDTVDHPVRFLRNRFLSITSELVLNADFADTKVTVPVHPRCRVFVLQPPI
                     AIERVDVKSTIGNSPHWQEFAMYGFENYALDI"
     gene            <568225..>568965
                     /locus_tag="CYME_CMN231C"
                     /db_xref="GeneID:16995461"
     mRNA            <568225..>568965
                     /locus_tag="CYME_CMN231C"
                     /product="probable tRNA splicing endonuclease subunit
                     Sen2"
                     /transcript_id="XM_005537302.1"
                     /db_xref="GeneID:16995461"
     CDS             568225..568965
                     /locus_tag="CYME_CMN231C"
                     /codon_start=1
                     /product="probable tRNA splicing endonuclease subunit
                     Sen2"
                     /protein_id="XP_005537359.1"
                     /db_xref="GeneID:16995461"
                     /translation="MSVQAQLVGGEFWVTDPVSARLCWQSLMGFGKGNLSRSRPVYGE
                     LVRGAVDHVHLGRALRSLVRAGHFAARTDKEDVEHLHLAPFEAAYLAFDEQFLTVKGF
                     ENTQSLWTYFVSLPKEHLRQYAVYRAYRHAGWAPHSGCKYGADFVLYRFRASEGRHSH
                     APYAVLVRSANERIHQRWIAVQNQLRLTKQVAKRLVYVEVSMSTAMEHLQHRERWLQT
                     VCLHEVLVDRWTPSIRTRSKEAKQRAAK"
     gene            complement(<569538..>571271)
                     /locus_tag="CYME_CMN232C"
                     /db_xref="GeneID:16995466"
     mRNA            complement(<569538..>571271)
                     /locus_tag="CYME_CMN232C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537303.1"
                     /db_xref="GeneID:16995466"
     CDS             complement(569538..571271)
                     /locus_tag="CYME_CMN232C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537360.1"
                     /db_xref="GeneID:16995466"
                     /translation="MDASEDTDENRIFIERFLPRFSGVLAELELPNSTPLHQQPGTPS
                     GVLQPPTIPGWSAGSVLVSQLRLVARRLPSSASAAFHVGLCYLRLGDRKAAQSWLELA
                     AQRLGSAGRKHSLYFGVLHALWITTRGLTRLDGKSGTSFWDCNVEEDQAWLELDAASR
                     VHRMQDIVGRGCDDADHWNNLGVAFTRDEHYLTAAACFEQAILRGCTAPALGNYAQLM
                     ALSPHARTRHEHERRQWLQLQADSRLPSFALLEAVCETQLSSVAHASTESPESPLYPF
                     LAFTWGGLALWHSLRNEHVLAHAAACVSVSSSPDEFQAEFALLARILTAYADLSRDAL
                     RHSENVDRLRRAASSLKLLSERVSRCTVLLEAAQIVMGLCARLRSECGDEHGHSRLAD
                     SSARHYSLALERHPDHASNWISLALLLVDIGEYADAVDLLLQAWDRDQDNPVILNNVG
                     IVLGLSGRPEEGCHALWQALQHAGALRCPTLYAAIWTNLGSLYRQRGHHNEALRCYKQ
                     ALVAGGEQPFVYNNLGILLLMMDATQEAKAMFTRALELDAQYDCARSNWRRVDELIQW
                     KSQRAAVPTSN"
     gene            <575155..>577476
                     /locus_tag="CYME_CMN233C"
                     /db_xref="GeneID:16995467"
     mRNA            <575155..>577476
                     /locus_tag="CYME_CMN233C"
                     /product="dihydrolipoamide S-acetyltransferase,
                     chloroplast precursor"
                     /transcript_id="XM_005537304.1"
                     /db_xref="GeneID:16995467"
     CDS             575155..577476
                     /locus_tag="CYME_CMN233C"
                     /codon_start=1
                     /product="dihydrolipoamide S-acetyltransferase,
                     chloroplast precursor"
                     /protein_id="XP_005537361.1"
                     /db_xref="GeneID:16995467"
                     /translation="MVLDGAGHALSLAFVGGIPTSKRRAAVRPGSRPRGSPPFWSNFP
                     CTWRWGSARMRLAPRQLGRSFLRMEVSPEVRERVQAHEVFMPALSSTMTEGKVVQWLK
                     KVGDRIEKGDVILVVESDKADMDVEAFDEGYLAHILTKEGETAVVGATIGLIAKNVED
                     IEAIQACGLDCIVDGSGSRHDGTTAVEPGDAAPAPSTHQRESAAERSAAFGGRDAIVT
                     APAAAAPLVPKPAGTVEVFLPALSSTMTEGKIVEWTKNIGDEVKSGDVIMVVESDKAD
                     MDVESFETGFLAHIELEAGISAPVGAVAGYLARDKASVPLVQAWAKSAARELDQAPGE
                     SSAAVRSTAPGSESAPVTTPEHVAISTPTPTPTSTEIQEDDLAPGGESMTAPTGRVIA
                     SPYAKRLAKENKIDLRTLRGRGPGGRILAADVQAAMLARSAAQTPSVASEKPLQASAV
                     SGRMIATPGAKKLAKSRGVDLAKVRGTGPYGRITEADVKRALGEASSDSQTSAPTASA
                     EAAVTSERRSTGSDAGAETERKARRGASSADAAPATEKAALSGPVPMSTMQKAVVNNM
                     NASLQVPVFRVSYSITTDAVDALLSKLKSKGVTMTTLLAKALGLTLRKHPLLNARFEE
                     PYTIVYQPGANIAVAVALPDGGLITPVLRDCADTDIYELSRRWRSLVRLALEKKLKPE
                     DYQSGTFSLSNLGMFGVSSFDAILPKGTGAILAVAASQPQVRLQSNGLIGVSKVMQVT
                     ITCDHRHIYGAQAAEFLRDLADLLEKRVEELLL"
     gene            complement(<578490..>579158)
                     /locus_tag="CYME_CMN234C"
                     /db_xref="GeneID:16995462"
     mRNA            complement(<578490..>579158)
                     /locus_tag="CYME_CMN234C"
                     /product="similar to chlorophyll a/b-binding protein,
                     CP24"
                     /transcript_id="XM_005537305.1"
                     /db_xref="GeneID:16995462"
     CDS             complement(578490..579158)
                     /locus_tag="CYME_CMN234C"
                     /codon_start=1
                     /product="similar to chlorophyll a/b-binding protein,
                     CP24"
                     /protein_id="XP_005537362.1"
                     /db_xref="GeneID:16995462"
                     /translation="MAFISALSSIGLKTGTVTRVACVTRVPARGLRMQAPSGATMPSM
                     PFLKRPSKLDGSLPGGEGCFDPLGFTEVFSLEWLREAEIKHCRVAMLAVLGVIAQEFG
                     TFDFYNAKSKLQLSPDLHNQFVQNGALQQILLFVCAWEFIVGLPALIESVNGNREPGY
                     FGFDPLKLGGTVGSAQWKRMQAGELRNGRLAMIAFGGFFHQQLLTKQGIIEQLAHFNA
                     IKPN"
     misc_feature    579788..581559
                     /note="pseudo-gene of chlorophyll a/b-binding protein,
                     CP24"
     gene            complement(580514..581879)
                     /locus_tag="CYME_CMN236T"
                     /db_xref="GeneID:16995488"
     misc_RNA        complement(580514..581879)
                     /locus_tag="CYME_CMN236T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461485.1"
                     /db_xref="GeneID:16995488"
     gene            <582258..>583037
                     /locus_tag="CYME_CMN237C"
                     /db_xref="GeneID:16995489"
     mRNA            <582258..>583037
                     /locus_tag="CYME_CMN237C"
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /transcript_id="XM_005537306.1"
                     /db_xref="GeneID:16995489"
     CDS             582258..583037
                     /locus_tag="CYME_CMN237C"
                     /codon_start=1
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="XP_005537363.1"
                     /db_xref="GeneID:16995489"
                     /translation="MFVAQAFSQLRVQPSRVCCSRRRSARSLKMATWIMAPDNPDEPD
                     EPGRRDPSPRRMPSIPVPQVATDQGTLDIYSRLAKDRKLLLGTQVNDEVCNQLVAQML
                     FLAQENPEEDITLYINSPGGSVSAGLALYDTMMYVPCDVATVCFGTAASMGAFLLCAG
                     AKGKRRALPHARIMIHQPLGGAQGQAMDIEIQAREILYVRDLINQIMAAQTGKAVEEI
                     ERDTDRDFFMNAEEAVAYGLIDEVVKTKNMLPYPKKPSLVY"
     gene            complement(583489..583615)
                     /locus_tag="CYME_CMN238R"
                     /db_xref="GeneID:16995425"
     tRNA            complement(join(583489..583546,583579..583615))
                     /locus_tag="CYME_CMN238R"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:16995425"
     misc_feature    583882..586804
                     /note="possible transcribed region"
     gene            complement(<587152..>587646)
                     /locus_tag="CYME_CMN240C"
                     /db_xref="GeneID:16995486"
     mRNA            complement(<587152..>587646)
                     /locus_tag="CYME_CMN240C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537307.1"
                     /db_xref="GeneID:16995486"
     CDS             complement(587152..587646)
                     /locus_tag="CYME_CMN240C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537364.1"
                     /db_xref="GeneID:16995486"
                     /translation="MGSFIPPINFSWVEEDLYRSGVPNELNYPFLEKLNLRKVLYLSP
                     DELPPQFLNFLDDHDIELVPVGWDSDQTPWMPISEEVVLAALDVILDTENYPLHVMCN
                     LGRHRTGTVIGCLRKLQQWNLTSVLEEYRRYVGGKVRLLNEQFIELFDVDLVRIPENP
                     PAWL"
     misc_feature    587633..589388
                     /note="possible transcribed region"
     misc_feature    complement(588134..588717)
                     /note="possible transcribed region"
     gene            <594367..>596385
                     /locus_tag="CYME_CMN243C"
                     /db_xref="GeneID:16995471"
     mRNA            <594367..>596385
                     /locus_tag="CYME_CMN243C"
                     /product="propionyl-Coenzyme A carboxylase, alpha subunit,
                     mitochondrial precursor"
                     /transcript_id="XM_005537308.1"
                     /db_xref="GeneID:16995471"
     CDS             594367..596385
                     /locus_tag="CYME_CMN243C"
                     /codon_start=1
                     /product="propionyl-Coenzyme A carboxylase, alpha subunit,
                     mitochondrial precursor"
                     /protein_id="XP_005537365.1"
                     /db_xref="GeneID:16995471"
                     /translation="MPFRRVLIANRGEIVRRAAKTLRKLNIEPVVVYTKADETGTHVR
                     EAVRKQRIESYVSISEVVAAARRARADAVFPGYGFLAERADCADAVQQAGMTFIGPSA
                     RAIARLSDKIEAKKFVKALGIPVVPGYVDPLEHVDHAGYIARELGFPVVLKAASGGGG
                     RGLRVIHHEQELRTQFEVCAAEAKQAFGDSRLLLEKYLEPVRHIEVQILGDRHGNLVV
                     FPERECSIQRHNQKLLEESPSPLVDKRLRWRLFHDASRIARAIEYDSVGTVEFLVHAH
                     TKEHFFLEMNARLQVEHAVSEAVTGVDLIEHMIRAASNQVVDLDEPENITRLELDHDP
                     PFETCRMLRSRGWALEARICAEGWSAGSLVPSTGRLHKFRLPVSQPGVRVDSGYDEGD
                     SVSPLFDSLLTKVIAHGETRTAARRRLALALDALLIDGVEHTTGLLRDIVAKDADFAN
                     GIYTTRFLKDYALHFNESDARRALQLMANRMKVDPGTKKPIAALTVEYGLVRFDREHD
                     TVAGSVASSGATAPLPLQDSDGLDALSDTPESPLFVMAPRRAPRLLFRGMPITVQRLF
                     DEDELMLWERIRKPVSAAPVEANAWRALHAPMPGILVAVLVSVGDEVQPKQPVAILES
                     MKMRNMLHAPSLPPGAQTLVVGSIRAAVGTVLRKGDLILEFSLPTFTT"
     gene            complement(594446..597451)
                     /locus_tag="CYME_CMN244T"
                     /db_xref="GeneID:16995473"
     misc_RNA        complement(594446..597451)
                     /locus_tag="CYME_CMN244T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461486.1"
                     /db_xref="GeneID:16995473"
     gene            <596961..>597647
                     /locus_tag="CYME_CMN245C"
                     /db_xref="GeneID:16995492"
     mRNA            <596961..>597647
                     /locus_tag="CYME_CMN245C"
                     /product="similar to mutator MutT protein"
                     /transcript_id="XM_005537309.1"
                     /db_xref="GeneID:16995492"
     CDS             596961..597647
                     /locus_tag="CYME_CMN245C"
                     /codon_start=1
                     /product="similar to mutator MutT protein"
                     /protein_id="XP_005537366.1"
                     /db_xref="GeneID:16995492"
                     /translation="MARFLRLRGGANRGPIVLTLDEVEFLIDCLPPPPEASALRGRLN
                     ALLGALRSGQPVPAEVAGERPSSRSPSVDHEVRGSRYRSPALTVDAAVLRGPREALEI
                     LLVTRAREPFKGKLAFPGGFVEYNEDPQDAVVRELAEECGIQAKNPQLVAVRGHPSRD
                     PRQHVVTVCYKLDIEGQHEPRAGDDAANAGWYAVETLLKSHEGRARLAFDHADLLAQL
                     AAWLDQRHRR"
     gene            <599799..>602135
                     /locus_tag="CYME_CMN246C"
                     /db_xref="GeneID:16995493"
     mRNA            <599799..>602135
                     /locus_tag="CYME_CMN246C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537310.1"
                     /db_xref="GeneID:16995493"
     CDS             599799..602135
                     /locus_tag="CYME_CMN246C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537367.1"
                     /db_xref="GeneID:16995493"
                     /translation="MKTSEQVERGVCSYCEELLFAKNKAEREALAHPLLGSRWSQVWL
                     CLRCRKTVQQLRSRGARSSPGKRERNGRPLPATEVRCAVCADSGRRQLCCQRCGATFC
                     NRCFGCTLGDWRTPPCALGSEGLRIVQRLNAILWKKGVEPLDERVSLLPAPAWMCPLC
                     CREQGLRLAFESWLKDLPEAPQRGRLAEWTTFRERYDYRSWNPWWLWCGSLKLPQVWT
                     QCSAGSKLTQLFDAAFSGDWKRVQTVHEDYGKLLTALEELHMASGGAFPSRQQRFRHM
                     RRGMAEPLRLNARAQELLERYPTGPTESDALQLDCTEHDSGLVHDWYRVYSILCIAIR
                     ELLVAVAWSRLVCASVVPELWLPVQRHVLEALPFRWDDLWSRHGTICFRCGRPGGSGE
                     LLHRCDIPGCGKVYHASCVSCLSRAPYFTNGSDLTERRHWYCPWHFDRSTGWYLPSEP
                     YPSDFISLLEAHASALPSDTLERIPWLGVVPRSDGWRLPADESAASEHAAVDRSTDGH
                     SSGTLTTTQVPPFRAVQCRTCPFSCSIPNQAGWPEDHSEWYVWDAGIISCCSCSVWLE
                     PPQGQDPTELACVAATWKDAGASTRVQRATQRHDKRQRLATAPSPASRHSVAPSAPSA
                     ATFAKMIRQAAHEGAARIQEAKARGDVPLVQGRSGEYIDALEYVRAEYEKYEKGNTGA
                     VVGIMAALKSANGKPVTFSELTLELLRRGWFVTTGKTPQMTIAAFFSTRRQRLMEQGQ
                     TCTWFEWLGSARVRWCLDTPAAAVDDESSAAPADSANT"
     gene            complement(<603030..>603647)
                     /locus_tag="CYME_CMN247C"
                     /db_xref="GeneID:16995490"
     mRNA            complement(<603030..>603647)
                     /locus_tag="CYME_CMN247C"
                     /product="coatomer protein complex, subunit zeta"
                     /transcript_id="XM_005537311.1"
                     /db_xref="GeneID:16995490"
     CDS             complement(603030..603647)
                     /locus_tag="CYME_CMN247C"
                     /codon_start=1
                     /product="coatomer protein complex, subunit zeta"
                     /protein_id="XP_005537368.1"
                     /db_xref="GeneID:16995490"
                     /translation="MPVQQPRASVLLVQSARGSRLLARYYDEERFTDERSKKHFEEQL
                     HQLWRSAGSSEAAADSYWTAGLDPGTFAAVGSAAGLLGDNDVLVSDNFVILYRSGVDV
                     CFLLVVSLAENEIVFSQVLSCLTNALGALIGELSELQILRNYETLLLVVDEVLDDSGA
                     ILEVDPTEVRERIAPVLPRVLNLSEQGFAEALNYAKTTLTRRLLK"
     gene            <604840..>606243
                     /locus_tag="CYME_CMN248C"
                     /db_xref="GeneID:16995491"
     mRNA            <604840..>606243
                     /locus_tag="CYME_CMN248C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537312.1"
                     /db_xref="GeneID:16995491"
     CDS             604840..606243
                     /locus_tag="CYME_CMN248C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537369.1"
                     /db_xref="GeneID:16995491"
                     /translation="MRCLRFADGPWKPCSCACSCRKATTKRSAQRSSVLATVDPSRWL
                     NLSKIKGALSKSIQHFRPRVWKLLQFSTLAYAAVAGATSMLTWLATLQPSFSLYALVP
                     FTYRVQRRLHALALDHPDLETKQSQPAPAVSKDALGAVHRAKQKFADTVLKLLLETPG
                     MPPDLQVQVHVERVPAKPAYPNEPEFVFAIDDGPLFQTRCVQRIAGPVSSETENPSSF
                     DVYVSAEMEPALIPAALSHALAHGVANHAAEALSALFYGAVPLSAWRPRCLVNMIAPA
                     SLAARWGGGTAVAAHWVVDTLQRFRAPLVALCMRPVQRRNEFEADLIAATILARIGLD
                     PASMLELLRHAEAGTTLRLTSDDNGGRHAVHAATWNRDALPWARYPSIQRRRRSLEPH
                     MERLKRLEALVQKSEGARNRRIAVLRDQVQRELARFERSSRSAPQASTEQGRVSERRS
                     AVSGDASPAWGSSAQAR"
     misc_feature    607020..608923
                     /note="possible transcribed region"
     gene            complement(<607883..>609298)
                     /locus_tag="CYME_CMN250C"
                     /db_xref="GeneID:16995484"
     mRNA            complement(<607883..>609298)
                     /locus_tag="CYME_CMN250C"
                     /product="chloroplast signal recognition particle receptor
                     FtsY"
                     /transcript_id="XM_005537313.1"
                     /db_xref="GeneID:16995484"
     CDS             complement(607883..609298)
                     /locus_tag="CYME_CMN250C"
                     /codon_start=1
                     /product="chloroplast signal recognition particle receptor
                     FtsY"
                     /protein_id="XP_005537370.1"
                     /db_xref="GeneID:16995484"
                     /translation="MPVLRRPTVREPVLHTDVTACVQVDEHRARTRTAPFAMVVKGPH
                     RPSGTERPMQAFSFHVPRNLHGLSFRSDWRVARYLKVCRRSTSPGFQGPLGVRAGVFD
                     FLRNFGEQARQEQQALVDAVKQGKFMDYVRDKAVRDAAQVSAFREGLTKTRERLSREI
                     ETIVERNMGRLDQVDQAMQDIENALLGADLGVSVVDRLMENLRKDIAEQRLRSGAEVR
                     ASLAASLLALLTRAQTDAQKRIQSQRLAAQQHSGSPQCEVLMLVGTNGHGKTTSAAKL
                     AYRLRTQDKKKVLLVAADTFRAAAVQQLAEWAQRAGVDIAMPLENQKSAASVAYDALK
                     RAVDERYDVAIIDTSGRLHTNENLMEEMKKLRRVVERQIQGPLAECLLVLDAPSGRNA
                     VAAARQWLRDVQVTGLVLTKLDGTARAGFLVSVVEELGIPVKFVGVGEKLNDLRDFDP
                     VAYVDGLLLSDTPAAARRAAP"
     gene            complement(<613107..>618497)
                     /locus_tag="CYME_CMN251C"
                     /db_xref="GeneID:16995479"
     mRNA            complement(<613107..>618497)
                     /locus_tag="CYME_CMN251C"
                     /product="ATP-binding cassette, sub-family C, member 1"
                     /transcript_id="XM_005537314.1"
                     /db_xref="GeneID:16995479"
     CDS             complement(613107..618497)
                     /locus_tag="CYME_CMN251C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family C, member 1"
                     /protein_id="XP_005537371.1"
                     /db_xref="GeneID:16995479"
                     /translation="MDTQPGQNGEGAADREGVQETAARHGADASASRSAQPEWPYSGQ
                     PAESVHEAQPSVPDDEFAEQLDIAVAETAEQNDLTLGRERMSLVRHEVLSTPLAAEED
                     PNVDGVPRTAVQEAAQADGIGIDPASQEKHPKHAADALESQSTSAIATAGSAYFQYQG
                     RQAGVTDYHRYAQDQMRRIAEAAALTATGDSASRKPLPELEASWLSRWTFWWFGSLIW
                     RGWRRTLDDSDLYELAPDDRAQPLSERFAVAWVDFLERQEERITRELERERQARTAKT
                     GALDGVAPRKDDSLDHVDEEQLRIQRRSRWPMFWVILRVHTRIIIVSGILKFFDVGLG
                     QVSPVFLNKLLIWLETPGAPTYQGYLWVLAIFLAPFLKAFVENQYFYLTFRLAVRIRG
                     EVQSAVYDKSLRLSASARAQTTTGEVVNHMQLDAQRLSDFMQYAHVLWAALLQIGGAL
                     ALLIVYLGYSGLIGFLAAVLTVPLQGYLVKRLSGFRRLTFGITDRRVKLLNEMFQGIK
                     TLKFYAWEEPFAVKVTEIREQELAAYRRTVFVRTLFYVVLFVTPVLVSAVTFGFYGGV
                     FHNQLNPAFIFAGLSVLNNLRFPLIQYPFVFTALVDARIGVQRLQRFFALEEIEPSPA
                     TERLSTDAKSSSSSSDLMGDPAQKLTDKQKRTPSAEDAQVPPAPHQPESTRSRWRFFW
                     RKPVERAAKHSAPSSEHPTDAIDGADASGSVMTRAREPSGAIPAEEASSLPGALHWGP
                     SIELPGESAAFHEQAETSTILMDSTDTAENGQGTGMLLDKPSKDLSSGLGRASSSFRK
                     EPMYVIEIEHGCFDWTLSKEQPAPASASASATEGQQLPKRRLALFQRLWHRRELRRQP
                     PQPEVRLKPVEFVPALEDVNLRIPPRALVAVVGRVGSGKSSLVSAILGELQRRSGTVR
                     VHGSVAYSAQAAWIYNGTVRDNILFGLPYEPKRYRRAIYVSALNADLEILPAGDLTEI
                     GEKGINLSGGQKQRVSLARLVYANADVNILDDPLSALDAHVGDHVFQKILSNEHGVLR
                     RKTRVLVTNHLQYASRCDWIVLMENGRIAGQGTLQHLTTSSPRFVEMLAAMTATRSTQ
                     SKTQVGDPNTEPAEDDLHRLDADDADGHRERSESTKERTSFFSSSGVGSGDPSVTGRE
                     TQKSTDRGQLVVTEEINKGHVALSVYWGYAKRCGNPYLFIAILSLFFVSAGEAVVNNW
                     WLSFWSEHEQQYTLGFFLGIYFALAAGHAIISFFRTYWFLLLTLVAARYLHAELLDSV
                     LRAPMAFYDVTPVGRILVRFSRDIMQIDFQLPQQYISFLQQIASIIAAYVFIAVIFPI
                     FVAAMVPITVLYFVLQQIYNPANIQFRRLDSISKGPIYSHFSETLNGLTTIRAYRRQA
                     YMQAVNRFRIDINQRAYYHQVTGNRWLALRLEVLGALLVFITGIFGVTSKNTTYVGLT
                     GLALTYALQVTSALSLAVRSITEVEQLMNSVERNFYYTDSIPHENLDGEEPPPSWPQV
                     GEIVFEDVSLRYRPQLPLVLQDVTFRVAGGERVGILGRTGSGKSSIIVALFRLVEIPV
                     NETTGKPMGRILIDGLDISKLRVRSLRSRLTIIPQDPVLFSGSIRLNLDPFGLYTDAE
                     LWSALRYAHLDDAVHAMPGGLEAQVAEYGENLSAGQRQLICLARALLRHPRILISDEA
                     TSSVDFQTDKVIQDVIRQQFEDATLLAIAHRLFTLAAFDTCLVMHHGRVAEYGDPEEL
                     LSTRPDGQFSRLVYSLGPRASARFRALLREHAPQRRHRQSSRKGRALSMTATSGSALE
                     AEPDSVHPEIDP"
     misc_feature    complement(621026..622709)
                     /note="possible transcribed region"
     gene            <621155..>621946
                     /locus_tag="CYME_CMN252C"
                     /db_xref="GeneID:16995256"
     mRNA            <621155..>621946
                     /locus_tag="CYME_CMN252C"
                     /product="similar to CpcE-related prtein"
                     /transcript_id="XM_005537315.1"
                     /db_xref="GeneID:16995256"
     CDS             621155..621946
                     /locus_tag="CYME_CMN252C"
                     /codon_start=1
                     /product="similar to CpcE-related prtein"
                     /protein_id="XP_005537372.1"
                     /db_xref="GeneID:16995256"
                     /translation="MFILSAQRLSGTQVFRRLAEGCTGYSVSSGCRQRRRCCPGAPQR
                     PRRVRVNALQLQSGLADPLDPKSEAEVREHLRSNSPAERALGINYARYLDESTRYDIL
                     LEMMEDTDPQVRYAAVTQLATVGSHDRQRTLKAVRKILWNTEEDASVRAGAADVLGGL
                     RFHEAFPDLEKLFHESKDWVVRFSIIAALGEMGVREAFPILVEALHANKEPLVQLAAI
                     GALGELGDERARVYLEPLVNSSDASIVERARFALDALDARGSERT"
     gene            complement(<623381..>626677)
                     /locus_tag="CYME_CMN254C"
                     /db_xref="GeneID:16995255"
     mRNA            complement(<623381..>626677)
                     /locus_tag="CYME_CMN254C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537316.1"
                     /db_xref="GeneID:16995255"
     CDS             complement(623381..626677)
                     /locus_tag="CYME_CMN254C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537373.1"
                     /db_xref="GeneID:16995255"
                     /translation="MIDPSTGDLELAAFYALNPPLGIAPSHAEEARAVLERVTAATED
                     GGFTLCWSLAVSDERILRPELVFWCLQVLLSTRQRLSLQQVLALSRSPQTSGHAPGYV
                     KNKAAQLIAELVVERYPLNWPNAVVDLLQALDADAMLRFLRALHEQVLAREAQRHVEA
                     SRLKEAMRADGSALLLLDWWAYLLRAALQTDAEGIELPEAVSAVMRSSGEPKKPGTML
                     STTELVVGVLELLADYAFWMDLSAIVERFQQPLLQLVSNAAGQHWPVTVVSAAVTALE
                     RMLLRKVAHPGEKVHVCKSLHLVELVMNASNADSDALPSWSSLLGSLLMELLELYETS
                     EATVSNWAANALRTLLDALLGATTSPTTNAQALLFSAPVLSAMSSLTRRLQTVDWDAL
                     SRRLLTAILQHLLALETNERDTSDAATSEPNGVRTDVPLASVHEAPTLARDQVSDAVS
                     QLSTSSDDCSTEIMSVLGHVVKRSPTLVLETLQQLPARRLQARLLLELASSFPENARE
                     LVLENARQVLSDPVMDLVYFDVVARFGAVLLPKSPPLYAYVLPMLVSSLQSESTRLRE
                     HAANTCVRLVQALRDVLPRDPEHIREQAGVVAAAPVAATGTRREPSPADSGIPADSAT
                     RVATGWKSLLPERVPSAALSSMLIQNGRFRVEYLLHHFQDLVHLDGQDPDLNLVQLPL
                     VECISLLISSEALSADTRLHYLESCLVPMHSSGLFRSASGLRAVLHLSKGFSPAQCQQ
                     DVRLSQIWLTCLDWVLEAAPSPAYGLDADARPLLHRLAELLSEPQTGDRIATFIETRL
                     ELGREALPLEQDLQALVLLENQLCDRFQTACVSSQRRLFEPLVRALLSWFPLLPADAP
                     AESTDGRLPNVSTSRGAPSGTPVLSEEARERYTLRNLFYTYLGQLLNNGLASIIVDDT
                     HQGLWPCLLHVVVAGAVGIHFQSIELVARQWQPTGPPAMLPEPESAALTRAALSVLRR
                     FAEHWAGSGTVPSLDAALLQALPELFRCAPAAVCRENVELQIVLLTRLPQVERVLELI
                     LEEATSRGCAASTCMQYLRILSQFSQLRRERERRGSAFDGIDSKQTAAVLPLLRQLVQ
                     TFSSSDTDQA"
     gene            <630065..>630748
                     /locus_tag="CYME_CMN255C"
                     /db_xref="GeneID:16995257"
     mRNA            <630065..>630748
                     /locus_tag="CYME_CMN255C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537317.1"
                     /db_xref="GeneID:16995257"
     CDS             630065..630748
                     /locus_tag="CYME_CMN255C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537374.1"
                     /db_xref="GeneID:16995257"
                     /translation="MLSLLDHTGARQPIAIASFGTLCISHPSASGLGAVCPSKHTGKI
                     RITTLAAVCMRDAGTTCAELTIHRSRSLPRWYESRVPFPRPRVVSTNSKGRDALVLCA
                     FHLSDYPSKLRSHVERRRDVHPQQTVLVHDRNVLILQTPWAVAGALRVSVYDHDPAVG
                     CTDGQLRAVGPGTDLAHTCSERLRVRRQQQNFVDKYEPRKAAPVRTLLLWLVSACAIK
                     LYTVLSAPI"
     gene            complement(<630356..>631435)
                     /locus_tag="CYME_CMN256C"
                     /db_xref="GeneID:16995481"
     mRNA            complement(<630356..>631435)
                     /locus_tag="CYME_CMN256C"
                     /product="reverse transcriptase"
                     /transcript_id="XM_005537318.1"
                     /db_xref="GeneID:16995481"
     CDS             complement(630356..631435)
                     /locus_tag="CYME_CMN256C"
                     /codon_start=1
                     /product="reverse transcriptase"
                     /protein_id="XP_005537375.1"
                     /db_xref="GeneID:16995481"
                     /translation="MSDSRAPGTDDVPPELLKQKLSESDASGSPAMSDEPARELAKRS
                     LEVLQRMDAEAAIPEIWNTAEVVPIPNGYPLTDMNNYRLVYLIPSMIKRMCSIVANRI
                     HRALAESTFFVPEQADFRSRQECMSHVLMVVDAMQRRFIREQQPTYACFIDFGATFVT
                     IPHEALFLKMYLAGIRDRNLAFFRALYLDSWFCVRLGDGARTPKIRMKRGMREGDPSS
                     PLLFKIFINDILDRCREYGVEFDCASADKPEKEGPHGRRLAGLIFVDKVLLLAPNPEA
                     LAASMREVSSWADRSELTIGASNCGVMVIHGDSKSTRDRPWRLQDKDVPIVDKYRLLR
                     MHITPTLDVRAQLRGIIAEMKSAEH"
     gene            complement(<634370..>635878)
                     /locus_tag="CYME_CMN257C"
                     /db_xref="GeneID:16995482"
     mRNA            complement(<634370..>635878)
                     /locus_tag="CYME_CMN257C"
                     /product="similar to DNMT1 associated protein 1"
                     /transcript_id="XM_005537319.1"
                     /db_xref="GeneID:16995482"
     CDS             complement(634370..635878)
                     /locus_tag="CYME_CMN257C"
                     /codon_start=1
                     /product="similar to DNMT1 associated protein 1"
                     /protein_id="XP_005537376.1"
                     /db_xref="GeneID:16995482"
                     /translation="MSARSPVESQALPGTVGASTVASLAELVTGEPTPESSAPNSRAQ
                     RLVPYSGAAEPPDNTRQDRPAKLRGLRREVYALTGSAAPPLAPRVALQSRLPAASAQV
                     HYAKRPFSNPAHPAGAAFQLWHWERHSLTQRKDAEASLTPEEGEAASAVYPFARFGKK
                     LETLRYTDEEYSRYLATMPVQGSREPWTKEETDTLFQLAERFNLHFVVMADRWSVFSP
                     SPKRKRSVNELKDRYYTVVRSLAQARAVSDPGFPHSSQDALQKHCRAMLANPYDIEYE
                     DRRKAQYEEQCRRPRSELLREEAVVQQAQEILRARRLKQRERRRLERLFRRALPAPPT
                     IPYAEAAASLETVQRTEIPGGQSASWASTAASSAGSQEAPPNIARTASNVVSAASAAV
                     ASRRPRRASHLAVFVRSSMMLAPVSQSQRVQRQVDQMLDELGVGIRPTPTREICEAFD
                     VLRQEILVLIELQRLLKRKEDELRAVRQQNNSAPAEHRARSKRRGKRDHSAE"
     gene            <638019..>639020
                     /locus_tag="CYME_CMN258C"
                     /db_xref="GeneID:16995468"
     mRNA            <638019..>639020
                     /locus_tag="CYME_CMN258C"
                     /product="dihydrodipicolinate reductase"
                     /transcript_id="XM_005537320.1"
                     /db_xref="GeneID:16995468"
     CDS             638019..639020
                     /locus_tag="CYME_CMN258C"
                     /codon_start=1
                     /product="dihydrodipicolinate reductase"
                     /protein_id="XP_005537377.1"
                     /db_xref="GeneID:16995468"
                     /translation="MFVGALPRWRLCRRQGTAECAGRSTRTRGGAVLFACGDDASVSS
                     RLALVSNGLPGRMALEVAQAALRRGLELVPFSLTGERTATAAVECTARDDTTGTERSV
                     QVQLVRPAERAQLATKLKKEYPNVICVDFTQPQAVIPNAAWYVENGFDFVMGTTGGDT
                     SALYQMVARSARYAVIAPNMAKQIVAFQALVELLGREFPNAFRGYRLEVIESHQASKL
                     DTSGTAKAVVASMLQSWGITGFGGEQDIQKIRDPALQVSRMGVPESCLQGHAFHTYRL
                     TSPDGSVRFVFQHNVCGRRVYAEGTIDAVCFLDRQRRAGADQKIYDMIDVLRSGGML"
     gene            complement(<640006..>641571)
                     /locus_tag="CYME_CMN259C"
                     /db_xref="GeneID:16995469"
     mRNA            complement(<640006..>641571)
                     /locus_tag="CYME_CMN259C"
                     /product="similar to phospholpid scramblase"
                     /transcript_id="XM_005537321.1"
                     /db_xref="GeneID:16995469"
     CDS             complement(640006..641571)
                     /locus_tag="CYME_CMN259C"
                     /codon_start=1
                     /product="similar to phospholpid scramblase"
                     /protein_id="XP_005537378.1"
                     /db_xref="GeneID:16995469"
                     /translation="MRSLSSASWLLSNAKTFTPPAASVWGAALWNLVVQRRKSSLEPA
                     RTPSVPAENGAQPHAAAEADKAADSVTPETQADISQLASVLDHPLLVVTREIEWGNLL
                     IGFEQANKYAIRLADGRIVGFIAEESSLGRAILRQALRTHRAFQATVMDAMGTPVLRV
                     HRPAYLISSSISVYRLFGDTVGPLLGEVHMNWHLWRRRYDLFDAQGRQFGEIDAPLLS
                     VQFPIRGEGAGSTEGPGVLASIDKDWTGLGRELFTDARQYVIRMDPAVTPQGVIADAQ
                     RKLGLPEGAPLASASGPVEPAQAAVPSRLETPAEALQRERERHRQSLEHDGHAGRLYA
                     PYASTSTASDCSLSELDMAKRAVILAAAISIDFDYFSLHSGSPGMFHMPFFFPIPIPG
                     FGGAAKAENDAPPADTSSSSATSTGTSGAEAAAASGSTETPPWMQRGAQDGSGGGAAS
                     TGPNPDKAADPWATFEPGVEDPSQGNSFDTDIDAGYDEGAWDTSPDADTSGGFIESLW
                     GALSGDDDDDDED"
     gene            complement(<643365..>644204)
                     /locus_tag="CYME_CMN260C"
                     /db_xref="GeneID:16995470"
     mRNA            complement(<643365..>644204)
                     /locus_tag="CYME_CMN260C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537322.1"
                     /db_xref="GeneID:16995470"
     CDS             complement(643365..644204)
                     /locus_tag="CYME_CMN260C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537379.1"
                     /db_xref="GeneID:16995470"
                     /translation="MRLSCQVTSTAYLTLPSLSKAIVGRPAVTAAATPRACTGRYYGF
                     AHTRAWTSAHKLLSKSLRIDIRMAATSTATPLPKRPVTVPFYGERPYPQVLVEVFLDY
                     NCPYSKKAFLTLWQEVLPHYRADSRVQFAFGLVPQPWHAQTCYMHEAALAARQVSGDA
                     GFWKASAALFAQQEDWVDEKVLDKTRRQVYEELAQCLAKAGVVSSASLITERLLTASG
                     NSGNAVGADVKFACRYHRVRGVHVTPTVHINGIPELNASSSWTVQEWKERIDSLLSSE
                     LSQ"
     misc_feature    644396..647350
                     /note="possible transcribed region"
     gene            complement(<644737..>647625)
                     /locus_tag="CYME_CMN262C"
                     /db_xref="GeneID:16995477"
     mRNA            complement(<644737..>647625)
                     /locus_tag="CYME_CMN262C"
                     /product="dynamin-related protein involved in chloroplast
                     division CmDnm2/DRP5"
                     /transcript_id="XM_005537323.1"
                     /db_xref="GeneID:16995477"
     CDS             complement(644737..647625)
                     /locus_tag="CYME_CMN262C"
                     /codon_start=1
                     /product="dynamin-related protein involved in chloroplast
                     division CmDnm2/DRP5"
                     /protein_id="XP_005537380.1"
                     /db_xref="GeneID:16995477"
                     /translation="MTARRLNLSGMEENFDPAWENFGTGSGGLSTSNYANEAALNSSG
                     MLGSRRQPRVADNSLGGGLAAPRTPLAEERTMNRTSFGTTSGEHADPTILNASAHEEL
                     YSAYNLLHALAQDFKKPFDAPAIVVIGHQTDGKSALIEALVGFQFSHVGGGTKTRRPV
                     TLHMQYNPRCAQPLCFLSTDQGEEQRSLAEIQAYIEAENLKLETDPFRSFDPEEIIIR
                     IEYKYCPNLTLIDTPGLLSPPPVGRRANPQQQQAIQASREVEDLVLAKISRPEYIILC
                     LEDTADWHTATTRRIAMQVDPDLSRTVLVNTKLDAKLPQFALGADLEQFLLARPVLNA
                     HPELLGGPFYTAVPAGRVGHTREHVFESNERFRQAIARREAEDRAYIERKIGKPLPRA
                     LRDRIGVSKLRAFLEDLLQTRYMQSVPSIVPLLQGEFRNVDQALRRTLEELESMSLER
                     LKEKGRVYAEDFLRRLAAVIKGTIRAPPTLWGESLADERIRGGSYHDLGSVGTNLQSA
                     QAGGIARLAISSRGESRVENEEARLFGGAQYYRALREFKTVVAEMERPPVTPEEIVNA
                     TGIDDAHDGANYMRAACVIAVEKARDAFDPLLERLTLRCLHIFRRMFPVVEFIMRRDN
                     LTLNEALDIPFRRIMEQIFCEFLDRTAANVQRICREDLESMTRFVTWNLSQPSKAALR
                     RFLQPVAEELGAPAAIQESLFGSPVSPEQAASEAVDEFYASQQYGAHDSDGTSAGAGT
                     AKAYAHPAAGRLAGSAGSRVMLPRKLERGKDGKLILPSRVAAQEVILQFMDDLLLSRV
                     VTPSSMAVVSSLVDHIVDAWRMHFAKVVELKFNCFFLMPVVEEFPRFCREKLDRLYGG
                     DLNDVFNIAEARAALERRREELLQERRRVEKLQEMFNAINSQLTGYHAGLPYPQDSAG
                     AGAALSSASAPGAAAAASQPGGVSAGLGATVRYPDLRRFEQGSLQRAW"
     misc_feature    647882..648616
                     /note="possible transcribed region"
     misc_feature    complement(649328..650199)
                     /note="possible transcribed region"
     gene            <650546..>651931
                     /locus_tag="CYME_CMN263C"
                     /db_xref="GeneID:16995180"
     mRNA            <650546..>651931
                     /locus_tag="CYME_CMN263C"
                     /product="beta-tubulin"
                     /transcript_id="XM_005537324.1"
                     /db_xref="GeneID:16995180"
     CDS             650546..651931
                     /locus_tag="CYME_CMN263C"
                     /codon_start=1
                     /product="beta-tubulin"
                     /protein_id="XP_005537381.1"
                     /db_xref="GeneID:16995180"
                     /translation="MREILHIQVGQCGNQIGRKFWEVISEEHGVDAQGFYHGDSEQQL
                     ERISVYYNEASTGRYVPRAVLVDLEPGTMDAVRASEYGTLFRPDNFVYGQSGAGNNWA
                     KGHYTEGAELVDAVMDVVRKECESCECLQGFQVTHSLGGGTGSGLGTLLISKIREEYP
                     DRMMCTYSVMPSPKVSDTVVEPYNATLSIHQLVENADEVFCIDNEALYDICQRTLKLT
                     NPSYADLNKLVSGVMSGITCSLRFPGQLNSDLRKLAVNLIPFPRLHFFSVSLAPLTAT
                     ASTAYRHLSIADLTQQMFDAKNQFVACDPRQGRYLTAAAYFRGSRISTKDVDEQMSMV
                     QSKNSAYFVEWIPHNIKSSVCGVPPKGLDMSCVFVGNTTAVQEIFKRVGEQFSAMFRR
                     KAFLHWYTGEGMDPMEFTEAESNMNDLVSEYQQYEQAVAEDEDEDVEQEFGAYRTGEE
                     DRTAIESSIMS"
     gene            complement(<652709..>654064)
                     /locus_tag="CYME_CMN264C"
                     /db_xref="GeneID:16995201"
     mRNA            complement(<652709..>654064)
                     /locus_tag="CYME_CMN264C"
                     /product="phosphoribosylformylglycinamidine cyclo-ligase"
                     /transcript_id="XM_005537325.1"
                     /db_xref="GeneID:16995201"
     CDS             complement(652709..654064)
                     /locus_tag="CYME_CMN264C"
                     /codon_start=1
                     /product="phosphoribosylformylglycinamidine cyclo-ligase"
                     /protein_id="XP_005537382.1"
                     /db_xref="GeneID:16995201"
                     /translation="MPSRQRSIVAFKNALFTPGLRAAASTRQVKARVRHSQPSRSSVR
                     FVCRRRSGLGTRPGIAAAAAIKATAPSPSYAESGVDLDVESASVRALVKALGAPGRTP
                     PALGAPADQLGGFSGLIDFGPNTLLALCTDGVGSKLVLATQLGLYDGIPYDCVAMNVN
                     DLLCIGAEPLAFVDYIAAPHPEPALWATLGKALGAACRLARVTLAGGETASLPDMVTH
                     LDMSGTALGWLPRGAQLDGRRIEPGDLLLGLPSSGLHSNGYSLVRKVVARSGADLNAP
                     PPFDVATEASACMRFMVSGEEHQPTWSMTTLGQVLLYPTAIYVNPIADLVRLCREQHA
                     QAPCSYEALHGLAHITGGGLSNLLRWRSDLGFDIENPLPVHPEFRWLQFAAGSISDAE
                     MYRVFNMGMGMVLVVETSAAAQVCGWLAERVPGVQIVGRVTESGRVRHCPSGVEYDQY
                     G"
     gene            <655034..>657034
                     /locus_tag="CYME_CMN265C"
                     /db_xref="GeneID:16995202"
     mRNA            <655034..>657034
                     /locus_tag="CYME_CMN265C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537326.1"
                     /db_xref="GeneID:16995202"
     CDS             655034..657034
                     /locus_tag="CYME_CMN265C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537383.1"
                     /db_xref="GeneID:16995202"
                     /translation="MNQARLMNLIRSVKTHVCAGSLQKSVYRGLLRRQWLRRSSSAAS
                     EQPPASTTASTATPSRSTVKPTTRNHRLSLWYVALVVPSLTLGGVLVALDLNDAFRAR
                     AERLLPGTTRWLSQLTGKPYGQSSEKDRIHKATVQRSRLLHAAATQLDNELRLEEAPP
                     TDKSFIGHESTDSIRADAETAATQIASHEKDMLNISASAGFEEAQSSESAELQGAADE
                     GSATSSAHASTTQQMTAAESSEHEEASPVSTKQASALTSTSTTLSASTEAEATAQHAP
                     DTSELSASREHILPTAVEMQALVEQLSVLVLAEALRVRELVKPLESQSKSGLLGGRGA
                     NPVEQRRQLALMLMKEETALQQDLERALRRLEKHLRQALEPQILAQLRPQFEKAWSDH
                     EALLRQQMQDELDTQRLALQREQVDRLLELQMLMERVEARALRDRLYKQYAHWAQRTA
                     LLWQALAVRLTRGEPFFAELSAMQQAWRSLATSKENPESSLDTWQQSAALVECVLSGL
                     APAIAMQGIPPASALQERFLNHVFPESRVAALMPANRGVWGYWLARIAAWLKTNRLEE
                     NLDQVSVIQILDAEDARAEEQTKPGTGLALTMEQRLLWARRCVERGDLRHALQHLQQI
                     PADSLVSRICKDWMTQVERYLVTEQAVRIIRAESTSVTAALC"
     gene            <658213..>659145
                     /locus_tag="CYME_CMN266C"
                     /db_xref="GeneID:16995209"
     mRNA            <658213..>659145
                     /locus_tag="CYME_CMN266C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537327.1"
                     /db_xref="GeneID:16995209"
     CDS             658213..659145
                     /locus_tag="CYME_CMN266C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537384.1"
                     /db_xref="GeneID:16995209"
                     /translation="MHPAAAQPSRIVVCIHGFGGFRWQLVPLASSLKRCGFNVYNYGY
                     AARKHTLEEHGLHLAAFLASIATESGLRSDAFPTRLGSISFVTHSFGGVVLREALTGT
                     AWHTARLTPEAARRGRAVCLGPPFGGVALARALRHREAHGRMPYRIIERLARTLLGPA
                     AGRELLEMPAEWFLRRGGMPDSMPVLVIAGDMGPINPLITRTRSPEVRSQESAWGRGQ
                     IISSAASEVAPSDGIVGVHETWLPSRHWFLRVRLPHHMLLYAPSVMEATAQFLLAQGD
                     DALFDYKLAGVAFRNERYKVAGDPDTEAESTDRR"
     gene            complement(<659912..>660586)
                     /locus_tag="CYME_CMN267C"
                     /db_xref="GeneID:16995210"
     mRNA            complement(<659912..>660586)
                     /locus_tag="CYME_CMN267C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537328.1"
                     /db_xref="GeneID:16995210"
     CDS             complement(659912..660586)
                     /locus_tag="CYME_CMN267C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537385.1"
                     /db_xref="GeneID:16995210"
                     /translation="MNAEPPGTERKRGADAQTPFSSVSERHPHPVLTTTQQRKRLVLP
                     YTLQCLRCQTYIQRGRKLTVRRESSTAVHAPSEHRNWRYLLCCPRCRARFALRPRKDA
                     HLYSLESSDSTEPLLVRNADLIAPQAHENPSSVPDELDAAITGFMQEMQNPRNVRTEH
                     ETLPYKLTDTSAKSSVVKRARRASRSLPGPSLAQFLTSAESIFDEEPLWNNSSSVDNS
                     TSNFNV"
     gene            <661781..>664147
                     /locus_tag="CYME_CMN268C"
                     /db_xref="GeneID:16995220"
     mRNA            <661781..>664147
                     /locus_tag="CYME_CMN268C"
                     /product="probable carotenoid cis-trans isomerase, CrtH"
                     /transcript_id="XM_005537329.1"
                     /db_xref="GeneID:16995220"
     CDS             661781..664147
                     /locus_tag="CYME_CMN268C"
                     /codon_start=1
                     /product="probable carotenoid cis-trans isomerase, CrtH"
                     /protein_id="XP_005537386.1"
                     /db_xref="GeneID:16995220"
                     /translation="MSKHRGRDQKREPQEPQRLLQMHQSYAQLWSPPLPRVTELRSAG
                     PATPPRVYVAARSTSMPAAHDRGYAFLTSWSPSLSHLRRFTPQRGWRQPTRRFQRTCS
                     GAGRQYQTARQRPERHGAPQLSANVDDGAAAVATAAPEIRTAFDALVIGSGIGGLVTA
                     TQLAQRGAKVAVFERYLIPGGSAGFFRRGGYTFDVGASMIFGLGEQPGSTNLLTKALA
                     AVGEHLETIPDPVQIHYHCPDPVLQHLLVYRDEKRWLQALTERFPAEKEGIHRFYGEC
                     WQVFRALNALELRSLEEPRYLLRVFRQNPGACFTLLRYLGVNVGTIARRHIRDETLLR
                     FIDIDCYVWSVMPADRTPMINAGMVFCDRHYGGVNYPRGGVGQIAQRLAAGLERCFPG
                     CKVFYGARVTEIEMMSDPSAPGGKRAVGVRLADGRRFRARAIISNATRWDTFGLEPET
                     VQEVASATTAAHASLPVAAAVVADTPTRGSVADNSGTVLEALLPQKSRSYEPAVSPEF
                     SSPTTTVSSHDRKTGEHFRAAAAVSGAGAQEFRPGRRALVNAEHVPEIERLWSQLYVK
                     APSFLSVHIGVRRDALSNKDGNLEDCHHIILERWEDMETAHGALGTLFVSIPTVLDQS
                     VAPEGRHIFHVFTPSWMEEWKHLSPTAYREQKERYAARLLERLEPHFPGLAAGIEEMH
                     VGTPRTHRRFLGRQDGTYGPMTHRLLQGLFTMPFNCTAVRGLYCVGDSSFPGQGLNAV
                     AFSGFAAAHRVAADLGLEPRLPKFIDDWLVDLIAIKRVNWFSRRMLRT"
     gene            complement(<665548..>666549)
                     /locus_tag="CYME_CMN269C"
                     /db_xref="GeneID:16995221"
     mRNA            complement(<665548..>666549)
                     /locus_tag="CYME_CMN269C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537330.1"
                     /db_xref="GeneID:16995221"
     CDS             complement(665548..666549)
                     /locus_tag="CYME_CMN269C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537387.1"
                     /db_xref="GeneID:16995221"
                     /translation="MQHQVCCLREVLATTDGRDKVYRLVQFTAKFVRGPYTELLIKDP
                     ERVPLLAQKALTLELVLADGRKLFRLARGLNVLAKYWNHQRTTKGGTLELIFGTPILQ
                     LLADLGLFCYFGFDHLVWLYRTGLFLEPPGQKRARFWGRCAGYSLLLSSLASFALYVY
                     QLWSILNRKRRSDEKGAKDSISALAATALEPERPPPGSFETGVLARAVRYGCDILVGL
                     NMAEPGQHSQTLVGAAGVLSSVLQLAQLWPRRRSRITEGTPTAGMDKLGATATVHATA
                     ETLPTTGPATETSHAVPNSLNAAAEQQSSESGNHSPKPRHRSRRRGPPRASRPSTSS"
     misc_feature    667010..668886
                     /note="possible transcribed region"
     gene            complement(<668559..>668924)
                     /locus_tag="CYME_CMN271C"
                     /db_xref="GeneID:16995230"
     mRNA            complement(<668559..>668924)
                     /locus_tag="CYME_CMN271C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537331.1"
                     /db_xref="GeneID:16995230"
     CDS             complement(668559..668924)
                     /locus_tag="CYME_CMN271C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537388.1"
                     /db_xref="GeneID:16995230"
                     /translation="MIRSISMTRNFSIASCSNESLRMTGTRALCRPKDQKAPWRASYT
                     TNIWIQQQRSSLSGQSIGCASMLRKSATLARDGGSCIPFTIAWWDSWHRDHCHKSVRY
                     QVRCPWRPELFPCLAWRAR"
     gene            669674..671133
                     /locus_tag="CYME_CMN272T"
                     /db_xref="GeneID:16995231"
     misc_RNA        669674..671133
                     /locus_tag="CYME_CMN272T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461487.1"
                     /db_xref="GeneID:16995231"
     gene            <673045..>683559
                     /locus_tag="CYME_CMN273C"
                     /db_xref="GeneID:16995232"
     mRNA            <673045..>683559
                     /locus_tag="CYME_CMN273C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537332.1"
                     /db_xref="GeneID:16995232"
     CDS             673045..683559
                     /locus_tag="CYME_CMN273C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537389.1"
                     /db_xref="GeneID:16995232"
                     /translation="MQSSASAAVCGSATVGDPSSRRISFILTRRGSLGLQELCTAWVG
                     TARSIHGTWIYPDGSGSSVTERASADRRKTGAVSESAVHSNDWFEEATQVTHTIVTEL
                     LPARFEIAHGARLLCAIATGHWILRASYLRASASAGCWLDNEIDHEWAASLESLSDAE
                     RSVASAARWWRESLQSGRCKRLLQDLRVYLLCPAVNGASNESRGRTCASWMVAVASNA
                     RAVAAIVRATGAELCGVGSTCTASDHSIDVVVEVYSENGQNRIPPNTSCLEMQQGRWL
                     SALDIVVGLIGCADEQLRFAQLRTTRNIPGSESHHATNSCRFGSSGGENSTCVSALAW
                     TETATSTKNEAVPSSDPSPSAGRLRQSPGERQELSDAPAPATVLAAQRAECLQQRPSG
                     ALSGTLSPDGSVLESACHDDDALGEVRHGVGAQRLPSNSLLSQDETHAVTLKHPDTTG
                     NTGIFTSYGSTPVASSNNSSSGSSTRSARIVATKFAAAHALGESESRSSGEIALLPAA
                     DSGTLTALEDEAPLEQLSGIRRDGITRQDPDNSCSASFTRVLGTLSEDNRSCAPLSDH
                     SPSGSIENACWPPYRQTPDDAAADGSASPFDEFDLKGLWQARERATAALPAHGTRTLS
                     PRKRQRIHQSIETHDGTSRCTTRRVLFGSIASPTTPEGVASHSVEAQTAGASSHRALP
                     ESRARVETRVESPERIPVDSKASPRSSLDCDDVSTSSSPMMASVCGKRIKHEPCSWPE
                     TRSPGTTPKTDTRVTGASTATKLETGSISSPDAKFGTYGSTAWDAVQPLPRTHLEKRV
                     SPGPPRRQAPALSPKFHVAASDAPSVLNLSHLLDLIQEFESAVQRDTNEWRRAVLTLG
                     YSRATKAPLFLRVAARNLRRLRLLMESGCVRVPMSYGRRLWYDSGATDAHRLQAASWL
                     SFDDAAWCLRRSSLLPPRDMGQFRERLVQSARIRARGRSELHRLEPVQAIVGLARVPH
                     RQLLRLAPDAQRRVHTLRRVVSRQWTREAVASWSEAALKAWRDRHENANAYYYRHTDP
                     GEFEGEETQSLHTWTPAERRLFFAELDRWRANQWRLGTCWGIFSKAIPSRCGYQCSNF
                     YRACIRSGEIHDPTYGFNARGELKRLYPEREDPNTRAPPDALNCLSEVWQWPEIQSME
                     RQVDTWIRELHPSLALNANWYRQQRPAGEPQRRNVRAASGGQRQARSIRRSLPATHID
                     LLGSYPDAYITTTDAAYEEADVRHRRERRLAYRSASVASTGCCVVAPAPDQRRLESRT
                     GSRQTLRSRSQAETPELAFVEVDGGALMEVMQAPAADPVAVPQRRRLRRLASPESDLV
                     DQDAFGVDDARCPTVASPESHNATAMRYQQRPNRIVLEAEHAGTSLGAPSGQRSDRCN
                     ANLDKVAIGVVRSMRSMTARRQRLESILERIRAGKASTRGPAPAPVHSLLQASMSDGK
                     EASLSGSTSPVHEAPDWRVQRLRHLVGAADQPQRTALLPALEASSGAVGGTSQRLPAP
                     LATAEGHSGRKRRQPQRLLIAGQTAATTTTTGAAAAAAAAMNASGAIVPPMETETRSA
                     QRSAVAQHCYTEQIVQETGNDLPGDEGDAAHQRTSRFWAHQHQQRSPASIVPAFRASK
                     QQTRLPEWRPQTLSDHLLRLCRLLDLSSSSSSSLSNAWCDNALGLPPAGVPLERATLA
                     HPECFDAGRSHPLPLIVAERSTVTAAGTRSQATDSWNAADAFIDGLDGVDASSSLLQQ
                     DSAPPATATDAAGRSRYAGDNPDSSFYAAWSGYLNQMLQRILQRRCGDAPADPHAETN
                     VSGAWNAHDEHASGTGASQAWSCSLSTRDTSCQFTLWPMLQTLLERLANDVVLLYTDA
                     DPVLGQWLRQSGSRFADGQEGAEPALPHLIQLVMRLTALHADTQVVVAAHSLATCVHE
                     ALDGTSASSSGICCARDALWIAVAVGLERASAAHVRLPTLPLTIPQTIPVTAANAAES
                     VNEQANAQQQLRSALRLFCWHLLCSEALHCAPVLLTSPMCWRLGASALAESLQGWRTL
                     RQECTSSSSSSSSSGSATLTMPALAALLARWHERVLACCTRHWRQVVNAACTHHTGGF
                     SLDTCAPLLEQALHLGAEAATWIAFPLATTTNAETTLGHAAQRRLGRHDWRLQAQALD
                     EWATELMRPFSPESDALGCTVLRPAAAAAAAAAAAADYDGNHNDGHDDHGTPASLQNI
                     CNVDSSTAVVALAGVPNAWHSNTLGAPFSQPSTSVDGFYVQGAAALSAPVTLGALFGV
                     LRSALEMLAVWRTSCWQRFITNASSPVAACSVVVDDANATHAGARLLASTLERRWLQL
                     LRASLARLWQVSGPADDTAGDGVCHWIDRSYGPYVFYLYGTALLAQMLPDPERQALYR
                     QVRHRCPNWILPTLLRLHGAFMIWCCTRVRFLETSQHAASSANETAMASPGSATPPLL
                     LLLLHGLVHVHATEWVTLSQQLLRWLETAGAAPAGLLPSAGMAYASERAPLPAVLAQR
                     VLAQRLETNRVMLGQIPALDHVTAWVERCVASSSNSSSSSSNSRTNNTIPSVGKCAIG
                     ASTWTCWETLWQALPWYWTWLTRVLENAALGSSGSTAPSTRYAITPALSMVTSGVVVR
                     VARFIQVVLASALLELTPCAESAGAQSDDARDPPRDPDAWIWAPEMTATTTVDWWAAH
                     TQRALLLHAIGPSSERLAAFLELVLPQNQSGAAGNSTGLLWFVPASLQEAHAHLVADM
                     VRLLHQVEGAATVHRFLTRLTPLLGGRSEYLESWTGIRACQRRWSIGFLTRLVFLAKL
                     QEPVRIPGNVHAPRGVSASEIHCCGSDECSETADAYGALGESSANALCSDQEAALRLA
                     AALQHLLTQTLLHGLVASPLLWASEQAGARERPASRLWSSMEPLVRALCQSGDVEDED
                     AGAAAAAAMPSWPLFLARYAARFCNGLVRHPATSVATSTTIAAAAPLTHVRHLWLPLL
                     ARLRQLVPTASAATVNSETSWRRHQVSTLLAKLVDELEALLTSALAWNHMWLQGRRAA
                     VTGDETPALSRAALQLFQYLVEFAGILLVLCARLLRVPGRAPFWSRVIRLGRRALEEY
                     ANIVAGQRRQLLQTETSYAPGRSRSLEHLRCVWIATVLRGLAQMDLVPNDSYYASFRR
                     HLIAASLAQDALDALVLGLWPGLSPTLLQQPVGESTAARSERPAVGACVRESDAAAEA
                     TALLALLDWYCRPETLFPAGTAALQRLERFQQEWLSDLCSRCLAQAQSERCVNLLQRW
                     LQGRLLTCTRQSCLSHLSGAVYYATMARTLAVAWWSGCMRHVAVRLNHAGSPSMTTTT
                     TTTPEQQQQQQQHRAALRPADRVATEVISDQCSGRRFAQRFRNSVDLAAALMEWLAAS
                     TRVDAPAQATCEETLALLLEALAAHVSAGSCPHCGDDPSPASISSDERVQLLRRRLAE
                     QRARSACAAVHAVWTDHLERLARKEAMDAKLFTHPSCCRNWLVIQVNDVVERAACWRR
                     RPGDIWRTAGPSVFDGMKDATTTTRTPPPWLCWSVPER"
     misc_feature    complement(683362..684699)
                     /note="possible transcribed region"
     gene            <684746..>686731
                     /locus_tag="CYME_CMN275C"
                     /db_xref="GeneID:16995272"
     mRNA            <684746..>686731
                     /locus_tag="CYME_CMN275C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537333.1"
                     /db_xref="GeneID:16995272"
     CDS             684746..686731
                     /locus_tag="CYME_CMN275C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537390.1"
                     /db_xref="GeneID:16995272"
                     /translation="MLTGWTVHSPTVLSWVLVGFHAKHGHQIECAELADELSVNWQVN
                     QPEERSGASAQNLSNDWLREVAVRALPDGAHERDHDIVYFTVRHCVTVDTLYGVACYR
                     QRQVDCSRIASAEEAAATARGLVQKSVVLLSRWPLYALLASRLEPVVASYFAKHNFGQ
                     VDCFRTLVTTLNEEVAAALGDPEVQRLPVSTPVPVQRLPACLDRYVFGDTCLQQLVTR
                     LRRDLLRLIKLVLLERRVLVVGSPVELVAKAVLSLVSVFPAECLEPPPNSGRDAALDL
                     ATCCTLAQLPFGLFDLYGSTGVIRVEPYVPLASLQPTLAERDADTAAATTTRWIVGVS
                     TPVGRLFADACRSAGVFERSPVRSLFVTGRSASAQTPHSVPESMSPERSDTRPAKASW
                     RPMNAFPQPPDALVHLERGRVYFTPELASLLELTRSEKRFIDELVHATARGALNESAV
                     RARLQWYIVKLALIAAVAGDDAPMPAEQQPALIDELGLPFFQHWNRHTTHFRRWHASL
                     HRAHATLRRNALGHVLRYASSMPTAVDEQQQQQHSMRASFEELDAGLGLHSLRQAWMR
                     WWRSATSTDDTRRQSSWRVHHGTAVTRVESRGASDAWQRSWALPSISAGTIADEAWAS
                     SGEASTIPQAKAHLMTPAVAAAFTSTDITLLRDRLSP"
     gene            complement(<687954..>688703)
                     /locus_tag="CYME_CMN276C"
                     /db_xref="GeneID:16995273"
     mRNA            complement(<687954..>688703)
                     /locus_tag="CYME_CMN276C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537334.1"
                     /db_xref="GeneID:16995273"
     CDS             complement(687954..688703)
                     /locus_tag="CYME_CMN276C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537391.1"
                     /db_xref="GeneID:16995273"
                     /translation="MVFVVCTLQRLQPGHRWSVSGAPAGVVAPKRRRCSCYASTAASG
                     SSDDGVDEERRFGQPPEQHAATPNGSPHGNAQPARPAPAVVRVQLMVLLETTAAWLAA
                     RRRGAPRASARELERVQRLPSFFRDTKGESSRSAPANAAVAAAPSAAGASSAQPSTTG
                     PENWTIRAPVYRVVLFRAQTLEQGHSTEHVVRALVSHVPQMGFGTAVATARILERCGR
                     AEVLMPSERLAECCCGRLLAEGIMASVEPVS"
     misc_feature    complement(688790..692159)
                     /note="repetitive element"
     misc_feature    complement(691948..693010)
                     /note="pseudo-gene of 3-oxo-5-alpha-steroid
                     4-dehydrogenase"
     gene            complement(<693665..>694240)
                     /locus_tag="CYME_CMN279C"
                     /db_xref="GeneID:16995371"
     mRNA            complement(<693665..>694240)
                     /locus_tag="CYME_CMN279C"
                     /product="similar to thioredoxin f"
                     /transcript_id="XM_005537335.1"
                     /db_xref="GeneID:16995371"
     CDS             complement(693665..694240)
                     /locus_tag="CYME_CMN279C"
                     /codon_start=1
                     /product="similar to thioredoxin f"
                     /protein_id="XP_005537392.1"
                     /db_xref="GeneID:16995371"
                     /translation="MVGISCFVSVPVAGSVGKRADLGSGAVCTRALLASGSKAPLWRR
                     HALGTVQQGVGSGHHHHHHHRCSYSYSRRRPLGSLRPRMAVREVDSQEEMERILSEAG
                     NKLIVVDYGTTWCGPCKLMEPKMESWSEEYTDVVFLKVVGDKSKETSMMMKAAGIRSV
                     PSFHFYKNGDRVLTINGAKAEEILRGIEAHM"
     gene            complement(<696407..>697528)
                     /locus_tag="CYME_CMN280C"
                     /db_xref="GeneID:16995366"
     mRNA            complement(<696407..>697528)
                     /locus_tag="CYME_CMN280C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537336.1"
                     /db_xref="GeneID:16995366"
     CDS             complement(696407..697528)
                     /locus_tag="CYME_CMN280C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537393.1"
                     /db_xref="GeneID:16995366"
                     /translation="MHSCSMLCRWCRRSCPSQYRPHLSGDAGARSHHHRHRRVDAWNV
                     GNSARRHASLPNLAPIADAGGAADVPNAHFGAAAGPVRSPRIECAGSRGVRRWCHRGV
                     SQGLHRGLFAAGRSAHRRTHTRCALIPNAAPPTIETLLFFLERGSVLINMRAWLLFAF
                     LSLWGLAGCLSRCAATVVTPLNLETLEESILRVPSRALGGIYINETDAMALNVSQYDF
                     TIMNALADLDHDLCLNKGLIIGAANVVDNMVECPIADVAAGNCSALGRAAVESALAVG
                     GWTSTDYMGAAHATKLPAHYFNWSSPYAYGGEGLFGREAFEAAMLVVPEMERVFRSAL
                     TSGRYKFIASYTAQMLNDEIYTYVILGSDPSQHCYSAGA"
     misc_feature    697583..700212
                     /note="repetitive element"
     misc_feature    700021..701627
                     /note="possible transcribed region"
     gene            <702544..>703191
                     /locus_tag="CYME_CMN283C"
                     /db_xref="GeneID:16995394"
     mRNA            <702544..>703191
                     /locus_tag="CYME_CMN283C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537337.1"
                     /db_xref="GeneID:16995394"
     CDS             702544..703191
                     /locus_tag="CYME_CMN283C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537394.1"
                     /db_xref="GeneID:16995394"
                     /translation="MVSNRSAFRLAVLALALILFTMIWDAAVYRGTSALPLSTQVRAA
                     ENRTHHLPDAVAAALNYTQFEYTLANSLYKINPHICLNYALSVAAANLADLLTYCTPD
                     QVGNNSCSALTPGAIARTLLAAGWTSTNIQLVDLAAKVPARYFNWSTSDGLSGLQAYH
                     VGLQAAPYVVNQLRPYLHSGQLNLVGVGAVALRTDYVYAMVALGGDPSQHCYEAS"
     gene            complement(<704997..>706091)
                     /locus_tag="CYME_CMN284C"
                     /db_xref="GeneID:16995395"
     mRNA            complement(<704997..>706091)
                     /locus_tag="CYME_CMN284C"
                     /product="probable cinnamyl-alcohol dehydrogenase"
                     /transcript_id="XM_005537338.1"
                     /db_xref="GeneID:16995395"
     CDS             complement(704997..706091)
                     /locus_tag="CYME_CMN284C"
                     /codon_start=1
                     /product="probable cinnamyl-alcohol dehydrogenase"
                     /protein_id="XP_005537395.1"
                     /db_xref="GeneID:16995395"
                     /translation="MTSSADKSVCVTGASGYIGCWLVKYLLEQGYTVHATVRDLNRKT
                     EPLKRLAEEHASQGGQLVLHQANLLDAESFNEPIKQCSVVYHTASPFQISKSRESGQK
                     RFIDPAVRGTENVLRACLRPETRRTLRRVVVTSSIAAVTGFYDQKHGNPVPTYDETDW
                     NTTSTPQNDPYSFSKTAAERRAWELAHAPENRDKSWDLVTILPGFVLGPSLTTETESG
                     SVEFMRELLGGRLALGVPAWQQSIVDVRDVALAHLRAGSDKKRVPSGRYIVVAGYKSI
                     LEVASAVRAEWGQRFRLPQRELPKWLMYLAGPFIGLPWEMIRHRVGIPICFNVAKSKT
                     LLGMEYRGVDLTIREHVQQMIADGLVPLQR"
     gene            complement(<706895..>708720)
                     /locus_tag="CYME_CMN285C"
                     /db_xref="GeneID:16995396"
     mRNA            complement(join(<706895..707825,707903..>708720))
                     /locus_tag="CYME_CMN285C"
                     /product="phosphoenolpyruvate carboxykinase"
                     /transcript_id="XM_005537339.1"
                     /db_xref="GeneID:16995396"
     CDS             complement(join(706895..707825,707903..708720))
                     /locus_tag="CYME_CMN285C"
                     /codon_start=1
                     /product="phosphoenolpyruvate carboxykinase"
                     /protein_id="XP_005537396.1"
                     /db_xref="GeneID:16995396"
                     /translation="MWFPRLRTSLRSGPRLLRTWQRRLSSGGTSPETVEQFLVRQLGF
                     QRAPGAIHRNLPFSEAKALALQRREGVEARDPPGALCVDTGEFTGRSPRDRYIERREG
                     SPLAERIDWGEVNQPIERTIVDELQKQVANYLSALPELFVFDGLVSSGPNRLKLRVVT
                     ELAWHHAFASNIFIPLSSPAEAASFGEPDFTVVYASGLRNRHYRAMGLNSDIFIVLGF
                     ERRLALIAGTSYAGEMKKSVFTIMNGMLPLKGILPLHCAATRSLSDTNPDTICFAGLS
                     GTGKSTLSADPERKLIGDDEHSWDETAIRNMEGGIYVKVIRLSPEKEPILYSAIRKPS
                     TILENVVVDGHGVVQFDDASKTENTRATCPIHNIPQWEASRQGPPPKAFIFLVCDAFG
                     VLPPVSVLTPLQAAYHFILAYTAKVAGTERGVLRPTATFSTCFGAAFMPLNGQVYAQL
                     LNEKLERHGTQVYLVNTGWAGGGAADGAARMDLEVSRAIVRAIATDAIPTSQVSAPDP
                     IFGLRVPRAIPGLDSRLLHPATYWADARLYEQRARYLAERMHAEYLRKGYNPEWAAGG
                     PLWPSRLASHRGTQAN"
     gene            <709259..>711550
                     /locus_tag="CYME_CMN286C"
                     /db_xref="GeneID:16995408"
     mRNA            <709259..>711550
                     /locus_tag="CYME_CMN286C"
                     /product="sodium/hydrogen antiporter NHE8"
                     /transcript_id="XM_005537340.1"
                     /db_xref="GeneID:16995408"
     CDS             709259..711550
                     /locus_tag="CYME_CMN286C"
                     /codon_start=1
                     /product="sodium/hydrogen antiporter NHE8"
                     /protein_id="XP_005537397.1"
                     /db_xref="GeneID:16995408"
                     /translation="MDLSKRATIAQQLESAGSVRRKERSKDVAVYRRRCFPVLVTLLM
                     GLALGQFLVCLHSVQEAVANGPPEAQNVVSRPEEAVPAAMLGSGGAAAGSWGGVASLA
                     ETVTADEAKAAGSASSPEHPPDTSAADGATGPPRTDPHAEKHLGLGLFYSIVALLIGI
                     LLSYLLLQYGFHALPDCIVYVIIGLTVGGFLRLAGDDYAAVSRALPNQEQFMLFILPP
                     VIFEAGYSLNKGDFFAQAGSIISFAVFGTIISALAFGLGMWFLGVLHLSYRLYLFEAL
                     AFGSLISAVDPVATIAIFNALKVNRTLHYLVFGESVLNDAVAIVLFQTFGGMVGSESA
                     TSWWQPVGHFVYIFLGSTAIGAAVGMLSALMFKYTRLYRYPVLELSTLLLVAYLPYTF
                     CEGLGLSGIMSILANGVMMAHYTHHNLSSVTKLTSQQSFKMIAFITETFIFIYLGLAL
                     TLFAHSWHFMTVFWGILLTLLSRFVNVFPLSAILNRYRREKINATNQFVLWFSGLRGA
                     IAFALSLNFPSADSGDPARDLETRRAIISTTLAIVIFTVIVLGGGTLPLLRLLRVEQA
                     ESADNYEMSRVHADAVSSTDQAAATTVSFADADAAGQRTAIFVGFETDSPVFRPAQDA
                     TTTGDGSATWNAPTIQTSMDAHREAAASASSLQHPVASGHAASMTAEESMSWLQRLDE
                     RILQPFFRAQHRQVGRQGIERFLKDGERRLLSPTELAQIVSRAAWDESDEDTGSSLPE
                     TAEHAEMGQLGQQTLEDGSTSGR"
     gene            complement(<712452..>712682)
                     /locus_tag="CYME_CMN287C"
                     /db_xref="GeneID:16995442"
     mRNA            complement(<712452..>712682)
                     /locus_tag="CYME_CMN287C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537341.1"
                     /db_xref="GeneID:16995442"
     CDS             complement(712452..712682)
                     /locus_tag="CYME_CMN287C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537398.1"
                     /db_xref="GeneID:16995442"
                     /translation="MHPVLKASDHPLCRELIKQLEDCHYHHKVLKFFGKCNACKRELD
                     QCLAKELLVKRELNYLASEARRPRSPASSQSN"
     gene            <712943..>714604
                     /locus_tag="CYME_CMN288C"
                     /db_xref="GeneID:16995443"
     mRNA            <712943..>714604
                     /locus_tag="CYME_CMN288C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537342.1"
                     /db_xref="GeneID:16995443"
     CDS             712943..714604
                     /locus_tag="CYME_CMN288C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537399.1"
                     /db_xref="GeneID:16995443"
                     /translation="MKLGRLGTPVMRPALHVWCLLWLCALLTEFVAAGTIQRVIGADP
                     ETERRFIAQIASLGGFRCSNDSGTLLPPSFLNDDYCDCPNGADEPGTAACAGLAPLSQ
                     KFFCPGEDNDKQTLPLSWVNDGQCDCCDGSDEWLSGVQCENVCDVLRSERLRELELQL
                     ARYRQGLEKRAELVEEAARIRQAEGNQLVVTKRQRLAEAERTLAAIEQKRRFFETWLR
                     WFDTSTEALADAGERPPAQQQDAQQQASPSGLAEMVTSEVERELAAVPSERDLTTAPQ
                     AKPLWRRWWWWSWRRHHFWERFIGASDSSAPIVELDEPVDLESTACMRLMRLQAPIWV
                     VQRFERLWGQHLAPMERIRRSVGRFAAPLLKRSVQHRHIRTCLRLAQGGVARAHRERE
                     EAARALEEAQRLEDAYLGPQDVLLGMRDHPCLRKTVGQYDYEVCLLQHVKQYERVSRG
                     SHTGIVLGSFAYAEHVSVNWSGSPDKLALQYLGGDMCWNGPQREATVIVECDPNLSIL
                     TVTETERCKYRVTLQGPLGCFEEALAELERQRARLSVQQQPASSS"
     misc_feature    complement(716558..717140)
                     /note="possible transcribed region"
     gene            <717534..>718295
                     /locus_tag="CYME_CMN290C"
                     /db_xref="GeneID:16995438"
     mRNA            <717534..>718295
                     /locus_tag="CYME_CMN290C"
                     /product="photosystem II oxygen-evolving complex 23K
                     protein"
                     /transcript_id="XM_005537343.1"
                     /db_xref="GeneID:16995438"
     CDS             717534..718295
                     /locus_tag="CYME_CMN290C"
                     /codon_start=1
                     /product="photosystem II oxygen-evolving complex 23K
                     protein"
                     /protein_id="XP_005537400.1"
                     /db_xref="GeneID:16995438"
                     /translation="MFLAQTSPAPSRVAALRPSTSSERKQHSWVAAGAPSQRLFSSCS
                     GERTERPASALPSSGATTGALHWTRRSLIQTTLLLAAGCVAGSPALAEKATAEAPAVP
                     RDVRNQLELYVDLQRGYKMYRPKGWNEFDGDPGNTKYEKKFQDIIQPLEFVTVFSIPV
                     KPGKTLASLGDAEAVGKRLAEQRGATLVAANQKESDGILYYVFEYVREPAHQLSLLTI
                     NRGRLFSVNACASEARWKRLEKLLRAVVDSFVPQL"
     gene            complement(<718453..>718758)
                     /locus_tag="CYME_CMN291C"
                     /db_xref="GeneID:16995439"
     mRNA            complement(<718453..>718758)
                     /locus_tag="CYME_CMN291C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537344.1"
                     /db_xref="GeneID:16995439"
     CDS             complement(718453..718758)
                     /locus_tag="CYME_CMN291C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537401.1"
                     /db_xref="GeneID:16995439"
                     /translation="MRDYSPSEQVLADAWDRALETGIKWAVYGLAAGGALGLLLFRGG
                     HARAGIAGLGSGIGMGMAYADARREFQRLASGANERSLAAASLGTTDSTLARIGSED"
     misc_feature    720529..721248
                     /note="possible transcribed region"
     gene            <721538..>721924
                     /locus_tag="CYME_CMN293C"
                     /db_xref="GeneID:16995191"
     mRNA            <721538..>721924
                     /locus_tag="CYME_CMN293C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537345.1"
                     /db_xref="GeneID:16995191"
     CDS             721538..721924
                     /locus_tag="CYME_CMN293C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537402.1"
                     /db_xref="GeneID:16995191"
                     /translation="MVADRCPVGASLMRKLGWSEGKGLGALEQGRQKPLLAQPKFDTC
                     GIGAKASDAAPADLSIVLSQLPTWVEPLQTEVMDDTSKLSLDDVFRKLHERRHRMKKT
                     KRDRRKRDKLGTHQAATPAKRPKSER"
     gene            complement(<723193..>723909)
                     /locus_tag="CYME_CMN294C"
                     /db_xref="GeneID:16995224"
     mRNA            complement(<723193..>723909)
                     /locus_tag="CYME_CMN294C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537346.1"
                     /db_xref="GeneID:16995224"
     CDS             complement(723193..723909)
                     /locus_tag="CYME_CMN294C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537403.1"
                     /db_xref="GeneID:16995224"
                     /translation="MASLAAVVRALLRRESQRATGYALREWTMLTARHLPYLQGQLTL
                     GRIAAVGHLQRSTLGRSEWHTSSAPLFGEGRGRWHWGLSTSDVVDGSDHEHHSTETGG
                     RELPSFKTGELGSDVDGDRAALEAWLAQIRDETSGWPELSLDALRDELDEELEGDDDD
                     NDDDDDETYENEELLKALQEAVNRHRTPVVALVSGRVVHLRRTAAPKRSPRAGRVPRN
                     EPQTTSRDTTKADANDNECT"
     gene            <724792..>727317
                     /locus_tag="CYME_CMN295C"
                     /db_xref="GeneID:16995225"
     mRNA            <724792..>727317
                     /locus_tag="CYME_CMN295C"
                     /product="ATP-binding cassette, sub-family G"
                     /transcript_id="XM_005537347.1"
                     /db_xref="GeneID:16995225"
     CDS             724792..727317
                     /locus_tag="CYME_CMN295C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family G"
                     /protein_id="XP_005537404.1"
                     /db_xref="GeneID:16995225"
                     /translation="MADTSDNIGREASISLHQGIQTREGAQELPFSAEDLLQGRTRGT
                     SPGTGSLESNSPDVTPDDADDKKDRNHAKLFTGASTRTQLRLARCRKAISLEFHNIHY
                     KVPLRRPPPPRSRWERYVTRPLRSFLPASISERTYGSVELLHGISGIVRPGEFCAILG
                     GSGAGKTTLLNALAGRSAVPISEGSILFNGRPRTHATRRLIGYVMQDDIFFSNLTVGQ
                     TLQFTADIRLPRTMSAQEKRERVDEVLQFLNLSKAKDTIIGDQQFRKGISGGERKRTN
                     IAETLLTNPSLLLLDEPTSGLDSTTALAVVRLLKDLAITEGRTVIATIHQPSSIMWAE
                     FDKVLLLAEGSVVYFGQARDATDYFEKQGFRLPYGYNPADYLLDLLVSGVHSGGRMTE
                     ERWTTVPDQVRWETRRLFGGLDQFEDPSMYPVENDYNLTASMVLRAAWRLHEEEMLAR
                     ERKLYEERIREHSTIARAADASKREMERAANDVERTRPTESLRNVLHRIRSHLPTGPD
                     RQTARTNDDDENNHVVIKLDSAINEFDEDDTAELEEIERHKYPVSWLQQFRALAIRAM
                     HQRKGVLFTFPTLIQCVIISVLVMLIWINSPNNANGIHQRFGLAFFSGIFWAFFALFN
                     SITSFPSERAVLAKDRSSGSYMLSAYFLAKTSVESPLELIYPYLYILIVYFATDLQRT
                     ARAFFLFVILLSLLTLVAQSMGYWISSMVMEFKQAQVIASIWMLASMLVAGFYISESQ
                     IPVWIRWIRYVSFVYYGYVGLVMNEFQGSTYACVSDSSTAKSYPSCAQSPPQPITPHE
                     VYQAYSVNTVFGIGGSIGMLIMFLVVLRFFAYLSLKYIQAVRK"
     gene            complement(<727766..>728041)
                     /locus_tag="CYME_CMN296C"
                     /db_xref="GeneID:16995388"
     mRNA            complement(<727766..>728041)
                     /locus_tag="CYME_CMN296C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537348.1"
                     /db_xref="GeneID:16995388"
     CDS             complement(727766..728041)
                     /locus_tag="CYME_CMN296C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537405.1"
                     /db_xref="GeneID:16995388"
                     /translation="MGKSAKISKVSRTGRLPFKQKRLKRELLKRRAQNQDTKEPDLWS
                     TTDELTHLRAWRQRKKQRALDVKEAAPTTSDANAGSKKSEESWVSSD"
     gene            complement(<729221..>730402)
                     /locus_tag="CYME_CMN297C"
                     /db_xref="GeneID:16995389"
     mRNA            complement(<729221..>730402)
                     /locus_tag="CYME_CMN297C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537349.1"
                     /db_xref="GeneID:16995389"
     CDS             complement(729221..730402)
                     /locus_tag="CYME_CMN297C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537406.1"
                     /db_xref="GeneID:16995389"
                     /translation="MARIMANAPTWAVVLGTMRTDELSGAAWSAVRPWVSSAASALVT
                     LVQLGQFIPQHIELYQRKSVVGLSAWTIFFGSLYTYLTMIDYLVQSRGVWLRACTRGW
                     LVCFTEIQPFVQVVGSWLLVSLLWFWYLRYEKLDEARELQRIRAGIVFSDSPADAHWK
                     SPRTETVSKLTSPRPGPSTPLLSTDENSASDPEADATPDPQWWHAVPREHRRHAHYRH
                     HRYYFDDSAHAALFFKIFLLVVVLVAVPAAGLIGGYDTGSGWLTVLFADVCGYLATLL
                     CTVMWIPQIITTYTYGHRGSLSTLWVLFTFISDVVYSLYLAALGVPFSVWANNVPDGL
                     CAVFLFFLIRVEERRERENTSKLHAPAGASVEPNESPGGCSGVCDRLRDSQRSSECPS
                     M"
     misc_feature    731024..732936
                     /note="possible transcribed region"
     gene            complement(<733029..>734522)
                     /locus_tag="CYME_CMN299C"
                     /db_xref="GeneID:16995475"
     mRNA            complement(<733029..>734522)
                     /locus_tag="CYME_CMN299C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005537350.1"
                     /db_xref="GeneID:16995475"
     CDS             complement(733029..734522)
                     /locus_tag="CYME_CMN299C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005537407.1"
                     /db_xref="GeneID:16995475"
                     /translation="MTRNGTQIVLAIVLVLSLSSLVSSAVVTRREVFGAATQPESGRG
                     RTGRGCASRLVLNVDAELETLGRSAPAPSPVSPPPAPLEDGQECVSDQGLRVSWKWLN
                     QNEGVVMWTFENPTNESGAVALNRGILQQPGSTYCLGDAFWPAYLEDNLAFIAAGPYP
                     ALTGSSASLPIAAIGQDSRVICFVFTLNPGESYDLPEAGFVGISPQCTALLDLRFVSN
                     INMTIAYDTQNQCREFNGNSKCPPNPVQTEIPLYQPHSGKAAGAFQPSYSSGSGFVCF
                     PGDALVERPDGSAVRMRELRVGDQVMTLSAGEHPSGTPRRVATRVYGFVDRIPHGSAI
                     PYLRITTTRQLLEITENHLIWATDAPLGAGGYRLARRLHPGVYVRSANGHLERIESMT
                     RVRHADAYAPLTEAGTLLVNGVLVSCYGNLESHEIAHAAFVPLRVLEWIWNLYISRFA
                     GTLGIGRERFLVTPPRQGLHPYARALVGMYAAIRHLSGGVLAPLQSN"
     gene            complement(<736774..>738555)
                     /locus_tag="CYME_CMN300C"
                     /db_xref="GeneID:16995176"
     mRNA            complement(<736774..>738555)
                     /locus_tag="CYME_CMN300C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005537351.1"
                     /db_xref="GeneID:16995176"
     CDS             complement(736774..738555)
                     /locus_tag="CYME_CMN300C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005537408.1"
                     /db_xref="GeneID:16995176"
                     /translation="MISTRRFRSLLMLWWLSSSAFVQHLAAAQSRSFSVRQTECSTGS
                     GWTRNAESARVVNASFRTETPNGTSSTWLSALEHGERSVGMLKFTFPSLPPVSFGQIP
                     SLNAQIPSIPTIGYPCCMSCCTRDCCCCGCSTVPTPTLVQTPSQRQSDTPSTPSSQSR
                     TVSAPPSPISSPTSTGFFCQSGRGIQVHWTWVDQAAGLVRWTFQNPTESQGVVVLTRG
                     VLGSGWYAFGNAFWPAYLETGLTHIGTGPYAPIEGPVQNLPLALVGIRHPGVAFVFPI
                     RGGATITVDEGGYAGSEPYCHELVDVNFIQNSAYQITYNVAFQCHDFAGTTRCPPDPY
                     LNTFPVYAPIDGSLEGAFWPSAGDLILPAVVVRERATLPRRGNCLSGEMQVRLRNGSM
                     RALRELRVGEWIWTRAATEPHARLLTQVYGFADYEPEDYGVFYLRITTDHGTLELSAD
                     HLVAVKSPSDGQIKMVPACRLEVGSRLLVEALTTAIVVRIDQTTVHGALAPLTDTGTL
                     LVNDHLVSCYSGRVSQVWAHLAFLPLRVYHRVKRYTASAWSIAPHAQTQTPPQPTFSR
                     SGIHPYARFLIMICRALGPLCPARDAL"
     gene            <741300..>743264
                     /locus_tag="CYME_CMN301C"
                     /db_xref="GeneID:16995177"
     mRNA            <741300..>743264
                     /locus_tag="CYME_CMN301C"
                     /product="similar to oxysterol-binding protein"
                     /transcript_id="XM_005537352.1"
                     /db_xref="GeneID:16995177"
     CDS             741300..743264
                     /locus_tag="CYME_CMN301C"
                     /codon_start=1
                     /product="similar to oxysterol-binding protein"
                     /protein_id="XP_005537409.1"
                     /db_xref="GeneID:16995177"
                     /translation="MSFVGPKPTPTSRIRKDDSPETRSNGSSVSPVDTSPRTAPQEAQ
                     LQLPKRRDWYRIPNAASAGGVGFSDRAELERQRHVVRDMLRQVGSSFIEGKDLVNVSL
                     PIRLFEPRSFLQRLTDDWAYCSTLLKAAAHATDTLDRFKLTIAFAIAGLHKSATMFKP
                     FNPLLGETFQACMPSDGTRIYLEQTCHHPPVTHWRIRAADRSYEFTGFGAYSARVQLF
                     ENAIRAQRLGVNVVHFRDGSRIIFWLPYMKIHGIVFGERRLEYLGKAVFLYEPPRNFT
                     TSGIPSRASLSDGENTEQRRSSETFAEPDRALVAVMLLNSEKTGFVGTLRGVARGIGR
                     MFGGRNNNNSSSNNANANTNANVSKRTPVAGGRPVSYPTGRASNGAISGLDTSRPIPT
                     DVFRGIIASVDAPQTPNAGYLAGDDSSTTPSQPGRPGQPILNAQRRKRITRRQVKQLL
                     AEFATRNGPLASSPWSSMDWRASQDVDQVAVREQAPSLSVTDGVSDANLQRSSLSSSS
                     LASSARNDPYRGAGRRQRSHSALDPVVLCSFEGTYLGFVDFDGQRYWDIRDMPGEAPL
                     PVPLEEALPSDSRFREDARALAGALQPGLSEREQSDRMMKAQAAKERVENQQRADRVL
                     RERGRRERGIKESNAFVPERILREDTCYWP"
     gene            complement(<743462..>744460)
                     /locus_tag="CYME_CMN302C"
                     /db_xref="GeneID:16995244"
     mRNA            complement(<743462..>744460)
                     /locus_tag="CYME_CMN302C"
                     /product="similar to Sm protein D2"
                     /transcript_id="XM_005537353.1"
                     /db_xref="GeneID:16995244"
     CDS             complement(743462..744460)
                     /locus_tag="CYME_CMN302C"
                     /codon_start=1
                     /product="similar to Sm protein D2"
                     /protein_id="XP_005537410.1"
                     /db_xref="GeneID:16995244"
                     /translation="MPPVDQPTALEAGAVAGLTVAQLRRELAAREAPTSGRKAELQKR
                     LLDLLGVKLEQEARDEDSSVAPGATQGEAGRATNLGDATTTSSAQQQEQQQEQQQEQQ
                     QEQQQEQQQEQQQEQQQEQKLAQTLDPAALSPSPIQSSAYPQSTTTTQRRKRRWAEPA
                     SAPPTAPRKRRPLDAHDTHLDQAGATPAASELSAAAEASTSYQTLIAATTPATTQSIP
                     NSSESAASALKPAVHAANGSPRTPFTLLDRCITDRVPCLVSCRHNKKLYGTLRAYDKH
                     FNLIMEHVREIWQESQPDRPPDLRERFISRLFVRGDGVIFIVRPCVSATSTARAQP"
     misc_feature    744634..746549
                     /note="possible transcribed region"
     gene            complement(<745094..>746662)
                     /locus_tag="CYME_CMN304C"
                     /db_xref="GeneID:16995173"
     mRNA            complement(<745094..>746662)
                     /locus_tag="CYME_CMN304C"
                     /product="gamma-tubulin"
                     /transcript_id="XM_005537354.1"
                     /db_xref="GeneID:16995173"
     CDS             complement(745094..746662)
                     /locus_tag="CYME_CMN304C"
                     /codon_start=1
                     /product="gamma-tubulin"
                     /protein_id="XP_005537411.1"
                     /db_xref="GeneID:16995173"
                     /translation="MPREVLTLQVGQCGNQIGLEFWKQLCLEHAIGPDGRLEPYAAPN
                     VDRKDAFFYEADDRRHVPRALLIDLEPRVIQSIKNSAYGSLFNPENYFLDIRDRGGAG
                     NNWASGYTQGQMLDELLFDMIDREAENAECLAGFQICHSVAGGTGSGLGSYVMEQLHD
                     RYPKQVVQTYSILPNQSYAVASGERHADARDYANSGSAATGLASGGGSGAEEDDANAM
                     FSDVVVQPYNSLLTLRRLVEFADMVTVLDNAALNRIASERLYVDNPTFDQTNALVSMV
                     MAASTTTMRFPAYSHQDLRELMSTLVPLPPCHFLVASCTPLTIYTGAGANQMNAKHVD
                     TNQIASGVDCLPQVLPVAESRIRKTSVYDVMRRLVQPKSLMASCPLRRGSYLSLLGVL
                     QGEIEDPSEVQRSLQRLMERENLGFTPLTSANVQVTLARKSPYLKCTHRVRGLMLANH
                     TGISTLLGRTIAAYDKLRRRNAFLDNYCREPPFASNLDEFDLARETAQQLCDVYAQLE
                     NQVATPQVSDDTRL"
     gene            <746952..>748091
                     /locus_tag="CYME_CMN305C"
                     /db_xref="GeneID:16995174"
     mRNA            <746952..>748091
                     /locus_tag="CYME_CMN305C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537355.1"
                     /db_xref="GeneID:16995174"
     CDS             746952..748091
                     /locus_tag="CYME_CMN305C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537412.1"
                     /db_xref="GeneID:16995174"
                     /translation="MSEGGKNDYPAHSELIEGYVAGNRKGEPTLTPQAIDTNTRNNMD
                     ALCVPTSSKAAEPEVLATVSAQAVETLDDCADTAYPSMPLEERFFGFHPCKLVEQVED
                     CVRDLLEDALDGLETSLFRECALAFDALQENAVTSEHEHAKRLLLQQGLMRLRDALFT
                     AFYDQMDRLQVYLLRNVFHIPPGLRIPNVNTSEDLVENWEQALGIDPSSVQIDANAED
                     EHAVDQELVALRQSLRVARQRLQRLCRERSVLEGAFHRLEGALQSRLASTLIPTEPED
                     PSGDCDALAKQVVTIARAVSELEAVVRSCRDQFLGDRSSAASGGAPPSGTVPAAAGGS
                     DVGAQGALVRPPLELERIFDAHTKATRVDSLDAVDALRRALHRSC"
     gene            complement(<748137..>752414)
                     /locus_tag="CYME_CMN306C"
                     /db_xref="GeneID:16995175"
     mRNA            complement(<748137..>752414)
                     /locus_tag="CYME_CMN306C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537356.1"
                     /db_xref="GeneID:16995175"
     CDS             complement(748137..752414)
                     /locus_tag="CYME_CMN306C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537413.1"
                     /db_xref="GeneID:16995175"
                     /translation="MRALQFDACNARMHARIARTHCRSAIDRRTAAREHVHCNCRCCV
                     RERRNSTCMEPNARILPLDESQDPLVCYLPATLVVKLNQVGLRLLHWPGRGGLHETCY
                     VVESVAALERLCTALTAEIEAPGESDPQTSTAQEETACRASRLVDAIEKAWKTDDAAL
                     TRSLTPIAELQFPASDDRASTVVSLDAKRCELELRSTGVSFSCLLLRIRGLRLGAARA
                     LLQEALERDLGSSSVDPSEAAKSTLALSCASALRWLNSDLSLSHILPMQLGSERVIAH
                     QSAAEESGGLGALIESILGALGIVSPDLQMTLLEILPELVQQSFDAERHELALANSLP
                     GLLQGAARGEKCNVRLMNTVVDTANALQTATARRAVRKSLLSEILSIVPGLYSPESLA
                     MGLQFLVGALESLGATSDAESALLTGNEVDCLETSAENAIMAALRENLLAERQQLHQQ
                     QTATSHDAVIVTSAVACALQHSQQAVKRMLAWYSQSAYGLVCRALQEWTDGASADATP
                     QPADLFLLLALYRANPESFEMKAHRARPATGTHRMPCPLEAATAYILCGDQGRRAILR
                     WGSILHTHDGSALLQLLNLICRSGPKMTAHAPLVGHVETLAQLIAAFFKAVPALRQDC
                     LLSFLELAHSESEYCRLLSLHAFVCIARETPAELAPFAPLVHGLAELCESLAPSTWQH
                     DFGRAPSPCANIQGALKTPGALPLTLMYSTFALMHRTVNTHACASIEAPERLETFLPL
                     MVRKLLTHPDALYQRCGCLATAILVETWSQREADYSKAQDLLELALQCTARRPAIAAQ
                     LYAELAAAWMPSLGTAASSSSSDLHRAPAPALWLLTHTLQQFASLFIWMPSSDAEAHE
                     ASIPSEARFGLAMEGSLDLVIPVANLVHSKKDGFANLVLLVPLLRLIWCIGVGQHGYT
                     SHWFQKELCPLLGAAVQLPVAPFSKPTASIPCAQLRDQMQSLAIASNWLGAQVHFFAV
                     LAKQDMHGARSHLVERIRHLIAVETAAEHLAMEAAANALPIVLEMPQEPCLPGSLLSW
                     LLAETAADAADPEILLWTLRHVRRCDAAVIDANLKVLIRIAKAPPACKARDTLHQVLR
                     VLESASGLDAELFCDAFLTQTSPLDWSDDETSLLLLAIMMRLEGVSFDRAVILQQWLE
                     SNLYSQAFEDLRFTEAVLKAALHLIEAAVDTAATEPTFEWALATLERYMPARHICQNQ
                     GPRCISCFLDARPARFVLVAQALERCFRIWCQQQQQQQQAPGRRAARSNAAVCVTAPL
                     DSAHFKLFRRFAQLLKTLLDKAVRGRDHRALGASMRLGRIFADSLNRSLVPLWIVHFQ
                     VCAADIASACAAFQKSTRILQRVCVFAKEQRDRSLIALTPPLKRALELFLYRVKEMLS
                     ANASLSSFWMGTLRHKNLDGEVVSSQLRIDSDPSQSDDDAEETLSAA"
     gene            <753314..>754351
                     /locus_tag="CYME_CMN307C"
                     /db_xref="GeneID:16995178"
     mRNA            <753314..>754351
                     /locus_tag="CYME_CMN307C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537357.1"
                     /db_xref="GeneID:16995178"
     CDS             753314..754351
                     /locus_tag="CYME_CMN307C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537414.1"
                     /db_xref="GeneID:16995178"
                     /translation="MDQCVRHGHWCASAQGDKPRAFRVRRTDAAGRCLSSSREETSKA
                     AHSEPLFDLLFVVCWPRLPGTSTFTRKQVRNSNTETKPAPPSPAPEVLEPLAQRFPLH
                     CEDFVNRERRLLVKAMYSWLQARRQPPPPPCVHPSTPCFVAAWRPLVAGLTTCGALVP
                     ISRARTTVRSHPNRQLRLGAVRCVRCASDQADDSSAPLDPAKPDMQTNPRYFTRPNRV
                     STRQRMFERNQNNVSRQRRRRALQAILCGQVIAETYDYVFTDGRYYFPPGSVNDTFLI
                     ETEETRMMNPIGRARMMDIRVGHVRIRRAAWRFFEVRRSDGGVWTTLQNYTAFWKSVR
                     LRFAPRNNAGD"
     gene            complement(<756553..>756744)
                     /locus_tag="CYME_CMN308C"
                     /db_xref="GeneID:16995182"
     mRNA            complement(<756553..>756744)
                     /locus_tag="CYME_CMN308C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537358.1"
                     /db_xref="GeneID:16995182"
     CDS             complement(756553..756744)
                     /locus_tag="CYME_CMN308C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537415.1"
                     /db_xref="GeneID:16995182"
                     /translation="MSTHRIVDGLFYLTSGSLAAFGIGGAVFLLANFARNMGPRPRAG
                     TPDSETVFSRPQTSGSADS"
     gene            <757426..>759249
                     /locus_tag="CYME_CMN309C"
                     /db_xref="GeneID:16995183"
     mRNA            <757426..>759249
                     /locus_tag="CYME_CMN309C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537359.1"
                     /db_xref="GeneID:16995183"
     CDS             757426..759249
                     /locus_tag="CYME_CMN309C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537416.1"
                     /db_xref="GeneID:16995183"
                     /translation="MKRSKRQGNGATSTQHEKKRSTHAKGSSDAGQVSVPCTLLDQSD
                     RLISLREKYTSAEPFSHIQLREVFDEVFLNAVRNEIISNCTGSLKETDIYKVYQTGEL
                     RNLDALSTEEQRRLRNLRVLRDILYSERFRKFLMALTGCCDESCGECLDGDLIDCSIN
                     VYTRGCHLLCHDDAIGTRRLSYILYLTEPEHTWTQEDGGSLQLFRLRDGKPVQGAIPE
                     PENYSHTSLLPEWNTLAVFQVLPGRSFHAVEEVRTDEMPRLSISGWYHVRAPDDKTPV
                     DPAASLRQLQTGAHRPFLPLSAELSASCAVLSQGSDRARTLLDAALSTAELEYLRTYI
                     QPVYFEDAHVRAIRKRFRRESSVQLHDFLKISGEASALVAALHETDSDARVRWQRLAA
                     GGESSDDPSGWRTVGPPHRQRYLEYQGYLDSGPPVSILEGTLNCFQALFASRSMARFL
                     MVLTGLDASYGRIRGYRCNIRRFRPGLDYTLATYETLVPRTEPCLLDATLCFVDDREQ
                     DSAEAWRSGECGGYECYMDSGDGDGDPSVYRDVDDADDANGNANQLLNLPPVSNALSL
                     VLRDHDVLRFVKYVTAAAPSSRLDLAFEYALAEEHNGKASQ"
     gene            <760552..>762903
                     /locus_tag="CYME_CMN310C"
                     /db_xref="GeneID:16995171"
     mRNA            <760552..>762903
                     /locus_tag="CYME_CMN310C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537360.1"
                     /db_xref="GeneID:16995171"
     CDS             760552..762903
                     /locus_tag="CYME_CMN310C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537417.1"
                     /db_xref="GeneID:16995171"
                     /translation="MRRFPGSAGLFLAWNDFDSSFGSGNDAACESGSAEALLPPPGPP
                     LRLSGLLAGTGTGDPVIQKRRLGERRPPKPGGSSERRSYGAVVDPQWAIAACSHSHTA
                     ETASCSTTYPLHDGRYVPSSGAGLRGSTMPTTKDRSNCLHAMRQSRSTDSMERAFVGF
                     HSDRRQDDLAPVDEAVLSQASTERLEGIAGKRNSNMPDLSLCSHSETAPGIDAAPGYI
                     STDEIPERHGPVLHRCIWVEAVLHGDCPAEIAQHSMLEIRAKNGTQWQSICPDLDHDL
                     EGSPAHEWHTTLAPDRNTHLRHTASQPVHQDAPDASFARVTIFGSDAPASPPLRQTAA
                     VALTARHSRPKQPRAAESRLHVLRIPCGCRLASNGVCELEIYLHMRIKVASETRFGCT
                     LFAFDQQRTPLASPHFVYVTISGGNVTDRNNPIGRLQVTCERASNWSRERMRGIPEAS
                     WQRATWLLPTSLHDPVTAGLSQAPNETELAAPLDMFDVFWRPAANCALAGSPSRASSQ
                     PCPRSVKHAPDAPVHPRRASGVNAAALGIESDAPFQSCCALEGASARAAASRVSPVTD
                     AWSSVEQAETYALWSFSLDSFEPVAAVEPRSSLATEQLVAERECCPLEKPDFPGVGVA
                     CKPPSATSPHSSASGTPGHASSDSHGIDSQPAVDPDTAQAFARVRERIRGKSKRFTLY
                     AITLSDLRSFFHLPRDVVARHLGICVTLLKKIARRNGIAHWPYRRLKTLRSKIAALEV
                     ELQLPSVVDRNGRALCRQLQQLRQRMQQIQGNGAVSDDALPAS"
     gene            complement(<763583..>764536)
                     /locus_tag="CYME_CMN311C"
                     /db_xref="GeneID:16995172"
     mRNA            complement(<763583..>764536)
                     /locus_tag="CYME_CMN311C"
                     /product="similar to phosphoglycerate mutase"
                     /transcript_id="XM_005537361.1"
                     /db_xref="GeneID:16995172"
     CDS             complement(763583..764536)
                     /locus_tag="CYME_CMN311C"
                     /codon_start=1
                     /product="similar to phosphoglycerate mutase"
                     /protein_id="XP_005537418.1"
                     /db_xref="GeneID:16995172"
                     /translation="MFILVLSGATLLIRHGETDWNRSGRAQGQSNEPRLTSTGHEQAA
                     QTAKWVTASAAERIHTLAVSTLSRAQETAKYFDTFAAKRRNWVRWDTELLWEVSVPWQ
                     GQQRGDIDDKYAEAYRIHRKEPENCPHFAELYARAQKFWETRDSASVSAVSPANHWVV
                     IAHQQSIRALLNTAIGQPRSYHRIWKISNAGCTLLDQQRRVHLVNGPARSAHVPDDRD
                     LELYCESVQTLHVERGERGQLQVYGPVAALQEYLAKNVPGIQAQRFVWYPGGRSCFRI
                     SAGTQSQASGAVWYHNIEPVDVDWSLAQYLEECERMAAAQV"
     misc_feature    765027..766921
                     /note="possible transcribed region"
     gene            complement(<765513..>769577)
                     /locus_tag="CYME_CMN313C"
                     /db_xref="GeneID:16995185"
     mRNA            complement(<765513..>769577)
                     /locus_tag="CYME_CMN313C"
                     /product="similar to histone methyltransferase Set2p"
                     /transcript_id="XM_005537362.1"
                     /db_xref="GeneID:16995185"
     CDS             complement(765513..769577)
                     /locus_tag="CYME_CMN313C"
                     /codon_start=1
                     /product="similar to histone methyltransferase Set2p"
                     /protein_id="XP_005537419.1"
                     /db_xref="GeneID:16995185"
                     /translation="MLGRKTSTPTDAAVALPVWLKRGRCVEVRTAEGLWESGTVQSIR
                     ERDGEIWIKLRLFGKEASYPLRNVHLRCGSQEFPTAIADERKKTETLGCKNGTVSVTN
                     GHAPECTGSVSSSPQQPTRPCFAAELLSQRRSPGPNAESVPVLAPNTQSLDEVLLQRS
                     DWQEAAKKLVELFALNDFTLYASLLKIDLTTDAVCFQVSPCLDRVDLLELIVHECRAQ
                     RSQRLNAISLPSAGVTVQQPALPEAVFAELLSTVTFLCDGEHPETKHLLACLQRRGEL
                     LPTLQAYICERLHDLVGAARKAARAPQEERMTSPEKSSRLVTDASSGAAEHLKVPQTL
                     GDPSFIALNLFITASNLLDTAIRDLAKEQRALPPATSGQERNASLARGVLEALLPSPA
                     FMQKHLVTVLDWVDLLQQESSTSPKSVMGERLAEELDEHLRLLLGGWMLMTDSDLAAL
                     SVVVSDLRIAQHFFRLYSVERLLDSLSRSDQERLRGETDEVDPALWAMVRIWPDLVAA
                     QELCWLPNSGYTLLLHCQKICKEAWGTSSARQLERYGASTLRHQLLETFTRLCCADSK
                     LLLRALSEASAVSTWADLLRRLWELLTEGLREDDIEDSSSDETLTEDALAQQTMRVVR
                     DAFFPAVMRFLASCHVACLRESSELFLQRVCNALGFSSRRGLDRLLAVLRRLPLVAGR
                     LTNTDDRAAYMVLLHGLENRRREASVAAGLHPLHTSVEAVDVSQERPSTAPDAAEPST
                     CLRLPDWDWSRLSAGDFGERSWYTLLSYRLAILEDRKQRMLDTDDGKPSPFIHLTANE
                     YLVPPSVAPAHADVCQCIGACVPGVCLNSTVCVECNPATCPVARSRSSTDPQCGNMRF
                     QRQAYAPVELFFSPNGRGCGIRSRAPLKKGDFIVEYMGEVIGPTELARRKRDHALERH
                     VYFMTLDQSTFLDASRKGTWGRFLNHSCEPNCHTQKWLVLGKVRVGIFASRDIAAGEE
                     LTFDYRMERRAAAAAAAEETSLLQRVSPRRDLDLNESDASVPIRCLCQAASCSGWISG
                     GPFASALDEQQAMEAVEHRRAASLQHITEQIAGIRKALGPRRRSVSAEEDTGAAVDAA
                     AKLLLTAWDDGDDDMNRETPAAGGQQVPASASVTSAMLVDVSAVPYIPRRKRAFPQDD
                     TTDAKRTQRSEGNVASSSSSSEERAAMQQHAALPDRNGADKHSGRESATEQAAAPAGT
                     SIIEKSAPEGVVAGVSHRSARITCFACGKIGHKRRDCPASKAGIPRLPSIGRIASNGI
                     TEQKQAAGQMFQGRNMCSTIHPKDAAGRPVQHDPSAQWARSAVHASSVPLETSLQTLQ
                     QQGSAYGMFRFETSTYRGVLDGYASDASCGQEHR"
     misc_feature    771908..774806
                     /note="repetitive element"
     gene            <774844..>775122
                     /locus_tag="CYME_CMN315C"
                     /db_xref="GeneID:16995186"
     mRNA            <774844..>775122
                     /locus_tag="CYME_CMN315C"
                     /product="60S ribosomal protein L37A"
                     /transcript_id="XM_005537363.1"
                     /db_xref="GeneID:16995186"
     CDS             774844..775122
                     /locus_tag="CYME_CMN315C"
                     /codon_start=1
                     /product="60S ribosomal protein L37A"
                     /protein_id="XP_005537420.1"
                     /db_xref="GeneID:16995186"
                     /translation="MGKRTRKVGICGKYGTRYGASLRKTVKKMEITQHAKYTCPFCAK
                     DAVKRKAVGVWECKRCRKRIAGGAWVLNTTAAATVRTTIRRLRETVEQ"
     gene            <778200..>779096
                     /locus_tag="CYME_CMN316C"
                     /db_xref="GeneID:16995207"
     mRNA            <778200..>779096
                     /locus_tag="CYME_CMN316C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537364.1"
                     /db_xref="GeneID:16995207"
     CDS             778200..779096
                     /locus_tag="CYME_CMN316C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537421.1"
                     /db_xref="GeneID:16995207"
                     /translation="MTLLGFTYNLLSDVALYKGRALASTSRGCKARSSRSRRWAQLRR
                     RSSRSTGALFLRAVEDESAESELPPVKEPYPGYFRDLERMGVSREQAVAQLREKLESK
                     RPPKDKKIGGKASLYRPDGTPYAPWMIGLVEEEPSKEKGLASRTDARGRLAGDPQAQE
                     IAGIGLRARIVDDRDVELLWRTEGETNNAGFQVSRRRGKSTDWEVIADYKSAPDTLRS
                     KGAQGGAYRFIDTPPEATGTWVYRVSDIDNSGEVSDLSQILVEFESEAERKRQLLVLA
                     ALIGTLLLIGTVTSMLDPLSGP"
     gene            complement(<780349..>782409)
                     /locus_tag="CYME_CMN317C"
                     /db_xref="GeneID:16995208"
     mRNA            complement(<780349..>782409)
                     /locus_tag="CYME_CMN317C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537365.1"
                     /db_xref="GeneID:16995208"
     CDS             complement(780349..782409)
                     /locus_tag="CYME_CMN317C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537422.1"
                     /db_xref="GeneID:16995208"
                     /translation="MWQTNWVARPASGFGATRALPSRHAQLACSATASPCRTKNRTGP
                     GLAKLRLANGQRHTYRNALCSCASSGPESGSDQKLPPQTKLSALLEQAEELGLDTAGP
                     PLLPELVRHFLDIEPRVWRRGQSLRDRLREHCIFPGMPIPEDVDLSDTLGARDPSAAP
                     AERKFDYNLFLNWLGFRDRDEAVAYMDERRLYRKRVRRFKRRLGFVLMLLAVTGHAGS
                     LLRAASRTPGGYAIALTIGATLDAFLVTGCIMVAIPVVLLAWDFLSAPVARRFDPRRL
                     PGYRASDAVRRLLLMYAFMVWPLLGSAAAIGNACTFVHDPVILTSSWIQGGLTEIGIF
                     WLLVGISARAAAIPALWQWPDLNQEVRIMASGRQNRLVHAFCLWRWLVTASCLWAILL
                     RCSALVRPRTGLVAMQYPCCWGLTLLARHRPLWLGAWLEQGLHQIVLVVAACTIVAYL
                     CYALYYLNFVVPKMPDLDHPKIDDPDDLLSMDPLNRVLAECSPPGARQRFSPIRALLV
                     RLRLIDDDSPEKEYSPFGEGLVERPSNRSALCRLASDPIILDDDDELLRALDALQPNS
                     YVNRLLDAEKRAYEQAGRPIDSLFKPRWEWLQVSEEEARALTKRIRAPPPPPDQRPLV
                     ELVESDPFEQATESATLEPSFLDGAGSGIRQRDSPADPESDTESDRDDDGESGPARSD
                     IYHA"
     gene            <783766..>785601
                     /locus_tag="CYME_CMN318C"
                     /db_xref="GeneID:16995215"
     mRNA            <783766..>785601
                     /locus_tag="CYME_CMN318C"
                     /product="folate monoglutamate transporter"
                     /transcript_id="XM_005537366.1"
                     /db_xref="GeneID:16995215"
     CDS             783766..785601
                     /locus_tag="CYME_CMN318C"
                     /codon_start=1
                     /product="folate monoglutamate transporter"
                     /protein_id="XP_005537423.1"
                     /db_xref="GeneID:16995215"
                     /translation="MHARAKGPVAPQVYRLAFSTAAAPWRARSQQQACGVQTRSAPPE
                     AAQETLSLDTFTPGNLHISKPAPCIRRMRWPAWRHGRFRLLMKRERPVLASRRSVRFV
                     AASRRKLAKLRTLLLERLLQGYEPTPELASILLVYLVQGVLGLARLATVFYFKDELKL
                     SPSQLAMLSGVQTLPWTIKPLYGFLSDAVPLFGYHRRSYLSLAGALGAASWLGLATWA
                     HTPAQALLCSTLASLAVAISDVVADGLVVERVRENSQERAGSLQSLCWGISAFGGLVT
                     SYFSGSLLERFTPRQIFLMTATFPLMISTVSFFIDERPSYSEQALVQERSTGSAASQD
                     GSRVHQATKWSRYSEQVARDARELLSKLWNAIRQPSILYPTAFVFLWQATPSAETAFF
                     YYMTNELHFGPEFLGRIRIISSAAMLVGVFVYNRFLQRVPIKSMLRWSTILSVPLGLS
                     QLILVTGLNTRWGIPNSWFVLGDAAVLTALGQVAFMPTLVLAARLCPPGAESVVFATL
                     MSLYNASGVLGTEMGALLTQVLGVTEQNFTNLWALITICNLSSLLPLLFIDFLDRAPI
                     DRNAAMSSTDTAAAASEEFTDLDGLERGHSSVTESTKNANARSRR"
     gene            complement(<788590..>790149)
                     /locus_tag="CYME_CMN319C"
                     /db_xref="GeneID:16995216"
     mRNA            complement(<788590..>790149)
                     /locus_tag="CYME_CMN319C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537367.1"
                     /db_xref="GeneID:16995216"
     CDS             complement(788590..790149)
                     /locus_tag="CYME_CMN319C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537424.1"
                     /db_xref="GeneID:16995216"
                     /translation="MPQRRFTAASENKPRKTIFDGLESGPLRSIAQNPASRLASSVET
                     LASAGAFPGGVSGLSAVGQEALLVLNYRFHEYRASGYQGQVIWSRTCYCETQPCAGLC
                     MFAEHRVPRAGRVESKQGAREHYETLSCSAYSSKDPCRNDECCIASATAKTKRTTTRI
                     PHSNSSASGAEIRNIFIHSVDRRLFMPVYQMQPTIRVRPRMIIAALHRHLCAVLEPER
                     LLIQDFDCEHARILHRMVSGRLTGPETDPGEAFGFRALAAMLHTCVQSNERKLQWIKQ
                     QLQHGQLHINTVEKSAAPRLLQGAARQVALVALRARNLRVCLEESLDDGIAETVAAWV
                     GECIPGDDAGMRASFASTQESVYTLIEWALWQCHDHEMSAAALRKQLHNIEELTVIAL
                     AAKQTRLWTVNISCHLWFCTILIMLIPADFFGMNIAIPAYEETAPSWPWFVVVAVSLV
                     LGAGFLMMGILYWKRKGMMSILFAKSSPPPPPPPPQQQQQQPRCSLCERGDETVTSGS
                     TSAAIDAAECC"
     gene            <792224..>792682
                     /locus_tag="CYME_CMN320C"
                     /db_xref="GeneID:16995200"
     mRNA            <792224..>792682
                     /locus_tag="CYME_CMN320C"
                     /product="NADH dehydrogenase I iron-sulfur protein 13kDa
                     subunit"
                     /transcript_id="XM_005537368.1"
                     /db_xref="GeneID:16995200"
     CDS             792224..792682
                     /locus_tag="CYME_CMN320C"
                     /codon_start=1
                     /product="NADH dehydrogenase I iron-sulfur protein 13kDa
                     subunit"
                     /protein_id="XP_005537425.1"
                     /db_xref="GeneID:16995200"
                     /translation="MWRTVLVRGSTGALVWRAVTPSLPGLVPSTPHLTTPLPLLGRSF
                     ATDALALKDGLIRYRMHYPDGQVPPKVDRNLVRSKWHSDAMELIEQVPPLVVEREVIA
                     CNGGPNVAMGHPIEYIRVDAADPAPSVCKYCGLRYIHRHAATAEAGSEHP"
     gene            complement(<792907..>793608)
                     /locus_tag="CYME_CMN321C"
                     /db_xref="GeneID:16995196"
     mRNA            complement(<792907..>793608)
                     /locus_tag="CYME_CMN321C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537369.1"
                     /db_xref="GeneID:16995196"
     CDS             complement(792907..793608)
                     /locus_tag="CYME_CMN321C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537426.1"
                     /db_xref="GeneID:16995196"
                     /translation="MNAQATSEGAPVVLLDSAVLDFLLMELVAENTASLLPASAAGFG
                     KPDAPVRHGSVPAPLWQRPRKPQHLHTTSENDQGTEALTTETLALARVEEAGFYVGER
                     LGPRVPRVGALAGNPVSELDALKVLCRDLWRTVFGKQVDSLKTNHRGVYVIFDASFRW
                     LRHVQELPESVGAPSWYCVFPAGLIRGFLAQLGHPCTVQGVCEPAPPSAVFTVRMHSS
                     SAPDSETVASEPRQT"
     gene            complement(<797110..>797622)
                     /locus_tag="CYME_CMN322C"
                     /db_xref="GeneID:16995197"
     mRNA            complement(<797110..>797622)
                     /locus_tag="CYME_CMN322C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537370.1"
                     /db_xref="GeneID:16995197"
     CDS             complement(797110..797622)
                     /locus_tag="CYME_CMN322C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537427.1"
                     /db_xref="GeneID:16995197"
                     /translation="MLRLPRLLLAPGKRTIDLILRHEPRGIVRELTVRVRLSGPLGPG
                     PVIVPATEQGNWFREIRGLPPYDPVADAQFPSVPADTETETHLPIHLRCSSGIGLVRV
                     YIQECDADIGIPVHIPRPDAEVTRGIPSIVPYPVELKHVERTATATTREDFDGEAFTT
                     VHLPPEEEHS"
     gene            <798749..>800173
                     /locus_tag="CYME_CMN323C"
                     /db_xref="GeneID:16995194"
     mRNA            <798749..>800173
                     /locus_tag="CYME_CMN323C"
                     /product="probable aspartate aminotransferase"
                     /transcript_id="XM_005537371.1"
                     /db_xref="GeneID:16995194"
     CDS             798749..800173
                     /locus_tag="CYME_CMN323C"
                     /codon_start=1
                     /product="probable aspartate aminotransferase"
                     /protein_id="XP_005537428.1"
                     /db_xref="GeneID:16995194"
                     /translation="MYVNSLCGSGWLQKASFLGNRSQDAGASFHQVGVCRVARHANCR
                     ASSPLRRFLAMHTRVPRNENFSKLQGGYLFPQIAQRRREYLEKHPDAALISLGIGDTT
                     QPIPPHICAGLTQGAKKLATKEGYSGYGDGEGLYALRKSIASRLYGDRIRPEEVFVSD
                     GAKCDIARLQMVFGSEVTVAVQDPSYPVYVDTAVMTGQTGRINADTRQYAGIVYMRCD
                     AANDFFPDLSKTPRTDLIFFCSPNNPTGAAATREQLAELVAFARHNGSIIVYDAAYAP
                     FIRDPAVPRSILEIDGALECAIEVNSFSKYAGFTGVRLGWTVVPSALRFADGTPVAKD
                     FGRVMNTAFNGASNIAQQGGMACLDDEGLAEIEQLISYYLENTRILREGMESLGFSVY
                     GGRNAPYIWVRFPGRSSWDVFTEFLEKCQVVTVPGAGFGPAGVEYVRLSAFAPREACQ
                     EAVRRIQTAFGGRPADPIAASSFQ"
     gene            complement(<801991..>803118)
                     /locus_tag="CYME_CMN324C"
                     /db_xref="GeneID:16995195"
     mRNA            complement(<801991..>803118)
                     /locus_tag="CYME_CMN324C"
                     /product="developmentally regulated GTP binding protein"
                     /transcript_id="XM_005537372.1"
                     /db_xref="GeneID:16995195"
     CDS             complement(801991..803118)
                     /locus_tag="CYME_CMN324C"
                     /codon_start=1
                     /product="developmentally regulated GTP binding protein"
                     /protein_id="XP_005537429.1"
                     /db_xref="GeneID:16995195"
                     /translation="MGILDRIRDIELELKRTQVNKATMGHICRLKSRLARLRTQLLLD
                     EEKARKQGAGSAEGFEVPKQGDARVIMLGAPSIGKSTFVSQVTGIDSAVAAYEFTTVD
                     CIPGELHLRGARIQLLDLPGIIEGAAQGRGRGRQVIALARSADLVLMMLDVGKDVDAQ
                     RRFIEREVELAGIRLNRRPPNVMFQLKKAGGGITFNATCPLSHLDEKLVYAILQEYRI
                     YNADILVREDVNVDEFIDVIEGNRVYVPCIHVYNKIDLITIEELDRLARSDPYHGVVL
                     SCALRLNMDEVLEKIWRALKIVRVYTKKRGEPPDFERPLILRSSQARVADACRKIHRS
                     LADPTQFRYALVWGRSTKHDPQRVGLSHQLADEDVLCVVTK"
     gene            <803294..>805885
                     /locus_tag="CYME_CMN325C"
                     /db_xref="GeneID:16995192"
     mRNA            <803294..>805885
                     /locus_tag="CYME_CMN325C"
                     /product="ATP-binding cassette, sub-family B, member 10,
                     mitochondrial precursor"
                     /transcript_id="XM_005537373.1"
                     /db_xref="GeneID:16995192"
     CDS             803294..805885
                     /locus_tag="CYME_CMN325C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family B, member 10,
                     mitochondrial precursor"
                     /protein_id="XP_005537430.1"
                     /db_xref="GeneID:16995192"
                     /translation="MRGRLASLVHTVGRTTWSAHLQRFGLAESADCVHRCGVAGHLSS
                     VRALHVQSFMSGRLASLVHAIGRTPRNVHRQRLRFAEYGPRNARLEDSAERQLQASAA
                     LRLRACASAPLHSELSRALQQDYRTQVASGWTRFEQGLKGRFNASRAHEARVRRQNLS
                     TSRSTSEATPTGRAAEGPQHSTNASTNGASELEFRFKLPDAVSIRRLLRLAQPHSRLL
                     AGAVATQVASALSTMAFPLAVGRMIDALTAADGLEQLRQVAVIMAVVFVLGAFAVGAR
                     VLLLNITGERVARALRKDLFSAMLRQDTSFFDARSTGELVNRLSADASAVARTLTDNL
                     ARSIRASITTVSAIGFLVYLSPQLTTVSLCMVPAFAAGVALFGRYARRLSRQLLDALA
                     AANQVAAERIAAIRTVRLFAAEQLEQARYDRRIDDTYDIARRVAVIEGIYMGAGFLTA
                     QTSLLGVLWYGGTMVYHGSLTVGALTSFAMYAVNLGVGVTSLSSAIGQLVRAQGAAAR
                     IFEVLDRDSCDAGSTTTSAKPDSDTGTPAPERPLPSGKVAAVERSLSARPEHPNDRSG
                     SAGCRTGGIVLPVGYAPPAIEYDKVHFRYPTRPDTPILRGFQLAIEPGELCALVGGSG
                     SGKSTLHMLLARLYDPDHGTIRFAGHDLRVLDTAWLRRQLGIVQQEPVLFAGTIAANI
                     SYGRDAQRFPAAPDAAADRVSALDADALRRAAEAAAAHEFISELPGGYQTRIGERGAG
                     LSGGQIQRIAIARALFHEPTALTLDECTSALDLETELRVLENLVRVIRERRLTTLVIT
                     HRVPIMKVADRVVVLAGGVCAEQGSFATLIQNPHGVLPRMLLSAQESLLAGRTGASKA
                     SIASATA"
     gene            complement(<807215..>809689)
                     /locus_tag="CYME_CMN326C"
                     /db_xref="GeneID:16995193"
     mRNA            complement(<807215..>809689)
                     /locus_tag="CYME_CMN326C"
                     /product="similar to MAP kinase phosphatase-1"
                     /transcript_id="XM_005537374.1"
                     /db_xref="GeneID:16995193"
     CDS             complement(807215..809689)
                     /locus_tag="CYME_CMN326C"
                     /codon_start=1
                     /product="similar to MAP kinase phosphatase-1"
                     /protein_id="XP_005537431.1"
                     /db_xref="GeneID:16995193"
                     /translation="MRAAEAASDTQKSEAAPRLQLATCGAPLDWKGATESETEAGAGR
                     LSTSLCAPLTSPRQHSSSRWCLKHLSAAERCLGFESTSTGKSLCLNWGHAPHGYRFVS
                     CTSSAGNAAACTWHGAVREQPGSRAVLTAPELEHWSVTTLAEAAGSVSFLAPQAETSE
                     HTASTPAAAHPLGRAAWSPGLFHNTARLSLLSDQHSTQNPEFVTIQAACDVPEGCGAG
                     RWGEPPACSLELATSPVDEQPPLKLDVQLDTETRNIATSFIEDSFLESEQVPPIEGCV
                     KKADSASHASALEKRHQPWTACSRACARSMHAEEATCPEMLFPRLAAQADTGDRRADS
                     DAGLGARTLRMMRPPGAFCEEQKAQDGDSTEESTTTTTTTTTTVPSKPGARWNHRLGS
                     PEDDSRVISSGQLNWSDSNGVSGYCCAAEQQLKQPRSPASSALLEPCELASYLDRMTE
                     QADKEQRRLTALSETGAPIESPREAALQQEQCASAASSPEEATKGAASQGVVHGGTHE
                     QQRTAKQLLVLDVRPRMSFVFEHIRHAEHLWVEPDRYSSDEKRELAFVRHVCKRVRQE
                     SGPLDLVVLYDHCTESMDKPLSIAAKLVCLLNAEFALRNLQVRRVCLLRGGFTAMSRA
                     HHQHIIRVCDDDIGMNLCAAMRTRVGPLFERLLHQFLHERAQPASRILPYLYVGSERD
                     ASDWSFLQFAGITHILVVGSELRPHFPGALTYKQLPALDSSDEALDSLYPAIFAFIDE
                     SRRDPDSTILVHCYAGISRSVSAVLAYLVYSGWTLSAAWELMRERRSISRPNLGFWRQ
                     LMAFEKQRHGVQTLLEPPCVSTLGFC"
     misc_feature    810561..812958
                     /note="repetitive element"
     misc_feature    814228..815018
                     /note="possible transcribed region"
     gene            complement(<817566..>818750)
                     /locus_tag="CYME_CMN328C"
                     /db_xref="GeneID:16995181"
     mRNA            complement(<817566..>818750)
                     /locus_tag="CYME_CMN328C"
                     /product="probable phosphate/phosphoenolpyruvate
                     translocator precursor"
                     /transcript_id="XM_005537375.1"
                     /db_xref="GeneID:16995181"
     CDS             complement(817566..818750)
                     /locus_tag="CYME_CMN328C"
                     /codon_start=1
                     /product="probable phosphate/phosphoenolpyruvate
                     translocator precursor"
                     /protein_id="XP_005537432.1"
                     /db_xref="GeneID:16995181"
                     /translation="MEPAFVMTSPAPCWRLSGAAFRSNTAPASTRRWQSIQYKRCSLF
                     PGKTKTHVIERHTQHCSPATLQMTASEPAASGTSAPTDLSASLGRRLALGAYIACWYA
                     ANIGFNIVNKTLMKSFPLFVSVTAVQMLAGATISLFLWGTRMHRFQRATPADLRKIYP
                     LALAHLFGNLFTNFSLRQMAVSFTHVIKASEPFFSVVLAKIFLPGTTFSWPIYASLVP
                     IVFGVVLASVSEVSFNWPGFLTAVASNVSFQSRNVLSKKFMKGVEFDDVNLFGWISCL
                     AAITAIPLAIVVDYTKYAGVWSAANASIGGLSLLGMLALCGLLHYLYNQFSYVVLQRV
                     SPVTHSIGNTVKRVAVIVSSVLFFRNPVSRQNIIGTVIALAGVAIYSQVKTLRGGKVK
                     KA"
     gene            complement(<819825..>820175)
                     /locus_tag="CYME_CMN329C"
                     /db_xref="GeneID:16995199"
     mRNA            complement(<819825..>820175)
                     /locus_tag="CYME_CMN329C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537376.1"
                     /db_xref="GeneID:16995199"
     CDS             complement(819825..820175)
                     /locus_tag="CYME_CMN329C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537433.1"
                     /db_xref="GeneID:16995199"
                     /translation="MYGTGRGYGRVHRVEPPAPAKGVYRALRQAFTRHRAAFREARVL
                     NLRKHLSAIKCHRGDGQSASEYREDEKRQTGCALQLPLVHEMRRQLPGTAQSGLERSR
                     RHLSTADIAAGRGS"
     gene            <821757..>822038
                     /locus_tag="CYME_CMN330C"
                     /db_xref="GeneID:16995217"
     mRNA            <821757..>822038
                     /locus_tag="CYME_CMN330C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537377.1"
                     /db_xref="GeneID:16995217"
     CDS             821757..822038
                     /locus_tag="CYME_CMN330C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537434.1"
                     /db_xref="GeneID:16995217"
                     /translation="MVGNNTEAGMAKFLELKAAFEDVYEDTTKFFEKGNKAAAVRARK
                     KLLRLREIAQEMRVLIQQTKAQLEQEHKTARTSGGGGGLGADNQVSMGE"
     misc_feature    822665..824267
                     /note="possible transcribed region"
     gene            <825455..>826852
                     /locus_tag="CYME_CMN332C"
                     /db_xref="GeneID:16995213"
     mRNA            <825455..>826852
                     /locus_tag="CYME_CMN332C"
                     /product="serine hydroxymethyltransferase, cytosolic"
                     /transcript_id="XM_005537378.1"
                     /db_xref="GeneID:16995213"
     CDS             825455..826852
                     /locus_tag="CYME_CMN332C"
                     /codon_start=1
                     /product="serine hydroxymethyltransferase, cytosolic"
                     /protein_id="XP_005537435.1"
                     /db_xref="GeneID:16995213"
                     /translation="MVNSVYRECYDDSHYRPEFEGFIGNRPLEEVDPEVVTLIRAEKQ
                     RQAGGLELIASENFTSRAVMEALGSCFTNKYSEGYPGKRYYGGTEVVDELERLVQQRA
                     LSLFGLDPQEWAVNVQPYSGSPANFAVYTALLKPHDRIMGLGLPSGGHLTHGFYTAKG
                     KRISATSIYFESLPYQVHPQTGYVDYDRLEELALLYRPRLIICGASAYARDWDYARMR
                     EIADKAGAMLMCDMAHYSGLVAAGELTSPFPFCDVVTTTTHKSLRGPRQGMIFCRRQY
                     EADINEAVFPGCQGGPHNATMAALGVALKEAMTPEFRAYQQQVRANAKALAGALQARG
                     YTIVTGGTDNHLVLWDLRPEGLTGNKVQKLCDQINITLNMNAVPGDTNALSPGGVRLG
                     TPALTSRGFREKDFEQVAEFLHQAVQLCLKIQKDSGKKLADFERALEGRPELATLRDQ
                     VRAFALRFPMPGGPR"
     gene            complement(<828047..>830413)
                     /locus_tag="CYME_CMN333C"
                     /db_xref="GeneID:16995214"
     mRNA            complement(<828047..>830413)
                     /locus_tag="CYME_CMN333C"
                     /product="phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_005537379.1"
                     /db_xref="GeneID:16995214"
     CDS             complement(828047..830413)
                     /locus_tag="CYME_CMN333C"
                     /codon_start=1
                     /product="phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_005537436.1"
                     /db_xref="GeneID:16995214"
                     /translation="MGVALSLEDTHTETSRLSRTSGKEKEQHVSMARTLTTELGAAAE
                     DANNTEEVHFTDPKNNSSLSNDAGSYLATVEAAESLQKAAVAPAVAGSLLVSSACAAP
                     ASDTPEKQGTMEQGGSDRSGSGSAGTTLDDATDDSDARKRAESRTEVRMSLGRRLRRP
                     PPLQVTVAATEENAEPTKSRLVLLTNAENNSVHSGTTNSTYSQQSGTLEVAPLSVSTS
                     ATSRVMRAEHAMGTAHSSSIEPQSSSSASSGQQLSVNGFASVPFSESRPATIVGAAGL
                     GDGSFEHGAYAAVHADARSTHRRRDVRRGSHTVLPPPLPPLVVEPAVHLYIDALPAMP
                     PKSPLPGSARGALQPVGHASATGSCHSAGVIGTYNLLHPFTRRGNFQIRHGEVIYKGH
                     RSYHLMMQIKAGIRYTVERQNALAPRNLCMADFRTSNTIRFPAVGSSDTPPIEKCFTF
                     KDYAPMVFRQLRQRYGISPTSYLRSLCGEEALREATTAGKSGSLFYYSSDDRFILKTL
                     SKQEASVLLSILPQYYFHMMKNPESLITRFFGLHRVTTHRLGLRRRRIRMVVMSNFLP
                     TRTPIHLRYDLKGSTHGRFSRTPASHVLSNDDEQQTAPQQRFRPSLLCRASQELDPRQ
                     PRKDLDLFRDGVGPIAIDRRLRRRMLNQIDMDCLFLESVHIMDYSFLLGLQYVDTSAN
                     LPVSAESWRRLRERDARHANSWVGLLENGEEARLFFGIIDVLDRYNAEKKLEHFGKAH
                     LLCLHDSISVIEPSSYARRFRRFLEKVFVPVPRSPYAAVQDDASTGLR"
     gene            complement(<831939..>833147)
                     /locus_tag="CYME_CMN334C"
                     /db_xref="GeneID:16995211"
     mRNA            complement(<831939..>833147)
                     /locus_tag="CYME_CMN334C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537380.1"
                     /db_xref="GeneID:16995211"
     CDS             complement(831939..833147)
                     /locus_tag="CYME_CMN334C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537437.1"
                     /db_xref="GeneID:16995211"
                     /translation="MQVRLRFLVPRPVASCEGGDVSVLLQRSERASPDEQPQTCVRAA
                     DASEGALTAETLWGYPHHGRLSYCYGYQDRQSCRLERTVPVRWLVAVLGDNTEPHAAP
                     QVPVYSFDDTIVRVRFALKVHTAFGRFVVVKCCESVCVLQWSATDIWRGEMTIDSSEV
                     LWGDDLAYQWADLPEAEAMTVTAADACWSRSTMQLLKLESNTAVRERPEEPCRSAPDD
                     AIPEPPISLSLTPGVPVTPWPQYVKNVGDLRIERLYTSWLQLRIAPANNSNGEGDASL
                     DSELHGLVSEEEWRALSRFGQRLSPTSAWSQEPMMTIPREKIDENTRLMDEPSFSIGQ
                     PPKASKKNQAAESPSGPQPHQQQRPRRWRLLLFCLLWSWAAVGALYAYRQNFAPTERF
                     AGKRHSLKRQ"
     misc_feature    complement(833221..835427)
                     /note="repetitive element"
     gene            <836571..>839651
                     /locus_tag="CYME_CMN336C"
                     /db_xref="GeneID:16995212"
     mRNA            <836571..>839651
                     /locus_tag="CYME_CMN336C"
                     /product="acetyl-CoA synthetase"
                     /transcript_id="XM_005537381.1"
                     /db_xref="GeneID:16995212"
     CDS             836571..839651
                     /locus_tag="CYME_CMN336C"
                     /codon_start=1
                     /product="acetyl-CoA synthetase"
                     /protein_id="XP_005537438.1"
                     /db_xref="GeneID:16995212"
                     /translation="MLNCSRELGRATLATVWQKGQVSGLRAWYAQVTACDAAGGYRLG
                     GKRLITQLISPADSVGSRKMGVPTAVSVQRLSSSCAGETGTAASERSASVPRFDPSVH
                     IVTRRTRVREQLDAIFKPRAVAVIGATEKPGSVGRNIFQNLLSPFGGAVYPVNPKRSH
                     ILGIRAYPNVSSIPEPIDLAVITTPARTVPSIMHELADNRVPGCVIISAGFAEAQVGG
                     EGRKLLDETLAEARRGGTRIIGPNCLGILNISTGMNASFGARAEYVKGDVALLSQSGA
                     LVCSLLDWALKERFGFSKVASLGTMCDVDWADMIRYIGEDTHSRSIVAYVESIGNVRA
                     FISAAREVATTKPIVVIKAGRTPAAAAAAASHTGNLTGSDEVIGEVLRRAGVLRVDRI
                     DDLFLTARVLAQQPRPRGKNLTIITNAGGPGILAADELVSGGGALTELSSETMDALDK
                     VLPAAWSHANPVDIIGDATPETYAKALEICSKDVNTDGTLVILTPQVMTDATATADIL
                     VRAAATARAEDKPVLASWMGGIDVLAGQEILKRNEIPNFAFADVAVRIWNYLHRYNSI
                     LESLYEVPEGPSTRVAGMRQIKRSAEEMLEQARQAGRIVLNEYESKRLLSMYEIPVLE
                     AKLAHSEDEAVEIAKRIGFPVVAKLLSHTITHKTDVGGVKVNLHTPDQVVEAFHSIRE
                     SVTKLRGAEHFQGVILERMIDLRPGGYEVLLGSTLDPQAGPIVAFGTGGTLVEVYRDV
                     SLGIPPLNSALARQMMERTRIYNALKGVRGHDPADLEQLQTVVSRFSRMVCEQRLIKE
                     CDINPLFVTPRGIVAIDARVVLHDPHVSLDTVPQPAIRPYPSEYVSPWSGDSMGNLPV
                     VIRPIHPSDTPKLLEFWDALSTTGTGYLVPQVVAAAPTRDVNLRDRWLRNRLLRIAFC
                     DFNSEMVIIAEARDAEGSAAIHALAQLRLEPEPDPGHFAINVLDTDRGHGLGTEMLRR
                     LMDIARREGLTRIWSEIAPENRAMQRICEKLGFQLGPLPDQENGNILAEYVLSA"
     misc_feature    complement(840017..841781)
                     /note="repetitive element"
     gene            <843555..>844766
                     /locus_tag="CYME_CMN338C"
                     /db_xref="GeneID:16995205"
     mRNA            <843555..>844766
                     /locus_tag="CYME_CMN338C"
                     /product="NADPH:protochlorophyllide oxidoreductase,
                     chloroplast precursor"
                     /transcript_id="XM_005537382.1"
                     /db_xref="GeneID:16995205"
     CDS             843555..844766
                     /locus_tag="CYME_CMN338C"
                     /codon_start=1
                     /product="NADPH:protochlorophyllide oxidoreductase,
                     chloroplast precursor"
                     /protein_id="XP_005537439.1"
                     /db_xref="GeneID:16995205"
                     /translation="MQALFVSVPLYQERYIVRARAATRAPFPLRTPRNGCFAAGHCHH
                     CQHPLPLVVQRLPVARRHHALHLRMGPKQSQIAVITGASSGVGLYAARALVNKGNWHI
                     VMACRDIDRAERAADSVNLPKDAYTVLHCDLADFASVLKFVRELSSVARVDHLDALIC
                     NAAIWHPRDKKPRFTVDGIEETMQVCHLSHLLLCRELLPKLKISRGRIVFLTTQTHSP
                     NSLPGKIPPQARLGDLSGLAAGLGPQTTGMVDSGPFEPTKAYKDAKAANVLTMKALSD
                     RYGRDGVTSVAIFPGCVADSNLFREKRGWFRHVFFPILQKYITRQYVPNDEAGRRVAE
                     VATQGQFSDSGSYYQWRGKYTEGREKTKPQVIEPTYEIDKADQLYELSLDLIDQALRR
                     RGLKSTILAPV"
     misc_feature    845345..847223
                     /note="pseudo-gene of trefoil factor"
     gene            <847214..>849403
                     /locus_tag="CYME_CMN340C"
                     /db_xref="GeneID:16995203"
     mRNA            <847214..>849403
                     /locus_tag="CYME_CMN340C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005537383.1"
                     /db_xref="GeneID:16995203"
     CDS             847214..849403
                     /locus_tag="CYME_CMN340C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005537440.1"
                     /db_xref="GeneID:16995203"
                     /translation="MRKRYFSIVRLLVIVLVVSGTHTVRGVLSAENTVLWTWIGGSSS
                     NGSSGSYGVQGVPNTSNVPPARFGAAFWNGADGVLWLFGGGSDLRDVFGDLWNYNLST
                     FSWTWVGGSSSLNSGGVYGSLGVPNKSNYPPSRTESAAWSDSNGNLWLYGGWNLNLGY
                     SDMWMYNVSSGEWTWVQGSNETNVPPTYGPLGKSSSSNTPGGRYQPATWVGLDGQFYL
                     FGGFYPFGHFYGDLWQYNTVTNEWSWIGGTQQQTPSGSYGTFRQASPNNYPAGRAGAT
                     SWRDLDGNFWLFGGFGQIVGSSNLLNDLWLYNVSSKEWTWMSGNDSVGSNGSVYGEKG
                     VPSSSNTPGYRSGSSGFVDSSNTLYLFGGSSPGVCNDLWTFNITSLEWTWVDGDDTTN
                     GAYSYGEVNKTSNTTLPPPRYGAVLWNTDQNDPVLFGGQGSSGSYNDLFTLYIATSTP
                     MPTATPTPTASPTPSVTASPSATTNVTQTAVGEGSAVCFPADASVLIDGLGNSLLISE
                     LRSGMAVIGVNGRGQLVEDSVLGWLHNEPGATAEILAIKTLSGKQLRLTRQHLVYRVI
                     EHSRDFDSMTTAFSCISQKQQQQHQKHVGQSLELGTSAVVAVFAEDIRVGDALLDVAA
                     QLPDPVVAIETLVTHNGLYAPLTRSGRLAVDGVLVSCYGTYASHAVAHAVLWPARVDA
                     LRKVWGSGLGTEGIVGIMPYAERLYHIWTSAARVLTEARVSVVVAAC"
CONTIG      join(AP006496.2:1..852727)
//
DBGET integrated database retrieval system