GenomeNet

Database: RefSeq
Entry: NC_010141
LinkDB: NC_010141
Original site: NC_010141 
LOCUS       NC_010141             902900 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 15, complete
            genome.
ACCESSION   NC_010141
VERSION     NC_010141.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 902900)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 902900)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006497.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..902900
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="15"
     gene            <6558..>8069
                     /locus_tag="CYME_CMO001C"
                     /db_xref="GeneID:16995679"
     mRNA            <6558..>8069
                     /locus_tag="CYME_CMO001C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537384.1"
                     /db_xref="GeneID:16995679"
     CDS             6558..8069
                     /locus_tag="CYME_CMO001C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537441.1"
                     /db_xref="GeneID:16995679"
                     /translation="MLRTRGFQYNPLLRTGIILLLMIWAQLCSAFQEADKTSLGARPT
                     QGLATKISCSPASYVPTCKIERYCVRHDTSNGCATKEQACSRNEPHRNRLQQVEDRVQ
                     HSRGFTNSMWYNLLRQRQEKVSVVDTRVDCNSECEQKDARVCLAYEYRKVCLICSCIR
                     SYSEMKDAAQRYPEYIGKQDQGLGMQSTLNAGTKYEIFENRFQHRYRCLWVPTNQDAI
                     TSSRGILRAMNSRLSWIKARLQKTGIRDAAQVPAVSQTEREQSQWLPTEPVGRRAPGG
                     ALPSMPNTIISLVGTPSLSLSPTPPSPSATLVPTTPTMLPTPTTTGISTVLPSTMEPL
                     PSPSTATTSAMPTPMMPSPSTSTSTSSATPHTYMPSPSPSASTMTPPWTATATSSCSH
                     TKTHSHWTGTMTAPNPPPPTYMPSTQYPPGCYTGPPTVMCTCVCSCPTAAPPSMPSTM
                     SPTFTASALPSVSQSSATGSITTTTASASPSTTLSGPVSRTPFPSIIVTFMFR"
     misc_feature    9444..12672
                     /note="repetitive element"
     gene            complement(<12943..>14535)
                     /locus_tag="CYME_CMO003C"
                     /db_xref="GeneID:16995520"
     mRNA            complement(<12943..>14535)
                     /locus_tag="CYME_CMO003C"
                     /product="mannose-1-phosphate guanylyltransferase"
                     /transcript_id="XM_005537385.1"
                     /db_xref="GeneID:16995520"
     CDS             complement(12943..14535)
                     /locus_tag="CYME_CMO003C"
                     /codon_start=1
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="XP_005537442.1"
                     /db_xref="GeneID:16995520"
                     /translation="MSPRLYRTEASMMPVKFLHCSPSAYAKRVNPEMAHRSNPLKIVA
                     RLPSAKRGGIAGACHIAIGAAVQPQRFRLTLALESWSRVLLPAAPLKGQSLMSAKAVI
                     LVGGGSKGTRFRPLSFDLPKPLIPIAGKPMILHHLERLAQVPGLFEVILLGFYDESLF
                     SDFVQNASNHLGIGVRYLREESSLGTAGGIWRYRDAIRSGSPEVLFILHCDIASSFPL
                     NDMLAFHRKHGKPLTVLGKTVPPSGDARAYGCMVKHPDTCELLHYVEKPETWVSNLIN
                     CGIYIATTGSFYELLEKTCVECSRWALTENASGGSLFSVSESDCNHIRLEQDVIMHYE
                     GRKVIYIYEHKDFWCQIKEPAAALLASKLYLEHYAEVHPEQLADHAYRPEALASRLFT
                     KSTDDLGRGSVTMSSTSPTFVGAVFVHSTARVASSAKVGPNVSIGAGCVIGAGVRLQH
                     CIILEDCVVREHAYIANSIIGWSSVIGPWARVEGDGIESEAGRVSVLGSHVECDGGVV
                     IRNCIVLPHKTLSTSASGQIIL"
     gene            15915..18622
                     /locus_tag="CYME_CMO004T"
                     /db_xref="GeneID:16995521"
     misc_RNA        15915..18622
                     /locus_tag="CYME_CMO004T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461488.1"
                     /db_xref="GeneID:16995521"
     gene            complement(<16393..>18339)
                     /locus_tag="CYME_CMO005C"
                     /db_xref="GeneID:16995499"
     mRNA            complement(<16393..>18339)
                     /locus_tag="CYME_CMO005C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537386.1"
                     /db_xref="GeneID:16995499"
     CDS             complement(16393..18339)
                     /locus_tag="CYME_CMO005C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537443.1"
                     /db_xref="GeneID:16995499"
                     /translation="MSSEEKRDHSSSTHAVSAEVLSSLIAFGLGWLLRGNQRPSSTKL
                     TKVRRSDPAPSVVTTSSVILRVTGAEVFEGDGVAASEQEELLIDQVIRAVAAHRASVQ
                     RLQSLKSQSADSKAPSAVDAAVHGTAQDAEQAVKQDGVLSASAETGEPALERTDASTV
                     VELSEQERIWSEELAAILKQRRPLKQKPARWCRTPDDFIAMLLHACVFAARKHRNHRR
                     KDTERTPYINHALNVAYALWHDGRVRDGRVILAGILCHAISDEHFAAHTENALTQEAL
                     PDDLDENHDGKLLLTAANASSASSASIVEIEKEFGIEISSIVRECWAEKRVLSRHLAE
                     KTVQHPLDQRARLQNDFLTEKKSTNMLHEESTARATGASTERSLWTRLFSRAQPNDVK
                     GSDTAVQGETPGSEKGLSNMWGRAKDWRVMKASSMLTRMDRKKIEAACSMLKSKEAKM
                     VRLADKLVNLREILACEQGRPHGWSQQRTAEYFAWADALQRRIGNACPPLAKAIEKIV
                     KMHRSQYDLEKNLSREPALVIATGIQKSHNDGEASILSSSTEDEHSSGKEGLFGLSPS
                     NPLDKENFAVVRGAPFRVGALAPDGGQQHQKYVLISDYLEKHVSKPLKSSTIEADTSS
                     LTISTLDTPAKRGVLLELQSTESL"
     gene            <19451..>20251
                     /locus_tag="CYME_CMO006C"
                     /db_xref="GeneID:16995500"
     mRNA            <19451..>20251
                     /locus_tag="CYME_CMO006C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537387.1"
                     /db_xref="GeneID:16995500"
     CDS             19451..20251
                     /locus_tag="CYME_CMO006C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537444.1"
                     /db_xref="GeneID:16995500"
                     /translation="MDVGSFGIDPDIQLRNVKLFEVHIRRTWLALTLARRACYVVLIV
                     LCLHAAYCAKKACSAVFSVQLFGTSVPAVQAMRSSFDQSAPGQLYHGCSAKFVNQDTM
                     HGASTSDCETCDLASAQLAEKPCTNACANSPPGTGLDSSGVYGCAVEATRGTRTRAVL
                     RLLEALKYATLWALRGFLPLWIFFGMGIYRAFLLDSQLYVIRLNRVLSRFHIVFSRSA
                     RRLHKAERYASRAQHPSSWTYAEQRIARPPESERLEHRADRGKLQRTS"
     gene            complement(<23584..>24729)
                     /locus_tag="CYME_CMO007C"
                     /db_xref="GeneID:16995501"
     mRNA            complement(<23584..>24729)
                     /locus_tag="CYME_CMO007C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537388.1"
                     /db_xref="GeneID:16995501"
     CDS             complement(23584..24729)
                     /locus_tag="CYME_CMO007C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537445.1"
                     /db_xref="GeneID:16995501"
                     /translation="MSKLVNRERPAASAGEWERGMPQRTSFRRATWLVVAGITLAVSF
                     AYSLHSFQVFSRNNGFPSLSHLFWLLTLQSLGYGAAFALVAVATLICSSGSGDTQRSG
                     RSTEELSSECPQFTKQFSTGSGLPSPRSFLGVFSGGAGSAPRRDHGAQTAGCVSEPHS
                     PSRELFLEPLSLLKHVHWRGISTHERHEASSQTSLTWSRLDALERENKQLQGHYARLR
                     RERDDLDKQLLVLNARMAHLEPIASRAEELERRQIELVLQLAARDEQLAEAERKARRA
                     ESGLGNEQKRSREAERELLQLRKKIEETEENRRNTAESELPGRFSLRKFTRRRVREHL
                     QSLEEQLAQRDEELVRLRAIIEQLSSGYASDVAISCISNIDMDASNA"
     gene            complement(<26640..>27224)
                     /locus_tag="CYME_CMO008C"
                     /db_xref="GeneID:16995516"
     mRNA            complement(<26640..>27224)
                     /locus_tag="CYME_CMO008C"
                     /product="ribonuclease P protein subunit POP5"
                     /transcript_id="XM_005537389.1"
                     /db_xref="GeneID:16995516"
     CDS             complement(26640..27224)
                     /locus_tag="CYME_CMO008C"
                     /codon_start=1
                     /product="ribonuclease P protein subunit POP5"
                     /protein_id="XP_005537446.1"
                     /db_xref="GeneID:16995516"
                     /translation="MVRYRCRYLVCQIRNASDAGTQPRTEAEVSRCGEPSGQPMERGA
                     LVGQKRRYFSKVGPASTGNTADAHQARTAEVYRLPLPFGERELHAALRATIESCFGDL
                     GWCLLVPSLATKYFDAETGIAILRAPRDQYRLLWAACSLLNQVQLTATGQWVPLRVRV
                     VHVGGSVRSCQNRMMQAMRRELPLFIDEHAVEKR"
     gene            complement(<28687..>29592)
                     /locus_tag="CYME_CMO009C"
                     /db_xref="GeneID:16995517"
     mRNA            complement(<28687..>29592)
                     /locus_tag="CYME_CMO009C"
                     /product="similar to splicing factor RSp31"
                     /transcript_id="XM_005537390.1"
                     /db_xref="GeneID:16995517"
     CDS             complement(28687..29592)
                     /locus_tag="CYME_CMO009C"
                     /codon_start=1
                     /product="similar to splicing factor RSp31"
                     /protein_id="XP_005537447.1"
                     /db_xref="GeneID:16995517"
                     /translation="MSTREFEGLSNSDVWGSSGPKVTPTGVKALYIANIGRAPQRDIE
                     KLVEPYGKVQRIEMKSNYCFVYFSEDTAVEAYEHAIAALNGQRLGSQSRILTAEWARG
                     TAPASISRLQESEKTLGGEDSITGGDGACLENSVTTSKTLFVVNFDPDEITSRDLLIH
                     FHRFGPIERIERRKHFAFIEFRSLDDAIRARSEMDGAYIGCRQVSVEFSQKGPPAPNG
                     DPATESGSCTLVRNTTRTPWRQGLDTRRPRSLDRSTRNPSWARRRRRSYSPPLFPAMS
                     SRRQARMRNSSMEAPLPETSALYRS"
     misc_feature    complement(29910..33212)
                     /note="repetitive element"
     misc_feature    30895..36147
                     /note="retroelement, dead"
     gene            <37512..>38843
                     /locus_tag="CYME_CMO012C"
                     /db_xref="GeneID:16995514"
     mRNA            <37512..>38843
                     /locus_tag="CYME_CMO012C"
                     /product="S-adenosylmethionine decarboxylase"
                     /transcript_id="XM_005537391.1"
                     /db_xref="GeneID:16995514"
     CDS             37512..38843
                     /locus_tag="CYME_CMO012C"
                     /codon_start=1
                     /product="S-adenosylmethionine decarboxylase"
                     /protein_id="XP_005537448.1"
                     /db_xref="GeneID:16995514"
                     /translation="MGSVYEPVGFEGPEKKLEIDFQPAGEVAGSPCSPKHSLRSVPRS
                     KWETILAVAQCNILSVLQNAHCDAYLLSESSMFVFDRKVMIKTCGTTSLLRTVPELMA
                     VGQQLQLEIGFLQYSRTAFRYPEYQPAPHQSFRDEIAYLRQYLPEGFERVMADDHAIP
                     PAQRMAWHVFTYDNQRMPTNEQSLEVCMFDLDPMAMRCFFGDDSLHGGDPVLCTHVSG
                     IDDLLRAAKRLDQNAVDDDGAAPLVDAHLFSPCGYSMNALDGSTYYTIHITPENHCSY
                     VSFETNAHLGSFVPVLRCVLETFRPARFQVAYVGDEQAAGTHAARDWPKHLHAGEQRF
                     SRRDALQTGGCAKPKCSPMVWRRTGPYNHWMASSATYQCVLGWPSLACDEIAGERAHC
                     GYNGWSSPVSGDSWSTRPTPSLCSDSERDLDDVPLDSSTTLDGQAPNISIG"
     gene            complement(<38956..>39942)
                     /locus_tag="CYME_CMO013C"
                     /db_xref="GeneID:16995515"
     mRNA            complement(<38956..>39942)
                     /locus_tag="CYME_CMO013C"
                     /product="probable nicotinate-nucleotide
                     pyrophosphorylase"
                     /transcript_id="XM_005537392.1"
                     /db_xref="GeneID:16995515"
     CDS             complement(38956..39942)
                     /locus_tag="CYME_CMO013C"
                     /codon_start=1
                     /product="probable nicotinate-nucleotide
                     pyrophosphorylase"
                     /protein_id="XP_005537449.1"
                     /db_xref="GeneID:16995515"
                     /translation="MNSKEKQLERARVAPLPLLLNAHIERWLLEDAPSFDFSGSLVDL
                     RPASGTLWQKSAGVVAGRPFFDAVFETLGCSVTWRDEGTTSTTSLEGQYWDGAEGSSS
                     AGKRPLATVRGPARRLLQGERTALNLLSRCSGVATRARQFKQLCRVRQWHGVIAGTRK
                     TTPGFRLVEKYGMHIGGADMHRVDLSGMIMLKDNHLACIGLELQRAPDDPIVIQEAVR
                     RARNCAGFSVSVEVECGSEASALAAITAGADVIMLDNMDPETFCETAKRLREKTATMP
                     HCRYLIEASGGITLETAPRYMCAAADIISVSLSQGYECVDYSLKVSFTNREA"
     misc_feature    41056..42908
                     /note="possible transcribed region"
     gene            complement(<43103..>45325)
                     /locus_tag="CYME_CMO015C"
                     /db_xref="GeneID:16995506"
     mRNA            complement(<43103..>45325)
                     /locus_tag="CYME_CMO015C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537393.1"
                     /db_xref="GeneID:16995506"
     CDS             complement(43103..45325)
                     /locus_tag="CYME_CMO015C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537450.1"
                     /db_xref="GeneID:16995506"
                     /translation="MLRLDPERTNELNFRELMRRQSAVAPAPVREETAGATRVLAPST
                     ATASVVASGTLEASDGVAFRTEAAQPSQTEANKPVSALEATGSLRLPTKQGDLETNVR
                     EQPPGSPASIPQTIAPVRATVPTGRQRQGRKRRRRRLNAAVRGNYESDDSVYDYDSDF
                     IDDSEITEDFAADMQPGFGVLSSILGQRWNRIPSADPRPASAASTPERHQLASGMTGR
                     SGPSQDDDFEEWAWSRRHSRVVLPQRVEEVARRLEARIRDLYGDKKPNGWEKVPELVE
                     LLAEFCESAVAARLASVPTSEGSVPYRFQEELFNRLAFLRTTKPKLLQVASARYWRQV
                     ERDAEEQLRQIRDQLHIVAEQLPAADGATESNLLERPALLDCVHQYFVHQVQALNAAN
                     FRYKKPRSVSKMLKVFAAELKQHPVFVNDASVTAKDLESVYRKRESELLAKRRAEREA
                     ERQRKREERQRDKEQQVTSQVDSEGRATPTHAGSQQNELEQQSPEASQTGSDSFTQPR
                     AHPRQSTEQSEGDHLSDEGVSTAPADTPQAERNKRTHSLEERFAELRQWRYETDEWTP
                     LHPYPSVICRRDRFRSVRLWVKSQRMIARGTGRGKLAPKDFYRRCKAELGVDLFHGLQ
                     IIGSVHTSPGEKPLYRPRPTGNPLISALKMPLPTGAPSTLFASMDRYRIPEDLAEEAA
                     REAAAAAAAAAAPAWRSQTATPISDRGTPDVAASQRSTAEPPHASDNASSAIEAASSD
                     "
     gene            45523..46822
                     /locus_tag="CYME_CMO016T"
                     /db_xref="GeneID:16995496"
     misc_RNA        45523..46822
                     /locus_tag="CYME_CMO016T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461489.1"
                     /db_xref="GeneID:16995496"
     misc_feature    47607..49367
                     /note="possible transcribed region"
     gene            complement(<48794..>49834)
                     /locus_tag="CYME_CMO018C"
                     /db_xref="GeneID:16995498"
     mRNA            complement(<48794..>49834)
                     /locus_tag="CYME_CMO018C"
                     /product="ubiquitin carboxy-terminal hydrolase L5"
                     /transcript_id="XM_005537394.1"
                     /db_xref="GeneID:16995498"
     CDS             complement(48794..49834)
                     /locus_tag="CYME_CMO018C"
                     /codon_start=1
                     /product="ubiquitin carboxy-terminal hydrolase L5"
                     /protein_id="XP_005537451.1"
                     /db_xref="GeneID:16995498"
                     /translation="MASSVDDGADSEGGWCTIESDPGVFTAMITELGVKGVQVDELVD
                     LSEEAFVAANLACPVFGLIFLFKYDQVLAAPASEPLSTAETPHHLIFSRQVIRNACAT
                     QALLAVLLNARQRGLQLGPLLTEYAEFAQALDAETRGELLANARDICAVHNSFSPLRG
                     ILLEEDPSLRNLLPREDVFHYVSYVPLGGKVYELDGLQTGPSAVGTFDASLLAPGTPD
                     SKQQLPTAEAQHHNDLAWVCVALRAVRQRISRASNQELRFSVLVVHRDPRPELQVRAS
                     GGDQVAASLLAQEEAKHARWQLDTTLRRMDLVPLAIRLLILFADHGHFVELLEEAKRK
                     REQQVANHAEHS"
     gene            <50280..>51554
                     /locus_tag="CYME_CMO019C"
                     /db_xref="GeneID:16995494"
     mRNA            <50280..>51554
                     /locus_tag="CYME_CMO019C"
                     /product="unknown conserved AAA protein"
                     /transcript_id="XM_005537395.1"
                     /db_xref="GeneID:16995494"
     CDS             50280..51554
                     /locus_tag="CYME_CMO019C"
                     /codon_start=1
                     /product="unknown conserved AAA protein"
                     /protein_id="XP_005537452.1"
                     /db_xref="GeneID:16995494"
                     /translation="MAGKRASDGAAASNPYNSLFADILTSVISVTALFIGANIIRKRL
                     DPAFESKKELERRRKELEERLRKQRSSCGRPPLDLSDLTPNEEVVAHYLVDPDELDVQ
                     SLDDVGGLEEIKEELRELVILPFHRPELFPPGSLLQPPKGILLYGPPGTGKTMLAKAL
                     AAESKACFLAISPATLLSKWVGETQQLTRAVFSLAYKIQPCIIFIDEIDALFRTRSAQ
                     DHEVYRDFKAEMMQLWDGLTTDSSAQVLVLGATNRPWDVDTAIQRRMPRSFLVDLPGV
                     EQRKRILDVILRSDRHRLEASTEELAKLTEGYSGSDLRELCRAAALLVLRDAMREAKK
                     CGVDVSQVQLRSMRLEDFERAMERVAPTGAHAEIFRYRQTLERVRKLRVAQENSNVES
                     REPDEQTLVAGIEEALLVEANEFVERVGRRLG"
     gene            complement(<54925..>55734)
                     /locus_tag="CYME_CMO020C"
                     /db_xref="GeneID:16995495"
     mRNA            complement(<54925..>55734)
                     /locus_tag="CYME_CMO020C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537396.1"
                     /db_xref="GeneID:16995495"
     CDS             complement(54925..55734)
                     /locus_tag="CYME_CMO020C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537453.1"
                     /db_xref="GeneID:16995495"
                     /translation="MAVPSGVHRCFFRGQSVSLEKLLSIFASEVCEQVVFIGENHEHS
                     VAQQLELRILEALWLSSQRQNRQLLLSLEFLDRSQQHVLNEAMLRDEIESVVPEPYVP
                     LVRFARTNNLAVLAANAPRSITSRVAKQGQQAVMETLSPKERAWCAPTPWPAPSNAYS
                     EAFQAIMQQVMRPDPSSAQAQQERMQRMLQAQSLWDATMAFSIAEALERYPKAQVLHV
                     TGFFHVANRLGTVEMLAHYRNTVNALVSIVYPEELQHSTSALDGDVVIYAP"
     misc_feature    complement(56198..57508)
                     /note="possible transcribed region"
     gene            <57715..>63831
                     /locus_tag="CYME_CMO023C"
                     /db_xref="GeneID:16995503"
     mRNA            <57715..>63831
                     /locus_tag="CYME_CMO023C"
                     /product="similar to rRNA biogenesis protein; rrp5
                     homolog; multiple S1 rna binding domain protein"
                     /transcript_id="XM_005537397.1"
                     /db_xref="GeneID:16995503"
     CDS             57715..63831
                     /locus_tag="CYME_CMO023C"
                     /codon_start=1
                     /product="similar to rRNA biogenesis protein; rrp5
                     homolog; multiple S1 rna binding domain protein"
                     /protein_id="XP_005537454.1"
                     /db_xref="GeneID:16995503"
                     /translation="MEVEQAATMPQVANGGDFPRGRDDDLPVTAAAAVTSDRRTRQTG
                     TKRSKRASTSVIRKPQKINLSPLVRSERAKVPAWLQVGDLQPGTLLLGCVVTVRPERA
                     VILLPYGIWGTCPLAGTEALERSASGAPTASVAVAATLKLQPQTIVRACVLSRPLASH
                     ELEPERRATHQSGKRERSIHLSVDPRHVNRGLGLSERLADYGPIQVRLSLPLDDAQKR
                     FTVEALAEDPSQDRRLALQVSGAGATASNDTGMVCWASLASWNEQRRTGILQNDPKMV
                     AEAFTRGHWTLEQLSPGMLVEAQVLSRDERFAIVRFLQVFEGILEWFHLDQWEDFARL
                     EPDAILRVRLIYIDCRRRRIMVTARTSLVNTLTLPLLVSAARRYHRGSFVESLRVFKI
                     ENGRGIWLRKDKEAIYFFADRKMLSDERFSRMERLFPLGTVVPRARVVSHMAMEGIVR
                     VSLKPSLLERKFMDVSELEPGALVRCRVLGWISVTPATATPSLRVSIEDCLSGEIPLE
                     LLTDVPVQWRRLEKKFPPGSQLRCRVWLVYPKRKQVLLTARRSLVDSDLPILAGWDTM
                     QQGQVYAGILGPRDPSGAYRVLFYQRFTGILPANLGTEMASFKSGQVIRVRVERIHSR
                     RAKQLLVSLDNSAVTATPMAAAAAAAASEQQSDQGRLRPGTLVRIQSAFRDQVGRILA
                     LVYIDEPRAKDAGAQSAKRTWLVLLPRQHLTDYPMFQKSWAADAGLAALCDEVALVID
                     AGHTGDSSLPLISHRWSLCRAAACGLLDDGAVERSAPGSIGVGYVERIGAAQAYAVVR
                     LGLSSRRVHVQRALLADRFVDQSTSVLLEGQLVLYSVRNGSRYSLRYSDVQPALETEP
                     YREFFQEMRSLVPLVRELARLWRAHEASQSLGLSLPLPGTLVRGRVLYSGDDRMDMEV
                     QHEQVIYRGVVGSYHFVDTQAGEQAPTASRETSTTRAAVGQLCTALVLWMDPLAKTMV
                     LSRKASLLKTAPLPWSDAQCLTATDSTVSSSLGGCTRVQKAQVLAVYGQVAVLLAQAR
                     LAFMSTLDINGRGTERPVHVGQQLTVTARTANATARPPPAPAASTPAADDENNGAKNG
                     DDAAEWPAWMRAMLRASVRPAAPSTETAAQSAGVQTKRQVPQPLSRPPVRIGDVVTDA
                     EVTAVHSFQVHVRWSDGQTGRVHIINVENEGAFRELQVGQLLPPARIVAQRRPRQWEL
                     SLRQRDLEATDVLSLDSLPQTGDLVERAVVKTTDLNAQGDVLAVWLYVRPGLVARLSR
                     LEATPRVLDESWVPGRFVQGLRVLRADADRKRYDLTTTDPLLAGQCITGARVRSVHPV
                     DGIVRVQLPRGQMGVLFIGCLPYEDPKDPFRTLQGIQKLDVYLVEDWIPSKQVPVTAI
                     PERQPLRWAQLHRGDVVGAFVRHVDQAGVFLNLAPGLVARCLLRDLAEGFVPDPVQVY
                     PVGMHVQAMITDCGGSDARHVRVSLRAAQQQQQQQQQRAVAAEQAPTSAVHIGGVYLG
                     RVRRVVPFGIFVELLTDRTDEGDAQVLATALCHRSELVEQGPWPLPEELPQRFRVGQH
                     LPVLVVARDAAGRLSLSAKASLIKEALATQCASAKSIDEVDLGAGFTPALKDVIVSAT
                     EDENVAHEPISRSGNCDSPASAATKYAASSLMGSERSPQQRDAMACLGSNTTALDHLE
                     ENTETEEMEHTAHQPNGVYAAVNGASAGTLPFLAIPSETELVREDADTHASKDWSRSV
                     DEASGAARAPLDDEALERGERALVESLHKPQTAADFERALLGRPNDPQLWIGYMALHL
                     ATGNELEARGIAERALQTIHYREYQARMRVWIAYLNLERSANAAADPLESDIFRRALQ
                     NCDSLQLHLRLARSLEAAQEVKLAGRVYEHACRRHGHQTASVWIAYGAFCFLRSSQEV
                     LGRTLLERALRALMDPAQHVQCILKFATFEFKGSGEPERGRTLLENLIQAFPKRLDFW
                     NVYLDMELMLLRQERGKLELVRRLFRRCTALPNLSLKQAKHFFKRYLEVERAFGDASS
                     VEHVKQAARAYVAQRTGEAPQR"
     misc_feature    complement(58926..59547)
                     /note="possible transcribed region"
     gene            complement(<64046..>64243)
                     /locus_tag="CYME_CMO024C"
                     /db_xref="GeneID:16995504"
     mRNA            complement(<64046..>64243)
                     /locus_tag="CYME_CMO024C"
                     /product="40S ribosomal protein S28"
                     /transcript_id="XM_005537398.1"
                     /db_xref="GeneID:16995504"
     CDS             complement(64046..64243)
                     /locus_tag="CYME_CMO024C"
                     /codon_start=1
                     /product="40S ribosomal protein S28"
                     /protein_id="XP_005537455.1"
                     /db_xref="GeneID:16995504"
                     /translation="MDQPVKLARVKQILGRTGSRGGVIQVRVEFLDDQNRSIIRNVKG
                     PVREGDILTLLESEREARRLR"
     gene            <65759..>66370
                     /locus_tag="CYME_CMO025C"
                     /db_xref="GeneID:16995519"
     mRNA            <65759..>66370
                     /locus_tag="CYME_CMO025C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537399.1"
                     /db_xref="GeneID:16995519"
     CDS             65759..66370
                     /locus_tag="CYME_CMO025C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537456.1"
                     /db_xref="GeneID:16995519"
                     /translation="MRYLRSSALTARLIKAGCLREPAWMSALRGLEAVRAQPVLDPDA
                     RVPKPGTRTRTANDHTSRVSLLQRLRRRLAERHPEWLLHVVVDLNAPTRAERDVIEKF
                     VRMQAELIQREQLSEEEAYERTLAVLRSELPRTSQLAALVEQQQTASKSVGLSQVMVA
                     APSLSVASPERPLQDPEAVFLASLQDAQRDRWLFEQFSRRLTS"
     gene            <68273..>68863
                     /locus_tag="CYME_CMO026C"
                     /db_xref="GeneID:16995507"
     mRNA            <68273..>68863
                     /locus_tag="CYME_CMO026C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537400.1"
                     /db_xref="GeneID:16995507"
     CDS             68273..68863
                     /locus_tag="CYME_CMO026C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537457.1"
                     /db_xref="GeneID:16995507"
                     /translation="MDLSSPQETLRPRYNAVAWSVLLVRRPRTLLATAGQAALRPALM
                     VRGFNVRVGIVLHQLPDAPIRARNYLYCLSEKQPDSKKPTDRSRRDASQPVPRDQSVE
                     QRLAREATQHGHGSEEEAPVFDETAARAAEILELLEGLRAFRQRIIDDAQAMAKQIRT
                     PKEQVDASLAKHPDIAKIDASIRRLEAELKAISDNV"
     gene            complement(<69150..>70229)
                     /locus_tag="CYME_CMO027C"
                     /db_xref="GeneID:16995508"
     mRNA            complement(<69150..>70229)
                     /locus_tag="CYME_CMO027C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537401.1"
                     /db_xref="GeneID:16995508"
     CDS             complement(69150..70229)
                     /locus_tag="CYME_CMO027C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537458.1"
                     /db_xref="GeneID:16995508"
                     /translation="MLKRKLGTRLFVGPTLVLVQQRPTPANTCARRLCCKSREPAARR
                     HCKVTLALSEHPLRQTLFSGDMRTSTASGNNPARQTVQLVHRLQRLFVSIRSAVRAPL
                     LSRTDGTSDLERLRPQQSVLASKERGELHVSCLSSTACSPSNTDDTAGHDCDIGRTRE
                     ADQRWGVAAPLTEVTAASSEFQYRSSEEQLQSSGRAHRSRVVLLCGIPGSGKSTFAKL
                     VLKHGGENWVRVSQDDLGSRQECERMMQEALTSDPPRHVIVDRCNVDSAQRAVWIAIA
                     AQANAYPVGVLVFPVPLDECIRRVLLRGPNHPTLFESTENDVVKVVTSFAGKWENPSP
                     GEGIGFCRIVASPADEERVMAELLC"
     gene            <71710..>72573
                     /locus_tag="CYME_CMO028C"
                     /db_xref="GeneID:16995522"
     mRNA            <71710..>72573
                     /locus_tag="CYME_CMO028C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537402.1"
                     /db_xref="GeneID:16995522"
     CDS             71710..72573
                     /locus_tag="CYME_CMO028C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537459.1"
                     /db_xref="GeneID:16995522"
                     /translation="MFLFASTFVCQRAWPRARFRNAPCRRVTLDARGDSVSAGAEQPT
                     RRPEAPAKRRGSRFLIKVRKSVRTTRKHGSVIPADVWLPPELTSDVLPCGDSKLLDNE
                     AHLPALVLNADYRPLSYLPLSLWSWQEAIKASLSGRVRVVAEYDKIIRAPSMSMRLPA
                     VVCLKRFQQSTVSRAAFTRFNVFLRDSFQCQYCGTSGPITDLTFDHVVPRSRGGKTCW
                     RNVVTCCTACNRRKGGKLPHEIPNMTLQRQPYVPLYCELQEVARKFPPRFLHETWADY
                     LFWDVPLQRDE"
     gene            complement(<74894..>75733)
                     /locus_tag="CYME_CMO029C"
                     /db_xref="GeneID:16995523"
     mRNA            complement(<74894..>75733)
                     /locus_tag="CYME_CMO029C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537403.1"
                     /db_xref="GeneID:16995523"
     CDS             complement(74894..75733)
                     /locus_tag="CYME_CMO029C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537460.1"
                     /db_xref="GeneID:16995523"
                     /translation="MAFIHALPVRPKHTPIQAIFPRAQRRHFINKGTLCVLMNDTTSN
                     QTATLFSVPVSNFSARVRYIIYDNNLDIKIEPPGSYLKTSEYRQRVHKYGKFPALVLP
                     TGESIWESDVIVEYLLDKYGLGERYRPQTPEKRARARLYVRVHDLYLTTNQAVLYRPT
                     NTPAEREHGLSQIELHLDTLETMLTEDNTRRHAVETQMVTLADIALAPTLAMYAAIMP
                     KWHHRPVFRNRPRLQQLLEGFRASSETAARVLEEIEGGVHAWEQSGRFEQMGLSPVKV
                     PNA"
     gene            <77511..>78287
                     /locus_tag="CYME_CMO030C"
                     /db_xref="GeneID:16995512"
     mRNA            <77511..>78287
                     /locus_tag="CYME_CMO030C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537404.1"
                     /db_xref="GeneID:16995512"
     CDS             77511..78287
                     /locus_tag="CYME_CMO030C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537461.1"
                     /db_xref="GeneID:16995512"
                     /translation="MDTTASYHVLLVLLSVETFLFFAVIAQTAVQEPLAHGKIARFFG
                     LAFLSESVAGLALAVTPLLRGSVFLLDLFALIAVVAIWAGAAVAIIGAAHVVFPEDAR
                     REVRVALVVLFAFVFAFGTARLYVAVSAATPALPLWSTDSLRVSVAVSQGAMASVGAA
                     CVLRALARPKIRGRNGASVLLLGTLVCLVGSVIWTWLLGKCELSQTLDKEDVRCPLPP
                     VFDHNALYCLFLIAGNILSAEGVLRLMAVGDGALNYAEIP"
     misc_feature    complement(78209..79651)
                     /note="possible transcribed region"
     gene            <79962..>81194
                     /locus_tag="CYME_CMO032C"
                     /db_xref="GeneID:16995509"
     mRNA            <79962..>81194
                     /locus_tag="CYME_CMO032C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537405.1"
                     /db_xref="GeneID:16995509"
     CDS             79962..81194
                     /locus_tag="CYME_CMO032C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537462.1"
                     /db_xref="GeneID:16995509"
                     /translation="MQPGTEDDPLPYSEAVVEPLTLEYEAPEHDTMLGNGEAARAGSA
                     GTPSRPAHPEDAVSFRFDPKVWEQVHLKDESNLIFYEGGLDDENDGTAGGFDEIQEQF
                     RESEEIQASGAHTQSNSAEHSCMSAPFYFLWGIMLRILQPYFEIDSSDVMLRLSRSFV
                     PIRPLLAGEHHQMNMVLRLHKIWTRIRQFSQARSPETAETNATIDSDISDDEWTYSRR
                     ADLYGPFWIATTLILLLSLSGTVSHLLHRASVHAVQTAKASTAVKPVWKTSEIIRLTV
                     SAAIIYGYELLAATVLWALRLVYRSQGQVPPWTTMLCVVGYAQGPLVPASLLALFPYQ
                     FFQFVVMVVAFALSVGFLARNLLIEPLAGADTSLDAGEATITEPIWLLKQRALVPALV
                     AGLLQIGFAIWCVLFIIL"
     misc_feature    complement(80815..82495)
                     /note="possible transcribed region"
     gene            <82295..>84787
                     /locus_tag="CYME_CMO034C"
                     /db_xref="GeneID:16995511"
     mRNA            <82295..>84787
                     /locus_tag="CYME_CMO034C"
                     /product="similar to postmeiotic segregation increased 2"
                     /transcript_id="XM_005537406.1"
                     /db_xref="GeneID:16995511"
     CDS             82295..84787
                     /locus_tag="CYME_CMO034C"
                     /codon_start=1
                     /product="similar to postmeiotic segregation increased 2"
                     /protein_id="XP_005537463.1"
                     /db_xref="GeneID:16995511"
                     /translation="MLQTLPPEVVRHLTSAPVVTSLASVTKELVENALDAEATQISVF
                     LSGYGLEFIEVSDDGCGIAKQDLEQLAQLHTTSKLRAFAELSSISTYGFRGQALASLA
                     MTGRLEISSRPRDRDASAVPGVAFRARYQAGRRISDLEPEARPYGTTVRVYELFASMP
                     VRRREAESQKKRELQKAIQILQTYALAAPTVRFSVQWTPKGRERPTLCLATQGKCTLR
                     SCFSLLYGAEQLTKLVDLAVIVKWPTPLPGACTEPELHMRGLLSRCYPAAGRSAPDRQ
                     MLLLQAKRPVQWTRMRRMLDSEFRQRTCTSLYPVYVLAIDLPPDTFDVNASPDKTEVL
                     IHDDAAVVASVREALRTSWTQVADVRTRAPFSVQTGKCADARAKAPDDHLRAAQLANQ
                     LEWSVTTEQKRDTSQRLVTDARPACVKESATSTLAASETTLSSSGMSAGVCVASRAEV
                     EAASFIVDHVKPHTTEQPFRESLQASSAAVAATTGAHEQWETAEPLAQRWTHHNAEAA
                     SSGTESSGTIHRSADTILSGVSGVNSHEHDRVVARASGASMERWLAVHVVIDPFQWTS
                     SANISRSSGCARDADLPHVEPIIRARVGERLQLACLLEASTPNTTEDCVTESSTEADR
                     ELEQRFHKHWFEEMRIIGQFNCGFILATYGSDLFIIDQHAADEKYIYESLARALRPRT
                     QSMLQPLSIPASASEELTLWEQRENLAALGFELEFRWSAPPTERVWMLGAPTVCQTVL
                     EATDLLEIAHQAPLTGRVADLLRASRVKLLLATRACRRAVMIGMPLDRTHMQSIVARL
                     ATLEQPWNCPHGRPTMRHLVRVSEIGFRRAVT"
     gene            complement(84973..86920)
                     /locus_tag="CYME_CMO035T"
                     /db_xref="GeneID:16995524"
     misc_RNA        complement(84973..86920)
                     /locus_tag="CYME_CMO035T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461490.1"
                     /db_xref="GeneID:16995524"
     gene            <87295..>89406
                     /locus_tag="CYME_CMO036C"
                     /db_xref="GeneID:16995525"
     mRNA            <87295..>89406
                     /locus_tag="CYME_CMO036C"
                     /product="probable ATP dependent RNA helicase"
                     /transcript_id="XM_005537407.1"
                     /db_xref="GeneID:16995525"
     CDS             87295..89406
                     /locus_tag="CYME_CMO036C"
                     /codon_start=1
                     /product="probable ATP dependent RNA helicase"
                     /protein_id="XP_005537464.1"
                     /db_xref="GeneID:16995525"
                     /translation="MFDTENGIVYTIEEADPEQLSSTIEQESDASSASELSFAAEFFD
                     WTGPEALVENAASRRRSESEQARVDRDPRHETPEHRANHHVTDSGEGTKPDSNGTDAH
                     TALATHDRLKPLEKRVHAASATKHSSPEAKVDTVRQSESWAALALSPRMLRVVESLGW
                     MQPTPIQAQAIPVALAGRDVLGSAVTGSGKTAAFLIPIIERLYRAQRADGVRFAADAS
                     QTAAIRVLIVLPTRELAVQCHAVLEAICDRTARESARRMKQGVAKFVGTPEQTRLRSV
                     LLVGGLALKPQELALRHVPDIIIGTPGRIIDHARNAPNFTLDDVEILVLDEADRLLQM
                     GFMDELREVVRLCAASAPYRQTMLFSATLDAGVEELARFALAPDRVVTVRVDATFDLV
                     GTLVQEFVKLQMPEVLVEPAQDTRDTLTHAEQVVQTERAALLLALCSRSFTRRVIVFF
                     ARKRTAHLFKIIFDLVGLRAAELHGNLTQAQRLDALEAFRTCTNADFLLCTDLAARGL
                     DIHGVETVLNYELPKDIREYVHRVGRTARAGKHGRAVSIFQQTDRKERHLLRRLREQA
                     RRYRVDALRGDAPVPAPVLLERRIPATVIREWRDRLHSLLDSVREKLRQEREHRELER
                     AERLERKAHNLLIHEQEIYARPPRTWFQSKAERKRAQMVDQEPASKERSERSNSHKHD
                     KVRKRKLVTATNRGAHNRSRM"
     gene            <90918..>94085
                     /locus_tag="CYME_CMO037C"
                     /db_xref="GeneID:16995526"
     mRNA            <90918..>94085
                     /locus_tag="CYME_CMO037C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537408.1"
                     /db_xref="GeneID:16995526"
     CDS             90918..94085
                     /locus_tag="CYME_CMO037C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537465.1"
                     /db_xref="GeneID:16995526"
                     /translation="MDADFPEWEAPAVSLFDCLLQGCHENPNGRCVRCENSVGCPVAS
                     VSSDGWLAYAQVRAYVDRLIAYLQSEPLKLTPGKRVAVYSVFRWEVSIVLSAASFLQL
                     PVVLIDAHEDVSFARALLNNQCVSLLFLGQEQNCEELQSYAGRCLLLGAAALDLPSQP
                     PTLFSVLQVDTAPEVVTSGQPRRKDSVALIMPTAGMTGPRRVICVTEEQLAQAAHALA
                     PLLQYTSSDVVCFLTYSIFHPFFIVHILLLFRAGGAFGAELQTLDNIRKMRTTVLVGP
                     GAILSTFYELLRKEGEKLRGLARRIFALLVEQPPLNQWDPKAALKSTRTGIARSVMRS
                     IRDLFVPQYRLTVSGISRLAEDTRLCLERLLLEPVLDVYGPSEWAGVCLARTRKREHD
                     EWFCILSSPFNRLGRLSTLMRQGEHTAYGELHLHINGKWTATGDLFRFIMNRGPSDPE
                     APQWRALAFVDRISKIVLCAEHGANELDTSLVEPIELSPHEKQPPFLSLSLMERASQR
                     SAFVRQCWISFEAPQRLMVLLVPVRDMVWKWLRMRQSANGTALVPSRDALSVEPMRDV
                     CNDALFQEAVVCDLRRVLVNCRAIRDEWFDALSWEIYFEPQLDAGCFDLGFTPRNRLL
                     TPSFELRTKSLRAYYGKELGIPVPRASLERGALLAEQLDEEGRLSESSNSDEFESDIG
                     DEPETATASSLQRWLLTLWSALRADLVDPVLNADEECIEHRSFWGRIFHRQLVTSDSA
                     ERATTRSTRETSAGEAASTSIPRTDPDPDGASKGPAPAQEIGWIARFWRSAGDPGLSE
                     RPPVHLPRFASLDADLPDGACLPLLHSTRNTGRRQRQKAHDGRLRSRDGGAASGHSRW
                     RLGRLWNTLVHESPDHDCVDAGAATQVDRGAGDGADMVGGLTASGASEAAAQMPRWRR
                     WLHVPRVTASGVCGAPQMNEHMRTIRKGRKRNRYDHHSAESLSISDSEIARRFQRPWR
                     KFPVQFHAAAAGRIRQWWTGRDSSDRHVNASVTSIREHSDDHCIASASNATEQGVCTE
                     TSSNVSAVDSLSENYQGSMRIQGLP"
     misc_feature    complement(94230..95879)
                     /note="possible transcribed region"
     gene            95362..97719
                     /locus_tag="CYME_CMO039T"
                     /db_xref="GeneID:16995575"
     misc_RNA        95362..97719
                     /locus_tag="CYME_CMO039T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461491.1"
                     /db_xref="GeneID:16995575"
     gene            complement(<100876..>102114)
                     /locus_tag="CYME_CMO040C"
                     /db_xref="GeneID:16995565"
     mRNA            complement(<100876..>102114)
                     /locus_tag="CYME_CMO040C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537409.1"
                     /db_xref="GeneID:16995565"
     CDS             complement(100876..102114)
                     /locus_tag="CYME_CMO040C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537466.1"
                     /db_xref="GeneID:16995565"
                     /translation="MSVWETNLKKLELKRIIREPHNEDIRALERNTVQATAHNLIASL
                     SSEYCFVYDNEHLGPNLDLCVAFRSSDGDEFTCCCFVLPVTTREQRSWLERWVPASER
                     GKATLETLVVIGCRSGRLRVLSIAEASEILIISHEAGKPLSAAEACTAVDLHAVADAL
                     GIRAVGAHPSREGVFASASGNGVCVWQLLGGHRHVQLIGRVHLERPTALALSPEDALF
                     VARTKPSEIRVWQLRFEESTWTGPAEAPGAESKVLQGRLAELDGGRLLAAVASTVEVV
                     RCGPRGLVVKTSDSLRYLDYEKGTDIWNQSGRGERVIGLRGSGGGCGAIDVALDEDHI
                     GTAVDPGLVCVATDAGVIHVYRLEDALRVASVVVPRLRHQMGSCVFGSRGESLIAAHA
                     QLIYRLQAVSDDAPASEMNR"
     misc_feature    complement(103179..104640)
                     /note="possible transcribed region"
     gene            <103614..>104435
                     /locus_tag="CYME_CMO042C"
                     /db_xref="GeneID:16995567"
     mRNA            <103614..>104435
                     /locus_tag="CYME_CMO042C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537410.1"
                     /db_xref="GeneID:16995567"
     CDS             103614..104435
                     /locus_tag="CYME_CMO042C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537467.1"
                     /db_xref="GeneID:16995567"
                     /translation="MFVGTGTARFFATKAQKAANAGQQHGRFTGYDHVVLVNRVNAPR
                     RPRGNTRNASSALRIQQPLSLSANLFRNEKKNDWPRCFPQVLCGLLVALQLQSSDCTV
                     FASANPTENAGTAPLEAEPYLKQGRPVPATTEPLTLGHAADVEHRVTRDATGTLIPLD
                     IVQLRAPRDVRSPPVRSRDAVLVRYVAFLEDGTVIEDKRNGKTPVFFRAGTATLPAAV
                     DLGVEGMRVGEQRRVRVRAVDNFHGVNLRLGAAAVVPRESTLYYDIELVGINPYS"
     gene            complement(<106180..>108228)
                     /locus_tag="CYME_CMO043C"
                     /db_xref="GeneID:16995558"
     mRNA            complement(<106180..>108228)
                     /locus_tag="CYME_CMO043C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537411.1"
                     /db_xref="GeneID:16995558"
     CDS             complement(106180..108228)
                     /locus_tag="CYME_CMO043C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537468.1"
                     /db_xref="GeneID:16995558"
                     /translation="MQVFQNGSLTPTAQLVCGGYAIWRCFRDQPGVRSSRERHVAWKS
                     YVDLVEQVSAQSTSAHGLEASDCGSSEEARVLASLPALGGIWRLAQALLFCDEPLENV
                     LSIDECLHQWYAGVSTAEPEHPESAPSERSGTLDWRAVHRACAQGRPSAALELLGAAL
                     SKSRNDRAGGDTQLLDATSVLELVAAALHEAPETLTAPNWRQWQEACAVAAETLSQLG
                     ANGRNIDGLHEANQLLKCLSGEEEFSLDVVRNWADDFIAHVLYGRGSYEDERSFAALS
                     SKAAKSACLRFPLASPAEYLDTIREGSLEPAAVLYWISNAIAMGHFEEAIVALTLFPF
                     GIWHAVHMADTCSPPSGMTSIAGPLMQRYADTLMERTEFTDYWRMTLRYRTSFAAANA
                     VSGMLLALIPSSLHSLREQRLFEAEAIRMMHRAGVATLEREALGDALHAARARLLEAN
                     AIWPAAFYEWVLLGQKEKALRCCTAQMRRLEIGDSVRLPDMMWFLAQKQSLLDAFEAA
                     LQDRPAPASVGQQRRQILAALAFLPDYAQFYELILCKLRGIFLSDEQILEMLQRASRM
                     FSSTDLPACLRRQLLEIVIQHILPQCAARNVSPGHEITYALFDTCLWMSTDVHTSASV
                     TESSSEASACVAPESRMDDASRHGAAANDHEVDQPSIRHDWLSALAQWNALWVQAFTA
                     "
     gene            <108643..>110469
                     /locus_tag="CYME_CMO044C"
                     /db_xref="GeneID:16995559"
     mRNA            <108643..>110469
                     /locus_tag="CYME_CMO044C"
                     /product="lysine--tRNA ligase class II, chloroplast or
                     mitochondrial"
                     /transcript_id="XM_005537412.1"
                     /db_xref="GeneID:16995559"
     CDS             108643..110469
                     /locus_tag="CYME_CMO044C"
                     /codon_start=1
                     /product="lysine--tRNA ligase class II, chloroplast or
                     mitochondrial"
                     /protein_id="XP_005537469.1"
                     /db_xref="GeneID:16995559"
                     /translation="MRPRLLFLSSLPQRYWGRFTNPSFCLHEASVRSLRRHGGKQGHS
                     PSLELLASDAAPEHSAKVQAATASSAAASPAPKNARGRQNPNIASPESGATANNLRVL
                     RSARLEKVHAMRQAGVEPYAYRFEVSHSTQDLHQLFGDVEPGTIRDDVHVSIAGRIMN
                     RRIFGKLAFFTLQDSSGTIQLYLDKQRITEHMQNRIPESFSRLKQWIDAGDIIGVTGS
                     IRRTEKGELSVYVKEWTMLTKSLRPLPDKWHGLTDIEKRYRQRHMDLIVNPAVRDVFR
                     KRAQITAAIRRFLDTHGFLEIETPALHQQAGGAEARPFVTHHNALDMDLYLRIATELH
                     LKRLVVGGFDRVYEMGRIFRNEGISTRHNPEFTSIEIYQAYADYGDMMRLMEDLVVQV
                     LRDVHQGVLQVRYQDTELDFSPPWRRVSLFQMLQERTGMDWRSTALSLEEARALAHKH
                     GCPAGDARSIAEVAVAVFESLCESDLVQPTFVVDHPRETSPLAKPHRSESGLVERFEV
                     YCAGRELANAFSELTDPVDQRERFVEQSARKAAGDLEACDVDESFLAALETGMPPTGG
                     LGIGIDRLVMLLTNAPSIRDVIAFPLLRPTLEYPNDGSDDAE"
     gene            complement(<111624..>113204)
                     /locus_tag="CYME_CMO045C"
                     /db_xref="GeneID:16995554"
     mRNA            complement(<111624..>113204)
                     /locus_tag="CYME_CMO045C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537413.1"
                     /db_xref="GeneID:16995554"
     CDS             complement(111624..113204)
                     /locus_tag="CYME_CMO045C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537470.1"
                     /db_xref="GeneID:16995554"
                     /translation="MRPMFCYTTPSGMHAAYHRSRGLEKPTCRVHYGLDRSCMERHLY
                     GGKAPSARLLMDALHQRRFWFQVKINDLGRRRKYSSKSAATQSCHTESDHLRTADQTS
                     YPAAQAREEVPIDHSVRVGGESSRAGRSEIIRGATPLRCEEHQAKASPRTEATVPGAE
                     EARLLHKKEPSNSKAPEGIVDDLNSDRMKESPLLSSSALPDEPFGMGTLFDGATAPMQ
                     RCLEEITGNSLAQEETNAHTDGTSAEKTADLVLTHPFDETNTERDQDLVQPVDGLADS
                     DVVLNGPSTAAEAASETELAPDDSNHSLEAMPHDETESEHASAIEHQTLGSMATDSDA
                     KESTEHEPTRDELANAHAQEPGTLERMPRRPLGRPRRISDVFRVPTGQSTTKRAPSEP
                     AKVTSVELGRQRLDILYAIRRGWRPGKSESEDGATTADVEISAEDLENLSCPEISMDE
                     NTVAWGASPTERTSDRAAFVDPAEAGGRATSTMGIIGLSRLIRYRMRLWFLHMLRMVF
                     TVLNMLRSYLRTLRKPRT"
     gene            <116083..>128922
                     /locus_tag="CYME_CMO046C"
                     /db_xref="GeneID:16995555"
     mRNA            <116083..>128922
                     /locus_tag="CYME_CMO046C"
                     /product="similar to PCAF histone acetylase complex
                     subunit"
                     /transcript_id="XM_005537414.1"
                     /db_xref="GeneID:16995555"
     CDS             116083..128922
                     /locus_tag="CYME_CMO046C"
                     /codon_start=1
                     /product="similar to PCAF histone acetylase complex
                     subunit"
                     /protein_id="XP_005537471.1"
                     /db_xref="GeneID:16995555"
                     /translation="MPSSPTPGELRARLEDPQLTSAERLKLLIELRENIEWFQSTDYQ
                     QFLDQLIPCFEQILTTLTRPQLEENAEQALRRTVLEVLSRLPHGEALRPHARRLLQMC
                     QYVLDVDDAEPNAVLALQIMFECHKAYRPQLAAAIPPFLDFVLRIYGVFEWRESDDDS
                     LVAEDTGQQDTYLEPGLEQDGSVEAASRNRPTNVRYAPALRSYRTVRECPPLFMYLSQ
                     HYPALIEPRLDELLAVMVRAIEIQVPPTSPARALPIYHDFITAQMKTVSFISFLLRQF
                     ESRMLQYAERVPRSVVNLLLNCPDSAVSIRKELLIASRHLLATEFRRGFFLQTDLLLD
                     EKVLIGTSRAAYETLRPLAYSFLAELVHFVRLEVTLPQLSRIIYLFSTNVHDASLSFS
                     MQATSIRLLLNLIEGIMHRREDLNTRGRQLLERIFETIVTKLMEVAEVVPSLLVSTGA
                     ADGNDAEDKANGSASSQRASSPIPEPSASTETGAMRPSAVPDEKSQEERSKEVQECRQ
                     LVRTLVLGLKTIVWSMSNAFGDSRTRGLTEWECILVSRMLPAARTCFQLYKFGEPAEQ
                     KEILDQFAQVFTVMTPRNFQDIIGGRLPQLLAFMVEHQTALSIPQHFLANTSTSRFFA
                     DILITFLTEHLEQVVSDDAARASVLLRLFKIMFASVTLFADNEPVLKPHLGTIVRRCL
                     ELAATAENPTNALQVLRALFKSLAGGRFELLYREFVPMLYYLLHSLERLMQGPLGESH
                     GLLLIELCLTAPARPSTIFPYLRMHMRPLVRGLDSESELTSLSFRTFEFWIDTLHPEV
                     LERLMQAVQPELERALWRYLSPTSPFSAQAVRILGKLGGLNRKTPRELTPLPWQQPVQ
                     AIHAALAWCDRAEPLTVALDEVINAAVDAVLFQASYKVAAYTLLQQVMIAALSSALPP
                     QIKGCPADLLPASVYTMTSAFPRLQVSKTIYTRMLTALFFASGDDALQQTRNAVEFAR
                     QLCDYFCRIWMAPVLMEKSTLSALEAAALNAHRTPPENITEWTRFPAAVTIDCFLDAL
                     VEAAVLQQKTLDLAAAAKDLNLFALSRCVELFKGDFRGPQRPVVPASDAAEVAAPDSK
                     PLTAAAKGARATEAPSAETAATTAVDAPEHESVDRLRDDHRGADTATCVDEEIAPPLH
                     SVAGASRLTEQLALLVERISHLGYRERWQDRLSCAMLLAGIIEQLPTVVFLDRSYCLY
                     EARLVRVLLQVLKGCAQEGMASRKPAPLVRQTLETLLRRCHEPTSPAWALEDVTSSTI
                     PETDRPSKTNASTPRARCGDVVACLVFDLASEHQAVRETVHASLAQLLRYGVGQNMAE
                     VLALAQTQILRPLLSRRVRTLHYSSQVGHVDCLHYCLENGIIRPFIDQETSLLRTSLV
                     AAMEIFEDPINTRLGEADALMLNRLLENRFVDQETITAIVMLREKVLQFLALCLRQID
                     QLVHTPNEDIRSLYARLVACFFRGVESRHEAVTRAAKHGLRVFTERSRQLPRGILSSN
                     LRPILQNLSDTNKLSLPYAQTLANVLEVLSNWFNVQLGERLVEHLMNLRAGNPRNPSL
                     LAARIIDLFHLLPPAASRFLDRLIAIVLSFEDEMGPADTGAGHHGLQSRWAGSMSPYR
                     APLLRYLEKHANLAIGYFLERIRFANYALLFQSLLRAHNAENLRRELANDVSRFIAAT
                     FDRGHLLQGLLIVDALESFQAGWIATQRPIYNIALQIWQSAERLERLRREETLPVDQL
                     AESSLLAHVILAYCAVHHGEVDGLYALLSIFSLRTLRDFSFVRRFLTETVAQSYPILY
                     RKKIVERFLERYLDPELSDEVKMYALLYLVIPILRQAFRAGEGLAILDAVTLEVLVKR
                     LFTSTPPASEALTDASADGGGGGDTAPMLASPAESDVLGEALLQLSTLLIEEMPIELV
                     QYRREIIRFGWNYLKRDDSIAKPWAFLNVARFFEAYQAPEKIVLQVFVALLRASQSEQ
                     RALVRQALRIVTSILPSRLPATLGKARHAPWIRFTKKILVEESYSALHLAHIWSLVID
                     KQELFFPGYASLMPHMVNSLPRLVSGSVSAREHRRLALELAGLVVAWQQRLLQVGNNA
                     SISSNAPSENGESANASPQTGSAPMASPDVARRLEDLSAVTEVVLQFLIRLPFLVSEP
                     GEHTELFTRARSLLVKAQRVWNHLGSERSPIAQMSCLDKLLDNLAATAAASPTTATGQ
                     TSASGTNTAAMPGAPAPAQSHSTTSTISTSTTSAGAASAAHHRTANAGTASATVAPPN
                     NPRDAPASRAREALARSRRLVLEHIVELCELFLDWQGIRWILANSNSLRKLVRPVLAA
                     GMLPLAYRFALLLCKLWLQIGDALRTPESTEDQRANLETVRRDLEQALFEALDIHSDT
                     ATLHRSLLLAQTLDPERFTTKHVELIVRILQILMRECLAGIQTNRRMVLIPAPASGDR
                     PQASSSRAQLGTSAGRSSHPPEASVTGSGTGASWPAATGTVTKTGTFSTMTRLAQVAG
                     ESAPLGSVADPTASVKETKSAHVASGDEHLPAKGGFEYPGVANPLLVCLEILERLFHG
                     LADYRRSFLQMLWVLLDKCCYSEVLMHVVRVLSQWILMDADDPGAFLQPKEKVHFLVK
                     MTVFERITGAEAHLEAFLPLVLRLLAEPCHALPRDWLPRLERPFMIGLRASNPQLRQA
                     FFQLLDESIIRNPVDRLYYIFEYQSWESLADSLWIRQATALLLALVQVPGSRIELTPD
                     CVRLGCVSYRSGTAADDAMTWEVSRPGADAPTDAADAPRETLTKGAQRSPTDDAYVEA
                     FAGAWTALDGHVDTNAFFEALHELLHHDVSTLQSLWTQLFGAVWSLLSDREERLAMQD
                     ALIALLCRDYLLTQCRWRVNVVQIILDAATKCAPQVVIPPQLALHLATHWNAWHIALT
                     YLERRSRSSTLGVARHSDFVFDSLPDGHEFAGILDAKAELYRQLNEYDLYIGLWKRRA
                     MDSRTLLALSLEQQGHLPAAQNLYYDAMTNTESRVAVTEAEAALWEDRWLHCAEELNQ
                     WDALTEFSRTVMHPTLLHEALWRLPDWAALKELLMKMPPEDSPRLKILQSFVQLQENR
                     LDQVEPFISSGIRRALEEWQGLPENSSITAFEPSLVLFQQFVELSESASILQELNNAL
                     QNPTLLETHAENIRLVLAMWRDRQANHWDRLSDWNRLICWRNHVLTAVVHTLQGLRNR
                     SRVDIPQPLLCMGINETAWNVNCYARAARKQRLSEVCMQALQRMYPYSTMDVQDFFMK
                     TKEQAKAHLLLPSNDDVALRAGLVQLQHTNREYFNTRQKAYLSALEGEFYHRLGEFGA
                     ANQAFASSVREYGEHGGVWLRWARYCDQRGRLASAVHCYLQGIRFGSRQAREHLVSVF
                     RIVFALDGASSNAVADSSSLEAMQTEQAAATTTTTTTTTGTADAAAPASPLTTTSAPV
                     AVSSSSAAVSAGASAEVHASQTPSEGLGESRTDACDVCESFVGVLPVWIWVPWSHELI
                     SLLSLGRELKLLRHILLRVAGYYPEALFFQLRTFIEERRLLDRPTRMLCPRVDQIQLP
                     VMHPLRSQVASGIPPSSSSSSSTSSAKRNDPTTITAAAAAAATTAGADRSRKPESTTT
                     TTTTTLSAAGNEPSSVAASAGNTAGNSAQKDAENASASGANAASTGATPAPNQPRGSG
                     TSALPSVEQNILSMLQLPLGDTPFEIADTVLAFMVKQHPQLLVELETIARELSLRMKP
                     SAEEQVLHVLNALLHRCWSLPPLMHREVSSGMRSALEEVSKMCFGTGLAADEFHVPPT
                     LADLREAFEAELAPQTAKNFPKTIEPFVALLRKWRGIFSRRVQAMPETLRLERVSRKL
                     VDVRDSQLHVFGQLIQLAQEDGEPLPDLLVHIQSFSVDVQVVHHCGSSARGIAVTGSD
                     GRQYRFLVETALGASLQRSEDRVGHVCRFMNALFQRDSEARRRRLVALVPFSLPLSPQ
                     ARLVAYQENTLRIQHALQAFCECHGFDMDDTLVAFRDTCALRLESLGNVASRELALEY
                     RLDAFKRACLSLPDSVLAHWAAASLPDANSLFMVRKRFALSLGTSSLLLYLLGVGSRT
                     PMHIGIHGSTGDVVHLETHPIVVSRGQQVYIGFDEAVPFRLTRNIRSLIRLTGVEGPF
                     AGSIAATLNVVYRNWALLRDLMGIVYTMELFERTSRETLRVEDLAQAVEESLVRSWAR
                     VEPLPFSAAPLVQSPTAPAYAAATATATANGKRVPHPESSHGGDHDHDHDHDHEVTQT
                     LPPPVNTKANGLEFAERCGPATSVRDEPEGVARRVAELIANAGDPAHLSQMEPLWYPW
                     F"
     gene            <133494..>133919
                     /locus_tag="CYME_CMO047C"
                     /db_xref="GeneID:16995549"
     mRNA            <133494..>133919
                     /locus_tag="CYME_CMO047C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537415.1"
                     /db_xref="GeneID:16995549"
     CDS             133494..133919
                     /locus_tag="CYME_CMO047C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537472.1"
                     /db_xref="GeneID:16995549"
                     /translation="MHTLHLATKQPFGVHCVAVSPRGRRRQQQQQQQQYPQKRTAGVP
                     LAFGGGWEVTLGSLLSTLLALGLVLWAERRSCSACQGTGMAPCPSCRGTGWAPGARAQ
                     VCGRCDGVARVPCPRCAGRRPRQRQSSRRSTTFTTRGDK"
     gene            complement(<134238..>137018)
                     /locus_tag="CYME_CMO048C"
                     /db_xref="GeneID:16995550"
     mRNA            complement(<134238..>137018)
                     /locus_tag="CYME_CMO048C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537416.1"
                     /db_xref="GeneID:16995550"
     CDS             complement(134238..137018)
                     /locus_tag="CYME_CMO048C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537473.1"
                     /db_xref="GeneID:16995550"
                     /translation="MWFFPGQYLVQCIEKYGVGRVCESRVTTAVSESVKRSEDSYRTI
                     GRIALQEELQNDKALRSESRLLAALRLLLVTDESPLDLFPQLLQLTFGGYGSRVAGAA
                     RLLIRRCARAVAVVTTGSNDENELATQLSQHTSEIAEAFRKWSLQFEKRHHAREVGAL
                     QTAVALAVALPSSGIVDQLATLLLRGSCSVVGAPYSELEQASVTLDLDIASCSALVNV
                     WETDEEVQLGRCSLADSGWTADFRPRSNALYTSGTATDDAAATAGPLKLHSSPRESDA
                     FLEALLLGWRELQALRLEKLAQKPYPIPVHFIELAWNARSAAVRRHGVALVLQYTQLC
                     RRTSGEFNLPTRMRGLIRRAFCNRVLLARLAADPATQVYLVKILQCLVHIHQLNTTDV
                     KRSGAQYISLAQMRLSMLSTAQELSSERMAMTNRRLLAARVKAEMARNKSLSVDTGDH
                     IESEEFSDKEILTYVQELCDYSTGNRSILEMLAMLSRSLPWEKWMFLEANDPSWPFTN
                     EAALLSTQRQVDEAASADPTRDTASSNVLLELDDLLSGGQDERSDAEHTTEAPSDSGS
                     AQLQRRSQPNGDNAHKARRPLADTAMRRALYALASAESVRRLAALTLWLQVLRSVANA
                     TPAAMEWIRERPVYGALRERIVIAMNGDRSAAVRVAAAIAFIYMFHIEDTGQLSQLEE
                     RPYRYSELAEHLQPFLLSCAPRDAIFFLREGAFGYAKTSPQLARLHIQFCEQLASKYA
                     SSPLIVSWLRNGWLLCMETPSAARDVHASLLRCLRSPEAWLALAAAAFSRRFGVELLF
                     IAARDRPDDQDQRRLFSVSMSKLLRGLWEAALNSTLLDVRRECVLAFATVSALADEPF
                     LTQALESLPAIFKRPGLGISSVAKVAYDALSEILDARAAASLMLKHRGRVELAPALRK
                     CAARASDLWSVH"
     misc_feature    136861..138372
                     /note="possible transcribed region"
     misc_feature    139792..140505
                     /note="possible transcribed region"
     gene            complement(<141385..>142371)
                     /locus_tag="CYME_CMO051C"
                     /db_xref="GeneID:16995553"
     mRNA            complement(<141385..>142371)
                     /locus_tag="CYME_CMO051C"
                     /product="similar to Raf-related MAP kinase kinase kinase"
                     /transcript_id="XM_005537417.1"
                     /db_xref="GeneID:16995553"
     CDS             complement(141385..142371)
                     /locus_tag="CYME_CMO051C"
                     /codon_start=1
                     /product="similar to Raf-related MAP kinase kinase kinase"
                     /protein_id="XP_005537474.1"
                     /db_xref="GeneID:16995553"
                     /translation="MFFWKTGRETATEPAAGHPPPLIVVKPAELKVLARIGKGSFGEV
                     FKARWQDVHIVAVKVLHVSGKSKAEREHLLKQFQKEVRLLSTLHHPNIVRFLGVSDVS
                     VLPPYFICEYLNRGTLTNWIRKAEPHLQQDLAFARDAARALAFLHAQKPPIIHRDVKS
                     DNFLLADRDNGLVLKLSDFGLSRVMASLGEKMTPCGTIAYSAPEVIRCEAYSEKADVY
                     GFGIVLWQLMTHQIEPYPGCTPLQIQLKVSLQRARPQIPHRFVDLRIPRLMHLCWREQ
                     PDARPSMAGIAQLLERLCADLVDPNGHHRRQLHGVRFPHGGSRPPVEERHHM"
     misc_feature    143211..145824
                     /note="possible transcribed region"
     gene            complement(<144448..>147906)
                     /locus_tag="CYME_CMO053C"
                     /db_xref="GeneID:16995543"
     mRNA            complement(<144448..>147906)
                     /locus_tag="CYME_CMO053C"
                     /product="alpha,alpha-trehalose-phosphate synthase"
                     /transcript_id="XM_005537418.1"
                     /db_xref="GeneID:16995543"
     CDS             complement(144448..147906)
                     /locus_tag="CYME_CMO053C"
                     /codon_start=1
                     /product="alpha,alpha-trehalose-phosphate synthase"
                     /protein_id="XP_005537475.1"
                     /db_xref="GeneID:16995543"
                     /translation="MRLYRFVLVRLLVLALVVATWSARTVKKARALYQLCIVLAVQVL
                     NWSFCTKIRLRDGASSRSNCSSFASAEQVQRISLEFFLVTFPGPMNANNQSSDSVEDV
                     EEVVDFSSTDFELEDSSAGQSGAGSYTDVTAALYGRQIGGENPYRSTGAAYRRSHARS
                     HAVEQSSPLAGASVSPNHVTEDELLSRIQELQFQLMDLRESGNPPSGTNRTPLNLGTP
                     AESTPVAGELQQTGVTGSDDAASAALSRTISLPASAATQTVRETIAEGPSQFSQASGS
                     PADTESSAIQAFGGSDGTAAALDAAGTQARASTEHTGSWRVSRRAASLPRNTRTDMHS
                     EMQSEDESKPKLIIVSNRLPITMKRRNDGQYDYTMSSGGLVSALEGALDPRELPFIWV
                     GWPGGEVDPADETQVSTELLHRYGLVPVFLSAELHELYYNGFCNDVLWPLFHYVPLQV
                     VSQDGERKFDYKYWAAYTTANQRFAEAIMSVYRRGDSVWVQDYHLMLLPALLRRKLRH
                     STRIGFFLHTPFPSSEVYRILPVRREILEGVLAADLIGFHTFDYARHFLSVCTRILGL
                     ESSHKGVAFHGHFARVGIFPIGIDPNLFLRTMELALVKARIEELRNRFRGQKILIGVD
                     RLDYIKGVPHKLLAFETLLKKYPEWHEKVVLAQIAVPSRIEVEEYRKLIAYTNELVGR
                     INGRFGSVEYAPIMFINQSIPFEELCALYHVADVAVITSIRDGMNLVSYEYVMCQREK
                     CGVLILSEFAGSAQSLSGAIRVNPWNIEELAAAMHEALTMSDREREMKHWKLYRYVTT
                     HTASYWAQSFVSELQQLRSTQQQQQQPDSQQLLTVPEFMQQVARAQHRLFILGYEGSI
                     QEQQSVPELAAPSQMLWRLLMRLCSDGNNRVYLMSSRDRSHLMSWFEEVRAGGERSAN
                     ATLLSMGLIAEDGQFYRHPGRLTEWKVTTSATEANASETELKWKHEILPILNYYTERT
                     PGSFLEIKERSISWHYRDADPDYGVWQARELQAHLVDYCTTMPMEVIHQGGSAKRIDF
                     RASGGSRAAAVARVLQDLGSSWHLVFCLAADTRDDNEVYTLLRGYRRDTGDRIAWTCS
                     VGSGVVTAGSSAPTSAEFFLPDIGHARHVLREIVGLTVTSSKSRSRETERRRRSGSGT
                     QILAAD"
     gene            147978..149338
                     /locus_tag="CYME_CMO054T"
                     /db_xref="GeneID:16995544"
     misc_RNA        147978..149338
                     /locus_tag="CYME_CMO054T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461492.1"
                     /db_xref="GeneID:16995544"
     gene            <149675..>150649
                     /locus_tag="CYME_CMO055C"
                     /db_xref="GeneID:16995538"
     mRNA            <149675..>150649
                     /locus_tag="CYME_CMO055C"
                     /product="similar to UDP-sugar transporter"
                     /transcript_id="XM_005537419.1"
                     /db_xref="GeneID:16995538"
     CDS             149675..150649
                     /locus_tag="CYME_CMO055C"
                     /codon_start=1
                     /product="similar to UDP-sugar transporter"
                     /protein_id="XP_005537476.1"
                     /db_xref="GeneID:16995538"
                     /translation="MKAAAQNFTPNGANGGRTSLFRAVLAMAYYITAASGLTILNKSI
                     FSSFGFRYPLVLVEAQLLCTLGLFELLTRCHALQRPTWSFASASKMLPLVGSYLVMLL
                     SGMFGLQNTTLVIYNTLRRTTVAFVLVLEYFILNVFPTLPTLCCVLAMTLGATWAGLV
                     DSTFDLYGYVMIFVANVSSALYVVYARQVKQTSAWSNTDILYLNSLFSAPLVLGFVLW
                     RGELTQLYRMGIGAYPWSFYLIFALACLMGFIINHSIFYNTNTNSPLTQTISAQVKDV
                     ILLVASAPFDGTKAISENLVGILISLLGSVAYSIIKYREHRALTEERH"
     gene            complement(<151428..>154106)
                     /locus_tag="CYME_CMO056C"
                     /db_xref="GeneID:16995539"
     mRNA            complement(<151428..>154106)
                     /locus_tag="CYME_CMO056C"
                     /product="probable importin beta gene"
                     /transcript_id="XM_005537420.1"
                     /db_xref="GeneID:16995539"
     CDS             complement(151428..154106)
                     /locus_tag="CYME_CMO056C"
                     /codon_start=1
                     /product="probable importin beta gene"
                     /protein_id="XP_005537477.1"
                     /db_xref="GeneID:16995539"
                     /translation="MSQLAPLLLQAQSPDHQAREAAEAELFRLENDEYVRFVLDLVGL
                     LADGTAPIQARQLAGILLKNSLSGRFGSAKEGATERWLAQIGAAERKQVHCVLIQALG
                     TVQGGASVRRQAAQALAQVAVVELPHGQWPQLIEQLVQPLTQAGSSDALKHGCVEALG
                     YICEEPSVAGVIAHQSNLILTALVQGMRGDHETTPTEPPVPKENTLVRRAATTALFNA
                     LAFVAQNMENEVERDMIMRTVMMAAAEPADAELRRSAYECLVGIASQYYEKLACPSPS
                     NPPLTFIEMAFQLTCHAIQYDQEDVAVQAIEFWSSVADVEIKRLEEHQLLQNGTLETA
                     YLGIVEQAAPALIPLLTQCLIRRDEDEDVEGENWNRVLAASACVSLFAQVAPKATLEA
                     AVPFIREHLDVQRDWRSHEAALVAVGSIAVTFTSANDEQTTLEVFALPLRMLETAQNE
                     AVRDTAAWSLGRLIAHLVTHLNANVIEAALTALMRALADTPRVARSACYALTSLIETQ
                     HESAEALASISAATLTLANALWQTAQRDDADEWNLLASSYETLIALVQQSSPENARSL
                     AREYLPLTMHSLERALQESDAMLAASANQPAFQIEIQGLLCGLIQVFVQHLDPPLLEG
                     TTSRLVEMILQVLNRNRSVAVHEDALMALGSIASAVEHAFASYAARAMPFVLASVRNW
                     EAYHVCAVAIGTISDICRALEKRFEPFAAETVQVLLAALENTLLNRTVKPPILCCIGD
                     IALALEGAFEPYLDPCIAALQHAAWSTLQTPVLDDETNDWILEMRQCILDAYTGIING
                     LNAAQKAGLLIDRQQVEWVIRFCEQVSQEVVDDEDMLRAVVGVMGDIGQTFGPAAVSA
                     LRELGWLRPIVEKLCISGRRKSTRETATWAFGVLFS"
     misc_feature    complement(155771..157595)
                     /note="possible transcribed region"
     gene            <157321..>159126
                     /locus_tag="CYME_CMO058C"
                     /db_xref="GeneID:16995536"
     mRNA            <157321..>159126
                     /locus_tag="CYME_CMO058C"
                     /product="Rub1-activating enzyme E1 N subunit"
                     /transcript_id="XM_005537421.1"
                     /db_xref="GeneID:16995536"
     CDS             157321..159126
                     /locus_tag="CYME_CMO058C"
                     /codon_start=1
                     /product="Rub1-activating enzyme E1 N subunit"
                     /protein_id="XP_005537478.1"
                     /db_xref="GeneID:16995536"
                     /translation="MSMQADSTSERFARQLPIWGDYAQRLLQRARVVVIGGTSSAAEA
                     IKCLVLGGVGSILLADSARITPADTEGNFFLPPWTVGEWRATALLRSLVKLSPTTRFT
                     ARLGTAQTLVNEWTTLQPLSMVILTEGTTAEKQQLAKFCWYSAIPLFIVSVHGFGGSL
                     IPQFPERVFFRSTGLRPAVHTIEYLQAIRVMNPFNALAEWCTKRFWPLQQWSPSQLAA
                     IPWPVLVVLALQQANRSMRPENRDPRQSTNTDRATTSDGCRCTEAEEREHRHEPTEAG
                     GALTQAALPRERQSRGAGALLVPGCFSAVSGGSASEAVSSRIERALILLRKWEPSELT
                     SANWNMAVAALQKLRTASTDPDPRIIRESCSLRNRQLTRILEATRAFATQHGWPVFSD
                     LGELHGDPESVHELRRLYWEQAEHDIETIWRLVRADPMEAEAPDSISKELVREVCSNL
                     FFMKTWRTQPFYCLYEDAAVEKPQLAPPTTAAQRRAASLFLALIAHECCQELDRTQQL
                     VRRHGADAVLLEEAQRIARLWSWPPDLIDSVRLRHLAELFAEEEHPSVPIMLGSFAAQ
                     EAIKLVIQLFEPLTTILVYDGLADKADLLHPAVAS"
     gene            complement(<159880..>161715)
                     /locus_tag="CYME_CMO059C"
                     /db_xref="GeneID:16995537"
     mRNA            complement(<159880..>161715)
                     /locus_tag="CYME_CMO059C"
                     /product="unknown heatshock protein"
                     /transcript_id="XM_005537422.1"
                     /db_xref="GeneID:16995537"
     CDS             complement(159880..161715)
                     /locus_tag="CYME_CMO059C"
                     /codon_start=1
                     /product="unknown heatshock protein"
                     /protein_id="XP_005537479.1"
                     /db_xref="GeneID:16995537"
                     /translation="MRFFWWGSNNDQGQTPKAAQTFVMRCHYEVLGVPRDATAEEITR
                     AFRRAALRLHPDKNPDRPEEAAEAFKELRRAYEVLSDPHERKWYDDHREDILRGRDPL
                     EATQAPGTDTGAASRTERTVNRATELNIYEYFRSSAYNGYEDGERGFYHVYGAAFEQL
                     AREEVAAGGAQPPPFGSATADWPSVRRFYNFWENFVSAKTFAFADSWNPSEAPNREIR
                     RAIERDNRRERERARREFQALVRELVAFVKKRDRRVLKHKEEEARKEAEKLERQVQER
                     EQWERLRSLHAARLAAQLEEDIPNLEELLEHLEYAGISEEAPDVNQPHGASDAVQPTI
                     EGVQCLACKKYFKTFAQWENHEHSKKHRDCVRRFRKDLCLAKGEEVQVFRIMGQVEAT
                     GDEDHVYDVVNGDAHPNETMRQRASSERQKKLPDGDGSLCEGQCSEDEQAGVRPASSV
                     EASSESEQSVSRRHHADDDDDDEIEDDLAVPVGTRNAHSESDPKSATKEAERTRSMQD
                     AHMNGKSTNAGRDIEAGTHAAAHTDELRALGDRERSRPHRRRAETAKDRRRRRHLAAA
                     TAAQNAGAAAAGAPAAYKCQTCSELFTSRNALFRHIREQNHAQYR"
     misc_feature    complement(161737..163055)
                     /note="repetitive element"
     gene            complement(<164542..>166167)
                     /locus_tag="CYME_CMO061C"
                     /db_xref="GeneID:16995531"
     mRNA            complement(<164542..>166167)
                     /locus_tag="CYME_CMO061C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537423.1"
                     /db_xref="GeneID:16995531"
     CDS             complement(164542..166167)
                     /locus_tag="CYME_CMO061C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537480.1"
                     /db_xref="GeneID:16995531"
                     /translation="MVSGSEQATASAQNLEAPVRDILRETVRLRRVIIRGVERTRIDF
                     VQSLLDASLSEEQNRDSLPPESSRRSLTLEELLERASLATERLRLTECFRAVDILIDE
                     SAVPANGEPTAESVPCDALVTVREAPPFSLRIGTSTDTRTGETALELDGGFINFTGTG
                     DALHCQLGAGVGGSGFALSSLSSLAALVHPNRYLFAKQTATNHLVCGWRKPHPWGLLD
                     ALATASAESALLNRMDTSSYSEFQRSFEAGLQTRFGRFAYECSWRELGQVAPHASIRV
                     REQAGHSVKSSFKYTWTRDGRDDPLAPRQGTNAQWNCELAGLGGDPATRFIRSELSWQ
                     WNVPLTGADGSELVRNVDDSLAAGDAAPSPPERLMPPIVFSVGFQGGMIIPFHQALAA
                     MKDRKSEHRAGPRHALRQTRICDRFFVGGSANAFRGFRNRGLGPSADGDSIGGDVYYK
                     LGLHLGVPIVTSAVARSLGLQFHTFCAIGDCREWSDAVAWRQSWRMSAGLGLACCTSL
                     GRFEVNWARILRRGDGDRFDEGFSISFFQSFSP"
     gene            <167086..>167163
                     /locus_tag="CYME_CMO062C"
                     /db_xref="GeneID:16995532"
     mRNA            <167086..>167163
                     /locus_tag="CYME_CMO062C"
                     /product="60S ribosomal protein L41"
                     /transcript_id="XM_005537424.1"
                     /db_xref="GeneID:16995532"
     CDS             167086..167163
                     /locus_tag="CYME_CMO062C"
                     /codon_start=1
                     /product="60S ribosomal protein L41"
                     /protein_id="XP_005537481.1"
                     /db_xref="GeneID:16995532"
                     /translation="MRAKWKKKRMRRLKRKRRRMRQRSK"
     gene            complement(<167555..>168547)
                     /locus_tag="CYME_CMO063C"
                     /db_xref="GeneID:16995568"
     mRNA            complement(<167555..>168547)
                     /locus_tag="CYME_CMO063C"
                     /product="similar to yeast chromosome segregation protein
                     MLO2"
                     /transcript_id="XM_005537425.1"
                     /db_xref="GeneID:16995568"
     CDS             complement(167555..168547)
                     /locus_tag="CYME_CMO063C"
                     /codon_start=1
                     /product="similar to yeast chromosome segregation protein
                     MLO2"
                     /protein_id="XP_005537482.1"
                     /db_xref="GeneID:16995568"
                     /translation="MGSSEHALGSVEDSEDVVTLEDLVSAACPEHNWQCARERSQAER
                     AIAVCVCRTCTTRAALPEGPSLPSIVCQACADACHADHDTFALGNKHGLVCQCAPPHC
                     ALSDVAAAPLPTSQVWWLREHHNARNRFCVCDAEYQGEKDDTMHQCIGCEDWFHVKCL
                     GGLDATTGSTDGLLVCTACRRSCSPLALWVPAAKAAGSVSKPLCIAQAVLDSDTSTQS
                     EQMAPIFVTVEELEAVVCPCDACSSQRNAAHLEWLFDEEQAADGAVDVEMSPFPPSIQ
                     GKRVLELEYAYAWGAAKRRLYSLFQECARENRVVTERDVRLALAEIQREIQQTH"
     misc_feature    complement(168573..171127)
                     /note="repetitive element"
     gene            complement(170960..172500)
                     /locus_tag="CYME_CMO065T"
                     /db_xref="GeneID:16995569"
     misc_RNA        complement(170960..172500)
                     /locus_tag="CYME_CMO065T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461493.1"
                     /db_xref="GeneID:16995569"
     gene            <172702..>173424
                     /locus_tag="CYME_CMO066C"
                     /db_xref="GeneID:16995533"
     mRNA            <172702..>173424
                     /locus_tag="CYME_CMO066C"
                     /product="cytochrome b6/f complex iron-sulfur subunit
                     precursor"
                     /transcript_id="XM_005537426.1"
                     /db_xref="GeneID:16995533"
     CDS             172702..173424
                     /locus_tag="CYME_CMO066C"
                     /codon_start=1
                     /product="cytochrome b6/f complex iron-sulfur subunit
                     precursor"
                     /protein_id="XP_005537483.1"
                     /db_xref="GeneID:16995533"
                     /translation="MFVLTTNSLTFRTVPRCYPGTVERQHTTLGRKRVALRMTYALPS
                     TVDNARGGSGSGGDGGGSSGSDDDYIPDMGKRTLLSLILLGSVGLPASIMLSTYASYF
                     MPPSKNKSSGGVIAKDALGTPIKKEEYLKTHPPGSRDLVQGLNGEPTYLVVNDAGELE
                     TYALNAVCTHLGCVVPWYAAQNKFICPCHGSQYDRTGKVVRGPAPLPLALAHTKVDDD
                     GFVQIKPWKETDFRTGEKPWWK"
     misc_feature    complement(174063..174784)
                     /note="possible transcribed region"
     misc_feature    176559..178612
                     /note="repetitive element"
     gene            <178653..>180743
                     /locus_tag="CYME_CMO068C"
                     /db_xref="GeneID:16995833"
     mRNA            <178653..>180743
                     /locus_tag="CYME_CMO068C"
                     /product="similar to glycolipid transfer protein"
                     /transcript_id="XM_005537427.1"
                     /db_xref="GeneID:16995833"
     CDS             178653..180743
                     /locus_tag="CYME_CMO068C"
                     /codon_start=1
                     /product="similar to glycolipid transfer protein"
                     /protein_id="XP_005537484.1"
                     /db_xref="GeneID:16995833"
                     /translation="MPQWDKRARQRRSNQSRWRREPWETQEVASPLSWLCLPARVLAC
                     FGSPPSEELAESAQPPDDIVPWEDSETADSSSQSSFGGSDEGARQELACRTRAEKVDG
                     NGAGTENDQDEQLSVELDALRRRRSFSATSFHLPAVSRPTAAGSIVDIPSERPQTAQR
                     RERQRIVGKLALVGLGTQLLLLSLKLYRFESLSPAYLVFSVAFFVFSGGLAFLSLHYF
                     KMGRLPPFLDVAAKRREASHNRSCGTSPARSNTDSTMRTLSGAGSAFSTPTADRSPCT
                     PKSRIASRSREYAQSFQEKGDAQVVRTSFDSRSNRRIFSVLGVESSQSFCEQQGCSTR
                     MPSKSRPAAIRIDVTSERTAATSASDDAVSADNIAVSVREPSTLSDADADHTEHGIEK
                     RRGTFREKPGQRGTPGVRAAVAETQRRHVQRATETRSAGAPALPVPDASDQMRAGASL
                     EQRRRSREASSLSDDGTPPEVQIESLRIVESWEKMRITAKKEILAEDFCEGMLSLLSV
                     IDALGPAFRIIKIDIRNHVNGIHRSCTKHNCRTLQRLIDAESNRVSRWLNPSGIGDGT
                     EHVLWMKRAMQFVYMLLYMFLDGIDLDRCVYHAYRMTLRACHPYIVRKVAENLHRFVP
                     TRAGFLRRIHADEDFVLTQMRRFLKAIEPRLDIIVEVFNANQLEPHCRFSCAELRRLA
                     QHCAKYDIDEDMTQ"
     gene            complement(<181174..>181575)
                     /locus_tag="CYME_CMO069C"
                     /db_xref="GeneID:16995556"
     mRNA            complement(<181174..>181575)
                     /locus_tag="CYME_CMO069C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537428.1"
                     /db_xref="GeneID:16995556"
     CDS             complement(181174..181575)
                     /locus_tag="CYME_CMO069C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537485.1"
                     /db_xref="GeneID:16995556"
                     /translation="MSREGDSFWDQFRTFRQLKEYAAVGEVKSWKRGAFREFAREHPA
                     EANCLRQSRRAGNFAIATGLAGAVGSGAFAYKYGRSGLGATLAATAGFAAAALMGGHA
                     ASVYYWGFSPKVDPLDASILFLKWVKDHEQS"
     gene            <182724..>186596
                     /locus_tag="CYME_CMO070C"
                     /db_xref="GeneID:16995557"
     mRNA            <182724..>186596
                     /locus_tag="CYME_CMO070C"
                     /product="kinesin-related protein"
                     /transcript_id="XM_005537429.1"
                     /db_xref="GeneID:16995557"
     CDS             182724..186596
                     /locus_tag="CYME_CMO070C"
                     /codon_start=1
                     /product="kinesin-related protein"
                     /protein_id="XP_005537486.1"
                     /db_xref="GeneID:16995557"
                     /translation="MADDKENQPRRTLYPNESTKLFGEGHDVRECQSNGDASSETWVD
                     GCSDAIRVVLRVRPLTPAEHERSQRTCLELDSATNSVLIGTNNDLRRFTYDHVASPEV
                     DQAQMFYLVGRPIADSALDGYNGTVFAYGQTGSGKTYTMQGDVYTNKESEEKDNRGLM
                     PRLFEYIFAQIARREREHSATRYLVRCSYLEVYNEVVTDLLDPLSTNLAIREDFRNGV
                     SVEGLSEELVSNADDCLHVLERGLSNRHIGSTSMNRESSRSHSVFIMVIESETTNETR
                     VTTRRRSRLNLVDLAGSERQKLARTSGQTLREAGNINKSLSALGNVINALVDIANGKE
                     RHIHYRDSKLTFLLKDSLGGNTKTTMIATVSPSEQNFAETLSTLKFAQRAKYIKNKVV
                     VNEHLSSNNIAALQAEITRLRQLVTSAGIPVDADVSKVGWIVARQSVPGIDCEKMHLQ
                     RIGDLERLLLEALDRARYHQEQYQALERQNEALNTACRKRDKVLQQNKMILRLRDAAL
                     ERVRSSGEVYPTSEELLKEIEILREQIEHHPQVTSYAVENMRLQERIRVLESLVPADQ
                     DQSAFVKLERFVEQLRIAYQACCEEKNSLHKKLHELVYAELEPLDQAEKTHNRFIALE
                     LYKWREKERFEQQVEEARSECRQAMLKYEHAQRELETLRTKFKQVEQAYEEKRAACVE
                     METALSTLRLQHDKQTDIEQKILILSDELRESRERCQSLETDAAALEQECDRLRAVLN
                     DTKDRLQHTETEKEALEQQRNQLEKRLEQLEKDGQHMRQEAAERAQAMEAAHNAALTD
                     LESRLANVQMELESQLERNCALQDQIDQLQSETDYHRGRYQEAQRELANAQEQVKGLE
                     SKLAQSNATVEELRASQCQQAASHDEQLRSALRQQRSAETALQQERETLHRLQSDHEQ
                     LLARHETIQQELRESRDMIQRLRVGMQAAQHEAHAQQEARLALERRVTDLEQERAQGC
                     ERVATLEQDLTSVRQRADEASTEAAARISELIQELERKHSALTRAQLALAETVAKADL
                     ERKQLADEHAERLRARDRLLAQSEVETAKLRQGIENLQASVAEYRNEQRELHRLAAQE
                     RQQRKMLEDDWEKQRRQYARDMDALRKRLEAAESETRMRCDAQADAQREIACIRQQAE
                     AYQQKLAHAEKHRAQLENRLVMLERDKQRLVAENRHANEALIRAQAQFEALEREHRQT
                     SEALEKERVALASLQTEFEQLQIMCERLEEENTKLGGHHNLRQRIHHHIRVKEENAVL
                     RKERDRIAAELDACRARLAELENAPGTS"
     gene            complement(<186690..>187418)
                     /locus_tag="CYME_CMO071C"
                     /db_xref="GeneID:16995547"
     mRNA            complement(<186690..>187418)
                     /locus_tag="CYME_CMO071C"
                     /product="unknown flavoprotein"
                     /transcript_id="XM_005537430.1"
                     /db_xref="GeneID:16995547"
     CDS             complement(186690..187418)
                     /locus_tag="CYME_CMO071C"
                     /codon_start=1
                     /product="unknown flavoprotein"
                     /protein_id="XP_005537487.1"
                     /db_xref="GeneID:16995547"
                     /translation="MRAQAREANQNSDSTPSAPRSAVATTLQGRCVVVGVTGSVAALR
                     SLELVEALRARRANALVVATANGLRFLGQAAAEYSGAASALAPADLVAFFRERGVSLF
                     TDEDEWRSWAKIGDPVLHIEIRRQADILVVAPASANALAKLAYGICDNLLLCVARAWE
                     LGSKPVLVAPAMNTAMWHHPVTTEHLQLLVKRGTHIIEPTVKMLACGDTGVGAMASVD
                     TIVRAIEDQLTGAVSGAASSAPTT"
     gene            <189247..>190413
                     /locus_tag="CYME_CMO072C"
                     /db_xref="GeneID:16995548"
     mRNA            <189247..>190413
                     /locus_tag="CYME_CMO072C"
                     /product="unknown WD-40 protein"
                     /transcript_id="XM_005537431.1"
                     /db_xref="GeneID:16995548"
     CDS             189247..190413
                     /locus_tag="CYME_CMO072C"
                     /codon_start=1
                     /product="unknown WD-40 protein"
                     /protein_id="XP_005537488.1"
                     /db_xref="GeneID:16995548"
                     /translation="MSEAAILAEAIEKGSTFDEKLVTQHANWVQSMSFSPTARSLLTG
                     SNDGSVRVSDPRTGENRLELRGDFGGQVYASLVTPTSDAVVVACGDGKIYVYDTETVK
                     GPQKEVRLAARLRRTMEAHGSNAVLSLAITKDGSTLVSGSVGRDIVKHDMKSGEELGR
                     FVGHEGYVYSLAISRDNTLLASGSGDETVRVWNMKECTCIHTLTEHIGWVWGVDFHPK
                     RDILASGSNDRTICLWNPQTGELLQKIETFEHVYCLQFAPITGRFLLCGTSGEKPLRI
                     YDMEKNYAEYLINNTKQGGRVFAVAFAASESAFAAGSEDGNVVLYQPKMPSDSASTTR
                     RSAAAARPAAEPSPVEDAGAARAPSTKRTGGRRSNFCSCFGGGGGGGDGGSSRR"
     gene            <191094..>193643
                     /locus_tag="CYME_CMO073C"
                     /db_xref="GeneID:16995529"
     mRNA            <191094..>193643
                     /locus_tag="CYME_CMO073C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537432.1"
                     /db_xref="GeneID:16995529"
     CDS             191094..193643
                     /locus_tag="CYME_CMO073C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537489.1"
                     /db_xref="GeneID:16995529"
                     /translation="MPVRARCCSARTTRLGMTGATWNQGPYATRYTPRTRDRLSALGR
                     QLLDARYGRSRESHATVPTASSVAGGNFEHSAAYTGRFYDRTGVAVEGSVLKSSTTAN
                     DLDAEGFLRAHTSRMSLCNDGAQRSLLADQSSMDTSSPVYHGIAAANVGERDTEPFIK
                     EPNFWITTGSKPAVTRAGRGSRAALEPRPQPVLHRLHTTDRVLDSATITSPATGSDLS
                     PQRFQSSLQACVAGSAPADTSPRASATMPQAIDANRRMLYANASPAWNRAVPEDNSEN
                     NDLDSIDAASSLDPASERDFYDEIATGRRHDMSARLEALSPDRAPSVSACSSKSSPRS
                     PVASKSFAQLPDPVAGQAFEWTEACDPFTDDGSVEDTSSRFSTGEITQRLELLQQLQE
                     RLERIREDLRHQFESDSPPRAHTRDQNQSFEHDPKWRLISEHIRCLRELWRHESNQAS
                     ELRSVLAKQQQQQQRQEKHAGQCSRYGAAGVPAPARSPRLQARQSSPLTSRMSASFER
                     SLLPENENMDPSSSCAMQNCEGSHHQHRLTGGNFASSVNSRTLVERAACTHKSKEAAK
                     KHLAGGKRVCSTRDAKMPVREAGRAARQENRARAVVVSASCNQKPGAHNDEVSSQTVS
                     AAAPMHLLANEAAARHAHVSKGATDTSLSKIPARRCERCASRLSRTRQKLRVAVHALV
                     AMLRLTKRVHRSKSSPEPKAPNFASPGRREQTPSHRTRAASACLSVAQAAENEYEPTF
                     PSHRATRFSAPLSAQPTTQLLESSSEQADPVQARARRRGNESCDGRRARALFQAPPCG
                     RDPRRADVRTVCVYRQALRRVLRRLISLTASSTATASSPAQPAENAVASER"
     misc_feature    complement(191558..193433)
                     /note="possible transcribed region"
     gene            <193782..>194540
                     /locus_tag="CYME_CMO075C"
                     /db_xref="GeneID:16995562"
     mRNA            <193782..>194540
                     /locus_tag="CYME_CMO075C"
                     /product="RNA polymerase III subunit"
                     /transcript_id="XM_005537433.1"
                     /db_xref="GeneID:16995562"
     CDS             193782..194540
                     /locus_tag="CYME_CMO075C"
                     /codon_start=1
                     /product="RNA polymerase III subunit"
                     /protein_id="XP_005537490.1"
                     /db_xref="GeneID:16995562"
                     /translation="MFRSVLVEAAVRVESPLLAHRLEDALLHACKQRFCSRILPSLGV
                     CLTALRICKLVDGAGKQLALEIWPVEVSGGGLRARVHVELLLWSPLPHELAFAQVRSC
                     SRFGIRLSILNGFDYAFVPPGSMPEPCTYHEEQRCWSWRFNEDDFVIGEGDWVRVLIE
                     RVEYATDSAMATFDSPGTVGSGPPLHILPPPVPVGRTVMETDQANATPGAHPEHAPPL
                     ETEPPEFWETPSILPLRVWARLDAPGLGPIDWWS"
     misc_feature    196467..199279
                     /note="repetitive element"
     gene            <199389..>200345
                     /locus_tag="CYME_CMO077C"
                     /db_xref="GeneID:16995563"
     mRNA            <199389..>200345
                     /locus_tag="CYME_CMO077C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537434.1"
                     /db_xref="GeneID:16995563"
     CDS             199389..200345
                     /locus_tag="CYME_CMO077C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537491.1"
                     /db_xref="GeneID:16995563"
                     /translation="MFLTPVGTSCTGTLRRPIIGRQRLQTAKLGRLVARTAVPDSLEV
                     AVAQAQEATRRALANSLRQLRLELDTSLGDETYSRLKQTLPFLRLLCLALLQSDESLR
                     SSLRVLLPDEGAAAALRNDWKSEDQLSSVPVFSIESRVRRRELVAEAREHTVTCLAVT
                     PRATEVDALQELARAANEHDSLRLIVLNPELIDMGATGLGLAARRLRDRLLNGLEPVY
                     YLRTAPWGLVLRVYPDAWSVWIDRERYLAVKGEHEAENAANDDDAFVCIADDWQEQPT
                     GDALADLVESFMNPEQALSGPLAGLMQSWRSLQRFLRALRQT"
     gene            complement(<201045..>202577)
                     /locus_tag="CYME_CMO078C"
                     /db_xref="GeneID:16995564"
     mRNA            complement(<201045..>202577)
                     /locus_tag="CYME_CMO078C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537435.1"
                     /db_xref="GeneID:16995564"
     CDS             complement(201045..202577)
                     /locus_tag="CYME_CMO078C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537492.1"
                     /db_xref="GeneID:16995564"
                     /translation="METVGLEDRVALEALAKKLPRVLIVSRRHVRKQKFVDFVGEFHL
                     ELVLGGGAVPVIVPRVPRMIDCLDSYEPFHGLLLCEGEDIDPKFYKHYENQGGVLADQ
                     ETLRRIRERHAEDTTYDTAKDSIEFELARRCLQRGIPYLGICRGSQVMNVACGGTLYA
                     DIEAELGDTVKHIDYNNYDGHRHRIRIVRDTPLYQWFEEDELWVNSYHHQGVKKLAPR
                     LKPMAHADDGLVEAFYDPNCFDPTQGRFLVGLQFHPERMVNVELALREGRMEYEYRGC
                     PKVYHTFIQAVLSYFEREHVAAGLHGCTAGAATPAVDPRQRATGLVPTGELEAARLRL
                     VRSFERAADLYYRSQVTCMNDDAIELGTSFLLDPTGLAEITRRLAAAGATVHGGRYYY
                     RKDKDVSMRKRHLLLQTESQTHAEPLNSSDVLRDTIRTLLERVGNAALDSAVFEKVLL
                     DSVSEMSAEELDRLQQLAQALLEAARKRRAELQALRIPQRVSGDPADPRQRSSSCNAL
                     GP"
     gene            <202811..>203953
                     /locus_tag="CYME_CMO079C"
                     /db_xref="GeneID:16995570"
     mRNA            <202811..>203953
                     /locus_tag="CYME_CMO079C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537436.1"
                     /db_xref="GeneID:16995570"
     CDS             202811..203953
                     /locus_tag="CYME_CMO079C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537493.1"
                     /db_xref="GeneID:16995570"
                     /translation="MSLSVRVVLPGGDFIFIRGLTSNSLVKDVLDRLQSQMPTLPPGL
                     LWYQGRALAEAHTLAEEGITSGVSLNWTTASSKPKETWKGEHISEGFVPGEALKALVP
                     FSEQLNAWTLGDLRAGKLRAFWRLRQLQTLGTIDGDTARVPGSVENAQDTEQALRAGL
                     ELAQRTLASVSNTSLSTLENETEARWRLEQLALALRWLSDGLFCVSAIASAGAYSGRG
                     DAEEALGCTAALRELLGRIQSSESPGFQTEQAESQANVSTWQPEISSKSTSASRSGTL
                     SSRATGAGSVLATSLGGIAGAATAKKTTFRTQAVPAASVPKRSAAFATTRSAPVIDSR
                     LESLIDESELQRWKALLARDARYQPSAGMRTLSVLYRSTGRHSVGL"
     gene            complement(<204427..>204966)
                     /locus_tag="CYME_CMO080C"
                     /db_xref="GeneID:16995571"
     mRNA            complement(<204427..>204966)
                     /locus_tag="CYME_CMO080C"
                     /product="NADH dehydrogenase I iron-sulfur protein 18kDa
                     subunit"
                     /transcript_id="XM_005537437.1"
                     /db_xref="GeneID:16995571"
     CDS             complement(204427..204966)
                     /locus_tag="CYME_CMO080C"
                     /codon_start=1
                     /product="NADH dehydrogenase I iron-sulfur protein 18kDa
                     subunit"
                     /protein_id="XP_005537494.1"
                     /db_xref="GeneID:16995571"
                     /translation="MAYVLHRASGLWKHILQRQNPLSGQRRLFEDTRGALGRVSGTPD
                     EHRSRRLRIYRPARSATQQGRGSRTQLWKAEFEVQDGFGRWTNPLMGWYSSGDPLSQT
                     TLTFSSKEAAIQYAEKYGFQYVVYDPHEEPLHERKIAPFTRSMVHHWRHEGIPRYSTW
                     NEPTEETECSSQHSPSNKP"
     misc_feature    complement(206077..207649)
                     /note="possible transcribed region"
     gene            <207912..>209618
                     /locus_tag="CYME_CMO082C"
                     /db_xref="GeneID:16995573"
     mRNA            <207912..>209618
                     /locus_tag="CYME_CMO082C"
                     /product="similar to nuclear LIM interactor-interacting
                     factor"
                     /transcript_id="XM_005537438.1"
                     /db_xref="GeneID:16995573"
     CDS             207912..209618
                     /locus_tag="CYME_CMO082C"
                     /codon_start=1
                     /product="similar to nuclear LIM interactor-interacting
                     factor"
                     /protein_id="XP_005537495.1"
                     /db_xref="GeneID:16995573"
                     /translation="MAGVRERDSLEPSREPAPRVQRKSSRDGSESNPNRKANRWSFSG
                     IEEALELPSARTNSLSALDVDNTRADSSRRRRRDATSTTSSSSTARSRSRTPERFACR
                     QLAYRAPPGVETLAYHSYGLFLGKLETLRLGVRSFFRKTVPRFLSACWCLLQLLLLRA
                     RFNPTAFVKMEQLLGGSCWIRRPRSRDGSASQPLDAKANDKRASKQVKMGRDAERSRS
                     AQNSTEPQAKGFSSRLAAAGDRFLSYIAAFGLLGISPSSILGGIRKRLVQYHSMFSWE
                     GVVGRASRCAAARGRTTLYWCRDTVLRPGSKPVLLGLASAQVLGAVSCDIAEWVARIV
                     LETFARCFTRVRVDSTTLIDSIQFGGLLPRFARVSCGPFLAYASTPTERKILVLDLDE
                     TLVHSSFKERNGCDITVEVEVDDVPTVFFVRKRPHLELFIRVARQWYDLVIFTASLRR
                     YADPLVDALDPTRTLFRARYFREDCVRLPPYNFVKNLNIISPNLGKVIIVDNSPASYA
                     LQAANALPIDAWYDDPFDEELLNLLPVLRSLSILEDVRSVLGLRLTRGSLISRYKPLV
                     AM"
     misc_feature    complement(208496..210217)
                     /note="possible transcribed region"
     gene            complement(<212177..>213883)
                     /locus_tag="CYME_CMO083C"
                     /db_xref="GeneID:16995816"
     mRNA            complement(<212177..>213883)
                     /locus_tag="CYME_CMO083C"
                     /product="similar to processing protease"
                     /transcript_id="XM_005537439.1"
                     /db_xref="GeneID:16995816"
     CDS             complement(212177..213883)
                     /locus_tag="CYME_CMO083C"
                     /codon_start=1
                     /product="similar to processing protease"
                     /protein_id="XP_005537496.1"
                     /db_xref="GeneID:16995816"
                     /translation="MRACVQSAFVAIPPGRERLGRGKLVRAEAFSPFTRRHELAATRL
                     RLGRACATPERKQLGPNVASLQRLAKLAVIGFSVLLGFSPYFSHDIDQAVALVEPCTE
                     VSAERSEPGPAPWETLSFPTLPALPTLESIYEETFKNGLHLLILEDHEVPLTSGFLLT
                     EAGSWLDPPNKVGLAETVTALIREGGSAAYSPEELDDFLENRAASIETSLGVKSFQIA
                     FQCEPSDLGEVLRAASSLVRAPLFSAPRLELVKQHQHANIARRNDEPSSVLRRTFAKL
                     VYGSVSPFARESSDESIDRIERDDLFRFHADHFGPDFNTFLVLYGDLDRASVRRLAEE
                     TFGDWSRLVDPPRMALAPAPRPNPNASLVLLVEKPGLTQAQVAMGELGGTLRDPLYPA
                     LDVMNALMNGLGGRLFDELRSRKGLAYSVYGVWSPKYNYPGVFIAGGETETAQVPALV
                     EGIQAEFRRLDNELVSPDALNYAKDYVLNSMVFQLAPNKSEMLRRLVLYRFHRYPDDF
                     LQQLRAGIERVDARSLQQAARDRIDDDALITLVLGDRNKLEPILRAHFGQERVRVLPP
                     TK"
     gene            <215623..>216648
                     /locus_tag="CYME_CMO084C"
                     /db_xref="GeneID:16995541"
     mRNA            <215623..>216648
                     /locus_tag="CYME_CMO084C"
                     /product="similar to C3HC4 zinc-binding integral
                     peroxisomal membrane protein PEX12"
                     /transcript_id="XM_005537440.1"
                     /db_xref="GeneID:16995541"
     CDS             215623..216648
                     /locus_tag="CYME_CMO084C"
                     /codon_start=1
                     /product="similar to C3HC4 zinc-binding integral
                     peroxisomal membrane protein PEX12"
                     /protein_id="XP_005537497.1"
                     /db_xref="GeneID:16995541"
                     /translation="MFLSSIYGTNDKPSFLELVSQEQLLLGLRPALDRVLHGLCERFS
                     GQHWLRALHRRTDELWLLILLVVEGRSLYSNGATVAESFYGLRRRTNETSTLASRPKE
                     EHGPAPGLPAAAVWKSVLESAILPYLRTKLDALYQEFYIQASLGLDGFWSCFWKRLFL
                     RLYPFLRTLDHCFVFLFRLLYLFGRTEYYSWPLRLERIVVVRAPYAAGLVQGRPAATL
                     LQRFLDRAFSGGKLALIVGLYTLRFVDWFRSNLERERREQVRSLPLPPPPEPLGPPQT
                     HAWTPGACALCHRADCCEPSVCLVSGFVFCDACLREHIKIHRRCPITKFPASELDIRR
                     LYFSDAL"
     gene            complement(<216950..>217444)
                     /locus_tag="CYME_CMO085C"
                     /db_xref="GeneID:16995608"
     mRNA            complement(<216950..>217444)
                     /locus_tag="CYME_CMO085C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537441.1"
                     /db_xref="GeneID:16995608"
     CDS             complement(216950..217444)
                     /locus_tag="CYME_CMO085C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537498.1"
                     /db_xref="GeneID:16995608"
                     /translation="MRAFSEASRLSTWRAPLVYFLVGSLSSLAFFRLVNWTVNEGGAF
                     RFKLRKMKLDPPEERRLEPILVGPQDGFYWPAKLDKTNLEELLRKRLELSKERMQRAR
                     ERANLANFEVNISEMDVHAVEQQTLEPGANRSAHEHLRRERFMLRMLQERTRNFIERC
                     STEP"
     gene            complement(<218505..>219029)
                     /locus_tag="CYME_CMO086C"
                     /db_xref="GeneID:16995609"
     mRNA            complement(<218505..>219029)
                     /locus_tag="CYME_CMO086C"
                     /product="similar to microsomal signal peptidase"
                     /transcript_id="XM_005537442.1"
                     /db_xref="GeneID:16995609"
     CDS             complement(218505..219029)
                     /locus_tag="CYME_CMO086C"
                     /codon_start=1
                     /product="similar to microsomal signal peptidase"
                     /protein_id="XP_005537499.1"
                     /db_xref="GeneID:16995609"
                     /translation="MVASTWRQRLTSYAATCFFWFLILLALQVALDAVRTARCPQITV
                     KNFGGRILGFHGNLPRASETAFLSIDMEADFQPVWRGTYRQLYVFIVAESKNASSQVT
                     LWDKVVGSRDSRVIRLIGERAKYPLRAFPNETLRGNSITMRLHYMVMPYVGLYQRRVA
                     LGSADLTFHENAST"
     gene            <219293..>219871
                     /locus_tag="CYME_CMO087C"
                     /db_xref="GeneID:16995610"
     mRNA            <219293..>219871
                     /locus_tag="CYME_CMO087C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537443.1"
                     /db_xref="GeneID:16995610"
     CDS             219293..219871
                     /locus_tag="CYME_CMO087C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537500.1"
                     /db_xref="GeneID:16995610"
                     /translation="MQGPAHHVLQGTALYEPVPQTQFVAAYLHRDGSLVRTGGRTTQR
                     CLAYAGTLHLDVCKEARKYRCSSAGWSSTNRSVEAGISICDSNACQCRMERGLRLERI
                     HENSGLFLWSSALAFAELFCDCFLFLCVAVGFPYGVLLFPYNVLRSQWKGFGGSVEFL
                     NALLPPVTDAFHPQAKAATYASLAIFICIVYS"
     gene            <221687..>222574
                     /locus_tag="CYME_CMO088C"
                     /db_xref="GeneID:16995611"
     mRNA            <221687..>222574
                     /locus_tag="CYME_CMO088C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537444.1"
                     /db_xref="GeneID:16995611"
     CDS             221687..222574
                     /locus_tag="CYME_CMO088C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537501.1"
                     /db_xref="GeneID:16995611"
                     /translation="MQRPEGPGTHTIPMPKLNSAEDVFTFWFGVEPSLEKRRKCLSSF
                     SYFESRVATWFLGKNKEFELVQLESVDLVHRAGRGELHGGEWDQPLGLLARILLTDQF
                     PRCIWRGRAEAFQYDNVARGICRAILEKGWDKSEFFFAERIFIYLPLEHSESLADQRE
                     CVRLMRTAAAGSPWLTRWKHARSVNVKMAEDHLRVIERFGRFPYRNESLGRASSPDEI
                     AWLRSGNLPVFAKSQLASSQHNEAASTEPASAGGNASTERAFGRVSRSPWTALSAAVL
                     AIGTAAAISYRIYQRRHEV"
     gene            <223821..>225281
                     /locus_tag="CYME_CMO089C"
                     /db_xref="GeneID:16995612"
     mRNA            <223821..>225281
                     /locus_tag="CYME_CMO089C"
                     /product="plastid division protein FtsZ2-2"
                     /transcript_id="XM_005537445.1"
                     /db_xref="GeneID:16995612"
     CDS             223821..225281
                     /locus_tag="CYME_CMO089C"
                     /codon_start=1
                     /product="plastid division protein FtsZ2-2"
                     /protein_id="XP_005537502.1"
                     /db_xref="GeneID:16995612"
                     /translation="MSGGGCPGTLHHRMQSCIASRGLAPAVPDRSHTQKTPFVTTVYR
                     DIRARVRTAGDLAATRAHSDLFLALFARLAKNMPDFAFVTTVHHKFNTHSHTVCRNKS
                     KSRCRKGLANVESLLDAHGDGLEQRPTPQSVLAHKALRAGQVGLSSSSRSDYQQKPVD
                     TDTPPCVVKVFGVGGGGCNAISRMLEDGEFRGVRFAIANTDHQALIEFKKKYILYTQN
                     AVLETVVPLGESICRGLGAGGNPEVGCAAAEESHDRIAQAIGVGTDLLFITAGMGGGT
                     GTGAAPVVARIAKSLGALTVGVVTKPFSFEGRHRMQQALDGVAALRENVDTLIVVSND
                     RLMHVVPKNMPLKRAFRVADDVLKNGVRGISELITRPGLINVDFADVRSVMAEKGYAL
                     LGLGTGSGERRAKEAALAAVSSPLLDFPLNSAKGAVFNICGGPDMTLSEVNQCAEVIF
                     QHLDPDASIIFGATVDPTLGPRADISVTVVATGFAS"
     gene            complement(<225609..>227747)
                     /locus_tag="CYME_CMO090C"
                     /db_xref="GeneID:16995613"
     mRNA            complement(<225609..>227747)
                     /locus_tag="CYME_CMO090C"
                     /product="probable 3-phosphoinositide-dependent protein
                     kinase"
                     /transcript_id="XM_005537446.1"
                     /db_xref="GeneID:16995613"
     CDS             complement(225609..227747)
                     /locus_tag="CYME_CMO090C"
                     /codon_start=1
                     /product="probable 3-phosphoinositide-dependent protein
                     kinase"
                     /protein_id="XP_005537503.1"
                     /db_xref="GeneID:16995613"
                     /translation="MMSTWRRERRTPSWAVDESWFAELERGIKGGCAAGLPVDTSAKP
                     EPVVCFEDSRDESEKETDQMLPHQPPVPEVSSKTSPPVADSHSWHTDGERNARRHFIA
                     LLPGVPPLELQGASRADFKATELIGEGACSRVLRATYLPTGREYAVKVISKALAEQNE
                     QVLPLRTEQICLQVGLGHPNIVQLKAILEDENFLYMVIELCPHGDLARLLARRRASSE
                     TPHPSHRDRFQKREPNGAAPSGGNHVGALSLDAARFYFAEIVSAVDLIHKNGIVHRDL
                     KPHNILIGNKGHCKLADFGVAAILGKTPDDELAGRSPRPQDKHRYDSFVGTFAYLAPE
                     QLRRERPGGGFESDLWALGVVLYQMLCGGELPFRGETDYLLFQSILKDDVAFPKSCLP
                     TSSGRDLVEKLLNKDPAQRITMRALKLHPFFKGIDFRHLHRVDASKLLGPDAFEKRDF
                     LSFDAASSAGHAAEGFRRVTRAINSWWPRGTHAHRRATREPQALQDAGAKELFAAHEK
                     WRQPARRVLNLASDFTGNPILASAIELVESLLQRIRRECMQHRKLPSEEYLFAASQLQ
                     SADPRTLTDDHAKIRFWVVLYNVMFIHVRMVHGAPVRSGLRDNRFFGEYFYRVFTLDY
                     CLDDIENGILRVPGPFFRSWERDDPRRELALKHLHPKIVDMLHRIRVSRGMADIPELD
                     HLTETNLLGQAAFEDDGLIETDTERTTLTL"
     gene            <231475..>232881
                     /locus_tag="CYME_CMO091C"
                     /db_xref="GeneID:16995594"
     mRNA            <231475..>232881
                     /locus_tag="CYME_CMO091C"
                     /product="similar to myosin heavy chain"
                     /transcript_id="XM_005537447.1"
                     /db_xref="GeneID:16995594"
     CDS             231475..232881
                     /locus_tag="CYME_CMO091C"
                     /codon_start=1
                     /product="similar to myosin heavy chain"
                     /protein_id="XP_005537504.1"
                     /db_xref="GeneID:16995594"
                     /translation="MPVGSGVEPQAAAFESLQPPWLGSKPPHTQSTRDDLEAVMTEQK
                     LELESAQRQRLARLEERARNQDKVIARLQRELYEARRLIEERKTSPTLVDAIRVPAGV
                     QTTTSSAGKQHDVASLALQLEAAKEALAAEQRNRQETERLSERLAKSFDSYLQEMERR
                     QRAQEQEYRRQEMHLRGELRRCNMAKAHLEEQLELEKESLRAAQQELRGLRSRVEGTI
                     EDMKARQLQLEEGKRELERNLNKLSDQLEKERTLFQSERERFQQASREAYTMLSESAA
                     RSDELEKRLAETQAQMQQLRIEFGSQLQAEVARSAALERDLDRYRQRNRQFEDRIDEL
                     LTVNQKQAEERASLRAEIRRLTDELVRVQARSTFAERRLQDLLLDASSPQTEANLLPG
                     DTGDVPTPLSGSIMKKTSPSSVHKLQNIESSLRGISEENAAFRAKVRAYLDKRTPEPR
                     SRSLADDTHTRSQKGTPP"
     gene            complement(<233482..>236235)
                     /locus_tag="CYME_CMO092C"
                     /db_xref="GeneID:16995595"
     mRNA            complement(<233482..>236235)
                     /locus_tag="CYME_CMO092C"
                     /product="DNA repair and recombination protein RAD26"
                     /transcript_id="XM_005537448.1"
                     /db_xref="GeneID:16995595"
     CDS             complement(233482..236235)
                     /locus_tag="CYME_CMO092C"
                     /codon_start=1
                     /product="DNA repair and recombination protein RAD26"
                     /protein_id="XP_005537505.1"
                     /db_xref="GeneID:16995595"
                     /translation="MSAPNSTSYVARSDALVTDPAVQVVDEGKLVVDIVQKAHRDLIE
                     QTRQQILVLEQETNELLQQVLGSEHGAGTSSQRAQRSDDACDAGSVAASGRARRRLHY
                     LHNRLEQLRSELVELEAEQVHELGDLASTDGYRNGEVSFTPTGSPDALASQQLARTLE
                     AGHAVGTEAAMELAPGLWLPRSLYERLFPYQKEGLVWLWSLHVQGTGGILGDEMGLGK
                     TVQIIAFLAALDYSGLLKGPILVVAPVTVLDQWRRELETWWPRLQVRVLHAVLGIGES
                     ALQPNQCPSQVIFITNYEHLRIHASWFTSRRWDYVILDEGHRIRNPEAEVTRVCKQLN
                     TVHRILMTGAPLQNRLCELWSLFDFIYPGRLGTLQSFEEEFSIPISLGGFANATPAQV
                     HIAYRCASTLRDLIAPYLLRRLKRDVALQLPQKQEHVLLCRLTPEQRRIYQNYLNAID
                     VERAADGQLNLLPIITTLRKICNHPRLAAADLHVSGSERKLLRQSTSGKLLALDRLLH
                     QLRETNHRALIFSQTRSMLTLLEKTLNKGQFTYLRMDGETNVALRAELVDRFNHDSSI
                     FAFLLTTRVGGLGLNLIGADRVIIYDPDWNPASDTQARERAWRIGQERPVVVYRLLTR
                     GTIEEKIYHRQIFKTFLSEKVLHDPRKRRFFKRKDIHELLTLHEDATDEDFVQVQATA
                     RESLAPVSVAAAAGDDADADNHCKLDAKQNEQLTAEMRIMRQLLDGNDARALDQVAAV
                     FNHDSTLEVSGKHPRTAFDRQVLQAEADRVAQRALAALRRSLNHQTPTTPLPEPTTQA
                     PWLCSTATANRAPSSKLASQALLQCLHEREAVDDDEEQVRKLQSLVHEITSYLQRRGP
                     GATTAELAGAFKSSLRVRGINAAEFRAVLKLVAYLSESGDGNRAVWRLRASALLPDTS
                     PET"
     gene            <236448..>236918
                     /locus_tag="CYME_CMO093C"
                     /db_xref="GeneID:16995596"
     mRNA            <236448..>236918
                     /locus_tag="CYME_CMO093C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537449.1"
                     /db_xref="GeneID:16995596"
     CDS             236448..236918
                     /locus_tag="CYME_CMO093C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537506.1"
                     /db_xref="GeneID:16995596"
                     /translation="MESLHVRDVHRFGSVMNCGRVMNWFSGIDYHLDLIKKSGETCAR
                     FTDWNGETSEKYVLQRERALRDSLCWTTSMVASELAANSWEYFQSLSGDFGSSFTVGS
                     CWTAQTWTRNATDEPRECRPRIQVPVRVYPMECCSSSCHDCPAYTIKIRSASAR"
     gene            complement(238938..240707)
                     /locus_tag="CYME_CMO095T"
                     /db_xref="GeneID:16995670"
     misc_RNA        complement(join(238938..239450,239627..240707))
                     /locus_tag="CYME_CMO095T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461494.1"
                     /db_xref="GeneID:16995670"
     gene            complement(<238944..>239887)
                     /locus_tag="CYME_CMO094C"
                     /db_xref="GeneID:16995597"
     mRNA            complement(join(<238944..239450,239627..>239887))
                     /locus_tag="CYME_CMO094C"
                     /product="3-isopropylmalate dehydratase small subunit"
                     /transcript_id="XM_005537450.1"
                     /db_xref="GeneID:16995597"
     CDS             complement(join(238944..239450,239627..239887))
                     /locus_tag="CYME_CMO094C"
                     /codon_start=1
                     /product="3-isopropylmalate dehydratase small subunit"
                     /protein_id="XP_005537507.1"
                     /db_xref="GeneID:16995597"
                     /translation="MVFVFSNAVVVQGTRARSSALGRCSAPRLPGLAGYRSRGCSRRA
                     TVRMETPAPLRMEDVCSVGRKRDPETGNIQGRVFVVHDNIDTDQIIPAEHLSLLPSVP
                     AEYQLLGSHALEGLPRELYPERFVEEGQLSTKYSIIIAGENFGCGSSREHAPIALGAA
                     GAKAVVATSYARIFFRNCSSTGELYPWVSKTRLVEHFKTGDEAVIDFETLSIRNLNSG
                     QRFELEPLGEIQPVIDAGGLFEYARRTGMIKPRSRAS"
     gene            <240374..>242773
                     /locus_tag="CYME_CMO096C"
                     /db_xref="GeneID:16995560"
     mRNA            <240374..>242773
                     /locus_tag="CYME_CMO096C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537451.1"
                     /db_xref="GeneID:16995560"
     CDS             240374..242773
                     /locus_tag="CYME_CMO096C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537508.1"
                     /db_xref="GeneID:16995560"
                     /translation="MTNSDHISLFNFAGRQVPTLSCFLGPRERMSQNQRPQRTAFVAS
                     YAGPRGSAAAVPQRRNAEERILVCRIKQASCTVNTHLHRKAPTQLLSVESARWPGGML
                     FSKRQQRHQRQRKRALALCAEAPHPGKPQLLVQRAAAFAGQAAVLGLLCYLQFLLGNG
                     SFSIMDNTEPKFAVCAKNMLRTGNWLIPQWNGRVRFDKPPLVYWLQAVAYRLFGFTES
                     ATRLPTALAACAVTLMVYCFSVGASSDNMRKRQFKGLISAAAFACSLYAVGWARSGVS
                     DMVLCACITACLGCFAAAYISETKATRFAWYIGMFAAAALALLTKGPLGVALPALIVN
                     VFLVLVGQWRAVVLHEIPWTRGVLLAAAIGLPWYMLIIRAYGLTYIKAFFGYHNLARL
                     TSAVNAHSGPWYYYLACLLLGFLPWVAALPVALVAAYRRSGFAAASRKSSRREQIPLF
                     ITTWFLLTISFFSCIRTKLFSYILPAIPAAALLIGEYFSGVDPRKPADCGRAERLITA
                     LAVIIIMAAMALLCLRLESLIIGSSGGAGDPWILRVCLEQVRAQKLVWRGVAPWVLGI
                     VGVLVTCSISRWYRYLPTAMAASFMLFQCMFLLPAIRVWDRAHQQPLRELAQCVRSLR
                     ERSEADLRTDRVYMMVFGWCDGVPEGQPSVVWYSDFDGWHFAERPEETLADIVLMARR
                     DDRAERVCLVSRPAADVAPNYASLWSACCDGIAEDDLRDAKDVLILADTSIWRTIPGQ
                     LPDTKVIERRGPFALYRVPPRAALRAVQAIRNRGGTYAFQRDRLDLKSMEPASNMKEY
                     P"
     gene            complement(<246123..>247178)
                     /locus_tag="CYME_CMO097C"
                     /db_xref="GeneID:16995589"
     mRNA            complement(<246123..>247178)
                     /locus_tag="CYME_CMO097C"
                     /product="imidazole glycerol phosphate synthase, cyclase
                     subunit"
                     /transcript_id="XM_005537452.1"
                     /db_xref="GeneID:16995589"
     CDS             complement(246123..247178)
                     /locus_tag="CYME_CMO097C"
                     /codon_start=1
                     /product="imidazole glycerol phosphate synthase, cyclase
                     subunit"
                     /protein_id="XP_005537509.1"
                     /db_xref="GeneID:16995589"
                     /translation="MASALPRCRRTVNTRCSRKCPALGFSLCLRLPIERQSTWRASVG
                     AWQLRCCAAFGRGSGGRASRAARTVQCLAAASSSPLSTTTILSVDEQLEPQERISGPA
                     KRIIPCLDVKDGRVVKGINFVNLRDAGDPVEQARVYYEDGADELVFLDISATPNGHET
                     TLRVVEQVAGSIFIPLTVGGGIRTVEDARRTLLSGADKVAINSAAVARPELLQECAYQ
                     LGKANIVLAIDAKRRSPGKWEVYVAGGRKPTGIDAVEWAQRGSELGAGEILLTSMDAD
                     GTLAGFDLELTRAVVDAVCVPVIASGGAGTMQHFVDAVTQGGASAALAASLFHDNTIR
                     IPDLKQYMKNQGVLVRL"
     gene            <247686..>249719
                     /locus_tag="CYME_CMO098C"
                     /db_xref="GeneID:16995590"
     mRNA            <247686..>249719
                     /locus_tag="CYME_CMO098C"
                     /product="threonine--tRNA ligase, chloroplast or
                     mitochondrial"
                     /transcript_id="XM_005537453.1"
                     /db_xref="GeneID:16995590"
     CDS             247686..249719
                     /locus_tag="CYME_CMO098C"
                     /codon_start=1
                     /product="threonine--tRNA ligase, chloroplast or
                     mitochondrial"
                     /protein_id="XP_005537510.1"
                     /db_xref="GeneID:16995590"
                     /translation="MLTRAENRGFVRLLFISRLGLLRTPSTFGRWATACAPQRRVRVE
                     QTARPLAHCCGVRGLRSCSAASTPRTSQQANASQKAPVAAGDATGTSRLDALPTNETN
                     PRLLRIRHTCAHVMAMAVQRIFPEAKVTIGPWIDNGFYYDFDISHPFSPQDLERIKQV
                     MDEIILADLPLKCVALSREEARARVEALGEPYKLEILDSITEEPITIYSVGDDWWDLC
                     AGPHVARTGEINPEAVQLEGVAGAYWRGDESKPMLQRIYGTAWETPEQLQEYLRRREE
                     AKRRDHRVLGERLGLFSIQQDLAGPGLVFWHPKGAFIRNMIETFWKDAHLADGYQLLY
                     TPHLSDRELFRVSGHVDFYAESMFKPIECESREIIAKPMNCPHHVLVYKSKLRSYREL
                     PVRFAELGTVYRYERSGTLHGLMRVRGFTQDDAHIFCTFDQLRSEIKRVLDLTETILS
                     RFGFRDYQVHLSTRPKVSIGSEEAWSRSEQALRLALEDKGWSFTVDEGEGAFYGAKID
                     LKVRDALGRLWQCSTIQCDFNLPERFNLEYVASDGSRERPVMVHRAIFGSLERFFGIL
                     IENSAGDFPLWLAPIQLRLLPVSDKFLPFCEQVVDKARRRRLRAEIDLSANRLGKKVL
                     NAEEEHIPYMAIVGKREVESDALSMRSRHKGDLGSVPVDEILARLECEASMQL"
     gene            complement(<249747..>251600)
                     /locus_tag="CYME_CMO099C"
                     /db_xref="GeneID:16995587"
     mRNA            complement(<249747..>251600)
                     /locus_tag="CYME_CMO099C"
                     /product="similar to apoptosis-inducing factor AIF"
                     /transcript_id="XM_005537454.1"
                     /db_xref="GeneID:16995587"
     CDS             complement(249747..251600)
                     /locus_tag="CYME_CMO099C"
                     /codon_start=1
                     /product="similar to apoptosis-inducing factor AIF"
                     /protein_id="XP_005537511.1"
                     /db_xref="GeneID:16995587"
                     /translation="MSWGRALYCFELLSRSCSGLRTCSARRGLLKTCLASGLTAGLGL
                     FAFAGDSDSLTNQLGAGLWHPSAADRLDKEPHERCNYRRRFHFWNQFRVWCALKAPWF
                     SVSSAIANETSCEAAENSKVKSLSHKASASIGSSYDYVIIGGGPAAHEAAAELARCDA
                     DASLLVVTDQSYDPSWTQEQCKRWVNHHRVFHEGHRLQALDVEQKTVTLEGVDPIRYG
                     RLLLATGQENSCPDSCVMGPNASRYFIPAGQLHAGCDWRECTEPRHYTLLGLDWYACV
                     LASEIRTWSGGLHSVTILFPESEPLGEFLPKEVAKQVAQSLRDLGIELIPYAEPRYIQ
                     ERTDTAAAQSDLELFFVRTYDRSVAVSFRTDRFTVLNKARPPGGVAVLKQVQHLEIDA
                     ILGGIVCNRELAAASDVYVAGDALCFPDPVAGRRRACGLEHACRTARMAARNMRGARQ
                     VYSDQAAHQFSFGSTTLLWFGDLHASDEMYQYVCSGVDASGESANGRLPGPEHTIVVY
                     VRGRSTVTGILWVRAALPHPDALGFADDAVLAQTLASMKALIGQRVPSYGGSGTANAT
                     LEPRVREIFRCFTPYADRMRRRRSSSSGGGGGAHAASQRAGTPASRRGFGG"
     gene            <253161..>254198
                     /locus_tag="CYME_CMO100C"
                     /db_xref="GeneID:16995588"
     mRNA            <253161..>254198
                     /locus_tag="CYME_CMO100C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537455.1"
                     /db_xref="GeneID:16995588"
     CDS             253161..254198
                     /locus_tag="CYME_CMO100C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537512.1"
                     /db_xref="GeneID:16995588"
                     /translation="MNVPQKFHIEDATIQGVRMALSHPREWVPGLVHALRTAQSPVGA
                     APLAAALWFSMLCALWAYVRSNITGSTSQVDMMWSLLPPAYVTWFAALAFYTSGASPR
                     LAVMTALALAWSIRMTYNFARKGGYSGVEDYRWPVLRRRISNPILWQLFNIGFVSIYQ
                     NLLLLSLALPAWAVFLRSQSAWTAVDTAALSMFLMFLLLETVADEQQWRFQCRKHALT
                     LVQRAQHPNPDIRRGFLTSGLFRFSRHPNFFAEQGMWWAFYLFAVGAVLGEQKNPAWW
                     RVIFQGSAVPFFHWSIIGPVQLTLLFQGSTWLTEQLSLEKYGDLYRAYQRRTSRLIPM
                     WAPALLKEHRA"
     gene            complement(<255911..>257011)
                     /locus_tag="CYME_CMO101C"
                     /db_xref="GeneID:16995582"
     mRNA            complement(<255911..>257011)
                     /locus_tag="CYME_CMO101C"
                     /product="DnaJ homolog, subfamily B"
                     /transcript_id="XM_005537456.1"
                     /db_xref="GeneID:16995582"
     CDS             complement(255911..257011)
                     /locus_tag="CYME_CMO101C"
                     /codon_start=1
                     /product="DnaJ homolog, subfamily B"
                     /protein_id="XP_005537513.1"
                     /db_xref="GeneID:16995582"
                     /translation="MGLDYYKILGVPRDADEAALKRAYRRLAMKWHPDKNPDNKELAT
                     RKFKEISEAYQVLVDPRKREIYDKFGEEGIKAGMHENGGAGAGGFPGGFAGFPGGAGG
                     GGGGNGTTFFFSSAGPGGAGMPGGFGGFGFQDPEELFREFFGRAAADDPFTSFSSRTG
                     GGAGSSRFGGASPFDSGFGGVRRTQKKAPDHEVPLALTLEELYSGTQKKIKLTKRIRD
                     ASSGQIVPVEKILTIDIRPGFKAGTKIRFEREGDEIDPNEIPADVVFILKQKPHPLFE
                     RSGNDLIYNVQVPLKDALTGTEIEFKHLDGRRLRVKIPEVVHPGFEKRINGLGMPNSK
                     NPNEKGDMILKFKVLFPVTLTEEQKRRIRDIL"
     gene            complement(<259470..>261722)
                     /locus_tag="CYME_CMO102C"
                     /db_xref="GeneID:16995583"
     mRNA            complement(<259470..>261722)
                     /locus_tag="CYME_CMO102C"
                     /product="vacuolar-type H+-translocating inorganic
                     pyrophosphatase"
                     /transcript_id="XM_005537457.1"
                     /db_xref="GeneID:16995583"
     CDS             complement(259470..261722)
                     /locus_tag="CYME_CMO102C"
                     /codon_start=1
                     /product="vacuolar-type H+-translocating inorganic
                     pyrophosphatase"
                     /protein_id="XP_005537514.1"
                     /db_xref="GeneID:16995583"
                     /translation="MFTAGFILAVLAVIAFGTLIFTYRLYEYLIGCPEGPQSMRDVAR
                     PIQEGASGFFKVQYSTIASIAGIFALVIYFFGTGGAGGTTQASPFFNAAAFLLGGTLS
                     ALSGVLTMYLAVRVNVRVAAAASRSYAEAMKVCFRGGLFGGLLILSNCLVGFILLYWF
                     ALVTGMAAGDITQVPVLFVGYAFGASFVALFAQLGGGIYTKAADVGADMVGKVDTGIP
                     EDDPRNPATIADLVGDNVGDASGRSCDLFESISAELVGASILGGTLARTANLSGASQA
                     AYVLFPLCVHAVGLVCSALGGVTVRVSSGVARDEERSLLRTDDAFETRLEDPMSIMKR
                     GFRVTMVLAAISIWVLCWLLLRVGNVAPSAWWHYALCGMIGLAVSYLYVLITEYYTDT
                     KFRPVRSIAEASEYGHGTNVIRMLAVGLESSALPAIVVSAAILGAYWLGATSGMPDRN
                     AAGIFGTAVATMGMLSSAGIVLAMDVFGPVADNAGGIAEMSGADPSVRRITDRLDAAG
                     NSTKAFTKGFAVGSAALAGYLLFSSFMEEMSAQLPEKMVFNSVDLAKPEVFVAGLLGA
                     AVVFLFSSLAMTAVGRAAQGVVAEVRRQFRDHPGIMAGTEKPEYERCVALVAASALRQ
                     MVLPGLLPVLAPIMIGMLFRFIGNMTGRPLLGLECAAGLLMVATIAGILMALFMNNAG
                     GAADNAKKYIEDGHYGGKGSQAHKASVTGDTVGDPLKDTAGPSLHVLIKMLSTLTMVF
                     GPAFVGSIGA"
     misc_feature    262740..263751
                     /note="repetitive element"
     gene            complement(<264511..>266655)
                     /locus_tag="CYME_CMO104C"
                     /db_xref="GeneID:16995578"
     mRNA            complement(<264511..>266655)
                     /locus_tag="CYME_CMO104C"
                     /product="flavin-containing amine oxidase"
                     /transcript_id="XM_005537458.1"
                     /db_xref="GeneID:16995578"
     CDS             complement(264511..266655)
                     /locus_tag="CYME_CMO104C"
                     /codon_start=1
                     /product="flavin-containing amine oxidase"
                     /protein_id="XP_005537515.1"
                     /db_xref="GeneID:16995578"
                     /translation="MKDCSVLSTLPDDPLCRLIGRAAFDRALTSYWTEKGFAELKAPR
                     VGWRQIDLFMLFEGVRAGGGIHTVHQQRAFQPIAQQQRLAWTATNAGNALGKTYRKWL
                     EPCEKLLAEAVDTATQSDLPKLDCFNPGEHIAAVVRSGITVNEIEPEEAAQFPEYVSA
                     LTDLFLDVRNHIIRKWWRNPTQWLSTEDIEQETPSEYTKLVRACFRFLHWRGKILFGA
                     VPLQQLASYGVQSLARVLVIGGGIAGLAAARHLRACEPAFDVRVLEARPRIGGRIWTH
                     RASLGQASMDLGAMIITGVRQNPLGLIALYQLRLHLREVDPSCPIFAGVHEVLDPELD
                     AKIEDIYNSILEETVKMRQKLRDADRISLGDAFRKAMKQKLHQQPDQFQPIVRWHVSN
                     LEYACAAPLEKLSLCHWDQDDPFGFEGEHCMVEGGLDQVVQALATGLNIQLRRPVQKV
                     EWMNDTVRVVCGDGSVELADYVILAVPLGVLRDPKLLRFVPELPVWKRDALRAVGNGN
                     LNKIVLLFSCAFWISHTHPDRKSAKLCSFGVACPLEEVAHDDGRFYMFWDLTPLIGCP
                     ALMGMLPADAADSMEMLSDDAITASAMQRLRLAFPEAPDPLETVVTRWRSDQYSQGAY
                     SYVPVGSSGAAYDTAAESVDGRLFFAGEHTSRKHPTTAGGAYLSGIRAAYEVLCHFHE
                     TKKAHRSTDTPAVHRLRCKRRRTDGDIANDMF"
     gene            complement(<268162..>270171)
                     /locus_tag="CYME_CMO105C"
                     /db_xref="GeneID:16995579"
     mRNA            complement(<268162..>270171)
                     /locus_tag="CYME_CMO105C"
                     /product="ATP-binding subunit of unknown ABC transporter"
                     /transcript_id="XM_005537459.1"
                     /db_xref="GeneID:16995579"
     CDS             complement(268162..270171)
                     /locus_tag="CYME_CMO105C"
                     /codon_start=1
                     /product="ATP-binding subunit of unknown ABC transporter"
                     /protein_id="XP_005537516.1"
                     /db_xref="GeneID:16995579"
                     /translation="MARGRHLVQECRSLAFIVPSLWSSVAFYGGNDQLCQQSRYLVSP
                     VVCFLGRRAPKVVAVPRKRLRKLSVTQLQSISRDSAIGAGIQSLGRWQLAQVFASLIR
                     THTKEVVFSGLCTLMSSSSLLWLIRLFGRLSSAVAAGSLANVGQLAVGCSVALLLRVA
                     SQFGQDVWLSRTCNFVEDALRARYVASALDFGLEEGALDSGEASMQATMEIERVGSAM
                     LLVLRSLAPSVLQFVVMLAYMLYVSLPLTLCILCTAPLMAVVYAILERRLDQYVRQAQ
                     KLFARYAAATADSFRNRQLLQLYLAQDFAASKLEAFAKELLLAKNRMHFIRAGIVPAI
                     SVCYAITVLTMLYASALCISWGYLEPKELVSFIAAVAFLIEPVQGIASGLGSVKEGEE
                     SARRVFRVINLRPKKRTQIETSSIPKPAASKIQVRNVWFRYAPDSEYVLRGVTMTVHP
                     GERVAIVGGSGAGKSTLIAVLSRMCDPQRGFVYLDGVDIRSMPLDYVRRQVCVVPQDA
                     PMLNFSVAENVAFGLPMDPMKVEYCCQLAKAHDFIVKDLPAGYETLVGEGGSNLSGGQ
                     RQRLAIARALYREPGVLILDEAYSALDAENETHILSSLRELFASSAYPRTTIFIAHRL
                     SSVRDADRIAVMENGEIVEYGTHEELLRESNSRYGMLLALQERNH"
     gene            complement(<272454..>273119)
                     /locus_tag="CYME_CMO106C"
                     /db_xref="GeneID:16995576"
     mRNA            complement(<272454..>273119)
                     /locus_tag="CYME_CMO106C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537460.1"
                     /db_xref="GeneID:16995576"
     CDS             complement(272454..273119)
                     /locus_tag="CYME_CMO106C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537517.1"
                     /db_xref="GeneID:16995576"
                     /translation="MAEPVRTRKPDWSCTSQVLDGALKGVPLGLAWGAIVGVHRVWGS
                     HRSDTAHVDNSVRDCTNTAWGKALDWRHLWQFRVPRPFAYPSHLYMSMIFVSAIGRAA
                     EFGVFTAQYYGIYCFLDRQSAIWTDKILDHSSGHVLEKLSTVEQLRNPRLIAAAAGTA
                     SGISTLWMKWLFIALRNRLALHSSSNGAQLRPGSAGYFLAASAVVGTVSAAVCFTVEM
                     LRE"
     gene            <273490..>276054
                     /locus_tag="CYME_CMO107C"
                     /db_xref="GeneID:16995577"
     mRNA            <273490..>276054
                     /locus_tag="CYME_CMO107C"
                     /product="ATP-dependent RNA helicase"
                     /transcript_id="XM_005537461.1"
                     /db_xref="GeneID:16995577"
     CDS             273490..276054
                     /locus_tag="CYME_CMO107C"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_005537518.1"
                     /db_xref="GeneID:16995577"
                     /translation="MPQPSELSKLGKGSCQPKPPAGLAFVALGLDARRIVRALVHCGY
                     REPTPIQRKVIPLILSGRDVVAMARTGSGKTAAFLVPLIQRIALHPTQCVGVRGLVLS
                     PTRELALQTFKFLCEYAKYARLRAALLIGGESLEAQFAALAQNPEVLVATPGRLLQVL
                     DQVPHFSLKLLEIIVLDEADRLWEGNLASESRRILDMLRGTPQVENVSGLNVAAQTQK
                     VLVSATLPKDLANFSQMVLSSPAFVRLDEEKLLSEAVETGYIFCRQEEKIAALIHVLR
                     TLLASSKRILVFFATKHHAAYAHRLLSRYENWPVACIHGGMDQICRKRTLEEFRKKEQ
                     VSLFVTDVAARGLDLPQLDVVINFHFPPSPKLFVHRCGRVGRRGRKGWCWSLVSTDEV
                     PYMLDVWLFANDGKSFAFRESSEECPVDVGNRGYVRDLRSQNVGRVSSAICQSIAERI
                     QRAEMEDAELQSLHQSCVRAYDLYRRTRIKASGSSVVRARHLRNEYWSHVSIHPIFSS
                     ATAQEETPAQEQAGRVVQVPNSDGPETKRSEVLRDIHCWRPRAPVCNVQQTISGHHAL
                     LRTASGPGPRLNETICRETEANDTTTAPSSTAALDEAAAISVDCGQSDASSADRIESN
                     TREKPRQRKRAREALLQREHTFAVPAEPPASTVTDRIRAAFLQLDQSTDVDPKKNDNS
                     ASGVGGLGASVSRRSSSLQWDFRRKKFIRTTSQNGNINDIRVRRRLRRKFSEEKKQKN
                     ATRDTVTAYERWTQKTQAYIQQTGALPRSSISTLALQTVRKPDYRSKQKKSSRWRSRH
                     APLGLHIDTEVMPSSAQMISNRAVTRSLPEIRKHRKRKAVIQHIQRKIGKPSRSRK"
     gene            complement(<276516..>277898)
                     /locus_tag="CYME_CMO108C"
                     /db_xref="GeneID:16995527"
     mRNA            complement(<276516..>277898)
                     /locus_tag="CYME_CMO108C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537462.1"
                     /db_xref="GeneID:16995527"
     CDS             complement(276516..277898)
                     /locus_tag="CYME_CMO108C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537519.1"
                     /db_xref="GeneID:16995527"
                     /translation="MLVNGYSHVQAGASCFLSSLSVDCTSFNPTFVSFRRLRRRLAGA
                     RGHRPEHRVVFPRRAPFADKQRRGAPGLAHKTTAFQGLDGSQGASGARGLLGSSVLST
                     DAQPPLDLENTVETLSDSILKAVNAGCTRLRCVVALPGINEKLETTVPYSETLLFALT
                     YAFAQKLTATNFYSIGDELNEVRLVFSSAGKANAAKSLFDELGDVTPCGEASAKFSCF
                     GEESANATWDASELLSKKSATWRGFIIIVEPRNLRGDSAIPRLENLIQQQMQALDVVS
                     SHGPGRDFQVIWILLNPYLEDQADNVTLSIREIDRRRQFLYSFQIGFFMEPIVEILRP
                     DLIAVEHGVLIRSFGENWNVFACSPTRLHPASWQRAMQERSKIVYTKVGTLDQTQYEN
                     RQPGDDEVMCIIRKLRNLNQAGQSRESGSERELLVGVLLAVIFVTILIIGENKDGAMS
                     LLQSLGRGSF"
     gene            <278135..>279607
                     /locus_tag="CYME_CMO109C"
                     /db_xref="GeneID:16995528"
     mRNA            <278135..>279607
                     /locus_tag="CYME_CMO109C"
                     /product="pre-rRNA processing protein bystin"
                     /transcript_id="XM_005537463.1"
                     /db_xref="GeneID:16995528"
     CDS             278135..279607
                     /locus_tag="CYME_CMO109C"
                     /codon_start=1
                     /product="pre-rRNA processing protein bystin"
                     /protein_id="XP_005537520.1"
                     /db_xref="GeneID:16995528"
                     /translation="MPVKHLSLEARKRKPEKRSALWHQKPLPQQLAGEVQPVRARPRR
                     KSLDGAQREARSPGHSSSDSDELRDVEQLKGSLAFDLFQGDSSHNRETRALQLATEQL
                     LETDYDLDEAALVWGATEPGRPKRRRASSNLGEIEFESDFSKSEESSLSGSSDTFSDS
                     AVEDSIVHSEDSTALLQMTEEERDALRSFELSRADPSATINLADLVAAKLREGAAASP
                     GGLPGAGSATGAPESQSREARFRQLYESVGEVMHRYKSGKVPKAFKLMPALRDWYDAM
                     WLTRPEQWSPQALFVATKAFASNLDQAAAQKFYTSVLLPRCREDISARGKLNVHLFQA
                     LRKATYKPQAFYKGLIFPLIDNECSLREAAVFGAVLNRCHIPALHSAAALLYLSQKPY
                     SGPVALFIRVLLDKNYALPRRVIEALLKHFLRTRGDCRDYPVLWHQSLLAFVQYFKSD
                     LSAAQVESLRSLLREKRHHSITPAIHHEIQSIVQQRDGEI"
     gene            complement(<280393..>281565)
                     /locus_tag="CYME_CMO110C"
                     /db_xref="GeneID:16995603"
     mRNA            complement(<280393..>281565)
                     /locus_tag="CYME_CMO110C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537464.1"
                     /db_xref="GeneID:16995603"
     CDS             complement(280393..281565)
                     /locus_tag="CYME_CMO110C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537521.1"
                     /db_xref="GeneID:16995603"
                     /translation="MGEVAFDESATVLVINGVAVSSALALTTSDSGAVYVLKSALEQL
                     GVQPAEHAAVVWKLLHSYSPAAFLLELPQGAYTAARTVNGGRSIVCYAFHVQRLQRTL
                     AALVQDAGRAPLQPLLEDTEAASCRFSLFSTKKLRDSIRTALHQWALVYQRKQGGNGE
                     AAEALIIIYIPCVDGNKVFSARTSDSKACCNLHETVPVFVRCSELAPPTVEHEVVSKH
                     AEVEFHLGIERSNPSIKYSGWVRDRKRCEELREHADSIELVIVRRASTSLIILEGLVS
                     NIFFIYKEGYVATAVNDVLHGHMRELVLRVCEAHNVPLRLEKPPLVEERAQWSEVFLV
                     SATRVITPVHRVWAGRSLGMSNELWRNENSPSMFLKQIRSWTIEEMHRTSTDFRDL"
     gene            <285367..>286284
                     /locus_tag="CYME_CMO111C"
                     /db_xref="GeneID:16995604"
     mRNA            <285367..>286284
                     /locus_tag="CYME_CMO111C"
                     /product="outer mitochondrial membrane protein porin"
                     /transcript_id="XM_005537465.1"
                     /db_xref="GeneID:16995604"
     CDS             285367..286284
                     /locus_tag="CYME_CMO111C"
                     /codon_start=1
                     /product="outer mitochondrial membrane protein porin"
                     /protein_id="XP_005537522.1"
                     /db_xref="GeneID:16995604"
                     /translation="MVIKLFSKLGENSKKILNDDFVFQPKLTVKSTTQNGVTYSVNGV
                     QTPNGNIEADFGTKFKLEPANLGSIISGGAATNTISLKLFTTGAVSAETVLDDVANVS
                     GLKATLSGTVRDASNFVALTSEYVGHILAISAGVNVFGTTAATSSGDTSSPSTALFNG
                     SLVLGAEGIYVGGELEYNASNAAISKYNAAISYCDKGESELLLALTDKAQCIRACYAH
                     AISKRLSVAAEISYRRATDARLLTVGFKYGIDELSSVKAKVDSAGELCMAYIQEIRPR
                     TTLVLASRLNVNQLDKGGHRVGLSLTYDA"
     gene            complement(287443..289674)
                     /locus_tag="CYME_CMO112T"
                     /db_xref="GeneID:16995561"
     misc_RNA        complement(join(287443..289648,289663..289674))
                     /locus_tag="CYME_CMO112T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461495.1"
                     /db_xref="GeneID:16995561"
     gene            complement(289613..289700)
                     /locus_tag="CYME_CMO113R"
                     /db_xref="GeneID:16995591"
     tRNA            complement(join(289613..289648,289663..289700))
                     /locus_tag="CYME_CMO113R"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:16995591"
     gene            <289922..>291745
                     /locus_tag="CYME_CMO114C"
                     /db_xref="GeneID:16995593"
     mRNA            <289922..>291745
                     /locus_tag="CYME_CMO114C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537466.1"
                     /db_xref="GeneID:16995593"
     CDS             289922..291745
                     /locus_tag="CYME_CMO114C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537523.1"
                     /db_xref="GeneID:16995593"
                     /translation="MRRENAFRALALCIALCILTIIIWDQYWNVLLRHGYGTTWFRRR
                     AEPHERAPHSLQENDESVVELEEYASLGELLSAATCTSNSDCTYGLVCVNATCTGCSS
                     TEQCSNIQLDCDANSNRCVHKPLSRFTWRDGLTFGLIFVIAGLSSTGGVGGGFLFVPV
                     LVLLTGFQARRAAALSQALVTGGSGANAFYGLITRHPFRERPRIDYYVVTVFMATILC
                     GTSVGVILNILFPNFFTLFMLAVLVAYVFYISIKKAIQLWKDERAASRNVRAQDQGAD
                     AAASNDVNADGSYDASCRGTEAEHCTDESFSIHSDQIVDMQDTGHERTFSVKSESVHS
                     TEGNEGMRTWAFGRLWTRLIGFFDPTLQFHSADEIMKYESRQYPLGSLVYVLAIFAFL
                     VVLSVFRGGGSSRVSVIGVENCSAIFILLYIVQEIGLLCFSVAAGFRNLRMHLVKLRV
                     GYEFYERDMEWTRNRILWIAPLMIFLGAVGAWVGAGGSFMSTPILIAGVGMDPLVVQA
                     TAGFMNFVAAFSSAIQYYVNHELPLDYGLALGGTAFLGSLSFVVFFNRLVYKFKLQAI
                     LVFIMAGVMFGAAVLNIYAGALELKTTLNQGKPFPFGNICG"
     gene            complement(<291937..>293166)
                     /locus_tag="CYME_CMO115C"
                     /db_xref="GeneID:16995580"
     mRNA            complement(<291937..>293166)
                     /locus_tag="CYME_CMO115C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537467.1"
                     /db_xref="GeneID:16995580"
     CDS             complement(291937..293166)
                     /locus_tag="CYME_CMO115C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537524.1"
                     /db_xref="GeneID:16995580"
                     /translation="MEAAGRTSETSSRITVAEAFIGTYSGGIAKLNFAQNILPGEKFA
                     SVDSEKHQQCSLSSENSPITVIKAFGSVVLSASVRKVAVYSAADAGEAAVFAAFGASN
                     GEVAFLDVSRSVLLETFDSQTECVNDLAFVRLHDRTFLLAAGGKTRGKLAVWLCTGQP
                     FRKWFLKKTLSLGKWPITHIVMTRNKAQFFTLDERPQLTLWSLEKLLESKRNRGCRPR
                     NTSNGRESIKSLAFPELRFRLGFRPESVEWCPESAVFFFAGRSILEMYDLNSGTAVSS
                     EKLTDALISCVYFVREYGANSGNRYAFLGTSRGEILLIQCISNSDGESSFKVIDRLAV
                     ESAEERCRPGKIRDIGLISISESALDIVALTSFRLFSCRFFPLKEEKAFVDSVTDFGH
                     RITCSYLHRLSKNKHHC"
     gene            <293288..>293623
                     /locus_tag="CYME_CMO116C"
                     /db_xref="GeneID:16995581"
     mRNA            <293288..>293623
                     /locus_tag="CYME_CMO116C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537468.1"
                     /db_xref="GeneID:16995581"
     CDS             293288..293623
                     /locus_tag="CYME_CMO116C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537525.1"
                     /db_xref="GeneID:16995581"
                     /translation="MDSKLGRELRIKLGVALRTAKDLDYYEKELVTLRMRIEEERKNG
                     SDCLRQLQDVFSETEAMIPDARFRLQRATQELEVALNKASFAGAADESDTSRAEVLLQ
                     ELRTKQLVR"
     gene            complement(<293875..>294711)
                     /locus_tag="CYME_CMO117C"
                     /db_xref="GeneID:16995545"
     mRNA            complement(<293875..>294711)
                     /locus_tag="CYME_CMO117C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537469.1"
                     /db_xref="GeneID:16995545"
     CDS             complement(293875..294711)
                     /locus_tag="CYME_CMO117C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537526.1"
                     /db_xref="GeneID:16995545"
                     /translation="MDSQPRVALVTGCGGSIGWSTVNNLLREGWIVLGLTRQRKTLES
                     TRGPCPQNLFLFELDARSATSEDFHSKLSLLVSAWEKFPRIQLVVNIAAICPKNWDAF
                     TLLETFSVNVVFPQRLYEVFHYLDMRHYPEPCSVINVSSGDGELCFFNSYWRRAIEQL
                     ESYDELTDFMHAVVERVDQAGLQPYAVVHGDEPAYRLSKALLNRLTLLQARTAPSHIR
                     IDAICPGDVKSNMNPLGGQREPSAAAKDILQLAELQHRIVRERCSSRYPHFWRLGKPI
                     PF"
     misc_feature    complement(295623..296376)
                     /note="possible transcribed region"
     gene            <296590..>297684
                     /locus_tag="CYME_CMO119C"
                     /db_xref="GeneID:16995598"
     mRNA            <296590..>297684
                     /locus_tag="CYME_CMO119C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537470.1"
                     /db_xref="GeneID:16995598"
     CDS             296590..297684
                     /locus_tag="CYME_CMO119C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537527.1"
                     /db_xref="GeneID:16995598"
                     /translation="MGVAQNRVERITKTQLGASKFGTHCFPSDFSLVLSLAVALMRLM
                     VSKPRIYISALILGVIVVAVALRSLSKFSHSTLVSRGNRGLELHAFYNVFWNSGTPRI
                     AQEQLSWLESSGIKIDALHVFAFGTNLSGLERIEKWTSAPVVYEQLSPIGNEEVTLAA
                     LHRFCTVAELKGKSVFVLYFHPKGSFHPSIRNEKYRQAVGHYVLRKPQGCLSAMALQS
                     CDACSLRFSEYPHAHFPGNMWWANCSYISMLYAPDIPRTELKSAKLPEYCIGLGRFAS
                     EHWIGSHPQLRPCDCFPVTEDAFYWYGFSGLDGVHRLMNSTMDCRRGPRPNIIEIARK
                     KGYDVELNLRCREVSAAGDRRAYGFETTSS"
     gene            complement(<298403..>299497)
                     /locus_tag="CYME_CMO120C"
                     /db_xref="GeneID:16995599"
     mRNA            complement(<298403..>299497)
                     /locus_tag="CYME_CMO120C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537471.1"
                     /db_xref="GeneID:16995599"
     CDS             complement(298403..299497)
                     /locus_tag="CYME_CMO120C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537528.1"
                     /db_xref="GeneID:16995599"
                     /translation="MGVAQNRVERITKTQLGASKFGTHCFPSDFSLVLSLAVALMRLM
                     VSKPRIYISALILGVIVVAVALRSLSKFSHSTLVSRGNRGLELHAFYNVFWNSGTPRI
                     AQEQLSWLESSGIKIDALHVFAFGTNLSGLERIEKWTSAPVVYEQLSPIGNEEVTLAA
                     LHRFCTVAELKGKSVFVLYFHPKGSFHPSIRNEKYRQAVGHYVLRKPQGCLSAMALQS
                     CDACSLRFSEYPHAHFPGNMWWANCSYISMLYAPDIPRTELKSAKLPEYCIGLGRFAS
                     EHWIGSHPQLRPCDCFPVTEDAFYWYGFSGLDGVHRLMNSTMDCRRGPRPNIIEIARK
                     KGYDVELNLRCREVSAAGDRRAYGFETTSS"
     gene            <301893..>304148
                     /locus_tag="CYME_CMO121C"
                     /db_xref="GeneID:16995600"
     mRNA            <301893..>304148
                     /locus_tag="CYME_CMO121C"
                     /product="transketolase"
                     /transcript_id="XM_005537472.1"
                     /db_xref="GeneID:16995600"
     CDS             301893..304148
                     /locus_tag="CYME_CMO121C"
                     /codon_start=1
                     /product="transketolase"
                     /protein_id="XP_005537529.1"
                     /db_xref="GeneID:16995600"
                     /translation="MEAYLSAPSRPSVTLSEFSGRRVCQTKRNDSLLGARGRFAPGTW
                     ERVVLGRRGGSRTVSRLPQVRATATAGVSLVKPKQTGNAFADLCINSIRFLAVDAVEK
                     ANSGHPGAPMGQAPLAFTLWDKYLRFNPKNPNWVNRDRFVLSCGHGSMLQYALLYLYG
                     YDQPTMDDIKTFCEFGSCATSHPENFLLPGVEVTTGPLGSGVAQAVGLAIAEAHLGAM
                     FNTPEEKLIDHYTYFIMSDGCMQEGVAAEAASLAGHLGLGKLIGFFDDNKITYDGPTD
                     LAFSEDVVSRFKSYNWQVISIADGNTDIDNISKAIEEAQKDLTRPSLIIVPTTIGFGS
                     PKHANKRTAHGEPFGSDEVKATRENLGWKYAPFEVPEEVLKHCRRKIQEGARLEQEWN
                     ELLQRYKSKHPEQAALFERMVIRKEKSPGWEKALKDCAAKTGSMATRQVSGAMLNALA
                     AVMPEIIGGSADLAPSNNTLLKGFGDFSRNNYKAKNMRFGVREAAMTAITAGIKLHNT
                     GLFPYCATFLIFTDYARGMLRLAALSEAGITFITTHDSVALGEDGPTHQPIEHLASLR
                     AMPNVYTFRPCDANECAAGYALSIRHDDKVVLLALTRQKTNKLETSSYDGALRGAYVV
                     SDNSPAGKHPDVILIGTGSEVDVVVEAADQLRTSDALNVRVVSMPCMELFEDQDAAYQ
                     ESVLPAAVPRSRRVVCEAASSFGWSKYADHFVCIDRFGASGKGPDLMKYFGITPSNVA
                     KKAREAAGKGV"
     gene            complement(<304190..>305392)
                     /locus_tag="CYME_CMO122C"
                     /db_xref="GeneID:16995634"
     mRNA            complement(<304190..>305392)
                     /locus_tag="CYME_CMO122C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537473.1"
                     /db_xref="GeneID:16995634"
     CDS             complement(304190..305392)
                     /locus_tag="CYME_CMO122C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537530.1"
                     /db_xref="GeneID:16995634"
                     /translation="MEQHPRRFTRALKHDPWEPGVPHDTAWSCRYRHRRCAKLGERSF
                     QTSVARKRHSASVHVSAAFCTSLRGTVVERILPVSRACRHATPTIIFRTSVSISKAPR
                     RYIIKQAIFGPTLELDAAAARPMHHQELVCDTPKRQPQPLLLYAARPRPHYGRVLGTQ
                     HQQPVQQHRFPHTDFRATRETRSEVRYRSVLDSGQLEATVRQQKLQSALGPAWKIRFF
                     LSGADVRNVQHLKNEKLPAYGNDHAVFLGEQRWLCLRRKAASLDDAPVLKVDCFQSKR
                     YEFFNVWVTFVCLREPVKAEARKAPSPERPLEVLQPGRHRREKTFEVDNGSKPQDPLQ
                     PRGDAAAAYPAVVTLENSTFYGTHLRTRTMRPNVITRDTTAVFRPCKNTLFQSVPIPQ
                     SVAAANAA"
     gene            304305..306090
                     /locus_tag="CYME_CMO123T"
                     /db_xref="GeneID:16995635"
     misc_RNA        304305..306090
                     /locus_tag="CYME_CMO123T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461496.1"
                     /db_xref="GeneID:16995635"
     gene            complement(<306715..>308661)
                     /locus_tag="CYME_CMO124C"
                     /db_xref="GeneID:16995625"
     mRNA            complement(<306715..>308661)
                     /locus_tag="CYME_CMO124C"
                     /product="glucose-6-phosphate isomerase"
                     /transcript_id="XM_005537474.1"
                     /db_xref="GeneID:16995625"
     CDS             complement(306715..308661)
                     /locus_tag="CYME_CMO124C"
                     /codon_start=1
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="XP_005537531.1"
                     /db_xref="GeneID:16995625"
                     /translation="MSAFVVPGWPLRGGVAGSRRSRALYPHHGSAGLLRRRAFPRCTA
                     GDVRGSYTVGRRLPSETPPPLPVPTDYVLISETAEWRRLVEHASEIDRLHLRELMQDV
                     DRVRSLRAEYDGIYLDYSRQRVTKDTIELLFALARRARLVDKIRAMQSGAHINVTERR
                     AVLHTALRAERNASLVVDGTDVVRDVWRVLDHVREFSERVRSGEHRGATGKPLRSVIA
                     VGIGGSYLGPDFVHEAFRTDPEAFEAARGRHLHFLSNVDPVDIKRCTQDLSAEETLIV
                     IVSKSFTTAETLLNARAMREWLWSEMGRSDEVVRLHMVACSSNVPMVEKFGIDPRNTF
                     EFWDWVGGRYSVCSAVGALPLSIQYGFPTFLRFLEGARSVDANFYDVASPLAGNLPVI
                     MGLLGVWNLSFLGYKSRALHPYAEALLKFPAHIQQVDMESNGKHVTLRGDDVDYAVGE
                     IDFGEPGTNGQHSFFQLLHMGQTVPCDFIGFIESQYPLCIEGEPVSNADELMANFFAQ
                     PDALAYGKTAAECRAEGRPEWLIPHLVTTGNRPSLTLLLQRLDPYATGQLLALYEHRT
                     AVQGFIWDINSFDQWGVELGKVLAKRVRKQLNESRYFGRPISEEFNASTRDLMERYLR
                     GQVGCVFNEPFDYHRDTDTGRSPL"
     gene            <312894..>313787
                     /locus_tag="CYME_CMO125C"
                     /db_xref="GeneID:16995626"
     mRNA            <312894..>313787
                     /locus_tag="CYME_CMO125C"
                     /product="phosphomethylpyrimidine kinase"
                     /transcript_id="XM_005537475.1"
                     /db_xref="GeneID:16995626"
     CDS             312894..313787
                     /locus_tag="CYME_CMO125C"
                     /codon_start=1
                     /product="phosphomethylpyrimidine kinase"
                     /protein_id="XP_005537532.1"
                     /db_xref="GeneID:16995626"
                     /translation="MVRGEASSSSMPRALSIAGSDSGGGAGIQADLKTFEALGVYGMT
                     VITAITAQNTVGVQAVEGVSPALVRAQLQSVLSDIGVDAIKTGMLLDCGTINVVADTI
                     ESSEPAAMAPLVVDPVMVAKSGDRLLAADAVAALKTRLAPLATVLTPNIPEAEQLLGR
                     RLTIDSMDSMRRALVELMEELPETRAVLLKGGHLDSTGNVCVDLFSDRVHGGLTELTL
                     SRLSSRNSHGTGCTTASAIAAGLAKGYPLLKAVYLSKRYVHGCIEHALPLGAGCGPLF
                     HAHLQAADGALDAKLKELIGD"
     gene            complement(<314294..>314746)
                     /locus_tag="CYME_CMO126C"
                     /db_xref="GeneID:16995623"
     mRNA            complement(<314294..>314746)
                     /locus_tag="CYME_CMO126C"
                     /product="dUTP pyrophosphatase"
                     /transcript_id="XM_005537476.1"
                     /db_xref="GeneID:16995623"
     CDS             complement(314294..314746)
                     /locus_tag="CYME_CMO126C"
                     /codon_start=1
                     /product="dUTP pyrophosphatase"
                     /protein_id="XP_005537533.1"
                     /db_xref="GeneID:16995623"
                     /translation="MCQTESNQESGALRVKRLSECATLPLRSSEHAAGYDLFAAESVE
                     IPPGGRALVRTDLAVAVPVGTYGRVAPRSGLALKHGIDLGAGVVDQDYRGNLGVVIFN
                     LGEECFQVEVGMRIAQLILERIETPPVVEVAELEETQRGCKGFGSTGR"
     misc_feature    314927..315688
                     /note="possible transcribed region"
     gene            <316193..>318448
                     /locus_tag="CYME_CMO128C"
                     /db_xref="GeneID:16995605"
     mRNA            <316193..>318448
                     /locus_tag="CYME_CMO128C"
                     /product="transketolase"
                     /transcript_id="XM_005537477.1"
                     /db_xref="GeneID:16995605"
     CDS             316193..318448
                     /locus_tag="CYME_CMO128C"
                     /codon_start=1
                     /product="transketolase"
                     /protein_id="XP_005537534.1"
                     /db_xref="GeneID:16995605"
                     /translation="MLAYLSAPSRPSVTLSEFSGRRVCQTKRNDSLLGARGRFAPGTW
                     ERVVLGRRGGSRTVSRLPQVRATATAGVSLVKPKQTGNAFADLCINSIRFLAVDAVEK
                     ANSGHPGAPMGQAPLAFTLWDKYLRFNPKNPNWVNRDRFVLSSGHGSMLLYALLHLYG
                     YDRPTIEDIKQFRQLGAVTAGHPENFLLPGVEVTTGPLGSGVAQAVGLAIAEAHLGAM
                     FNTPQEKLIDHYTYFIMGDGCAQEGVASEASSLAGHLRLGKLIGFYDDNKITIDGHTD
                     LSFSEDVGARYEAYGWQVLRVPNGNEDLGAIEQAILTAKSDTTRPSLIIVSTIIGFGS
                     PHKADTHDVHGAALGADEVKATRENLGWKYAPFEVPEEVLKHCRRKIQEGARLEQEWN
                     ELLQRYKSKHPEQAALFERMVIRKEKSPGWEKALKDCAAKTGSMATRQVSGAMLNALA
                     AVMPEIIGGSADLAPSNNTLLKGFGDFSRNNYKAKNMRFGVREAAMTAITAGIKLHNT
                     GLFPYCATFLIFTDYARGMLRLAALSEAGITFITTHDSVALGEDGPTHQPIEHLASLR
                     AMPNVYTFRPCDANECAAGYALSIRHDDKVVLLALTRQKTNKLETSSYDGALRGAYVV
                     SDNSPAGKHPDVILIGTGSEVDVVVEAADQLRTSDALNVRVVSMPCMELFEDQDAAYQ
                     ESVLPAAVPRSRRVVCEAASSFGWSKYADHFVCIDRFGASGKGPDLMKYFGITPSNVA
                     KKAREAAGKGV"
     gene            complement(<318490..>319692)
                     /locus_tag="CYME_CMO361C"
                     /db_xref="GeneID:16995606"
     mRNA            complement(<318490..>319692)
                     /locus_tag="CYME_CMO361C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537478.1"
                     /db_xref="GeneID:16995606"
     CDS             complement(318490..319692)
                     /locus_tag="CYME_CMO361C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537535.1"
                     /db_xref="GeneID:16995606"
                     /translation="MEQHPRRFTRALKHDPWEPGVPHDTAWSCRYRHRRCAKLGERSF
                     QTSVARKRHSASVHVSAAFCTSLRGTVVERILPVSRACRHATPTIIFRTSVSISKAPR
                     RYIIKQAIFGPTLELDAAAARPMHHQELVCDTPKRQPQPLLLYAARPRPHYGRVLGTQ
                     HQQPVQQHRFPHTDFRATRETRSEVRYRSVLDSGQLEATVRQQKLQSALGPAWKIRFF
                     LSGADVRNVQHLKNEKLPAYGNDHAVFLGEQRWLCLRRKAASLDDAPVLKVDCFQSKR
                     YEFFNVWVTFVCLREPVKAEARKAPSPERPLEVLQPGRHRREKTFEVDNGSKPQDPLQ
                     PRGDAAAAYPAVVTLENSTFYGTHLRTRTMRPNVITRDTTAVFRPCKNTLFQSVPIPQ
                     SVAAANAA"
     gene            318860..320390
                     /locus_tag="CYME_CMO362T"
                     /db_xref="GeneID:16995817"
     misc_RNA        318860..320390
                     /locus_tag="CYME_CMO362T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461516.1"
                     /db_xref="GeneID:16995817"
     gene            complement(<321015..>323336)
                     /locus_tag="CYME_CMO363C"
                     /db_xref="GeneID:16995818"
     mRNA            complement(<321015..>323336)
                     /locus_tag="CYME_CMO363C"
                     /product="glucose-6-phosphate isomerase"
                     /transcript_id="XM_005537479.1"
                     /db_xref="GeneID:16995818"
     CDS             complement(321015..323336)
                     /locus_tag="CYME_CMO363C"
                     /codon_start=1
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="XP_005537536.1"
                     /db_xref="GeneID:16995818"
                     /translation="MVGETRISFVLSLKKPAMATAFDLRLPCPYLPLDFLFLLRHARG
                     TRLSSAAKEQLMARTCVWNAIQVKVYQRVADPLAAPSQLHPPAARAGGESPKKRTPVE
                     SSLRGAVRNSVHLVFACWESVRLMSAFVVPGWPLRGGVAGSRRSRALYPHHGSAGLLR
                     RRAFPRCTAGDVRGSYTVGRRLPSETPPPLPVPTDYVLISETAEWRRLVEHASEIDRL
                     HLRELMQDVDRVRSLRAEYDGIYLDYSRQRVTKDTIELLFALARRARLVDKIRAMQSG
                     AHINVTERRAVLHTALRAERNASLVVDGTDVVRDVWRVLDHVREFSERVRSGEHRGAT
                     GKPLRSVIAVGIGGSYLGPDFVHEAFRTDPEAFEAARGRHLHFLSNVDPVDIKRCTQD
                     LSAEETLIVIVSKSFTTAETLLNARAMREWLWSEMGRSDEVVRLHMVACSSNVPMVEK
                     FGIDPRNTFEFWDWVGGRYSVCSAVGALPLSIQYGFPTFLRFLEGARSVDANFYDVAS
                     PLAGNLPVIMGLLGVWNLSFLGYKSRALHPYAEALLKFPAHIQQVDMESNGKHVTLRG
                     DDVDYAVGEIDFGEPGTNGQHSFFQLLHMGQTVPCDFIGFIESQYPLCIEGEPVSNAD
                     ELMANFFAQPDALAYGKTAAECRAEGRPEWLIPHLVTTGNRPSLTLLLQRLDPYATGQ
                     LLALYEHRTAVQGFIWDINSFDQWGVELGKVLAKRVRKQLNESRYFGRPISEEFNAST
                     RDLMERYLRGQVGCVFNEPFDYHRDTDTGRSPL"
     misc_feature    323295..324031
                     /note="possible transcribed region"
     gene            <324898..>326922
                     /locus_tag="CYME_CMO130C"
                     /db_xref="GeneID:16995607"
     mRNA            <324898..>326922
                     /locus_tag="CYME_CMO130C"
                     /product="ATP-binding cassette, sub-family G"
                     /transcript_id="XM_005537480.1"
                     /db_xref="GeneID:16995607"
     CDS             324898..326922
                     /locus_tag="CYME_CMO130C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family G"
                     /protein_id="XP_005537537.1"
                     /db_xref="GeneID:16995607"
                     /translation="MIWVVGAGLLAIFAGRSLSRRGREKDDIALSTEELHKAPPAVFL
                     EWGDVRVKVKDKRHPAGRLILSHARGVARPGRILAIMGASGSGKSTLLRVLAGRLPNS
                     GAYSVQGYLRIRIRQASQARELVGNTSNTGNSGSTQAPFRTAFIEQEESFFSQLTARE
                     TLEFYAELLLPRRLSKSARQAFVENLISELGLGRCAETRIGDARNPGLSGGERKRLAI
                     GCELFGSPSLIFADEPTTGLDASQALKVMEVFRRLADESRTVIVTLHQPRSSILDLID
                     DLIILCDGEIVYAGEYRLAAEHFEQVLGQQRPAESSVAEWLIDEVSPDQLQPEHSRRK
                     VSKLIAAVPIHLSIPSNELEGTKAVSERALKVRLRPVVPLRTQARLLLQRAWRQVSRD
                     WKTNLARLGSTIFSALLFGSIYYRLGLSQAAAQDRLGLLQVSTINTAMSALVKTLYIF
                     TEERSIASKERARGMYDLSVYIATKLLAEAPIAAAFPVLFGILTHRLCGLRATQGRLG
                     RFLGMLTLESFASAAFGLCVGAIAPTTQAAVAIGPALMVIFIVFGGFFVTNPPSWARS
                     IPEISLIRWAFQGLAVNELRGLRLQKSNTVGEADTGDAILARMQMNNVSLSKAFRRES
                     QILLGLYALTLSMLMLREKFASESKQLLRIQISSPVDQFISESGPSDTRN"
     gene            <330418..>331635
                     /locus_tag="CYME_CMO131C"
                     /db_xref="GeneID:16995619"
     mRNA            <330418..>331635
                     /locus_tag="CYME_CMO131C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537481.1"
                     /db_xref="GeneID:16995619"
     CDS             330418..331635
                     /locus_tag="CYME_CMO131C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537538.1"
                     /db_xref="GeneID:16995619"
                     /translation="MKRSASKRSTACRLCIFYLLISMVIQHALLLQQPVSATEGAGLL
                     GSPRVAAESQPAENPHTPHSGQTASGQSQQAEAAQRLGRENASEGSLEESDEDELDGE
                     LWRLREKTKELEQQLARLQKIIEEKSSSENSLLEQLTRLTEDRKNQEQNRLDLEAQLE
                     HVRAELAELQARPTPEPDLARLDLIAVVRAKAHYRSKQIMGALERRGVSGRARKLRRL
                     VARTGRHAARSLRALRKKAKPHLKRLRRLLRATGRVTSRRIRIVAYKLEPHLRVIFAR
                     GAVLFHKTAAKVSRSVPPSQLQRLQNIYHTVLARLLDFRRCYRKQMKLVPEYTTAEHG
                     NGYASTFERAVFLKENARIAAWCFWQADSTSRVILMGAFWMSMMFVWMSMVILVVIGR
                     LASKTLRILIPGR"
     gene            <333710..>336919
                     /locus_tag="CYME_CMO132C"
                     /db_xref="GeneID:16995620"
     mRNA            <333710..>336919
                     /locus_tag="CYME_CMO132C"
                     /product="probable DNA mismatch repair protein MutS"
                     /transcript_id="XM_005537482.1"
                     /db_xref="GeneID:16995620"
     CDS             333710..336919
                     /locus_tag="CYME_CMO132C"
                     /codon_start=1
                     /product="probable DNA mismatch repair protein MutS"
                     /protein_id="XP_005537539.1"
                     /db_xref="GeneID:16995620"
                     /translation="MLTRSLLAVTASVKYRAPFASRCPLGSSPCHCVLRPRILRFFAL
                     DRNQDGSQLRSSTPLLRHWERIRRRYPQHILLYQVGDFFECFKEDAVTLSETLGITLT
                     RRGVGKDATPMAGIPVRSLDAHLHRLVQAGHRVALCEQVEPASSGSRRLIDRRVTRLV
                     TPGTLVESIQQANENNYLVAVSLPANSALDGNEANNATCRIALDRTSASNQLDTTYLS
                     EVHDACVYYGVAWVDLSTGQEVQCSLESFETIGECLSRLQPREILVRGTLPDDAEACF
                     AYTLLRRVVSDKCLMTCHDERFRYQLPDQTGNGTLTPQERRAVETLFSYIEQTRNPME
                     DNAEGVASSAERLLCLRPLPLELWPIVRRFDAGGFMRIDASTRRALELHRSLRDPYSR
                     RGSLLAAIDATVTAPGARLLSLRLACPLVDSAAIERRLDAVEFFVKHRAIARETRRSL
                     QHVLDIERIVQRIFLTTGQAVREGRFTDFERVENTNEHLLSSPAIARIQNLIRDLVAL
                     GESLGHAQRLRDHIWKRFASKESHHDPCFEAVQRQMDRIRCDNIYNVLSTALEGVLGP
                     GTTVVGVSPPDSEARVRSGDITWPPDSNADGQEARTSDGTRAAATGPASTQAGAIRPG
                     YSAELDAAVVEYERSLQAVGALEQVYREVLGLKTLKVRSNNLLGWHLELTRREASRHQ
                     LFQKAQTHGKWEPLGLPVSAANPSPSDIDHHNVPSLMMRNKLTDDAVRRINETQHTVR
                     FRSRLLEHYVANRLQAEARFLRIQQNILLELTHRCAGDPHAREQIRETVAALSELDVA
                     AALAQVAHEHNYCRPVLHRPASEKPRYMIRIENGRHPTVERAVRNFVPNSCYLEIAED
                     SKIASPSLLVLTAANASGKSTFLRQIALITILAQTGSFVPADHCELHPADRVFARVGA
                     ASGDDLLSARSTFFLEMEETAAVLQKATRQSLVVLDEVGRGTSGEDGLAICEAVATAL
                     APRCRTILATHYLEIPRRILERTHPAAKHTRCFTAKVEHDATKRALKFSYRLSEGAAS
                     SSFGIEVARLAGVPEPVLRHAESIVQSRNAQKLGTRSGS"
     misc_feature    complement(336339..337158)
                     /note="possible transcribed region"
     gene            338014..340983
                     /locus_tag="CYME_CMO134T"
                     /db_xref="GeneID:16995617"
     misc_RNA        338014..340983
                     /locus_tag="CYME_CMO134T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461497.1"
                     /db_xref="GeneID:16995617"
     gene            <341369..>342337
                     /locus_tag="CYME_CMO135C"
                     /db_xref="GeneID:16995618"
     mRNA            <341369..>342337
                     /locus_tag="CYME_CMO135C"
                     /product="probable catabolite repressor protein
                     (CCR4)-associative factor 1"
                     /transcript_id="XM_005537483.1"
                     /db_xref="GeneID:16995618"
     CDS             341369..342337
                     /locus_tag="CYME_CMO135C"
                     /codon_start=1
                     /product="probable catabolite repressor protein
                     (CCR4)-associative factor 1"
                     /protein_id="XP_005537540.1"
                     /db_xref="GeneID:16995618"
                     /translation="MAGDAARAAPQTGKERPPPRFIEVFHDNLERELDVISSLVALGK
                     YKLVAMDAEFPGVVVRPLGNFDSPEDFQYQTIRCNVDLLKVIQIGICLADTEGSLPTT
                     EEAPAGNVWQFNFEFSLARDIYAQSSVEMLQEAGIKFDVLQERGIDPIYFGELLITSG
                     LVMNPDVTWITFHSGYDFGYLVKTCTADLMPATRQAFYELLSILFPNFLDIKSFMPSL
                     QLHGGLNKLAETLRVRRHGPAHQAASDALLTLDVFNRLARVHANFIAFDQFLNKLYGL
                     SFPTSVDVTNTSMQAQPQNALEMNALLEDTDRIRSEDGSGFAKPAV"
     gene            <345472..>346692
                     /locus_tag="CYME_CMO136C"
                     /db_xref="GeneID:16995601"
     mRNA            <345472..>346692
                     /locus_tag="CYME_CMO136C"
                     /product="coproporphyrinogen III oxidase"
                     /transcript_id="XM_005537484.1"
                     /db_xref="GeneID:16995601"
     CDS             345472..346692
                     /locus_tag="CYME_CMO136C"
                     /codon_start=1
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="XP_005537541.1"
                     /db_xref="GeneID:16995601"
                     /translation="MAPLCFTVAPARKNGSERLRRLGAERADGAFLAALCKSRWARFG
                     RRTQVSGLHWKLTCISTHENVSEAPNSLLREEDLQSGPLTTEHQRHIQGVPPVHPRMR
                     ANFENMIRAAQNSICLALENVDGSGKKFREDAWVRGADGGGGISRVLQDGHVFEKAGV
                     NVSIVYGTMPPEALQAASAGAVARNAGYARDERVPFFAAGISSVIHPWNPHVPTMHFN
                     YRYFETDKGMWWMGGGTDLTPSYLYVEDAQHFHGVLKSVCDRHDAAFYQRFKKWCDDY
                     FLIRHRGERRGIGGVFFDDLNDRPAEELFKFSSDMVGHVVEAYVPIVERRKHMPYTEE
                     QKRWQQLRRGRYVEFNLVYDRGTVFGLKTGGRIESILMSLPLTARWEYDHQPAEGTPE
                     WDLLDACRHPREWV"
     gene            complement(<347364..>349871)
                     /locus_tag="CYME_CMO137C"
                     /db_xref="GeneID:16995602"
     mRNA            complement(<347364..>349871)
                     /locus_tag="CYME_CMO137C"
                     /product="probable DNA replication licensing factor MCM2"
                     /transcript_id="XM_005537485.1"
                     /db_xref="GeneID:16995602"
     CDS             complement(347364..349871)
                     /locus_tag="CYME_CMO137C"
                     /codon_start=1
                     /product="probable DNA replication licensing factor MCM2"
                     /protein_id="XP_005537542.1"
                     /db_xref="GeneID:16995602"
                     /translation="MELPPVAGPAGTEPCLSEYIFTFSSFLLSQHFQEIERILAQPDV
                     SKYAAVRVNFLDLACFHSDLAALILARPTTFLPILDEALRDAQTRLLTERESSHASET
                     QEQRLSFKPLVHVRISNLPQCAEVTKPTISGLRSADMGRLIVLSGTVTRTGSVMVREK
                     EREYECLKCGYQFRAQATPVSKSVVFELPLRCPSGNELQDSETSEATSTTRGRPWKRF
                     KRCNAPCSGTRFAPVTRSNGDAGTCACGDYQEIRLQESVQHLGMGSIPRSILVVLTDE
                     LAGSCKAGDEITVTGILQRRWLRPLVPGTRCDMDVILEANYVQINNERKAIVDISPDL
                     LDAFGHFWRLAKRDGVILRARDRIIRAVCPQTYGMFIVKLAVLLSLIGGVPQEDSSGA
                     RVRGESHLLLVGDPGTAKSRLLRYAALLSPRAVLTTGIGTSGAGLTVTAVREPATGEW
                     ALEAGALVLADGGLCCIDEFDSIREHDRAAIHEAMEQQTVSVAKAGLVCRLNTRATVF
                     AATNPKATKASLQHLRKSGETGNSLSIALGVASPLLSRFDVILILTDKQDDEWDERVA
                     DFVLNDYAEKKSPFRRPPDDVFDNPIPSLDWSLEQLRQYLHHVRGTFRPTLSPASECV
                     LGAYYALRRTNSERSAARTTVRLLESLVRLTQAHARLMYRKRAVVQDAIFAIVVVDPD
                     FVEHFLTGGGDPRQSDFSSDPDNAYLDYAKLVLQKLGIESKVHMEEGLPIHSGLDLNP
                     ETSWQPSRNETVQKEPVLQPARPGEHPQPDSEAAAPAVEPLWQPSATETLSENDQQGG
                     EKTFVERALDDFDFDAIESRFLTDASLGSWAASLGPS"
     misc_feature    complement(353750..354450)
                     /note="possible transcribed region"
     gene            complement(<359246..>360736)
                     /locus_tag="CYME_CMO139C"
                     /db_xref="GeneID:16995632"
     mRNA            complement(<359246..>360736)
                     /locus_tag="CYME_CMO139C"
                     /product="2-amino-3-ketobutyrate coenzyme A ligase"
                     /transcript_id="XM_005537486.1"
                     /db_xref="GeneID:16995632"
     CDS             complement(359246..360736)
                     /locus_tag="CYME_CMO139C"
                     /codon_start=1
                     /product="2-amino-3-ketobutyrate coenzyme A ligase"
                     /protein_id="XP_005537543.1"
                     /db_xref="GeneID:16995632"
                     /translation="MGRNFLHCFSYGRSFVRRYSGAPSPGVFTRNSERTSCLWGWQTR
                     RHLAATPEQSTEARRRKWRDTGLYQWIHQELDGIRSAGLYKSERRILSPQAADVVVES
                     PETNNKPRKVLNFCANNYLGLANHPEIKQSARDALDSHGFGVASVRFICGTQDVHKEL
                     ERKISTFHDTEDTILYHSCFGANEGLFEVLLGPEDAILSDELNHASIIDGVRLCKARR
                     YRYRHLDMEDLERQLEKANQEGARHKLIATDGVFSMDGDVAPLEQICFLADQYDAIVM
                     VDDCHATGFVGAKGRGTPELCGVMDRVDIVTSTLGKALGGGAGGYTTGRKEIIEILRQ
                     RSRPYLFSNALPPSIVAGSLTVFDMLMRKRSPASGADTARSDGTGASTTETGGAEALE
                     ASELRARLARNTRLFRTKMGAAGFRLGGEWHPIVPVMIGDAQIAADMAKALLEEGIYV
                     VGFSYPVVPRDKARIRVQISAAHSTDDIEQCVAAFAKVGKEKKLIP"
     gene            complement(<362858..>365392)
                     /locus_tag="CYME_CMO140C"
                     /db_xref="GeneID:16995633"
     mRNA            complement(<362858..>365392)
                     /locus_tag="CYME_CMO140C"
                     /product="mitochondrial translation elongation factor G2"
                     /transcript_id="XM_005537487.1"
                     /db_xref="GeneID:16995633"
     CDS             complement(362858..365392)
                     /locus_tag="CYME_CMO140C"
                     /codon_start=1
                     /product="mitochondrial translation elongation factor G2"
                     /protein_id="XP_005537544.1"
                     /db_xref="GeneID:16995633"
                     /translation="MGLLRQGTFTFWASFRSWLPLNPVRITKKCAPFRQRHSQWRFWS
                     EAASSVSETEVRPNSIRNIGIVAHVDAGKTTLTEKILYYAGVSRRVGNVDHGDTVMDY
                     LWEERQRGITIQAAATSVTWPPFPQPKDRKSAVLINIVDTPGHVDFTFEVERSLSVMD
                     GAVVLVDAIAGIQAQTATVWRQTNRYGLPRLIFLNKCDRKEADVSRCLQQIRTSLGGR
                     PVLLTAPVAWNGHVGIVDLRATNHMLLFTGSHGEAVERIAMDAEASVQPLLTVNRNTP
                     LTWSKLATDLREALVETLAEYDDRLCTQYLDGKPVHDDDLSRALRSATLERHVVPVFC
                     GSALRGMGIQPLLDAVEELLPSPEERPARLGEALDGGSTRKIAMNSKDALVAYAFKVQ
                     QDLHRGPLTFVRVFSAGATACLQTGSVLKILSTDRVKWHDAVQERVTGVFRVHADHFM
                     PIQHVQTGGIYALSGLKRVRTGDTLVSSDADPISVVRLPPVPVPEPMFSVALARDTGY
                     QRSAQEALIAALQVLVLDDPSLRFHEDERTGELLLSGMGELHLDIACKRLEREFGIKD
                     LHASAPRVALFETVAEPGAGCVSAVNSVQCTLKSHDQMPLSTMDRTVGATRLRASMRV
                     TLHPLPRNESNDGIRLEREVCLCPNLVFRGASPQEGLAPSSREIPASIRDAITDGARA
                     ALQRGPRAGLPVVGVRAVIHQISAENPVETALRACAVDAVHDALGRSTVALVEPVMRV
                     EVRLDAVGELASEPDEPTRSDTSVDKQHLYGVVIRDLTSPQRRGQVLGTDASGSVVEA
                     LVPLEGLIGYANALRSLTGGRASFEASFCKYERVDEMFAHRLLERN"
     gene            <365404..>366198
                     /locus_tag="CYME_CMO141C"
                     /db_xref="GeneID:16995627"
     mRNA            <365404..>366198
                     /locus_tag="CYME_CMO141C"
                     /product="probable adrenodoxin"
                     /transcript_id="XM_005537488.1"
                     /db_xref="GeneID:16995627"
     CDS             365404..366198
                     /locus_tag="CYME_CMO141C"
                     /codon_start=1
                     /product="probable adrenodoxin"
                     /protein_id="XP_005537545.1"
                     /db_xref="GeneID:16995627"
                     /translation="MGSEPHAVPRLALRQRRLPVKRNVAAVCSTPAFRLVVSRLGSFG
                     CRLCGLWMRAAAGVCLKSLRSWVFLGSTRGHQCTLSGLVARTSQQRGQEVFWRLERTS
                     ESVLVPTRRWSSSWRRYVAHQSTGAAVESKSTVGKAEENPAEAAETISVTFVDREGVR
                     HAVRAPIGSSMLEVAHENHIDLEGACEGSLACSTCHVYVSEEHFRRLPEPTDDENDML
                     DLAFGLQENSRLGCQVIATKELDGMELTLPKATRNMAVDGYVPKPH"
     gene            complement(<367574..>369163)
                     /locus_tag="CYME_CMO142C"
                     /db_xref="GeneID:16995628"
     mRNA            complement(<367574..>369163)
                     /locus_tag="CYME_CMO142C"
                     /product="serine hydroxymethyltransferase, cytosolic"
                     /transcript_id="XM_005537489.1"
                     /db_xref="GeneID:16995628"
     CDS             complement(367574..369163)
                     /locus_tag="CYME_CMO142C"
                     /codon_start=1
                     /product="serine hydroxymethyltransferase, cytosolic"
                     /protein_id="XP_005537546.1"
                     /db_xref="GeneID:16995628"
                     /translation="MLSSATLRSFISRSKGTWGANKTLDALRGLLAVNSTRGQRFFAA
                     AQPVPSPERRGTAEPVLNASLAEVDPDIVEIIEREKQRQWSCVTLIPSENFAPRAVLE
                     AIGSPLTNKYSEGRPGARYYGGNEWIDRSEMLCTQRALEAFSLDPERWGVDVQALSGS
                     PANMAVYTALLRPHDRIMALDLPHGGHLSHGFMTAKKRVSATSIFFESMPYRLNEATG
                     RIDYDKLEELANLFRPRLLIAGASAYSRLYDYERMRKIADSQGAYLLADIAHISGLVA
                     AGVIPSPFEYADVVTTTTHKALRGPRGALIFYRKGVKSKDPKTGIIEEYDLENPIKNA
                     VFPGLQGGPHNHTICALAVALKMAKSPEFKEYQRQVLANAQALARGLTERGVSIVSGG
                     TDNHLLLCDLRSRGLDGARAERVLELADISLNKNTVPGDLSAMNPSGIRMGAHAMTTR
                     GCTEKDFARIAELVDEGLKVTGELKKIAGPKLKDFRALMADGAEGTRFPSLLELRDKV
                     HRFARQFDPVGWSISEMKYRD"
     misc_feature    371406..373592
                     /note="repetitive element"
     gene            <373634..>375037
                     /locus_tag="CYME_CMO144C"
                     /db_xref="GeneID:16995621"
     mRNA            <373634..>375037
                     /locus_tag="CYME_CMO144C"
                     /product="branched-chain-amino-acid transaminase"
                     /transcript_id="XM_005537490.1"
                     /db_xref="GeneID:16995621"
     CDS             373634..375037
                     /locus_tag="CYME_CMO144C"
                     /codon_start=1
                     /product="branched-chain-amino-acid transaminase"
                     /protein_id="XP_005537547.1"
                     /db_xref="GeneID:16995621"
                     /translation="MFSYAGNALTRLTFSNGIEREHRSELTGSSRSRRSHRQVTLPLR
                     TYAARTRAYSSADATKFLDARKLPFLRATKVINCCSSLSMRDSGSSGATGTAPVGTNR
                     NTAAQRVGRAAVDWQSLGFGFTPTNCYVKAVWREQTGTWSPVEVVPYGPNGEATFPLH
                     VASTALHYGQSIFEGLKAFACADGHVRLFRPQENARRLERSALRLNMPVVPAALFLEA
                     VTRCVYENLEFVPPYVEQGGGGSLYVRPVLFGSGGRIGLGPADEYTFMVLVVPVGNYY
                     KGGLSPVTAYISTNYDRAAPRGVGHVKVAGNYAADLKPSMEAKQRGYPINLYLDAREQ
                     KFIEEFGTSNFSAVRYLDENGNRYVYVTPDSPSVLEGVTNKTLMELSLDAGMKVERRR
                     IPVEELATFDEVFASGTAVVITAVDQIVYGDQVIGIGKHPGSGQVGPVARRLYDTVRG
                     LQTGRLPDRHGWTYLVA"
     gene            complement(<375315..>376415)
                     /locus_tag="CYME_CMO145C"
                     /db_xref="GeneID:16995622"
     mRNA            complement(<375315..>376415)
                     /locus_tag="CYME_CMO145C"
                     /product="replication factor C subunit 5"
                     /transcript_id="XM_005537491.1"
                     /db_xref="GeneID:16995622"
     CDS             complement(375315..376415)
                     /locus_tag="CYME_CMO145C"
                     /codon_start=1
                     /product="replication factor C subunit 5"
                     /protein_id="XP_005537548.1"
                     /db_xref="GeneID:16995622"
                     /translation="MSSNGRLTATQSEQSETIWVEKYRPRELDEIVAHDEIRGTLRRL
                     IAERTLPHLLFYGPPGTGKTTAILACAREMFGAQFKTMVLELNASDDRGIDVVREQIK
                     TFASTRHIYALKAGIKLVILDEADAMTSAAQAALRRIMEKYTSNIRFCLICNYANKII
                     PAIQSRCTRFRFQPVPVAQMIQRLEYIADREGVPVDRAAFDALARIAQGDMRRAIYLM
                     QSTFLASASARVTEDGVYANAGMPSPADLHAIAQILLYDPFAQAFCKISEIKKGKGFA
                     LLDMIHGLHEAVMLMELSPKVKAFLFEQLANMEWRLVSATSERIQLAALVGIFRLAAS
                     MIDDSESGMDPKAAAAVEKLVQGAGYDQTQHG"
     gene            <377410..>378531
                     /locus_tag="CYME_CMO146C"
                     /db_xref="GeneID:16995614"
     mRNA            <377410..>378531
                     /locus_tag="CYME_CMO146C"
                     /product="similar to glutamine cyclotransferase"
                     /transcript_id="XM_005537492.1"
                     /db_xref="GeneID:16995614"
     CDS             377410..378531
                     /locus_tag="CYME_CMO146C"
                     /codon_start=1
                     /product="similar to glutamine cyclotransferase"
                     /protein_id="XP_005537549.1"
                     /db_xref="GeneID:16995614"
                     /translation="MLSDCSAFVVVPRFCYRLHVGASPPGALQSSRRRVARLRERSAG
                     TLPWARATFCKAGCRIGSSSCSVLLRWKSCFLAGEERSHLRQLGSLVQQPGALRQHVS
                     MSLFSTPAQVSSYEIIESYPHDPSAFTQGLVYAEAPIHSPDEAEWTMLQTSTEVFYES
                     TGLVGESSLRCVHKLSGKVLKCVQVPAPHFAEGLALVPRPTRMLFQLTWLTRTAFLYD
                     GVSLKQVREIPYDLEGWGATYDSNRHCIYTSNGTDRIHIVDADTFEILDQVRVRSSPY
                     KFSRSCPTLWYLNDLEMIPDTDELWCNVFFSDYVAVVDPASWELKRWIDLRGLLLPEH
                     CLPCHEVDVLNGLAWDRNRQLMYVTGKRWPRMYAIRERP"
     gene            <379955..>381781
                     /locus_tag="CYME_CMO147C"
                     /db_xref="GeneID:16995615"
     mRNA            <379955..>381781
                     /locus_tag="CYME_CMO147C"
                     /product="unknown permease"
                     /transcript_id="XM_005537493.1"
                     /db_xref="GeneID:16995615"
     CDS             379955..381781
                     /locus_tag="CYME_CMO147C"
                     /codon_start=1
                     /product="unknown permease"
                     /protein_id="XP_005537550.1"
                     /db_xref="GeneID:16995615"
                     /translation="MLRYDVHRFDRIVIARTSVAPAGFVEAVTTLLPSLTSRISCVGA
                     HATLAGRDAVGSRTLVKLCRRPLYVSAKRVDCARSLTLHLQEFSDAEAEEVRGPVSRT
                     NKRSATVAKTPQHANERALINPVETSSAPVEAGTGKRALKSLQALSLWEYLWPRGLLV
                     LVAAIWGTNFATVKFIGDADSLDVSAGAFVRFGIAAIAMAPFTWRAVQRLLDDKTPTS
                     EHGSDANAAPQPEVAGTEDPSATVEQRLRKRTSEFLFGVLGLGTVVFTGYFTQAIGLL
                     GTDANKSAFLCSLTVVLVPFMERTFLGKRIEPRAWMSAFLATIGVGLLELDGSASVSL
                     SDLWSFLQAVCFGAGFMIVEKLTRRFPGHPLEIAALNLTIVAVYSGLWCLSAAFVSGT
                     TMQDLLQSLAQILIDHGSGVAGALLYTGLVTTALAVMMQTVAISKVSAEEAAVIFCLE
                     PLFAVAFSAALLGESMSMKGASGGALILLAVLCNQALNPEMRSRLGLQRSRTRNIRAI
                     EGHTRTLAPSDRTPSVIAPMKPRMVSPATPEQFVNGTAPESASSSSTHLEKPQQPRTR
                     PRPSILPNEITFIASKDKNSASTASQAEDTRSDESEMASVHS"
     gene            <382697..>383035
                     /locus_tag="CYME_CMO148C"
                     /db_xref="GeneID:16995682"
     mRNA            <382697..>383035
                     /locus_tag="CYME_CMO148C"
                     /product="transposon"
                     /transcript_id="XM_005537494.1"
                     /db_xref="GeneID:16995682"
     CDS             382697..383035
                     /locus_tag="CYME_CMO148C"
                     /codon_start=1
                     /product="transposon"
                     /protein_id="XP_005537551.1"
                     /db_xref="GeneID:16995682"
                     /translation="MKSKRTRISSVRSAVDIFGGLRRFHGEGSRNGTNHYVESLRTFP
                     LTPSNAPLLDNVAFHHSLWLRAFADSRGADQLFIPPYAPWLNRIDGVFSIVKRNDHFT
                     ERIDESFRTR"
     gene            complement(<383898..>384797)
                     /locus_tag="CYME_CMO149C"
                     /db_xref="GeneID:16995683"
     mRNA            complement(<383898..>384797)
                     /locus_tag="CYME_CMO149C"
                     /product="20S core proteasome subunit beta 5"
                     /transcript_id="XM_005537495.1"
                     /db_xref="GeneID:16995683"
     CDS             complement(383898..384797)
                     /locus_tag="CYME_CMO149C"
                     /codon_start=1
                     /product="20S core proteasome subunit beta 5"
                     /protein_id="XP_005537552.1"
                     /db_xref="GeneID:16995683"
                     /translation="MYAPLEFLDRTFSLCSGSDICPSSDGDNTAAPMDLSLGRVRVPR
                     GASIAPRLRDVLRDEQNSSLVKFLHGTTTLAFVFRDGIIVAVDSRASMGQYIGSGTVK
                     KIIEINPYLLGTMAGGAADCSFWERYLGMRCRLHELQHRERISVAAASKLLANIVYEY
                     KGMGLSMGTMIAGWDKTGPQLFYVDSDGVRLRGTRFSVGSGSTFAYGVLDQFYRWDMD
                     AAEAAELGRRAIFHATHRDAYSGGYINVYHVKADGWVNLSHDDSGITKYAEYMGFRAQ
                     TAPTTASTVDTGAASTDTMIIES"
     gene            <386845..>387687
                     /locus_tag="CYME_CMO150C"
                     /db_xref="GeneID:16995680"
     mRNA            <386845..>387687
                     /locus_tag="CYME_CMO150C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537496.1"
                     /db_xref="GeneID:16995680"
     CDS             386845..387687
                     /locus_tag="CYME_CMO150C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537553.1"
                     /db_xref="GeneID:16995680"
                     /translation="MFVTCLLVSGSRRKGTANCALNLHRAQTATWAASRSTQQLQVQG
                     WRKPVKPGACQVLNAQLTVFRNPKSGGPGAQASREPPSFAQVLREMAPTGKLDDFVVY
                     DSDGKQHQLLDVVGSYGPEDKDMKATLVIWPRHFGCVLCRRLVKELAAREQAFRQERK
                     WRLMVIGCGTPEQAAKFRTDATLGPLPASIPVYTDPLRRSYLALRFRRGILSTFNLPA
                     LQNILDSFQKGERQRWDMIPPDAFQQGGIALIERDTGALWMLYRSQYAGDAPTAEDLL
                     NIEL"
     gene            complement(<388290..>389555)
                     /locus_tag="CYME_CMO151C"
                     /db_xref="GeneID:16995681"
     mRNA            complement(<388290..>389555)
                     /locus_tag="CYME_CMO151C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537497.1"
                     /db_xref="GeneID:16995681"
     CDS             complement(388290..389555)
                     /locus_tag="CYME_CMO151C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537554.1"
                     /db_xref="GeneID:16995681"
                     /translation="MHRPLHTLFLFIASAVAVVSGAVLHRAWAPDAQRVCYLQHAIPF
                     RVLNALPHDETTFTQGLFVDPINSSRLYESSGLRFRSRLQHVELPTGRVLQTARVEPA
                     SLFAEGAAYRAFDDAIVVLTLSAGRALTFDRTELRYRFGQDIPYGPSGAWGLAAVHWD
                     HLAACPGALRQWTCSDSEHCLRRDEEPACFLMSNGSSIITVRHPRTLAWLTSFPALHH
                     PCSGEQVSSLNELEVVMRPAANRPERFPELWANIWLSSNIVVMDICAGLERQRHALFV
                     GELNLSVLALERTAQGPSPVHPVHPDAVLNGIAWDANRPRNLYVTGKWWRKLYTLELG
                     LREHVAGHTSRGAARHQRALLRLMRTLLIVAVLVMAISGLVRVLVRIRRRLADGLTIS
                     RTQNDDTSRKLTAEVQATRELVARKMASH"
     misc_feature    389708..390692
                     /note="possible transcribed region"
     gene            complement(<391235..>392743)
                     /locus_tag="CYME_CMO152C"
                     /db_xref="GeneID:16995846"
     mRNA            complement(<391235..>392743)
                     /locus_tag="CYME_CMO152C"
                     /product="signal recognition particle recognition
                     component SRP54"
                     /transcript_id="XM_005537498.1"
                     /db_xref="GeneID:16995846"
     CDS             complement(391235..392743)
                     /locus_tag="CYME_CMO152C"
                     /codon_start=1
                     /product="signal recognition particle recognition
                     component SRP54"
                     /protein_id="XP_005537555.1"
                     /db_xref="GeneID:16995846"
                     /translation="MVLETLGTKIVKALQSLTNQVVVDETALEAALKEVARALLEADV
                     NVKQVSELRQRVKNRVRLAELPPGTNRRRLIHKTVFEELCRMLDPGIPPYRPQRGQSN
                     VIMFVGLQGNGKTTSCVKVAYFYKRKGYRTGLVCADTFRAGAFDQLRQNATRARVPFY
                     GRYGETDAVKVASEGVERFRREGFEVILVDTSGRHKQEAALFAEMEQLDRALTPDHVI
                     FVMDGSIGQAAYDQARAFQQRVRVGSVILTKMDGHARGGGALSAVAATHSPIVFLGTG
                     EHLDDLEEFQVQSFVGRLLGMGDVRGLVSTIAEADLENPDEEQMNRISQGILTLRDMQ
                     MQYSNVLRLGPLSKVASMMPGMAEILPKGSEKDAQTRVRNMLVILDSMNREELDESTS
                     VRWDDSRKRRIARGSGRSVQEVDEVLTQYKLISKAWSRIGKNMKHLMQPGHGGVGHGT
                     GPNSIPNIGAMEQQMQRMMDPRMLQQLGSGPGGLQRVMQQLMSGRSGAIPRR"
     misc_feature    complement(394947..396484)
                     /note="possible transcribed region"
     misc_feature    395933..397359
                     /note="possible transcribed region"
     gene            complement(<397129..>399504)
                     /locus_tag="CYME_CMO155C"
                     /db_xref="GeneID:16995585"
     mRNA            complement(<397129..>399504)
                     /locus_tag="CYME_CMO155C"
                     /product="probable protein phosphatase 2A regulatory
                     subunit"
                     /transcript_id="XM_005537499.1"
                     /db_xref="GeneID:16995585"
     CDS             complement(397129..399504)
                     /locus_tag="CYME_CMO155C"
                     /codon_start=1
                     /product="probable protein phosphatase 2A regulatory
                     subunit"
                     /protein_id="XP_005537556.1"
                     /db_xref="GeneID:16995585"
                     /translation="MSSEQTIESGIEVTAVFVTGGDESGVHAISGTMDAPKLLVTLSA
                     TDIALEPKRHLEYLFMRWLFLPETLAWLEQVLGKLDVTGRVTDEDLVTAGSPKPTMLR
                     QERLSSPTASCNAASHGATAKRPTNADTITPNSPAGAARSAFYRILSQTPGSPAGGEA
                     RVARQGRSRSSSTEEASLTSSPQSPVSHFIRKYEVFRIWSEVEDSDAAMAHGQSDTEE
                     RCHEIASYMDSGVGHDGSSTENGASFSPPLPACEETAHQRNALHSGGLNKRSAVNALF
                     VPSECAFAKAETIPRFYYPDGRAHEHVIRAAEEQQAIQAAFDCQDGALSQREVVELIM
                     DIVGLPSFVSLVIFERLLQRQQHFETSNVASEVEGTNKKGAKEISIPGATGERIHQSI
                     FLQWYVEDCAGYDRHARLFHALQRSRDYHASVPNEERTESDAHSVSSPRSSISPRSAA
                     ASWTSNRRNLDGQRDRADRQAHERRYLVGSDFRPFIDALLATHPGLQFLQSTPEFQHR
                     YAETVIERIFYYLNRPNGQAYLSDIRRHRLLDIFRSVDEQEDINQERSCFSYEHFYVI
                     YCRFWELDTDHDLMIDREDLLRYNGHALTYRIIDCIFSGRGRPLDCARPGYMSYTDFI
                     WFILSEEDKNSETALDYWFRCIDADGDGKITLYDVDWLYSEQLHRMECLGHEPVAFED
                     ILCQLLDMISKDLDPPVITRSALRSSRMQSHFFNILFNLNKFIAIESRDPSLLRQERA
                     VPDLTDWDRFAALEYLRLSAEDDEANMDAWSASDLEGMYAVSSLSGAESPF"
     misc_feature    complement(399639..402980)
                     /note="repetitive element"
     gene            <404043..>404621
                     /locus_tag="CYME_CMO157C"
                     /db_xref="GeneID:16995586"
     mRNA            <404043..>404621
                     /locus_tag="CYME_CMO157C"
                     /product="retroelement, dead"
                     /transcript_id="XM_005537500.1"
                     /db_xref="GeneID:16995586"
     CDS             404043..404621
                     /locus_tag="CYME_CMO157C"
                     /codon_start=1
                     /product="retroelement, dead"
                     /protein_id="XP_005537557.1"
                     /db_xref="GeneID:16995586"
                     /translation="MYVGVLRSYRSSKRTPTYTDMNNYRTIRLIPSIMKLLCAMLTNR
                     IQRGLEERKFFASEQAGFRSREECMSHVLTLIGVAQRRSISDQQPAYVCFIDFQKAFD
                     TVPHEAPFLKMERAGVSEKCLAFFSALYADSWMRIRLGDSSRTPSRRIRRGLRQGDRA
                     SPLLFNIFINDLLNNGRQFVAEAPWIDCGDVR"
     misc_feature    406648..408754
                     /note="repetitive element"
     gene            <409164..>411260
                     /locus_tag="CYME_CMO159C"
                     /db_xref="GeneID:16995673"
     mRNA            join(<409164..409684,409919..>411260)
                     /locus_tag="CYME_CMO159C"
                     /product="unknown WD repeat protein"
                     /transcript_id="XM_005537501.1"
                     /db_xref="GeneID:16995673"
     CDS             join(409164..409684,409919..411260)
                     /locus_tag="CYME_CMO159C"
                     /codon_start=1
                     /product="unknown WD repeat protein"
                     /protein_id="XP_005537558.1"
                     /db_xref="GeneID:16995673"
                     /translation="MEAEGVAVATAAEQAALVFFCGPLNGSIFVAECAEVIDAAIVES
                     SEAWRWTVRPVWLRSPTSDNALSPALARATTDGRERKRQRTKPADVSANVSEREHLRA
                     AKVAAARSLRGNGVRCIAAQRCGRATSRGDGETCWMLAAAGDDKILRVFRGKHIQPAQ
                     ATDAAMLWETVVEKANPKRMTAVQLGFDGRVALTADKFGDVYALQIGEEALLPEPAWQ
                     YLLRQPVYVAGDASVEPVMGHLSIITSLAIDPGGRLIASADIEGQIRISAFPEVYRVE
                     QIYSSCGGDPSWCTSSDFITRLSWKHGSQTPTLIGAGTDVWFVAKQVKPVPAARDTCD
                     GESCWRIWGGRLGSLRGTGAAYEGSTSDENASMVARAPSEGAAGRALGRASGLESCST
                     HGFTWICLDIDARLTLALWGNAQHQTCFSIISLMNAESESALHRLNERLGDARARYRT
                     RIPTGCCSLPLSTCLPKGREHQLRSLSTPVELCSMIFVPTAPGPLDAAVCSMHETGAR
                     WTPEVTRTSTDVSEPEAVRFFFVLPFVESDDPAAEDALLPLAATMQWTLNQSVATCIR
                     ESSGAFSTSERANTPYNALHHSGWSWIFDQACNAVTGGDGSPAPVPTPTTETSR"
     gene            complement(<411736..>412611)
                     /locus_tag="CYME_CMO160C"
                     /db_xref="GeneID:16995674"
     mRNA            complement(<411736..>412611)
                     /locus_tag="CYME_CMO160C"
                     /product="similar to archease"
                     /transcript_id="XM_005537502.1"
                     /db_xref="GeneID:16995674"
     CDS             complement(411736..412611)
                     /locus_tag="CYME_CMO160C"
                     /codon_start=1
                     /product="similar to archease"
                     /protein_id="XP_005537559.1"
                     /db_xref="GeneID:16995674"
                     /translation="MSLDPHMIEWGFRSLPRRPAGPRCQRRATVRTSEPATTAASSLE
                     SLHQPGQAVLDQTHDPMGQGEEGAHASGSSQRLCRDSGAHHVPERTEEQPEALDAFPV
                     AIAEASILDSRGQFTYLDHTADVMIHAWSSSLPGAFAQCLLGLYGVMLNVEQVRARLD
                     ASPQTWSARGHDLKSLLYDFLSEGLYRFHVDGFVAARVLVTAWQIPVSDKELFRESDL
                     NDSEGQLTAEARESYQMQVTAFGEAFDPQKHGTGTEVKAITYSAMTIRKRTPAETAAD
                     NDPERVYEVFVIVDI"
     gene            <412854..>413654
                     /locus_tag="CYME_CMO161C"
                     /db_xref="GeneID:16995675"
     mRNA            <412854..>413654
                     /locus_tag="CYME_CMO161C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537503.1"
                     /db_xref="GeneID:16995675"
     CDS             412854..413654
                     /locus_tag="CYME_CMO161C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537560.1"
                     /db_xref="GeneID:16995675"
                     /translation="MAFGVVPQTPRQQPSFFRSRTTCCFVQRTAQSSPAVLRAASALS
                     WNEGGAQRPLWFVPPATGGQSKHCASGSLLIAASDGKPAHTNLNRQRSGPAYRPSRDT
                     RRGGHHRAGGRPQARRSEQQCFVLVANPCRRPTQRPIIEVRASKAVFGKRATVRTRAR
                     RRLRAAARQVLVIWGRSDFSYVIHGLPECLFVSWKDLLQEMMEALQRSGCAHEKARAP
                     PRLPQHPHDASSSSNGQASAAESTKDGSPAAQLTQTDEKPTTDAFRRQ"
     gene            complement(<414533..>415426)
                     /locus_tag="CYME_CMO365C"
                     /db_xref="GeneID:16995676"
     mRNA            complement(<414533..>415426)
                     /locus_tag="CYME_CMO365C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537504.1"
                     /db_xref="GeneID:16995676"
     CDS             complement(414533..415426)
                     /locus_tag="CYME_CMO365C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537561.1"
                     /db_xref="GeneID:16995676"
                     /translation="MQGWIAVQRAALASARVQPQVASRVARSLQESRWGLRNQQHRQA
                     AQAATVQKASAAVEQSPGPQWLAPLHPALTSLTGMLRPNRASSARSRNRHSKTMIPAV
                     IQRYQQPDIYLSVPLEPLYADLHVYHRCARNRRNSLTFCGPLYNLIVYTDEAALSAVQ
                     NGSAQPIDHCYRAVLRQLQIDPVNMLPIHAGFYAVDVSGVLHPRGFRMRLPVRPTDLE
                     ECTDLQLGFVNWIVRAIDVFVERDVIPPPFLAISVARMQLEERRYGRDICCPPGIRLA
                     HGIEDLLILKLNRSARTRSGS"
     gene            complement(<419248..>421374)
                     /locus_tag="CYME_CMO162C"
                     /db_xref="GeneID:16995847"
     mRNA            complement(<419248..>421374)
                     /locus_tag="CYME_CMO162C"
                     /product="similar to ring zinc finger protein"
                     /transcript_id="XM_005537505.1"
                     /db_xref="GeneID:16995847"
     CDS             complement(419248..421374)
                     /locus_tag="CYME_CMO162C"
                     /codon_start=1
                     /product="similar to ring zinc finger protein"
                     /protein_id="XP_005537562.1"
                     /db_xref="GeneID:16995847"
                     /translation="MASHEHRAQLGFLLGVLSLLLLRFTGHVNASVPTPVPWSAINET
                     CSNDTVLTQDSSACFASLPVASPALSFRVNTSSMDSSYLIIEMSRENVTVDAFRLAGR
                     VELTVQDVARNLTLATDNWGYLAGLPYVYVVLNKTQFGNRTLNVAVQGNYSSVLTSEP
                     QSITIQGPIRLRFADSLKQTCALGPFSESPCWGNGTCSTRGVCDCSGSLVGPYCSVEA
                     PNITVGESTTTLVNFSTLSYYRFSAQTLNTSSGATNYAVTLAIQGQNGCPELLVTPDN
                     GSYRSMPVFATFSPNDNFPANESDTNSFICGYSTQNVLLSPNASTYWVSVANRYCPTN
                     MDPFSKANVTLQVKICGGSSGSCPPASPACTGPPFYNSWFFLLPILFGGIAGVLGIGL
                     LLAWLFPRREYPTDPGVLYAMGPYVSEAEAQRLANSGIRIVPLRGQRGARNRLPPIPP
                     EKIEAVFPASLYCSGEHQSCKRSDTSDDAAAGENAAATPGVPLGGERTPDAINDNTTP
                     YMMMPNSAESLTSPSLLVQARELAKSTTDLAAVPRLPPESAMFDPERSIAYSSITCPV
                     CLEDFADGDRVRRVGCHHLFHTDCIDPWLRKHPACPVCREDFSPLLRNHALPNEPRLP
                     DPVAQPGDVERGIGEALPPSGTMMNAPVAPATQAHEASTGATTYRRWPWPRSAWLVSR
                     RTSQSLPSSTHTESSNATDSPQPQLR"
     gene            <423717..>425369
                     /locus_tag="CYME_CMO163C"
                     /db_xref="GeneID:16995671"
     mRNA            <423717..>425369
                     /locus_tag="CYME_CMO163C"
                     /product="similar to initiator tRNA
                     phosphoribosyl-transferase"
                     /transcript_id="XM_005537506.1"
                     /db_xref="GeneID:16995671"
     CDS             423717..425369
                     /locus_tag="CYME_CMO163C"
                     /codon_start=1
                     /product="similar to initiator tRNA
                     phosphoribosyl-transferase"
                     /protein_id="XP_005537563.1"
                     /db_xref="GeneID:16995671"
                     /translation="MRFMNLPALLQCIRCGGLAIVDATRSGKLWPDALRCTLPLWCAV
                     MNALWWWPVFHSSVDDVPDPAQLSCVAAFWLRLCCNWGIDKDEMTQLGQAAAAALGAL
                     ISCKPFMDWFEEMIRQRSDWGVLWPMVAFRGDQKLAERFQGTSACRVCSGQSSSDTGD
                     WLSLSCSVREALAVLQQVGMRLQYTGGKQSSLHVIPVVGISASDARQEGNPILSCRYR
                     YVAGAGDDEESWSEGLEPTLWWQYQSRIRDVLAQGEALSSVLPDQSAENRHICGIDHG
                     SCRVEILASIWKQERVHVFLGRCACSRANPTSGDHCGLQSENSLHARRVFWLDALPCK
                     RSSRAAAMLESSLRSASVAIQQTRSNEDLSPTRSPSTQPLHCTPHELEREQSTKAWKQ
                     PEAAGARSAPRAYAHHGDNSAQQCARSASYAPCKHLLNSGQPAASNGQQRCEDCLAVS
                     NGKLSRAEASAAALLDTLLPQIRQCIQEEDRSVVLASTAGDGLALAAALVWLATSGLQ
                     QPETGLCRLQETLLLLQCRYPSAEVSQAVMKLVRAHLRRYAR"
     gene            complement(<425779..>426087)
                     /locus_tag="CYME_CMO164C"
                     /db_xref="GeneID:16995672"
     mRNA            complement(<425779..>426087)
                     /locus_tag="CYME_CMO164C"
                     /product="similar to acylphosphatase"
                     /transcript_id="XM_005537507.1"
                     /db_xref="GeneID:16995672"
     CDS             complement(425779..426087)
                     /locus_tag="CYME_CMO164C"
                     /codon_start=1
                     /product="similar to acylphosphatase"
                     /protein_id="XP_005537564.1"
                     /db_xref="GeneID:16995672"
                     /translation="MEASPSLCHCRARVYGLVQGVFYRASTQEKATQLGVAGWVRNCA
                     DGSVELEAFGTTTKVEELLAWCRRGPELARVDRVDIEWLPPPQHPDEWRQWNPFRVVR
                     "
     gene            complement(<427002..>427823)
                     /locus_tag="CYME_CMO165C"
                     /db_xref="GeneID:16995666"
     mRNA            complement(<427002..>427823)
                     /locus_tag="CYME_CMO165C"
                     /product="TATA-box binding protein-associated factor 9"
                     /transcript_id="XM_005537508.1"
                     /db_xref="GeneID:16995666"
     CDS             complement(427002..427823)
                     /locus_tag="CYME_CMO165C"
                     /codon_start=1
                     /product="TATA-box binding protein-associated factor 9"
                     /protein_id="XP_005537565.1"
                     /db_xref="GeneID:16995666"
                     /translation="MSKVEVAGAPLDARILASILSSMGIEEYDDRVIHQLLELLYRYV
                     AEVLTDARDLSEHAHRGQGKVSRTGSGVSAAAAAGDMAEIDVNDVKLAIELKLQREFV
                     QPPPREVQMLHARELNAVPLPVFRGDRDTVELPPEELQLTAPVFRVTAQKRKRELNKR
                     ALPVATDGGGYSTVLAVSDAVNQRVAIVTHAHSDTAGNLGDSPQTRMIESEPLAEEAF
                     ARASPSVDESSEHEEAMVTNSPEADPERTGEPSSAPTAAADAARAEPASRRSRRR"
     gene            428193..430540
                     /locus_tag="CYME_CMO166T"
                     /db_xref="GeneID:16995667"
     misc_RNA        428193..430540
                     /locus_tag="CYME_CMO166T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461498.1"
                     /db_xref="GeneID:16995667"
     gene            complement(<429155..>430171)
                     /locus_tag="CYME_CMO167C"
                     /db_xref="GeneID:16995668"
     mRNA            complement(<429155..>430171)
                     /locus_tag="CYME_CMO167C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537509.1"
                     /db_xref="GeneID:16995668"
     CDS             complement(429155..430171)
                     /locus_tag="CYME_CMO167C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537566.1"
                     /db_xref="GeneID:16995668"
                     /translation="MWNKLIRRDAVQSERSDTDFGDKASSAATEPAASAGERLTRSPA
                     ATSDESSVTTEPTARNLSDATKARESPGLPLNNSVTAQVDASNATVSGAGGAAQHPGG
                     VTGVVATSVMCAYAFSVLERELRARGRLSTDDDPFREALPPDSDAYGLFITWKILADR
                     GHLRTTTDSVWQLRGCIGTLTPTGLHDALRSYAVTAALHDRRFAPIRIEELPRLLCVV
                     SLLSDFTERDSVWDWEPGVHGLIVEVEPQSQQRRFAWRRFTRPRTSRYSATYLPEVPL
                     ELKWSKYETICSLIRKSGYLGDVPATETDSWWSECVFLTTYRSTKAELRYDEYRAMLI
                     HRLN"
     gene            <432207..>433229
                     /locus_tag="CYME_CMO168C"
                     /db_xref="GeneID:16995669"
     mRNA            <432207..>433229
                     /locus_tag="CYME_CMO168C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537510.1"
                     /db_xref="GeneID:16995669"
     CDS             432207..433229
                     /locus_tag="CYME_CMO168C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537567.1"
                     /db_xref="GeneID:16995669"
                     /translation="MMGNGCEGEARLYTRRSRVQLHTIDFVLTRESSFQDRKVFVSLD
                     RIPFANNGGPVYGYSNRGRTAVYNEETKTSMTTASVLVEELSCGLVFIADGSGSFSTL
                     YFVEAVFADPPSHILASCSQTRALSITYLGQGHRRNVWCFKLYSEEQLRCKCRTLRYL
                     GNAKLGLSRTGAACSRCKLDSSMLLLWVLPCTRNSRAASQLGPHLWTHASLLLTRAGN
                     LADAEHFGLDLQNELRKQSALKSNLFRCRIASRTAPGTQPVSASLPGSLDALWASYWA
                     NAPNTRCMTRRQDIAQRAWTRHSGGPQVTLDLEAPFSISRWIMPDVNENIYDVGAWVH
                     HRNHNL"
     gene            complement(<433463..>434473)
                     /locus_tag="CYME_CMO169C"
                     /db_xref="GeneID:16995658"
     mRNA            complement(<433463..>434473)
                     /locus_tag="CYME_CMO169C"
                     /product="similar to proliferation related acidic leucine
                     rich protein PAL31"
                     /transcript_id="XM_005537511.1"
                     /db_xref="GeneID:16995658"
     CDS             complement(433463..434473)
                     /locus_tag="CYME_CMO169C"
                     /codon_start=1
                     /product="similar to proliferation related acidic leucine
                     rich protein PAL31"
                     /protein_id="XP_005537568.1"
                     /db_xref="GeneID:16995658"
                     /translation="MEAAIKKAIGEQLPRQVKELVLDNRCKQSHPSGLENFDSLEVLS
                     MNGCGLTSLTPGFPMLPALRRLELSDNRLTGAGLELLPTHAPRLEVLNLSGNAIRTLD
                     SLKPLRGCLHLRVVDCYGCPVSNLKDYRAFMFREIRGLMVLDGKDENGEDVEDDEEAE
                     GEGAEEDENDEEYEEDEEEIQQEDAVLRQAYGKTRPADLDEEDEEDDRGDAEDGEEDE
                     EGDYDEDEEEEDDNNGADSEDEASGPSGGHYLAGDVDDEDDEDDDGGDYVYDEEDEDD
                     EFSEEEDDEDNEFDDDEDGGGDFDEDEEEEEADDDDDDEDAVDEDEDEDEVPVSKRHR
                     RT"
     misc_feature    433644..433970
                     /note="possible transcribed region"
     gene            434949..436712
                     /locus_tag="CYME_CMO367T"
                     /db_xref="GeneID:16995842"
     misc_RNA        434949..436712
                     /locus_tag="CYME_CMO367T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461517.1"
                     /db_xref="GeneID:16995842"
     misc_feature    complement(436717..438289)
                     /note="possible transcribed region"
     gene            <438674..>441031
                     /locus_tag="CYME_CMO170C"
                     /db_xref="GeneID:16995844"
     mRNA            <438674..>441031
                     /locus_tag="CYME_CMO170C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537512.1"
                     /db_xref="GeneID:16995844"
     CDS             438674..441031
                     /locus_tag="CYME_CMO170C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537569.1"
                     /db_xref="GeneID:16995844"
                     /translation="MLGDSTRPVFLSPGFWWIATALLSTYAVVDAHLGHLTSVFERVA
                     VAVPLGWAVSSWLAYLFASLRYQTLDVRSVRAAWLVQAAIGLFHVWLVQRRRKAGHEP
                     AGTVRDSPARSAKVAPHRPGMGVTALTALIVWPMVSSRFLRNEPDGSVSSGGATWADL
                     PFHMNIAASFLYGTNREFDYRRTEAAFYAGSRLVYPLLPDFHAACLRVSGMSWRMSFL
                     LPALFLAVSASALLYAVNWRLTGSRAAAVLSVLLVMCAGGTGSFEHWIERGWSHATRV
                     AWDVDPVQADREGGRQEILWFAYFGHVFLPQRPATYAIPLILIVILLLVLAMTEGVPL
                     QQSAIVLRLAAFVAGILPLFQAHAFVGAVILCSVLFIMDFDRWYTHMDLLWRGWLTAA
                     FIGLALSAPQLPVYIGRVASSREQRGFLRFSWTAMSSFNRGFWRTWFRALTLHVPVYT
                     LVFGIVSVVLLAQALADLERLFGVRGYFPIVERIQNRVVHLLRGLAPAFSGPSHYWRL
                     KFFPAFAAVFVFCNLFLIQPWVKDNVKLVYIWLFQAAGVVGYLLVRLWRRGGPLGKLL
                     TPLILFFMLFSGFLGMRREWGGVTAELFTPADQELGEWIKMNTHWRSVFLTGEEHVNP
                     ACALGGRSLYLGYLGWVWSHGLPNIHERVQLRDKVLRGDDRNGTELLNLLRFRRVSHI
                     LLEPRIPDPGFESIFNPSDVWLGYENQGWRLYFIKDVVLGDRPIESISREQLFFSTGV
                     SLVALWMAAICLWYLPCVFTRQKTEEDGNYVLPHGTIGGRRMKAL"
     misc_feature    complement(440940..442808)
                     /note="possible transcribed region"
     gene            <441309..>441557
                     /locus_tag="CYME_CMO171C"
                     /db_xref="GeneID:16995650"
     mRNA            <441309..>441557
                     /locus_tag="CYME_CMO171C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537513.1"
                     /db_xref="GeneID:16995650"
     CDS             441309..441557
                     /locus_tag="CYME_CMO171C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537570.1"
                     /db_xref="GeneID:16995650"
                     /translation="MYTHTHTQALFVLEKARRPGRMLVQGTGQRGDNEQHPRPRGSQT
                     GERRFTTRTACSGCVVATHSVGALILMTKRVQLLNRPA"
     gene            <442486..>446214
                     /locus_tag="CYME_CMO173C"
                     /db_xref="GeneID:16995649"
     mRNA            <442486..>446214
                     /locus_tag="CYME_CMO173C"
                     /product="similar to Raf-related MAP kinase kinase kinase"
                     /transcript_id="XM_005537514.1"
                     /db_xref="GeneID:16995649"
     CDS             442486..446214
                     /locus_tag="CYME_CMO173C"
                     /codon_start=1
                     /product="similar to Raf-related MAP kinase kinase kinase"
                     /protein_id="XP_005537571.1"
                     /db_xref="GeneID:16995649"
                     /translation="MTPETIASPPSAARRDEIFVRQRHLYTHTHTERYFGNLLCHDWY
                     RLSGKHPSFRVLVPGIPPPPRLSLWDTRSVSRSNVRPECHLERRCGRSTQSERLCDTP
                     AGTGSSWNRRMDVRCPLACRQVRWWSCRRWGCHQASASGQSIRSSEGTRKIRSLQRVR
                     TGSALLDWVYVAMNLVRSQLALQRLQDGIESVRWRYTVLDALRVEPRFVSALVARERS
                     SGERPATTSSSRDCLVAERLDGIDVGAAVTEAELWTRAAERAPKLVVRLVEFIKVGAR
                     SCVFVYETYTPVDRDATPTDAQVVRVAAQAFCLVRLCETLGTSVNGRLDRSELSFQGK
                     ARGFGPGVLLRREAPAGVLESESAASESIAQQDEKQVVFQLGCLMGDLLAEDTQYYSR
                     RLLRLQASCVREAPEARPTLNIVERKLRRQIQRLVRARSDSGSTEARDEPPSTPEISD
                     VTAPVPSHEDLEEMLHQWESGMSGSQTPGRASKSSRDSESTVPASCAAYPAGPSVDSN
                     PLGGHVEAPWAMESCSDPTPNADRVEQLIQLALGRSEQSFGFPHCIRALLLEAFARPD
                     RAVIDTVLKALRRRVLQDALSVFSRLQALYIIHFLLLRGPRSVYDSAITYTDFISLLR
                     SAGQRSTKTALKQVSPRPKGAGFWVQGCTGGSRDATGIVHRYRERDPYGWVVGSAVHA
                     KGDQQAERSANRRQEMLLEQANELSRHYGALILSKLDAVRTWRDQRGANNDDARHQSR
                     RLGMASSLLQISKSAGKLAEELLTNPAPLPFREPVIDELLLDVLCGFATVTSILAPRL
                     SGVERVRLDHEFVVIFRGLARLFGLAIPYYIERSHEAFLRIGRSLWGLSQNCSLDERT
                     IFIQAARRLPAELAIGCGLRAPDTYSALPALALYAFRACSSSKSGNVRSMQVDATLAS
                     AVATTADITADDYRAAHCRARSKSICTVPSFETRLGNLPLNPEATPARLGRNLDIDWL
                     NIELIEELGRGSFGTVHKARYLNRLVAVKIFEMGRKYAQGDQYRNFYAEVRTLCSLDH
                     ENILPFIGAGRAPDPPRLFIVTEFMPRGTLFDLLHRRREALSPLRKKCIALDICRGMA
                     YLHEHGLLHRDLKSSNLLIDGSYRVKIGDFGLSKSIRYLALDQPMTGNCGTPQYMAPE
                     VLASAPYGTAADVFSFGILLWELLAEQLPYQGLEPMQVITAVLQRDERPPLNPRWDVE
                     LVRLLCECWDRDPAKRPPFRALVARLPPVPFPVPALAD"
     gene            446862..449321
                     /locus_tag="CYME_CMO174T"
                     /db_xref="GeneID:16995651"
     misc_RNA        446862..449321
                     /locus_tag="CYME_CMO174T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461499.1"
                     /db_xref="GeneID:16995651"
     gene            complement(<448042..>449262)
                     /locus_tag="CYME_CMO175C"
                     /db_xref="GeneID:16995652"
     mRNA            complement(<448042..>449262)
                     /locus_tag="CYME_CMO175C"
                     /product="cell division protein pelota"
                     /transcript_id="XM_005537515.1"
                     /db_xref="GeneID:16995652"
     CDS             complement(448042..449262)
                     /locus_tag="CYME_CMO175C"
                     /codon_start=1
                     /product="cell division protein pelota"
                     /protein_id="XP_005537572.1"
                     /db_xref="GeneID:16995652"
                     /translation="MKLLRRSVSLKDQRFEVALLPENSEDLWHAYNLIDKGDLVRTTT
                     WRKVALAGATEQRASARHTERVRLVLTIRVQRIDYDTEAPSLRIQGKNVSENEYVKRE
                     QHHTLEITTGLRFDLIKSQFDRVHLRTLETACDPSKSADIAICVMEEGLAHLCLVSGT
                     ATLLRARIQQHVPSKLQRAATAFGVRDKALERFFEAVMRALLQQVNLEQVRCVVIASP
                     GYVREQFLQYLFAEAARRDLRSILEHKRQFIAVAAGSGRMQAVHEVLASPETMTLIND
                     TKAAVNQRLLQTFYEQIHQDSDRALYGPDQVERAAQMGAVEHLLITDALFRHREVSER
                     KRFVALVDQVESARGQVHLFSSAHATGQQLADIGGIAALLRFPWIDTDDDAQDTDTSD
                     IETRCNAESTATSW"
     gene            448560..451672
                     /locus_tag="CYME_CMO176T"
                     /db_xref="GeneID:16995653"
     misc_RNA        448560..451672
                     /locus_tag="CYME_CMO176T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461500.1"
                     /db_xref="GeneID:16995653"
     gene            complement(<450594..>452282)
                     /locus_tag="CYME_CMO177C"
                     /db_xref="GeneID:16995654"
     mRNA            complement(<450594..>452282)
                     /locus_tag="CYME_CMO177C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537516.1"
                     /db_xref="GeneID:16995654"
     CDS             complement(450594..452282)
                     /locus_tag="CYME_CMO177C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537573.1"
                     /db_xref="GeneID:16995654"
                     /translation="MCSARVGAASTCTAMLRVITFFFISLEAQKCLSRLLGTRPPVVE
                     RDLDALEEKVLAEVGLCLRREYQGACSSSHAPPAGSDELSYERIRSLRNSWRRGTSPQ
                     QANTEVVTARRVTLARWEQSGPTAATRCAAVASTSTERLERKLNFDDIPVEQAESGAL
                     QAIDPILRRCPSLSSVSSEALPEWSSEMSVSRLKAPLSVDDYLSPLTDVADSESFERT
                     PMSSVSSDTSSQVPESGNRSPAAALPFVHVLVAGNEQDMFSGTNPQLRPLLLIHGHSM
                     SSAYFRHVLADFAATGRYVVYAIDMLGWGRSSRPPYTTGRAPRDTAARAQVAVHFMIR
                     GISEFLYSSGIESWCRKNGKRIDIVAHSLGAYVASRYTVEASNGLVQNLVLVTPAGIW
                     SKQSYKRAVYFQLTPQMIMRNAGVLGYLAFRLRWPGRDLGFRSRYLRRYTYALATRRG
                     GQSADLAFAALVTVSHKKRTARCVHPLASDGETTGGSILEQLPCCVNGRIRIVAGATD
                     SLISVHELERAYQVMDKAAPREHQVSFRVIPACGHVPFLEHPEQFLEACGLCDS"
     gene            complement(<453592..>455394)
                     /locus_tag="CYME_CMO178C"
                     /db_xref="GeneID:16995655"
     mRNA            complement(<453592..>455394)
                     /locus_tag="CYME_CMO178C"
                     /product="similar to bacterial putative methyl
                     transferase"
                     /transcript_id="XM_005537517.1"
                     /db_xref="GeneID:16995655"
     CDS             complement(453592..455394)
                     /locus_tag="CYME_CMO178C"
                     /codon_start=1
                     /product="similar to bacterial putative methyl
                     transferase"
                     /protein_id="XP_005537574.1"
                     /db_xref="GeneID:16995655"
                     /translation="MEAVAERACKSQGPCHRPRMNLYCAEWRAFGNFFHALSTLKEDK
                     RQRLVPAYGAGRWASKTGCTPASPTRAYKECARRFVTFPIDEFRTSCIDHELGCTLQT
                     LEMENCQISPDDIKKCGVLTEEQMGSRTKVRALHALVSTTNGGKKRMEFVNRDFNAAV
                     NVRRCAVLEKRPPEWTRENFVGQSLKVELYEKKLESGVGGRSEKTGRRLHDSRRPLVE
                     GTFTATTIHVRRRSTLERRLIASLMTQLNFVPCVRLPSQKCTRYRACRWIHASATTPV
                     TRNPEGKLPALIVQGILAFPPTAWLLKRIGRAGVVKRAEEIGVPWRENVRELRLKWDT
                     LEQKRARLVERDLVYPDYYVRAPFHTYPEGNLGWIPAMEVESSALAVHARLFPEAPPT
                     QGDRLLRDTFLDRVWPRLEQLLVPMGRPLVALDLGASTGLSTMRFIDAWLARYPERPL
                     DITGIDLSTFMLAVAELRAEERSYPSSIQVRFKHAAVENLPQKADSVDLVLCSLVTHE
                     LPMAATERLVVEAYRVLRPGGMLAMMDSDPHSEAFRSIPPVGAAIFRSTEPYFSEYER
                     VDMVSLLTISGFTDVQTENNTPRHRVWLATKPLN"
     gene            455028..456407
                     /locus_tag="CYME_CMO179T"
                     /db_xref="GeneID:16995643"
     misc_RNA        455028..456407
                     /locus_tag="CYME_CMO179T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461501.1"
                     /db_xref="GeneID:16995643"
     gene            457671..458500
                     /locus_tag="CYME_CMO180T"
                     /db_xref="GeneID:16995644"
     misc_RNA        457671..458500
                     /locus_tag="CYME_CMO180T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461502.1"
                     /db_xref="GeneID:16995644"
     gene            complement(<457946..>459106)
                     /locus_tag="CYME_CMO181C"
                     /db_xref="GeneID:16995645"
     mRNA            complement(<457946..>459106)
                     /locus_tag="CYME_CMO181C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537518.1"
                     /db_xref="GeneID:16995645"
     CDS             complement(457946..459106)
                     /locus_tag="CYME_CMO181C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537575.1"
                     /db_xref="GeneID:16995645"
                     /translation="MDDGGRALGSASVDHFDETDSSAFPDSEAYYEPDLLSLSLSDIF
                     TLGSLANLDDKIRNTKHRLVERRRAIERRVRTPEVIRLRDKLSFVLGLLNVLFTEYVI
                     LRQPARLWQWYLYQLTPLLILRYYSYRKSAQHYFMYDYCYFVQALLVAFYFGWPRTQA
                     WRQVMFVALFASANGPVLWAMVAWRNALVFHSLDKMTSVFIHIFPPLVTYNARWHSDL
                     IISRRIGICSHEADCIALGRRAFTVAVPLVIFLIWQTLYLAKILVISRRKLDRNPELI
                     TSLRWLTRHSGSAVSRMLNIFGERYQNLALAFWQLIFTGVTCLPTALFWRYKWMHEIV
                     LAFVGLIVVWNGSNYYFEVFASRYTRRMLEYARDRVQKIETNASSNPEKSSM"
     misc_feature    458620..460052
                     /note="possible transcribed region"
     gene            <460410..>460916
                     /locus_tag="CYME_CMO183C"
                     /db_xref="GeneID:16995647"
     mRNA            <460410..>460916
                     /locus_tag="CYME_CMO183C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537519.1"
                     /db_xref="GeneID:16995647"
     CDS             460410..460916
                     /locus_tag="CYME_CMO183C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537576.1"
                     /db_xref="GeneID:16995647"
                     /translation="MFVSGAFQVPRERRWGAARVARPRRALRLRDAQRRHSGVSILEA
                     NGESKDGKAGGKGGGLFGGLGNLMDAMKKAQEFSKSAQALQEELKNTEVEATSSDGRV
                     RAVVSGQQVPIRVEVSDELIAEGNPAVSDAVTEAVRNAHVKSAELMRQQLADLTQSYG
                     LPQPPKQP"
     gene            complement(<460969..>462495)
                     /locus_tag="CYME_CMO184C"
                     /db_xref="GeneID:16995629"
     mRNA            complement(<460969..>462495)
                     /locus_tag="CYME_CMO184C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005537520.1"
                     /db_xref="GeneID:16995629"
     CDS             complement(460969..462495)
                     /locus_tag="CYME_CMO184C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005537577.1"
                     /db_xref="GeneID:16995629"
                     /translation="MGHSLRCRVLFSWILLLALFCSVGLCCYVAYALPVKTLGLSDIS
                     RSKQARLRHLYYPKGTKPAGTLTVGRILERVRSQQSCSSPLGVEVSWSWISRSEGIVY
                     WQFLNPKNESLAVVLNRGATDVAAYPFGGAFFPAYLTGETDGTQLASISGGPYPPLTD
                     SLTIPLGLIKGQQAGVAYVFVVPSGSVVIVPEGGFVNGMEPTCASVVDVRFVENVGME
                     LSYSVCEECLDFYRETGMSAPFYCPANPMETNIPMYEPVETSATFDFWPQQGSTITLG
                     PPIYNESAKFVALESFSGCPSTLAGGQSFIGCFPAESTVERADGTLVPLSALEPGTRI
                     ATLVPNNRGGWTKRFTTAYAFADKQTAAGPFQYIALHTSSGGVLHMTPDHLVYVQPGD
                     AHERPRFTRARNLFPGMALLHEDGSTDTIVRVTEHVDTNAYAPLTFEGTLLVDGYLVS
                     SYGDTASHGAAHWAFAPLRLWYRLRHSTQKQQQQQPASNGLHSYAQFLITWRRLLLKI
                     "
     gene            <462835..>464427
                     /locus_tag="CYME_CMO185C"
                     /db_xref="GeneID:16995630"
     mRNA            <462835..>464427
                     /locus_tag="CYME_CMO185C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005537521.1"
                     /db_xref="GeneID:16995630"
     CDS             462835..464427
                     /locus_tag="CYME_CMO185C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005537578.1"
                     /db_xref="GeneID:16995630"
                     /translation="MRLAMKSLTTLVFVVEIVVCLSVWSGLALPVYRSDRPQLVFAKP
                     PQQQQQQQQQQLAAGVRLERAPLHPLDQRVVQEVSGAPLGQPSLRTSGTSCTSGAGVE
                     VSWTWFNQTSGIVVWQFYNPTSSERAVVLNRGAKGNNSIIESYTFGGAYTFAYLGNGL
                     ATLAPGPYPTLEASPSVLPVAIIDKSDPDIGFLFTIRAGGTVSVEEGGFVNLEPFCDS
                     VPDVSFAENADVNITYAKSVMCEEYYFQEGSSNVTCSSNPLVTTWPIYQVANGSVTGQ
                     NYIIMDSNTQIEFLNVSNSQGGSSSGFSCFPGDATVTLSDGQVKPIHQLKKGDWIYTL
                     SYDAKDRKWSRVSTRFLGFLDHKPAERTEFLRITLHGTDSVLEITPDHLLPVVAAGPS
                     PGEQRERYMPARLVVPGAFLFLETGELAHVRSMTWVQRTGAFGPLTEAGTLLVDGVLV
                     SCYAHTGSHEAAHMSMWPLRVGSRLSRWLNPVHARVPGSACASTGMHPYARVLLALQY
                     MLRMFEHPRSKQYLHKHQHIWL"
     gene            complement(<468517..>469047)
                     /locus_tag="CYME_CMO186C"
                     /db_xref="GeneID:16995636"
     mRNA            complement(<468517..>469047)
                     /locus_tag="CYME_CMO186C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537522.1"
                     /db_xref="GeneID:16995636"
     CDS             complement(468517..469047)
                     /locus_tag="CYME_CMO186C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537579.1"
                     /db_xref="GeneID:16995636"
                     /translation="MEPLAFAPDGWFGHWVERRPVCRCSVPRVNAVFRSRHREEVRAS
                     LEPNDPKRRTFIKQVGVGIAAFMTQWLLGAVSDARAREPPPTGPCPNCRGKGRVVCDM
                     CGGTGFWRAGGFAEDKRAQYKGTVCPQCDGKGNLVCPVCLGTGEANIRGMLRRRRVPT
                     ESGRTLQTNFPEDDQS"
     gene            complement(<469626..>470996)
                     /locus_tag="CYME_CMO187C"
                     /db_xref="GeneID:16995637"
     mRNA            complement(<469626..>470996)
                     /locus_tag="CYME_CMO187C"
                     /product="heat shock transcription factor"
                     /transcript_id="XM_005537523.1"
                     /db_xref="GeneID:16995637"
     CDS             complement(469626..470996)
                     /locus_tag="CYME_CMO187C"
                     /codon_start=1
                     /product="heat shock transcription factor"
                     /protein_id="XP_005537580.1"
                     /db_xref="GeneID:16995637"
                     /translation="MGAADITQDPSFDSKMDTDKPQTTVFIQKVYDLVQDAETADTVS
                     WEESGESFVIWRVGDFTEKVLPAYFKHSNMSSFVRQLNQYGFHKISHERWEFQHEFFR
                     RDRPDLLSQIKRNRPERRKRVLGASGTSGSSGSVNHGSAFKPVQGVRMLPGGVASKPR
                     LDANAAYLQQHINVPLAASELLGEEDLATFNTSDSGNQRKPPWLSRIFGRGNRTIEIG
                     KYGSLEDEAARLRRDNSLLLRELSELRRLYARLEQRLVESEQRESEREEQLHNLQGFM
                     LRLFSSVEIMNSQLASAGLDFLALSPEWTQALTYLSDQGDLSNRPVPDLRQVGAISGQ
                     HIHDTDPLELLQPDSSQLENASVSNTTSDSFGRETPQTTVADAYSSVQQSGIIDQELD
                     ALQQRMQQMYQEERAGFSTLHAFLDQQQTRPGRSAPEVTPSVPGLRILGEDVLLQGPT
                     GSSETT"
     misc_feature    complement(471537..473504)
                     /note="repetitive element"
     gene            <475842..>476510
                     /locus_tag="CYME_CMO189C"
                     /db_xref="GeneID:16995664"
     mRNA            <475842..>476510
                     /locus_tag="CYME_CMO189C"
                     /product="similar to ubiquinone biosynthesis protein COQ4"
                     /transcript_id="XM_005537524.1"
                     /db_xref="GeneID:16995664"
     CDS             475842..476510
                     /locus_tag="CYME_CMO189C"
                     /codon_start=1
                     /product="similar to ubiquinone biosynthesis protein COQ4"
                     /protein_id="XP_005537581.1"
                     /db_xref="GeneID:16995664"
                     /translation="MQHALSKAGRLFLAGAAGAFVLRNPVRADLVATVGEILPGTESV
                     LRGHLKELQKTEEGRSILKERPQITAETLAAVALLPPETLGGAYYAFLKKHSFNSSER
                     AEASFISDPDLAYIVQRYRDIHDIFHVVTNLTPTLTGEVALKYFEALQMGLPMAVLGA
                     TFGTFRLTARQRAALFRDYVPWVERNARSCENLLGVYFERYWQMSLTELRKKLRLEPF
                     RKEF"
     gene            complement(<477236..>479647)
                     /locus_tag="CYME_CMO190C"
                     /db_xref="GeneID:16995665"
     mRNA            complement(<477236..>479647)
                     /locus_tag="CYME_CMO190C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537525.1"
                     /db_xref="GeneID:16995665"
     CDS             complement(477236..479647)
                     /locus_tag="CYME_CMO190C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537582.1"
                     /db_xref="GeneID:16995665"
                     /translation="MSRQRQTERVLATDLSLLASRCLADPAAYQEVFTAQRQQFETLA
                     ALVALEPGARHDRFTKLVAFLATVAGAYPNACRAVAEFLVQFLTERAATLHAALRYEL
                     VQAVTRFRNRKGETFLTATAAVDLYVALLRFQDKTLRRLVLGQVLAELRRSQRNQRPL
                     HEKIKTRLLQVCQRVLPEADASMAKSLLRLFYRAYGLGLWQSDARLIQLVADTCFHSN
                     TSVAAQACRFLLETDAAGRSSADDSDSAAESTSADDEAPSEKQQAVQSRACKSVASAD
                     DGMLRMLNTRFKRTQKKSSRRKQRFQRELRRALRNTAEDGASPGASSFPPMNTRRGNP
                     GSDAPALTLLYDPQRFIERLLHRLGARQEKFEFRMLILQLACRCSGACRQCVPLLYTA
                     LQRYLMPSQQHVTRVLAMLVDAVHADVPAELVTPLLRHLAHYFVSDRRTDEVVAIGLN
                     TIRELCARVPDAMDSILLQDLVQYRKSRDRGIMMAARGVLQLYRRVLPALLPRRERGR
                     PVAAANAASSADSRHRTASVVATEDDSDAATELSWTELKDAARSEHRADVSVPGDLEY
                     DSTSDQEYDSMSPDSLASDAFSDEASSEQTNGLSLSSSSPVTDRCSLYPMGHTLPPAS
                     LETAVGVQSADGRSPADAEARNTALMDPCGTLPHARMPHSPEDDDDDDDDDIPQADGG
                     NIAMTDREALRSCSTKEDRALANAAFMQSAVVRFEEPFCPASPQRLESAFKRRRRSLE
                     ERLASVQRGRLDRPRYSGDPHRHHKKVGGLSNAEKAKRKPMAMLRPKIFRQKRNRGRK
                     SRKRS"
     gene            <481412..>481699
                     /locus_tag="CYME_CMO191C"
                     /db_xref="GeneID:16995656"
     mRNA            <481412..>481699
                     /locus_tag="CYME_CMO191C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537526.1"
                     /db_xref="GeneID:16995656"
     CDS             481412..481699
                     /locus_tag="CYME_CMO191C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537583.1"
                     /db_xref="GeneID:16995656"
                     /translation="MHRHARSCSAGEPGAFALPPGAHATRRVGGSARPTPEASQSYLL
                     RLEHVHLSIPGSERLLLRDLTLHVHRGEHTLIEAPSGAGKSALVRALRGNW"
     gene            complement(<482926..>485334)
                     /locus_tag="CYME_CMO192C"
                     /db_xref="GeneID:16995657"
     mRNA            complement(<482926..>485334)
                     /locus_tag="CYME_CMO192C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537527.1"
                     /db_xref="GeneID:16995657"
     CDS             complement(482926..485334)
                     /locus_tag="CYME_CMO192C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537584.1"
                     /db_xref="GeneID:16995657"
                     /translation="MRAFAEWLGNGAADAAASVVFHSEERRLLFNCSEGTQRLCIEYK
                     VRLGKLSHVFLSRLDADTCAGFLGLMLSLADAGHAGLTMFAPRGLEKTLSTAKRFASR
                     PQYPLHVHELGEDEPSDPLVQNPLFAVYALPWLVDEQLQRSLATQKDQVKRHCGERRD
                     EEVPEALSSSSKNEVAERIFVTYAVRVADQKGRFVTERAAALGIPRGPLYGRLQRGES
                     IEVEQPDGTRRTVHPTDVMEPSSPGPLLVMLCASSPDLVSQMQAPSGRQRLKQWFQRL
                     AASTPTHRQKRPVCVFHFLCAEVFSDPQYQEWALDVFGADAYHSVACESFSNQRITFR
                     GQAAMLERLKFVDWNWFLEPWTAPADPRARTTSALPATWQLAQPLLRFNAAPRTTLGW
                     ALPESHAAANHGWSRLNVPREPDTLKRTSSNNDSKTYSVLFLGTGSALPSRYRNVSAI
                     LVDLVDHALFLDAGEGTFGQLVRAVGLDTAKAMLLHRVRCIWISHMHADHHLGVGSLV
                     ALRTRLARELPQSERLGTAMMPLMVLGPRLLGRWLEALAELEPMSYIFLDNAALLQSD
                     TSPLSEYFPQTLGIHLRTLPVDHCPEAYGLVLESALAAGWDQNGSKEQQALPVPTSAP
                     STARSSDNAAAAASWKLVYSGDTLPYDAGLIAAARGATLVIHEATFEDGKEAEALLRK
                     HSTIGQALGTIESMQPQRAVLTHFSQRYPKLPLISSAETQQRLKANSCLLAWDLMRLP
                     WFSKDGEQAGSRTLTTTPPAVANSDVVSLFLQRLLTEFASEFEEPLEIADSELDAELA
                     SSEG"
     gene            <486632..>493012
                     /locus_tag="CYME_CMO193C"
                     /db_xref="GeneID:16995641"
     mRNA            <486632..>493012
                     /locus_tag="CYME_CMO193C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537528.1"
                     /db_xref="GeneID:16995641"
     CDS             486632..493012
                     /locus_tag="CYME_CMO193C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537585.1"
                     /db_xref="GeneID:16995641"
                     /translation="MSRLQEQLRIIREREEAHRILGASRCTVLFPDETIASRVSWSEL
                     AALARNGLEQLIKFDQRFASFLDSDLFHHRYVIEGATALPALDRGQESAAANAETQQL
                     IQHFCYLLVPYFTTRPGQKCVEWLLRAHSAGALDPASLVVAALPYIGTEAFERLVAAL
                     HLAQHGVAKVRWHWLERVHSLDHLVEQSSELNWFVPFLLDTAEALVRARVSAEGWHRL
                     LLCYGSTLVAKHPLRAGSVIRLVTLSLSRVGQAAERDKHLWQAFWYAALGMLVAAYRA
                     VGAAVRSDVFSATVRALLRLYVRTRTWYSGDPAWCRRLTLVLANLYAGSPHQPFPHEC
                     LETLSSCTDEWYRVLGALDASETESLRTAYSLALLEYCWHQQDADDDCWHQLVARLPP
                     SPSGCSALIGRLLELFDATVASESADATKVHSAADAQMMRSQRMMDASTETRASLSAD
                     HANANLETPGSPCSATEMQAPAEWHETTSHGPEVLLSKVSCKRGGRTTTHPPSDSDAD
                     RERFRSAAPTTETASSTLAATPSGSLDAKHRAQPAGMLPGTRAPSASALTRATVEPGD
                     ASAADAASGARVVSAGIGAEAPPEDTSTAPHSLRRRQVPSEVAALDRSQRILRPLVAH
                     VDPVTFWEALYAHERRFRGRARSWTLLCERCIAASSPLRSLQHPDPRVRTRTLHALSQ
                     APSAVQEQALPIILELLQQPNGFEDDVQRALCAPDDATCGDVLWLRDQLVRVGAPALE
                     SLLPRAMLLYLRAVGACPVRALVRCYRLASRYRHGMSASPKEADEIHSRGLAEGVIVW
                     EAAFEQLCAHWKLAPETNAERAARRAEPAEMWFRRLGERFGRSRGAEAFTALLEQLVD
                     LTMNEDENGVTACTLLLEWLRTGADLLDEVTIWRFLASIVHRLAAVHWLAPVSRILHT
                     LNDRLAQTKPITDPMLVMPHVQRILEAIASVLARAPHPSAITVLAETFIWLATQSSPM
                     ECEAVCYALQLDTYREQVLEFLANAGVQAARWLAVGAIEPVDVPAALALLDTCSANLG
                     VAGTTALLEHLFRACATDATWSAQLRQQTRRLLHQIVHEHPENDHREHLLDRHTAQLV
                     ATCIRLLKPLDDSDWCVVEPLWAVSKASTGLAVIRALLDALQERATDASIPQAPLSRP
                     LITALIAACRWLATGPTEQPAFTLVVPRSWLVDLLQSSAFHADNQKSLWLLEAIDLGR
                     LDWKPEPPAASNEHVSTTPTTATRSDSDPWMRFIQEQFDLACSGTLDTNRLSCVLCVA
                     LRDGTARAALQARHVAALLNANKASTCTHVPQGDHQRWRRHAARLLIQCLHDAGTRGS
                     GLHGELLEALLGALCQHHEWLPASERPAYRVTVVRGLVCYAQSLRSGDAVHAMWNVVC
                     LTASRDLPLDAVRDLFREVIGQDEAALEPVFRALRDARRIRAGTLAPVHAPGAARRGD
                     ATLSEHRSSLSSSSSSSSTTTTTTATSPVSATAMDRLWLQLLQDAAACAPRHVRRLLS
                     EASGIAPAVLQRLPEYLDMGRVFGNDSTEDILSFLETRHLPVALVQHLVTQVWPLTRI
                     REALEKRAQPVVMAILVEHLVRVARADVPRKQHHQRRELQETLRVLGRLLLEQNADPV
                     LVRRWLEHPYTRTLGPGMLPLLAAHADPVCVACAVRTFGHKMVPHLPRVLAHWPAPPV
                     VQALLETLPEFVSAPYIRQLWASMSESFPDDREAAAMRSLLVEAAPPMSILEALKAET
                     QHLACLSGWKMMHTEPFQSLTAALSSWDSTLVQRSSEQILAVIWRGLESRERIMMKAF
                     YAGRETEPSISEQLEQLETHCMEALVTMVLVLPHPACGEILYRSLLWCQSFAADEDSA
                     GGDIASERPARPTKRQRSSSSSSSSTSSSSTIGSDPDEAAPLGRAHMRRASHWRRIVW
                     FKLITKFASRLGSRFQEYVELVWDTIAEHAQLDAAGAATPDPTPSEAAEVRVAALETL
                     AVCLEAATPSCAQLSSSQCETCLDILAQWLSEAHMASPVAATALERLVAALARSGLSQ
                     RVTTVSTTSGTSSPLVRLGRLILVMPEVRRVPASSAAAALRLRVRLVRVLIETLDEAY
                     LPPLLPRTLSWLAEVLDNPDSAVEEMARDIANRLSRISGEDILTQLRETPAI"
     gene            complement(<493189..>494055)
                     /locus_tag="CYME_CMO369C"
                     /db_xref="GeneID:16995642"
     mRNA            complement(<493189..>494055)
                     /locus_tag="CYME_CMO369C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537529.1"
                     /db_xref="GeneID:16995642"
     CDS             complement(493189..494055)
                     /locus_tag="CYME_CMO369C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537586.1"
                     /db_xref="GeneID:16995642"
                     /translation="MPVWARNPSKAWAERYLLLVCPVAVGFLLGAVVATGWYQRLDAL
                     GYALVSLAMALVCVLPPVLFPGTPDRTLPWQERFIFKANVWNGVFGFIGNYLWTHYFY
                     RLLGAEYTFPSWRLNDVPIPCYLATQPYFCMYHTLVTLVLRLGSQRWTRLQRVLVVLV
                     LAYGTAFAETVTIAAFPHYRFRDWRRMVWIGSAFYGLYFVVSFPMYYRIDEDEVPAVR
                     FDEYRRPAQGKKRPASATRWTLSQVALDALAAAMLVTLLLEAWRLAIGGIHEDIYADA
                     GAGANPWMLARV"
     misc_feature    494132..496540
                     /note="possible transcribed region"
     gene            complement(<496177..>501330)
                     /locus_tag="CYME_CMO196C"
                     /db_xref="GeneID:16995638"
     mRNA            complement(<496177..>501330)
                     /locus_tag="CYME_CMO196C"
                     /product="probable microtubule organization 1 protein"
                     /transcript_id="XM_005537530.1"
                     /db_xref="GeneID:16995638"
     CDS             complement(496177..501330)
                     /locus_tag="CYME_CMO196C"
                     /codon_start=1
                     /product="probable microtubule organization 1 protein"
                     /protein_id="XP_005537587.1"
                     /db_xref="GeneID:16995638"
                     /translation="MTDEDQLIEEAKKLPIPEQVCHKLWRVREAALRKVREAIANGST
                     APSASDANLLAGAVRDANAAVQLAALDAVVALCDACADDATASAVLRKTGAAAAIARG
                     IAEKCLAGRPQNRARALDAALGLVSCDAGDDLVTVLCDVGYENRLPKVVSAAADILRT
                     CIREFGCGSNGEAAISANAASKGLDKLLDHSNQEVRSAGKALLLEIYSWLGQSFLERI
                     LKQVDIKPVMKAELTEACRNLAEHATHVPGQKRKPPRLTRRLERTQRVRSQQPREESA
                     GAPRASTKAIPERDPSLACRADADPGVCIGSLVDAVQVRVDAEDEGKSQQTLDFFQAL
                     GHQKWSVRKSALDNFLEKLQAASHIDTTRGSQLAAEIQRLIGKDANVAVATAAARVIA
                     QLATKSDKNFRAYGKMLAIVALSRLKEKNRILVEALRAALDALAASRAVEFSEVTPAI
                     IEAATAKVPGSRTIALQWCSRLIRQCSAQDLRPALRELKLMLAQTTADAAADVREAAL
                     ECVALLQVQCGTNAVSSLIEGLEKSKLDKIQKIVADESKELRAKPASPAQQVSSAQPG
                     RKPNAASYLSSSIIEDSFAVPPKRPGKMDAPVSAAAAAGAAAAHDAHERIASTAGAGP
                     ERMLRKASDGEGIVLADAAAGSRRTPIAKDMLVAGNDEDHSSVYSGALLEQECKALEQ
                     LVEQAVESDDHGALGRCRALVQRIHTTIAQCPQTSLRTARVASLAETIAYLLIQAPGL
                     TECSQLLLELASLGTPALVFACFERVCRDIPDLRARILALEFIQYQLVERFGMDSLPM
                     GAVLDMTRPLLPEQPPACADVVLRVIASLVRSKYGTEMQRGLVELGIPAAYRAQLEHL
                     DQENAAPSVVNCNGPMSGDVEKSGAGSEQNPLKSVRGSRYTNCTMSSMPTNCGSTAWS
                     SPAERHSGTTRTLVLDRIQPVLRNLESANWKLRQEALQDLLRKLAEPDLVVDIRTISP
                     ELLKALASRIADTNRNLGVCALNVLTHLGEATVESMKTQRLPGADDSILRLFLGSVIQ
                     HGVNDNKRMVREAALQCMSAWYPAVERDNTDSRPSFARYIAAALSLELPAARLETLQW
                     LCERWSRGAEQRTPSEAEARLVLEPVLLCFRDKNGHVRQLAERLVEVIVRLIGYAPIA
                     AQIRDISNEQVRKDVLTRTEKFRSMSPARSNRSIVSSPQASPGGASAPQTPASDVSER
                     RLHAEQADTLNAGDGSPLGAVPVSRDAFQLDADMQHSDTQFAAMLARAKADTAVVVGT
                     GTAALDSQVPTGRRPVQPPIDGLSEPRALSAVPSLQLPPERAIRLDETANRHTSFEPP
                     IAPTPCLPEGRFWRRTAVPAAGAGVTATAVAASGAAASGAAAAADSAEQQVRRLSHTL
                     LGESASAEERIQAAKELSAMMKAGQERSLQHHAADLCLGLTQGIRSVLAAAAEASPVD
                     AAGMRIVKYLLNALMHLIMKRELACLLSLAALELLITEVCDRLLDHRVPAYPEGPQLL
                     RAYNLLMLKTLEHAPVLVLSRALVRALRAAVRSVQTVPVSQAPTSSKETTPSRIVMLQ
                     KCLHRLCNQVLTSGPNTEKTVTGATSPLLETHLDLLLYELHVLFTMCATLPADRVQQT
                     CDEARLLVRALCHHCGIDTVRSHLRLVPVAVQPFLVRLVDALARQDTDWERIPLIAPA
                     TPLEALPSSGTAAPRSEASPPPPTSAPTLQTQQIRERLARLRAHRQRNA"
     gene            496230..498216
                     /locus_tag="CYME_CMO195T"
                     /db_xref="GeneID:16995640"
     misc_RNA        496230..498216
                     /locus_tag="CYME_CMO195T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461503.1"
                     /db_xref="GeneID:16995640"
     gene            <503044..>503862
                     /locus_tag="CYME_CMO197C"
                     /db_xref="GeneID:16995639"
     mRNA            <503044..>503862
                     /locus_tag="CYME_CMO197C"
                     /product="20S core proteasome subunit alpha 7"
                     /transcript_id="XM_005537531.1"
                     /db_xref="GeneID:16995639"
     CDS             503044..503862
                     /locus_tag="CYME_CMO197C"
                     /codon_start=1
                     /product="20S core proteasome subunit alpha 7"
                     /protein_id="XP_005537588.1"
                     /db_xref="GeneID:16995639"
                     /translation="MAGVGSGYDLTTTTFSPEGRVYQVEYATKAVEQSGTVIGIRCVD
                     GVVLAVENLRGVKLLRPDSLRRIFAVDRHIGIAVAGIGPDGRHMVGRARSEAQNYRSV
                     YAEEIPPSLLAERLASYAHVYSLYWHVRPFGCTILIGGWDASQGPCLYVVEPDGSGYK
                     YRAYANGKGRTAVRTALNKLNFEQLTCTSAVQEIARMIHQSRDIAKDKPYELEMAWIS
                     EASDHKFARVPGALVVSSRQAVEEEPQQMETGGSTASADRGETPSTSTHIMEES"
     gene            505476..505565
                     /locus_tag="CYME_CMO198R"
                     /db_xref="GeneID:16995592"
     tRNA            join(505476..505513,505530..505565)
                     /locus_tag="CYME_CMO198R"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:16995592"
     gene            505513..509249
                     /locus_tag="CYME_CMO199T"
                     /db_xref="GeneID:16995686"
     misc_RNA        join(505513..505518,505530..509249)
                     /locus_tag="CYME_CMO199T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461504.1"
                     /db_xref="GeneID:16995686"
     gene            complement(<506534..>508807)
                     /locus_tag="CYME_CMO200C"
                     /db_xref="GeneID:16995687"
     mRNA            complement(<506534..>508807)
                     /locus_tag="CYME_CMO200C"
                     /product="similar to nucleolar ribosome transport complex
                     component Noc2p"
                     /transcript_id="XM_005537532.1"
                     /db_xref="GeneID:16995687"
     CDS             complement(506534..508807)
                     /locus_tag="CYME_CMO200C"
                     /codon_start=1
                     /product="similar to nucleolar ribosome transport complex
                     component Noc2p"
                     /protein_id="XP_005537589.1"
                     /db_xref="GeneID:16995687"
                     /translation="MGSKHPPQELYKRSGRVAWQEPKRRHSASKRTLSSDAPQKGSLD
                     ARRKRELKRDHTGHKRRRLAADGGAFAGATRALEAPAARQRNNNSRNASGTSGLSEDY
                     ETETSLVDLDPVAAHQQELVNLQKQDPEFYAYLRSHDDALLRFGESEASKATVADGNA
                     SSSAESDQASAASDASSSASGPADHATSDTYEAHRLDALEQSATRPTRHDAKRLRLDV
                     SWIQRIRRELMRPSKRMAALRRLVSVLSHLVRERDVPAGNSDQARIGSFADADARHRV
                     MLFAIVAVPAVLQRHLGAKLRDLDPNDPEWQRYRRLMLSYGMCFSSLFALVRDPLTKC
                     YLIRRIEKLAHFLPLLPKWSKTLIRDLTIIWARPEELIMIRSQVHATLRALLGNLQPC
                     IAQVVLRECYRTFTQTFKSRNPRTAASMDFCLQSARELFAESGDASYRVAFGEVQELG
                     FQVRKALSSGRGCDCEAILNWSFIHAVEWWSHVLAVHEQLASLRFPYLQIVLILIDGL
                     RSARLFGARFACIRALLRLAGEVHSYVPLCASLLEMLGQVECDRTTKGAARREVPVID
                     WPRLLRIQDAVLQSSNFGEAVVDEVVYSLLNWLTLYVRESAFPELAFPIQKQLIRLLR
                     SSKSRFLRERLVVLVARLKDDIAAISNWRQANDVGAAMKVPNFVVIRLEQLLAAEREK
                     RARVQPTGIIIPEPDSMASESPAAHTEEQPRDHLRVTDELLAQTDDILLEFHLDEDGE
                     TEPDAMAIDTKANVHLS"
     gene            <510889..>511854
                     /locus_tag="CYME_CMO201C"
                     /db_xref="GeneID:16995662"
     mRNA            <510889..>511854
                     /locus_tag="CYME_CMO201C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537533.1"
                     /db_xref="GeneID:16995662"
     CDS             510889..511854
                     /locus_tag="CYME_CMO201C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537590.1"
                     /db_xref="GeneID:16995662"
                     /translation="MSRFDVHTDPKSPFDPILPSRSGGYCTSLCTWVQFRHALSGRIS
                     KARFRSRSAFATLQVQVACKLSDPVMFLVTKNYLAVRLSIRAEGNAAFTRTVSQRGRL
                     RSERNRWSMHHRGSGFGARAPVTADSSSRKERNVLRSFATAALVALMAVSSFNSPLKL
                     YRPAFAEEVFKVPGGGASTLATGTSKIVTRGVNLEGANFAKQDLHGVSFQQSIVRDVD
                     FSGSNLQDASFFDADCSGANFQNANLSRANLELANLRKADLRNAILTNAYVVGQTKLE
                     GIQIEGSDWTDVLLRPDQRRLLCKRASGENPVTHIATKDSLGCAD"
     gene            <514343..>516145
                     /locus_tag="CYME_CMO202C"
                     /db_xref="GeneID:16995663"
     mRNA            <514343..>516145
                     /locus_tag="CYME_CMO202C"
                     /product="coatomer protein complex, subunit delta"
                     /transcript_id="XM_005537534.1"
                     /db_xref="GeneID:16995663"
     CDS             514343..516145
                     /locus_tag="CYME_CMO202C"
                     /codon_start=1
                     /product="coatomer protein complex, subunit delta"
                     /protein_id="XP_005537591.1"
                     /db_xref="GeneID:16995663"
                     /translation="MVVLAIAILNKLGRLLISRQFREMQRTRVEGLLAAFPKLLENEM
                     TRSGENRQHTFLESDTVRYVYQPVENLYVVLITNKTSNIVQDLETLRLVSKLLAELSP
                     IVGVIDETAVYEAAFDLIFAFDEVIDWGGYAEAVNVPQIRQYLEMYSHEERLAKMIKE
                     SKMHEAKEEMRRKANLIEKQKQDLAKLPPEIRRLMGLEGSSVSAGSGAPAVSTGAYST
                     GNMRGFGPQDFSGALGGSTLLGDVGPAPSLTLGATRIAADQSASITVSAGGRGLSLGK
                     PKARTEDWMAHLHAESETSSADAQRSRVTPDHTEPTASQRAAKTVPSESATRAVATSS
                     IPASDFHLTTEEKLSISLTRDGRLESFQVHGELLLQIRDQKRAHARIRLKPLPESMMQ
                     KVQLRLHPMLDRSLWQQSWVLAQRNAERPFPYGSPTPMSLIKWRFQSTDESLLPVLLT
                     CWPTVSSDETSMTIEYEMMSRASVSSDLCPPSSLSSVQVHVPLPRTAVQPGFFQLTRV
                     DGRATLDEAAAAVLWTLPPLEAPCSGALEFTIAAVENPERMFPIQIQISATEVYTKLE
                     ILRVEVATSPESVPTEETAFTQEHRLLTDRFEIV"
     gene            <518238..>521024
                     /locus_tag="CYME_CMO203C"
                     /db_xref="GeneID:16995660"
     mRNA            <518238..>521024
                     /locus_tag="CYME_CMO203C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537535.1"
                     /db_xref="GeneID:16995660"
     CDS             518238..521024
                     /locus_tag="CYME_CMO203C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537592.1"
                     /db_xref="GeneID:16995660"
                     /translation="MERLLTAISRLKLGTHPQVSSVADHQLKSSAAALSRTLCSTSDG
                     TRLFLLGADGGLWLTNAEELWRSAQRLGEESRTEFFVSSSGTLGTPVHLTPALRFKPI
                     ACALSSSDRFLALYDEEFCAVVDLQTVPSSQTWLDQIAPAPVTAPAVLLGSRTSQRAA
                     FTLRSIRQVSWHPWSDGRLAILYDDGMLELYDTLEATLPEQTLRIRLPLSGSEAPAAT
                     GVEDTTVASVSIQNVSGALEQTAGQRTLVKTEAPAAFAFGPLTEPSEYPWELVTLYLL
                     RESDGALFILCPFAPTGLRLPAVWVEAVHGQLETGALADTATSSAADATTWAELQMRL
                     RREWLALCTSRQARMDLESHRADSEKAPPVYRLLRPPRTFNMQWTPLLQGPVHIEHDA
                     ATAASHWAPACGIQVLPSPLGPLLLRTWWHGVLDVLVTMEKVEPVWAPSSECSEQLPA
                     EEDVAPSLLLYERIFTGAPCAHSIVGESPTGLSTSCAANDEHLPLPWVSPAQTVPRLQ
                     RSVLLIRSHQGVSALYLTWLDMISHVLSPRSWPSSSLFHSEPDSNDEFMESEQLEQLL
                     EQLPCSTLVQSLASEAAPLGLAELRLPSTVTLVNGPAANLLLAMDADGEHLRAAALHW
                     WRLPSVGASLRFPRSSMTTRELEYTDLVHACSPAVKAGAAAASTTTTTTVATKIRSAS
                     GLTPLEQKLTQVFGSLVPWHTSGVSHAAATGDAQELWEQTRTLVLLWQMIQTIIQPLR
                     LFYAQTLSSTIEQLPLRLETNARQYSYLQHRLEMLQSRARDLDHRIRILATGMNENLQ
                     KRAAGLSELLLHRKPMITPLERQCFRQLERYRERLCEFQQRLTQLQRQAAAARQSGSR
                     ALPELDIREDWSLLRKTQQREIRQAIEENTRRLERLCQVSQETRASIERLVHMHDMRF
                     SSLTGTCKDDTRIL"
     gene            complement(<521445..>523619)
                     /locus_tag="CYME_CMO204C"
                     /db_xref="GeneID:16995661"
     mRNA            complement(<521445..>523619)
                     /locus_tag="CYME_CMO204C"
                     /product="similar to retinoblastoma binding protein 2"
                     /transcript_id="XM_005537536.1"
                     /db_xref="GeneID:16995661"
     CDS             complement(521445..523619)
                     /locus_tag="CYME_CMO204C"
                     /codon_start=1
                     /product="similar to retinoblastoma binding protein 2"
                     /protein_id="XP_005537593.1"
                     /db_xref="GeneID:16995661"
                     /translation="MPQQNVHQSIADDAQSGVYAEKEHSIASGAHSERAAPAAFAADA
                     PVYRPSPQDLENFVNYVHRSFTEWESHGIVVLSIPPACLEKYGVSEMELTEALHQTMV
                     QPRVQRFPQFAPSERSQRSPQKRVRRTWSNAGWPCFPESNRSMSAAAFRDQVRALDAQ
                     LVDWLQTHARASLPATSEPETKSIPLETRLKWQKSIIPERVQWLEACFWEALEHGFAG
                     HPRSVQYAIDIVGLSGSVSDTELPPWLPQGLHYHRHHHQATSCEGCTGAGTSPGGQAV
                     PLKPLSLLRFWPRAGGINVPMAYLGGLFTRFGLHVEDMHLCSLSMLWFGEPKVWYAIP
                     ASFADRVEHLIMERWSAASLSGANASCSGALRTPHTLPWALTSKSLLISPASLAQHGI
                     PVYRAVQVPGQIVLTMPRAYHCGFNCGWNVAEAVNWAPLEWLAFSRRAIGWERALQKT
                     GTVNDVLLGFVQMLAALNQAGAALWSNRERSLLRQALCPCVRANLLLIELFRREQTLK
                     CRADNPASCFLVYWIRSSAACLEAAAVLHHWRRKLRLERLHRSWTTTRQRAWNSVTNT
                     LANAQVWRFPRMAIDRLVAGHSWWQEAICVSTLFCSVCRAACGINFAICLECLEFEGN
                     LVKGIRCEEHLMVPCHAEFASGVLMPPRTECQREACRPYDQHSDPVDQEDAPARQQQH
                     QQLPMLVVSHLPPARLLGRLLRYWNESTTIFRACDDSLSAWR"
     gene            <526274..>526657
                     /locus_tag="CYME_CMO205C"
                     /db_xref="GeneID:16995684"
     mRNA            <526274..>526657
                     /locus_tag="CYME_CMO205C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537537.1"
                     /db_xref="GeneID:16995684"
     CDS             526274..526657
                     /locus_tag="CYME_CMO205C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537594.1"
                     /db_xref="GeneID:16995684"
                     /translation="MAKNVNDQTELRIGHEGNQQIEALLKERNELSEALAQTQAQLAA
                     ALMRVEAATRVIERLLRERQPLPQEESSPSPSPTLSKESVGAAEPASSTTSRAGSNTR
                     GRRTRSCVRRGGSFQDLPERSAKKR"
     gene            complement(<528470..>529411)
                     /locus_tag="CYME_CMO206C"
                     /db_xref="GeneID:16995685"
     mRNA            complement(<528470..>529411)
                     /locus_tag="CYME_CMO206C"
                     /product="similar to ribosomal RNA processing exonuclease
                     RRP41"
                     /transcript_id="XM_005537538.1"
                     /db_xref="GeneID:16995685"
     CDS             complement(528470..529411)
                     /locus_tag="CYME_CMO206C"
                     /codon_start=1
                     /product="similar to ribosomal RNA processing exonuclease
                     RRP41"
                     /protein_id="XP_005537595.1"
                     /db_xref="GeneID:16995685"
                     /translation="MKKMLVVVPTAAQVHSAPGLRRAFKDACQVRKYAMKSFRCQLGV
                     LSRPEGSAVCQLGKTKVVAAVFGPRPPQGSTDTDTELATVVVEYRQGLSSRPLSIQTL
                     ESDTISTGLQFAGGESDEQRWAPSRGRATLSETERRFAAALTRSLECVIARTEYPRLQ
                     FWVYIWVLEEGGSELALATTAAWAACLDAGVALVDALVGVSVAVNATPGYAGTEQTCI
                     AFPTSEEEASAHEGRLWVALLPNLGLTADLQWRGATSQRRRDDSTVDDIRAPESFSKA
                     FCCAQQAAVAMYPILREQLVAQLGEKKPSATSAWFTA"
     gene            <533007..>534923
                     /locus_tag="CYME_CMO207C"
                     /db_xref="GeneID:16995688"
     mRNA            <533007..>534923
                     /locus_tag="CYME_CMO207C"
                     /product="GIN4-like protein kinase"
                     /transcript_id="XM_005537539.1"
                     /db_xref="GeneID:16995688"
     CDS             533007..534923
                     /locus_tag="CYME_CMO207C"
                     /codon_start=1
                     /product="GIN4-like protein kinase"
                     /protein_id="XP_005537596.1"
                     /db_xref="GeneID:16995688"
                     /translation="MSSSSAELFVRDQAEEDGASSQGANVATRSIPRAHAGMSLGPMI
                     GPYSLGRTLGVGSTGKVKLGVHVETGELVAIKVIRKEFIERKESLKKKMQREIAVMKL
                     CDHPNVLRLLEVFETNTHLFLVTEYADGGELFDYLVKRGSLEPDEARLFFRQIIEGVD
                     YCHQRYIVHRDLKPENLLLDKEHRIKIADFGMASMLPPGSMLETSCGSPHYAAPEIIS
                     GEMYSGFESDVWSCGVILYALVTGKLPFDDDNLQRLLQKVRCGLYHLPSYLPPQLRSL
                     IHCMLTVDPKRRITVEGIKAHPWYLGKGEKGSGPHHSQSTASDGATAEGADARESRTI
                     PQSLEPAAPLYREPVLDPVPAILQSLVDLGWGDSDSLRAILASEQPSLERVFYRQLEI
                     REREMKQQSANDSDEGESGTPSPRAGSAAEKAADMSSAIAALSNAEATSAVRTRTRRP
                     QWFPPEWSNATDVPAGAGGGGGGGAPVQAADQTNDIQHRLAQTHIGAEDATKAAASTE
                     AGNAGVLWERPTVASAPQRIPRGTGTHHGAHEKESISGDTGEQPSDGAEAQNADEDMF
                     LADLSGPKKNWFDSLGRYFYSRQRRRSRGPPSSHSQSTDQTPKNPTTSSSDNGSTATE
                     QSADTPVSAAHLSS"
     gene            complement(<535448..>537676)
                     /locus_tag="CYME_CMO208C"
                     /db_xref="GeneID:16995689"
     mRNA            complement(<535448..>537676)
                     /locus_tag="CYME_CMO208C"
                     /product="2-isopropylmalate synthase"
                     /transcript_id="XM_005537540.1"
                     /db_xref="GeneID:16995689"
     CDS             complement(535448..537676)
                     /locus_tag="CYME_CMO208C"
                     /codon_start=1
                     /product="2-isopropylmalate synthase"
                     /protein_id="XP_005537597.1"
                     /db_xref="GeneID:16995689"
                     /translation="MLLLTGMWCRSGSSGGGRDGLGLGWAQCAQPRARVRTHHHRPAT
                     AFCLPVYWRWRGLSAEPVALSSFDTGKWNHGKRRSTIRNRIQRTSRRAAFEYASESLL
                     RQPCMHVDQGRKDALDQPTAGLNIQIYDTTLRDGTQGEGISLSCQDKLRIAAELDAKL
                     GVAYIEAGWPGSNPKDEQFFLRAKQELLPRMRNAKLVAFGATRHKGTPCDADPQLGSL
                     LRAETPTVTIVAKTWDFQVLQVLGTSLDENIRMIRDTVSYLKAAGREVMLDAEHFFDA
                     YEANASYAMQCLEAAVEAGADVLVLCDTNGAATPWVVENVMRVVQSRFESSPGVRLGI
                     HCHNDMELAVANSIAAVRGGATLLQGCVNGYGERTGNANLMSIIPILQLRLGYSVVAS
                     TTHLQNLTAVSRFVDEIANRPHVPWRAFVGESAFAHKGGLHVAAMLKDPRSYQFIDPA
                     LVGNRPRVLVSELSGRGNIQSKLRSLNLAFDERDPVWKARITKILERIKALENKGFTF
                     EGAEASLAMMWRRAVPNYVAPFELVDFSVFTGNKRVLYVNQEGCFTPEDPEDAEDSWF
                     SEPLARSLSEGARDGTAAPVTGGPLFVTPLPSAQIPERNSRRALARDPSVAVWRNETH
                     THAVVKVLVHGAAPTLECAEGNGPVDAVNAAMRRALLGSFPELEHISLEDYKVRILDS
                     ESATAATTRVLVSFHDRKRGLRFTTVSADTNIIVASVNALVDGLEYALHLDPARASQA
                     VA"
     gene            <538509..>539894
                     /locus_tag="CYME_CMO209C"
                     /db_xref="GeneID:16995703"
     mRNA            <538509..>539894
                     /locus_tag="CYME_CMO209C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537541.1"
                     /db_xref="GeneID:16995703"
     CDS             538509..539894
                     /locus_tag="CYME_CMO209C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537598.1"
                     /db_xref="GeneID:16995703"
                     /translation="MGQSSVYKEAFVTALNCGGGVANGIQGEKPSAGVRRKESLTTTT
                     CPRTSAPTFKSGERRSRTAICLESRFKTQINDGRCDSPSWVQGTVQACGLAAHTRLCF
                     WSYRRTQGRLTRRMARSSIQGLRDRWSISPVRLYDASLWVASAGAVETTLLTLWKVLR
                     SEVTCAMRGCSDVLSSPYASLLGIPLTFFGALTYSLLAFFTFQARRERVSRMTSGASA
                     QNGTAPVADAVDAIPLDAISFRLFGRQVRLQGISYQDLMFGASTFMLVFSGYLVWLLV
                     FELQAVCPWCIFSAASSVILFTLACAIENAFYQGERYRRWSRLFWVAGCSTVLSLSSA
                     AAAYAAAQWSMRVTATVSASELYAPPPIESHSSESAVALAKHLRSLGARMYGAYWCEH
                     CHAQKELFGREAFSHIEYIECSKYGVNGKMNLCRKRHVPGYPTWEIRGELYPGKKSLD
                     ELKEISGYTGP"
     gene            <542479..>543894
                     /locus_tag="CYME_CMO210C"
                     /db_xref="GeneID:16995704"
     mRNA            <542479..>543894
                     /locus_tag="CYME_CMO210C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537542.1"
                     /db_xref="GeneID:16995704"
     CDS             542479..543894
                     /locus_tag="CYME_CMO210C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537599.1"
                     /db_xref="GeneID:16995704"
                     /translation="MDLVYLLTFLTLCLTLTALQVDKSSAALSIQKLIIRKEQRNVVD
                     ESGADDQIKTQRLGFCSFQRTYLSVYFLAVAADWLQGPMVYALYDAYGFSKHEIAALF
                     IAGFGSSMVLGTYAGALADNFGRKRLALVYCAFYTVSCLTKHFPHFGVLLVGRLLGGM
                     ATSLLFSVFEAWYVNEHESRGFPAEWLSESFSRASFGNGLVAILCGQLAGLVAGPFGF
                     VAPFDVAIGVLVLVAVLIHHNWTENYGMRGEHVSRGLQRALRHTLRDSKMRWLGILQS
                     CFEAAMYIFVFLWTPALQGAQENPTNPIPHGMIFSTFMVALMLGSVLFDRILRRITRE
                     EKDASAVKTMNNAVLWLMQILVAISICSFVVAAVGDRLHWSAAYLAMIGFEVTCGLYF
                     PAMGCLRGILIPEECRAAVMNLFRVPMNLLVVLILAYVDRFTNRSVFFAAAGLNAIAL
                     LALVRLKAAKPEPDTTGEAHA"
     gene            complement(<544083..>544622)
                     /locus_tag="CYME_CMO211C"
                     /db_xref="GeneID:16995707"
     mRNA            complement(<544083..>544622)
                     /locus_tag="CYME_CMO211C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537543.1"
                     /db_xref="GeneID:16995707"
     CDS             complement(544083..544622)
                     /locus_tag="CYME_CMO211C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537600.1"
                     /db_xref="GeneID:16995707"
                     /translation="MPRSCGFVALWTALEPARARCKRTRPLNSLCARLHVTILAQGKS
                     KFQWIEEGFREYTKRLAPFVTVEQVWVRDEEALVKRTRQERASSSGQVVALDAQRGKV
                     YTSEEFAEVFMRQMEQGGSRVTFVIGGASGLPQAVYQHAHELLSLSTLTFTHQLARLV
                     LMEQIYRAIEIYNHTPYHK"
     gene            complement(<545817..>550091)
                     /locus_tag="CYME_CMO212C"
                     /db_xref="GeneID:16995708"
     mRNA            complement(<545817..>550091)
                     /locus_tag="CYME_CMO212C"
                     /product="magnesium chelatase subunit H"
                     /transcript_id="XM_005537544.1"
                     /db_xref="GeneID:16995708"
     CDS             complement(545817..550091)
                     /locus_tag="CYME_CMO212C"
                     /codon_start=1
                     /product="magnesium chelatase subunit H"
                     /protein_id="XP_005537601.1"
                     /db_xref="GeneID:16995708"
                     /translation="MEISFVAPSTTLQKRFLGTGVAVKAGSVQPLHQWGKTSAWGPLV
                     LPSSSRRSQQMRTRSVMTAANERRKGTGAAVNWNAGGNGVNDDGTGILAGAPGGLFTA
                     SKPEDRHIVPPVLEGRKLVKIVYVVLESQYQSTLTAAVRKINAKQEHMAVELSGYLLE
                     ELRNEANYNAFKRDIADANIFIGSLIFVQELADKVVAAVAPVRDRLDACVVFPSLPPV
                     MKLNKLGAFSMGQLNQTGQSTTSFIGQIMKKRREQQGADFESQMLRLLRTLPKVLKYL
                     PSDKAQDARSFMLSFQYWLGGTVENLENMILMVASKYVQDVQSFQFEVKDPVLFPDAG
                     IWHPVAPKMFEDVTEYIRWYDKEHAPRARLANDAPTIGIVLQRSHLVTKDDCHYVSFI
                     QELEARGAKVIPIFSGALDFSEPVNRFFYALNTAVPLVDVVVSLTGFALVGGPAKQDH
                     PRAVAALKALNRPYICSLPLVFQTFDEWKRSELGLHPIQTALQVSLPELDGAIEPLIY
                     AGRDGLTGRSIPLHDRIHLLASRALKWAQLGRMKNREKKVAVVVFSFPPDKGNVGTAA
                     YLDVFGSIHKVLQAMKLDGYTVGDIPETVDALMERVLHDREAKISSPELNVLYRMPVS
                     EYERLCEYQRSLQEHWGPPPGTLNTDGTNLLVYGAQFGNVAVVVQPSFGYEGDPMRLL
                     FSKSASPHHGFAACYTWLQKIFDANAVIHFGTHGSLEFMPGKQVGMSGDCYPDLLIGG
                     LPNLYYYAANNPSEATIAKRRSYAGIISYLTPPAENAGLYKELKECQSLIREYQELRA
                     NESRAAALCAAIVATARQCNLDRDIPNLPVDGFDQLTRQERDQVIGSIYARLMEIEAR
                     LLPIGLHTIGKPPTAAEAVATLVNIAGVDRPEKGLKALPRIVAESVDRDIEQLYRSTA
                     LDDVELLDRIQRACRNAVERVVSKSVNKDGRIDRVMVSFLSEAIKPTYLVALEESGFP
                     QCSARDLKPLFEYLEVCLEQIIKDNELGSLMQALQGRYIEPGPGGDPIRNPAVVPTGK
                     NIHALDPQSIPTSSAFAEAKVVVERLLEREAAANQGQMPETVSLVLYGTEAIKSFGQS
                     IAQVLWLIGARPVPDASGRVNRVELVSLSELGRPRIDVVVTVSGIFRDLLINQMALMD
                     QAIKMAAEADEPPEMNYVRKHALEQAAEENISVREAATRVFSNASGSYSANVGIAIEN
                     GGWTDEQQLQEQYLSRKSFAYDSDRPGAMIPARQRFERALKTVEVTMQNLDSSEISLT
                     DVSNYADGANEKWVAALRGDKRKPRSYIADSTTANVAVRSLDETIRLDSRTKLLNPKW
                     IDGLVNSGYEGVRELSKRLRNTMAFSVTSDAVDNWVYENANQTFFVDEAMRKKLMDSN
                     PNSFRSMVTTMLEAHGRGYWETSEENIERLRDLYREIEDRIEGVDF"
     misc_feature    550614..552726
                     /note="repetitive element"
     gene            <553176..>556838
                     /locus_tag="CYME_CMO214C"
                     /db_xref="GeneID:16995709"
     mRNA            <553176..>556838
                     /locus_tag="CYME_CMO214C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537545.1"
                     /db_xref="GeneID:16995709"
     CDS             553176..556838
                     /locus_tag="CYME_CMO214C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537602.1"
                     /db_xref="GeneID:16995709"
                     /translation="MSAGPRYSDESGTFLLETSRLARRRRAVVEELWNHRLAWPPAQL
                     HHVYQGTFYTSLNDLDVARSAFRESHVPLREALGTEIQMLLGFDLDSGKWCGRMPAPP
                     PLPDSFVYKVLFESGLPWQESVLALGYIPFQYGLSGDATDRLTRFRETSWRKAPRAAP
                     AGAPEQSRGRSLKNSSLVDTTQPVIVPLRLSAVLLEQAVTFLMTSVSGASLEDPDTIV
                     VRERTSAVLCGDVQVASQDESTPSSIPTLKPHHEFSDRVQQQTHRAEPATDMAVGENR
                     SRRTTPACVRRMNVCTGEAHATAPSRITSPTRPDRYQAAFGHRAKTGRLAASSHASAA
                     DAAASASTNTAPAGTGQCEQNDLAQRERHFLIGRHIARLPSMLARCLLIRLIATNQLT
                     LPLLCLFQGLELPILSLRSCRMHITDTWMPLIGTFVGLEELDLSFCHRITDQGIRFLA
                     RRYGSEENTEEPSVASRTLRSLSLQGCNQLTNTAVLHLEAFPRLKRLDVSDCPNMGNA
                     ALQVLAERFRLRALSVARCERVGSSSIAALLRGENHNRMASSKSVQLDQKAPIEEVPL
                     ETNECQLEFLDVSGCPAVGEYAFLGSATRFSNRIAANAASPSTGLPLRTLRLRGCTRV
                     NDTVCEQIGHLFRNLQELDLYGCARVTDRGILDLVRSLEESLQVLCLAETQITDKGLA
                     ALAQLRCLRRLHLTRCRRLEFAPGVMEMFCTRMAAQASLSELRLRSLPSVNARVIAEL
                     SGLFVAGELKHLNLTDCHQVNDEALLALGEALRVRLMDATPRTSSRTGNSSAVATQRP
                     PRCLVQSLSLRNTGIRDTGLIFKVFIGMRHLDLGECPTLEKLDTLFGDIAEAEEALAR
                     FGRRSMRLERPAVPTANRTSAPAFSAYEGIVSGTCSRACRDSHDDVADWRGRTNTNTE
                     DAGCWAPWGLANARASQEAGLSHGPSALPVVPPWLNTLEYLDLSHCQSVSFANLRTLR
                     SESLRILILDHCSGVTNACVALLAYHVPNLQELSLRFTAVGDLGIAAFANRFRHLEKL
                     HLRGLPDVTHVGIRRLAASPLATKLRVLELAECPAIGELALASLNGMKALEYLSLKGC
                     TEINDAALRQLEDVPVLTVLNLRQCPLVSSKQIELLRSRLPSLVEVKFSNESRGLAEH
                     TGTPSALVDSFLAYVHGGSRRSPTGRNQALARQQQVDEAAPSPTRIFLDMFDAWEMGQ
                     RSARRRCSRSSSSANR"
     gene            complement(<557832..>559931)
                     /locus_tag="CYME_CMO215C"
                     /db_xref="GeneID:16995710"
     mRNA            complement(<557832..>559931)
                     /locus_tag="CYME_CMO215C"
                     /product="similar to RNA methyltransferase"
                     /transcript_id="XM_005537546.1"
                     /db_xref="GeneID:16995710"
     CDS             complement(557832..559931)
                     /locus_tag="CYME_CMO215C"
                     /codon_start=1
                     /product="similar to RNA methyltransferase"
                     /protein_id="XP_005537603.1"
                     /db_xref="GeneID:16995710"
                     /translation="MRTEIRTGAVLVERTYVSLFERPVSLKPAFARVLSPIIYRARVW
                     QRPCHRSRQTRHFSAGERLSSATMVATDGPGAPSSQKSPSRGLLVELAVESLAHGTGM
                     GVSRLQLSENESFVVLVHNAIPGERVRARIIRRKRNHAEAIVVERLDPPSMFATAPLC
                     RHFLEGCGGCKFQNLIYTKQLSEKEEQVRDMYRALLRRLETDGLASEASVEFLPAVGA
                     TVPTGLYAYRNKMDFTFGTRVWRPKPNTADDSGKVTLRQGRDTSTRDENTVSSGRKRP
                     GTDTAPESGEDMRTGFALGLHVPRRYDKVLCIEDCALQIDVANEILRFVERHCRPLAE
                     TLLPPYDLVEHVGFLRNLVIRTAQDRHNQTQVMVNLVTSPPADAHQQAALEDVAAALW
                     KAFGETNRGLVCVLQNITSNRSGVAVGESQRRLAGTQDTIEQCLRPLRHVRSRIQTSS
                     WSETGINFQISANSFFQTNPAQAERLMAVVLENSGLLEQPSVGQVSPAAESSAELAVS
                     SPQARQDTGALVVDLFCGTGTIALCLAPFAEQVLGLELVASAVDDARTNARLNARTNT
                     VFQVTDLEKENLWQVIFRHLPLARQHPVDLLVMDPPRAGVHPRQLKAIAGAPPALRPR
                     RLVYVSCNPASQTRDLDLLLRDAPWYRLEKVALVDQFPHTPHIETVAVLSLSHEADAN
                     GRHKASGSTEESGRYSI"
     gene            557934..560157
                     /locus_tag="CYME_CMO216T"
                     /db_xref="GeneID:16995696"
     misc_RNA        557934..560157
                     /locus_tag="CYME_CMO216T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461505.1"
                     /db_xref="GeneID:16995696"
     misc_feature    560478..563275
                     /note="repetitive element"
     gene            <565428..>566789
                     /locus_tag="CYME_CMO218C"
                     /db_xref="GeneID:16995697"
     mRNA            <565428..>566789
                     /locus_tag="CYME_CMO218C"
                     /product="shaggy protein kinase"
                     /transcript_id="XM_005537547.1"
                     /db_xref="GeneID:16995697"
     CDS             565428..566789
                     /locus_tag="CYME_CMO218C"
                     /codon_start=1
                     /product="shaggy protein kinase"
                     /protein_id="XP_005537604.1"
                     /db_xref="GeneID:16995697"
                     /translation="MPADCSDRPSAASDATNGLEHRHDSLVSEPVVQDSDLAGGSSGS
                     CPVPTAPVSSLQSECTSATKSSVGAPASDPHHARELALADLAENGPNNFAPNSNAIHQ
                     TISYSADRLIGNGSFGVVFQATVVETGEIVAIKKVIQDKRYKNRELQIMRMLSHPNIV
                     ELKHCFFSSGEKTGEVCLNLVLEYIPETVYRISRHYSKLRQPMPLLYVRLYAYQLLRA
                     LAYIHDLNIAHRDVKPQNLLVEPRTQVLKLCDFGSAKVLVPGEKSLSYIVSRFYRAIE
                     LLIGSEDYTPAIDLWSAGCVIGELLLGRPLFCGESGLSQLIEIIKVLGAPTEEDLVAM
                     RSKHSDFKIPRVQPLTLRRVFKARTDADAVDLVSQLLVYNPQKRIRAMQALAHPFFDP
                     LRQLEAALPNGRPLPPLFNFSQREWEIAGIDLAHRILPREHFEAALRMYGVSRQRASG
                     ASA"
     gene            complement(<566923..>570351)
                     /locus_tag="CYME_CMO219C"
                     /db_xref="GeneID:16995698"
     mRNA            complement(<566923..>570351)
                     /locus_tag="CYME_CMO219C"
                     /product="insulysin"
                     /transcript_id="XM_005537548.1"
                     /db_xref="GeneID:16995698"
     CDS             complement(566923..570351)
                     /locus_tag="CYME_CMO219C"
                     /codon_start=1
                     /product="insulysin"
                     /protein_id="XP_005537605.1"
                     /db_xref="GeneID:16995698"
                     /translation="MSDPTSNPAVQPAPQRSIEPCRTATEPPEGVTVFKWPRKPDIDE
                     RSYCYFRLASNNLQVLLIQDPKANRAAASMSVGVGHMQDPPSYPGLAHFCEHMCFLGS
                     DKYPDEGAYHEHIARHGGHANAFTSLEETNYAFEIGPEQLLETLDRFAQCFLHPRFHK
                     AAVGREVDAVDAEYRMNIQSDTHRLFQLLKSLTDPVHPFHNFGTGNRETLLGSASAAA
                     AAAAEAAAEPHQAPTCLPAAVVESQESVREALCEFHRQYYGADLMCLCVSFTAHQTMA
                     EMQSAVWSLFGEVPRALQKAPAASYAHQPLFREDHQPQGKLYVVEPVKALREMRIVFT
                     IPPQRPLYRTKPAHCLAHLLGHESNGSLLAALKEHGFATALSAGVSWELTGIAFFDID
                     IALTERGLVHWQQTLSLVGAYLRLLRTLLGPGDILDADLPSYIYEELQLLGEIHFRYQ
                     ERESSPFQAVVELSSSLRVFDPEDVLAGPFLYWDRPSACALRELLSEHMCPEQAIVFL
                     VTTEMYQQPEAYGLESTQLVHGLEPWYQTRYLTGTMPAAAWYSETPAARALHVPLPNP
                     FMPRSFSLKVAPAAGTAAADANGQQPLPRCLLLDEAQGRVLHHSLDTSFRQPRIQAFF
                     QLYTDMAYASPEQAIFTKLAIALIEDALTASAYDAELAGMSYTLTPTATGVFLGLSGF
                     ADTFIRFTEHVFRTAAATCSGEDVKQSTEIRQRLLDAHLDRLRRSYEDAALQKPYQQV
                     MYNTRVLLQLPHWHATWDYLSLLREASSAGTERFSLESVDAFRTTLFGGASGAPGCSM
                     RNLVVEALLHGNVTEDEARLLFDRCMAIVQPCLRPEVGDLRQFLRRLECHQLRIPAEL
                     SPLGLFIPLPNATESNASLGYYVQTGVRSLERDLLVEVLSNLLQKPLFHELRTVQQLG
                     YVVSNFVYRRCGAQGLFFLVQSTERHPPWHVAERLECFLHDFYQNQLQRLRVDDLRPY
                     LEAMAEKREEPDRNLPERGARFWAEIEHGTYQYQRGEQEARYLRALLKQDTDEAATDV
                     NATGTLSLVKFHALLRTFWENEVCGHRHGGSLRVYAVPFCWMPVEGGALQVDQVAAYL
                     ATKETQQGLEERTRTLLLATAASVRKWQQHASRYPSEREYESPPTSLEPHGENP"
     gene            <572993..>574201
                     /locus_tag="CYME_CMO220C"
                     /db_xref="GeneID:16995694"
     mRNA            <572993..>574201
                     /locus_tag="CYME_CMO220C"
                     /product="similar to UDP-galactose transporter"
                     /transcript_id="XM_005537549.1"
                     /db_xref="GeneID:16995694"
     CDS             572993..574201
                     /locus_tag="CYME_CMO220C"
                     /codon_start=1
                     /product="similar to UDP-galactose transporter"
                     /protein_id="XP_005537606.1"
                     /db_xref="GeneID:16995694"
                     /translation="MIGSHGERAISMPPRPVRTVLRRSVEFSLCAVGIYATYLGYGVL
                     HERLYWRLYRTRDGAAYDRFRYPLFLVFWQCLCNASVSFFSRKIARSTPHDERLRFNE
                     KRRLYSAGSAASSRFYALVAACHVVAMCCAFGALIYVPYPLQVLAKSSKMIPIMLTGA
                     AMRRKRYTRTEIIRVLLITFGVVQFSRQRHSKESTFRQAAVPGPQSGGGHQRHLGWAL
                     LLMSLVMDGIVGPLQEHTRALFDVEAIHFMFAQNSWATFWMTLVLLATGQGVAAWSFL
                     RTHPSVWRDLFGFGLLSAMGQHFVFYVVCHFSALTLAMITTTRKLFSVLLSIVVFAHR
                     LSVGQALGMCCAFAGLLWEAIASLATRNVAGSALSGKCSSSVPGAQEKQASGASCRNT
                     STSVHVGEEG"
     gene            complement(<574468..>575334)
                     /locus_tag="CYME_CMO221C"
                     /db_xref="GeneID:16995695"
     mRNA            complement(<574468..>575334)
                     /locus_tag="CYME_CMO221C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537550.1"
                     /db_xref="GeneID:16995695"
     CDS             complement(574468..575334)
                     /locus_tag="CYME_CMO221C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537607.1"
                     /db_xref="GeneID:16995695"
                     /translation="MQRARRKRRSTQPSSPKRVAGSRQPLADVTGDVEHLRNREAQRG
                     ADARGRLSQARATQVKKARLLTSTKAVNATLEANISPGKPVDAITAGDGLRQLTSGAP
                     EPSGNDSDKSVEIISLSTPTSTEEELVTFERRFRKNIGSSVFEPNAEVPESNLRSSTT
                     ERLEPKRLSASSTTGAPSVQARKSRARRLRSAKASPINERSSDKLTPSAVTTGNEASN
                     LLQEQTRVSHATVHARVRHPPGRSPALKRELVLEQAGFWDQVDQEELLIEDVTSSVTS
                     AECGMNTCCDPL"
     gene            <577697..>579133
                     /locus_tag="CYME_CMO222C"
                     /db_xref="GeneID:16995701"
     mRNA            <577697..>579133
                     /locus_tag="CYME_CMO222C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537551.1"
                     /db_xref="GeneID:16995701"
     CDS             577697..579133
                     /locus_tag="CYME_CMO222C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537608.1"
                     /db_xref="GeneID:16995701"
                     /translation="MGEHRVNVAFTLAPVQPPCFSSYLNVTRAWSADAASRATRFRYQ
                     GTSPYPRQRTLFLNFFHRQDMVPCGFAALHPYHRTCRWRRSFIKSARSCCARAEAIAR
                     EHPPASHEPLVRCNGKASCFGARRTRPGVAGAAGAPRFPGALRAHPVTASLGIALVLL
                     LAALHSPSVASAAPVFHASNLQSLGTKMLHSFASGYASSLALVFFSELGDKTFFITAL
                     LAMKYHRTSIFIGAIAALSLMTMISVVLGQLFHALPPLVTSYIPFDDWAACALLIFFG
                     VSSIRQGLKARATRAGPGSKAETPTSLDSSSAGASERSGTLSDSRSTSAQAEELTEEA
                     EAAKFIREREERLLSTRSRPASATNTQMSDKTREHPRLSQAGAALAAIAMPLASHAQL
                     AAVVEAFTLVFLAEWGDRSMLATIALSAAKNPFGVTAGAISGHLVASLLAILGGSVLG
                     RYFSERFVSLVSGGLFIVFAVMTLLGVF"
     gene            complement(<579833..>581035)
                     /locus_tag="CYME_CMO223C"
                     /db_xref="GeneID:16995702"
     mRNA            complement(<579833..>581035)
                     /locus_tag="CYME_CMO223C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537552.1"
                     /db_xref="GeneID:16995702"
     CDS             complement(579833..581035)
                     /locus_tag="CYME_CMO223C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537609.1"
                     /db_xref="GeneID:16995702"
                     /translation="MTKGLKPSLIVAQAAEPTPTSPSATAPTEPHKSETLPLSRRRAD
                     SWNTFLRRRFHPNHNESTVHWAYSGELFNLSSGALIARVEGFETSRVLAASQSPLVTA
                     ARSGATAPLASQTVLCRKLFAFRPVRTSRTLGAAGNDLQRIDDTDHIHAVKWCREGAA
                     FLLAYPYQVLTFVHDASGTFKLVAEQGDSSGNARQLVASLTPESDSTRFERSRKQRID
                     SRATAWPSTRPLASENTLRLSLYVRPLTRSRTPFASGAFELYEIHPAEPPSVPAWKRV
                     LRLPSPWWWMRSWHKVAAEQVQKQSNLDWADDRADAAASMEHIKVGDCPSWAGLGVHN
                     KCLLLLRGRRVDAQAAKHSILSPILRGILERNPLYWQAPADLAEIGTLQAQQHGLARK
                     ASRRPAPR"
     gene            581241..582696
                     /locus_tag="CYME_CMO224T"
                     /db_xref="GeneID:16995692"
     misc_RNA        581241..582696
                     /locus_tag="CYME_CMO224T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461506.1"
                     /db_xref="GeneID:16995692"
     gene            complement(<583081..>583911)
                     /locus_tag="CYME_CMO225C"
                     /db_xref="GeneID:16995693"
     mRNA            complement(<583081..>583911)
                     /locus_tag="CYME_CMO225C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537553.1"
                     /db_xref="GeneID:16995693"
     CDS             complement(583081..583911)
                     /locus_tag="CYME_CMO225C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537610.1"
                     /db_xref="GeneID:16995693"
                     /translation="MPYAFLQEIRSLWTADVEGDNPFQASLVPLPSRSSGLRYEHTVL
                     PASALNEVQLGSIDGTLRRATNVSRSSGTVSLRDQGSMRTSAMAPFSVRSAHAGEARA
                     ATSLQRTLQRSERAVKGALVDYSDSVLAVSTNGLLTPCYVRRLEGPNALSIGGESLLA
                     YRRYGELDSSVTLLGPLRGRPRPFIQFGAMRRSDEEYGADARIGVECLLHWSRRKGGE
                     SREEAQARRFSRQVDEKIDSLGFRARGLVVHASAGTFMDGKGKYDPVFSLAMGLAFSR
                     "
     gene            <585644..>587860
                     /locus_tag="CYME_CMO226C"
                     /db_xref="GeneID:16995690"
     mRNA            <585644..>587860
                     /locus_tag="CYME_CMO226C"
                     /product="oligosaccharyl transferase STT3"
                     /transcript_id="XM_005537554.1"
                     /db_xref="GeneID:16995690"
     CDS             585644..587860
                     /locus_tag="CYME_CMO226C"
                     /codon_start=1
                     /product="oligosaccharyl transferase STT3"
                     /protein_id="XP_005537611.1"
                     /db_xref="GeneID:16995690"
                     /translation="MTLNLERVVASKTLPTVLRYAALTAAAVLAFAIRLFSVVRYEPV
                     IHEFDPYFNYRATRVLVDKGLYEFWNWFDDTSWYPLGRDVGGTVYAGTMYSAALVYWV
                     LQALGFPVDVRYVCVFVSPLWASFTTLITYAFTNELTEQKDSIAGLFAAVFVAIVPGY
                     ISRSSAGGFDNECVAIFALMNTFYLFMKAVNTGALQWALACCLGYLYMVACWGGYIFI
                     INLIPIYVIVMILAGRYSHRIYVAYSTFYILGTLLSMQIRFVGFQAVQSAEHMLAAVV
                     FLALQVYCLGQWIRSIVAEQVYHAFVRYFVIIVGSAFAGLGVLLLAAGYIQPWTGRFY
                     TLLDPTYASKHIPIIASVSEHQPTAWSSYFFDLHFLTVLAPLGLYYCFQELTDATLFA
                     ILYFVFAVYFSGVMVRLMLVLAPAACAMGAVGTSRLLQSFAVDLKAELAERNWIPWIS
                     DMQQASNASPGKKHTAGASSTSSTSGNRGRVTGSSQGNNRASALRLEVSLGILFSALL
                     LGNAYVKHCVWAASEAYSSPSIVLAGQGPSGRFLIDDFREAYYWLGSNAAADAKIASW
                     WDYGYQIAGMGFRTTIVDNNTWNFTHIATVGNMLSRPEKQAYQIARMLDVDYVLVIFG
                     GLIGYGGDDVNKFLWPVRIGGSVDPTLREAQFLTRRGEFRLDEEMAPAMRESLLFKLC
                     YHRYGEISNGYDRARGYRVAHLDVRLELFEEAFTSEHWIVRIYRVKPPSNRGNVAW"
     gene            complement(<588749..>589057)
                     /locus_tag="CYME_CMO227C"
                     /db_xref="GeneID:16995691"
     mRNA            complement(<588749..>589057)
                     /locus_tag="CYME_CMO227C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537555.1"
                     /db_xref="GeneID:16995691"
     CDS             complement(588749..589057)
                     /locus_tag="CYME_CMO227C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537612.1"
                     /db_xref="GeneID:16995691"
                     /translation="MVCCSSSRVNSAELCFLWTGKAREALPGAPSSASRPRGSRSALH
                     KRLRARGVFWNVPYRASKHAGFKLSIVTSTLLALVFVFANGTGRALLAGTIHVTCFSV
                     "
     gene            <589448..>592924
                     /locus_tag="CYME_CMO228C"
                     /db_xref="GeneID:16995718"
     mRNA            <589448..>592924
                     /locus_tag="CYME_CMO228C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537556.1"
                     /db_xref="GeneID:16995718"
     CDS             589448..592924
                     /locus_tag="CYME_CMO228C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537613.1"
                     /db_xref="GeneID:16995718"
                     /translation="MACSGKRSARDCIERCESLNFPSCFRRSGFSFIGPWTAHERQDA
                     SIFIPCCPISFQKRKFVRFRRGSASVRRTQRGGDVRASSSDQNGSVARDDVDTPLARR
                     GHHPETQPPDTTQFAQAGANGGSETPAKTAFQPALAPSLAHTLERRLPQLRSTFLSLF
                     GCITVLFIRFATATVFLGIMVLAWLGYFAANQRLGALVHSAASTSLGRSIKVGRLKRL
                     VLPLGVAAGKLEMAPDASKPCGSLGAVQVRLAIEPRRWITLRTGRVRFDVQFRRVALE
                     LHQHQPGEWDLGWSVTPGKRTDDASSDVNTADALPSGQRARSVPTQELPANGAEQALP
                     PALAEATLPVALRVVEFKRSSVALDVLGTGDSAFGRGIYVFRGIHGRLVFAQGMNALT
                     GKLSFETEHRGAGSCELALDLQRNIHRISVQTRALPAKTVVALLNLPFESDTGRVHGQ
                     VALVLRPDAKAPELTGTGRLQQVALRLAPDAPSFTGISGRLRFDESMVIFEGPTGFFG
                     QLPITVVGSIDLSKDYNLIGFVRRVAISDVLKTFRVESPIPVHGSVKAEVRMHGPLES
                     PLLTGAAISVGAPWRADRIHLRNARADFQLDTRSMELQIAAMEATLQDGGQLSGHGVL
                     KLAANGAVTASSIRDTEANESSSPVAVNDSRAERDPATQEPSVQLALNLRGAHAGPLL
                     ARYLHEPGKQGTVMDPIGRLSAELTVSGPLSEAELNLRWRLVGTAPPEASQTVASCGA
                     EAPTPNAKLYGAASGTLRMPLVARHTNANIDINTGTGARALAPVPAPPRTAVTGNTST
                     DPEPQRLRFTLDAYGIDLRRLAWRPEWTTAPKALLDTRLSADVTLQQPKRSTADAAQR
                     QQAPCVEAFLDVRRLQLNEFGYTRRLAGKLRFHPDEGVQFQALPHEHSSAQRSAASTL
                     QPGSDELQKLPVFLSVQLDPSFRRDLAVHLRRDRFRLDVSYQENSRFEACLENMPIEE
                     LLGPDYGAGGLVEATLSVDLQQERGTGSFALRDAYFRQFRCRAFAGELFWLDKTVFLQ
                     NSVIQQARSEYHIEGVYSSSNVAVGSAASTLPSWQTKIVIPRGDIAELACLAQAVNGQ
                     LDPTILSYWEIPPHLSLEEQILWFADYLCQSADVSPDDFLNDDRTLPRRAEPGSSASP
                     AGDASAGCRHLS"
     gene            complement(<597500..>598234)
                     /locus_tag="CYME_CMO229C"
                     /db_xref="GeneID:16995719"
     mRNA            complement(<597500..>598234)
                     /locus_tag="CYME_CMO229C"
                     /product="ribulose-5-phosphate 3-epimerase"
                     /transcript_id="XM_005537557.1"
                     /db_xref="GeneID:16995719"
     CDS             complement(597500..598234)
                     /locus_tag="CYME_CMO229C"
                     /codon_start=1
                     /product="ribulose-5-phosphate 3-epimerase"
                     /protein_id="XP_005537614.1"
                     /db_xref="GeneID:16995719"
                     /translation="MQSKPLATIVAPSLLSCDFGNLGAEAKRVLDAGADWLHVDVMDG
                     HFVDNLTLGPVVFQGLRRAVGQQVFLDCHFMTTAPVFWIEQFARVNGDNQGPAPNLGC
                     TFHYEVFGEDGLRMALALCERVRALRARPAVALRPSTPVEAVLPLVDAAAVDMVLIMT
                     VEPGHGGQSFMPECLPKVRFLRERYPLLDIQADGGIGLTTADAAAQAGCNVLVSGSAV
                     FGAGPDAGRVIAGLREALHRAHDHSV"
     gene            complement(<600591..>601571)
                     /locus_tag="CYME_CMO230C"
                     /db_xref="GeneID:16995713"
     mRNA            complement(<600591..>601571)
                     /locus_tag="CYME_CMO230C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537558.1"
                     /db_xref="GeneID:16995713"
     CDS             complement(600591..601571)
                     /locus_tag="CYME_CMO230C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537615.1"
                     /db_xref="GeneID:16995713"
                     /translation="MLSTEHSILPDRRIRDLRSSVSQNTWKRYHVELMIGRSTALMPE
                     SIKTNRKSQHQRRVSVERVTKRTAWALYLPPACCHRESQYVCRGFYAAFRVNTSVLVT
                     RAEAPWQEPMRQRCARQRSLSQKSKQRSFAYFFSVLEKETIGKSHPLVVVVNDAGRAV
                     VRIRRRLAPLTRSYLECENRLCTNAIDEFQTTFAHDEQQYALKQLEKRCVKQGQSLAL
                     THENNLTECHLVRHTHVNALLRWNCIGTQAHEHFPHRDLKAARDIRSCLVLCGASTSI
                     AWSEASREAFRIRCKHFAPIRNTSEQAINDQDSDHWTLAWNQALLPIHRR"
     misc_feature    601293..603206
                     /note="possible transcribed region"
     gene            complement(<603658..>604650)
                     /locus_tag="CYME_CMO232C"
                     /db_xref="GeneID:16995715"
     mRNA            complement(<603658..>604650)
                     /locus_tag="CYME_CMO232C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537559.1"
                     /db_xref="GeneID:16995715"
     CDS             complement(603658..604650)
                     /locus_tag="CYME_CMO232C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537616.1"
                     /db_xref="GeneID:16995715"
                     /translation="MHRCALPGRFRELTRGKALRCASQWRRCVNVLLKPTRDTLASTR
                     VHRWSVPVLVLEKAKVACLPMSTSAGSDASSARCPTGRDATRGEHATGLNSNALSNEC
                     TDESLPGVQVTTAALAARGGTDRGCASADTCSSSRTSKEPLEAVPGETREASSRRRVA
                     EQACSPAKSLVTCSEHLSIGTSGDTLQHDRVDESRQRPTPATSSTGNWDTEQVERLSI
                     AELLRVEPSSLEDYERLLVETKVAAANAESERERLEYQVQSLRKRVLELETALDATRE
                     AYEALKLKSLHLSDEVETLQRRNRALELRLYDLDGEWNRGRNTQREGTSKATGL"
     gene            complement(<607573..>608886)
                     /locus_tag="CYME_CMO233C"
                     /db_xref="GeneID:16995716"
     mRNA            complement(<607573..>608886)
                     /locus_tag="CYME_CMO233C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537560.1"
                     /db_xref="GeneID:16995716"
     CDS             complement(607573..608886)
                     /locus_tag="CYME_CMO233C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537617.1"
                     /db_xref="GeneID:16995716"
                     /translation="METVDEQNFERYGLDCPLCMRLLYEPLTTPCGHTFCRSCLARAL
                     DHASYCPICRTVLYVDSEKHPVTVAVAKVCEELFPDVYRQRAIEEERECTHQFDAPAA
                     TAAVAPDGTPPVETQPASNSGNSSRSSGTTETTVPVTSGPAVTVNQRIRWLPLFLLDE
                     AVFPYQRIQLHIFEPRYRLMLRRVMASSRQFGFVAVFRQPPAGLNVIRAAGGHPFMAT
                     VGTVLQVTDCERLGDGRSLIDVIGINRFRIIPETVHIVDGYVVARVELWNEDSESETE
                     NPDVAYLNGRGPDPELRTRFVSLIRDALEFAFDAARVELFTPASQGSVSPELHGLTPV
                     LGTMEEPSLSELTQCETESETSPRSPARSGPEGRGSRVQAVTRISFWLAHHTTPETAE
                     RQRLLEMRSALERLDKVMRGVRARRLPMLLRRLRMESSNSSNNNE"
     gene            complement(<610204..>610848)
                     /locus_tag="CYME_CMO234C"
                     /db_xref="GeneID:16995717"
     mRNA            complement(<610204..>610848)
                     /locus_tag="CYME_CMO234C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537561.1"
                     /db_xref="GeneID:16995717"
     CDS             complement(610204..610848)
                     /locus_tag="CYME_CMO234C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537618.1"
                     /db_xref="GeneID:16995717"
                     /translation="MEASEVGSDRSLTEQAARRRERILANRRKRLAVASGSAPEEVEE
                     AARRDQQGAPGDAHLRLSGRVRQEAETQPTRAPVGANTAGTPSVETKLRRRLWLWSCG
                     YAVVSWEIVLGLAAVLCGFGAWAQLHDLDSSLPLKASSLSPPVVFLTLEVSALGSALL
                     QRQLERRSRHWLAHSWWLLTRLHRWSLETALFFFLFFATILVLTTVETHLLQPL"
     gene            <611145..>612401
                     /locus_tag="CYME_CMO235C"
                     /db_xref="GeneID:16995725"
     mRNA            <611145..>612401
                     /locus_tag="CYME_CMO235C"
                     /product="26S proteasome regulatory subunit RPN10"
                     /transcript_id="XM_005537562.1"
                     /db_xref="GeneID:16995725"
     CDS             611145..612401
                     /locus_tag="CYME_CMO235C"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN10"
                     /protein_id="XP_005537619.1"
                     /db_xref="GeneID:16995725"
                     /translation="MVLEATMICIDNSEWMRNGDVAPSRMDAQLDAVNLLCNVKLDEN
                     PENTVGLLTLAGLPGGGALWTANHSASAAAEGRPRWLGTGAVCRVLITQTRDPGRVLS
                     AMHQVIVEGEVDFIGGLQKAQLALKHRQNRNQRQRIICFIASPVAATAEELVQLGRNL
                     KKNNVAVDVVLFGSEWSENEEKMKGFIQSVNVDDNSHLITVPPGTALLAEALMTTPLM
                     QSEQALMAGAAGSDARLSGTGIGAFSGGAADIGGFGFDPSADPELALALQMSLEEERN
                     RQAAAAAGAGSGADAVENNAPGSSSMTMEVVNDRSQAAAVDSRTSLQSRSEAGSIGHR
                     PDSSAAATADSEVAESSDLGNANSDIVNDEDEQMDEELRLAIELSKQEASTGGRQPRS
                     SSGQALAPEDQSPDDSKKKSEPRGST"
     gene            complement(<612527..>613549)
                     /locus_tag="CYME_CMO236C"
                     /db_xref="GeneID:16995726"
     mRNA            complement(<612527..>613549)
                     /locus_tag="CYME_CMO236C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537563.1"
                     /db_xref="GeneID:16995726"
     CDS             complement(612527..613549)
                     /locus_tag="CYME_CMO236C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537620.1"
                     /db_xref="GeneID:16995726"
                     /translation="MAVAGTAETALARQLASSDAQVRNRALRKVERMLCQREPAPLSP
                     KGMRRVWRALYYTLWFADTPSAINWTLERLCSWLGLAVDNWLYFEVMWETICRYWIEI
                     DHLRLDKYYALLNRSLSAATSLCVDQVDHWRRLTGIVERVVFEPLVGTSADLDLEAAP
                     AALGMALHVCDKWLELVLCQAPGGLESLTLDTDSTHPVDIAVQPFLRLYLAPMERASA
                     TQQRNRKVLMRRAFERLWEPLVRAPAAVPNQRDQLVYLSQPEHRQQLAERLFKLASRV
                     EVPPYGRRFMYGCVRRLHTAVITSAAATAAAAAAAAGPLFNDFDARIRKPRQRRRRRR
                     QQRRRR"
     misc_feature    613603..616044
                     /note="possible transcribed region"
     gene            complement(<614788..>616605)
                     /locus_tag="CYME_CMO238C"
                     /db_xref="GeneID:16995706"
     mRNA            complement(<614788..>616605)
                     /locus_tag="CYME_CMO238C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537564.1"
                     /db_xref="GeneID:16995706"
     CDS             complement(614788..616605)
                     /locus_tag="CYME_CMO238C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537621.1"
                     /db_xref="GeneID:16995706"
                     /translation="MISNYFSNVKQRRVHALFRNGKETEHGDLQTSPRGWPEEPHTAQ
                     RSASLTTLEASDAADRAETTSRALSAASGVSERNCSEAVGSSVFAFDGSTTGVRNDDT
                     IAAPRSCNEDQEHWSAPVTGCRTKVTEKDWVPLLEIMDGIESARLLLRARQARPTFEQ
                     VQAVVQWKCRRELTRQRLDQLLGLVPEVFMIHRFGPGETDLCIELREQFSSMRTESSA
                     DSVQVTRFGDAYGIMKRRALLRERLEAMERPAPACSDEAMRRSASQPLDVPSCGKPIL
                     EGDSNATAYSPQQHAHRKRRFADGCNSQDMSHDTVPPTPPQPFAKRKRTNDDFSPADE
                     LVGEHTPWKRAPQAPVASAPRPGASFRREMDVDGCASMQSPELVGYASPVTESSASGK
                     SHPASFSQVSTVDSRDQRMQRDNAVLRSTNDALSATLEIDGCLPAELIQRIRDRAAER
                     DCIESSRRHEETCLNIRRLIHAADLVYSFFQTPCVLGRPRRSVELDQLTAFLCQQHDS
                     APQSYEDARQQLQQLCEHSAGWCWLEKGSASGKTLFRINADRNAFREMRLALTSLLSE
                     LRKQIQLNDTAGRNEGPSRSAAAVNAHEPHRLEHLQQPF"
     gene            complement(<619575..>620669)
                     /locus_tag="CYME_CMO239C"
                     /db_xref="GeneID:16995731"
     mRNA            complement(<619575..>620669)
                     /locus_tag="CYME_CMO239C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537565.1"
                     /db_xref="GeneID:16995731"
     CDS             complement(619575..620669)
                     /locus_tag="CYME_CMO239C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537622.1"
                     /db_xref="GeneID:16995731"
                     /translation="MNRIRGCLKGLKQHVVPVRFHCLLGTRLGDDWLLSSHTSCTKTG
                     SARATLSVYTPAISFSTKNVHDSVKQQTGQEQRPQLLQQIASDTRGLNVERTLRTNWS
                     GVGPPRFWKKVEVAALISSEIGRPAEHVYCLKVDGKTLCLSPQQPLLAPTLPLALALL
                     YEWDRQSERLRPALMPLTRLLAKSLSVDDSCRALYVREILEHFGADSLCFLEHAHASL
                     LARQERLWRPLRENASQVLGVPIKVTAELVTAGIQSDFALQRMQEYLDQLDLWSLVAL
                     HSIACLSKSAIIGLNIQQGRISTEEAVLAGRCVEDWQADLYGVVEGEHDVDRAFLRAN
                     LGAASVLCRLARAYPETFANASSRVCREHV"
     gene            <620919..>621686
                     /locus_tag="CYME_CMO240C"
                     /db_xref="GeneID:16995732"
     mRNA            <620919..>621686
                     /locus_tag="CYME_CMO240C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537566.1"
                     /db_xref="GeneID:16995732"
     CDS             620919..621686
                     /locus_tag="CYME_CMO240C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537623.1"
                     /db_xref="GeneID:16995732"
                     /translation="MPQEMLVRYRSGKETFEVATHPGAVTKYREGTLKSLDEVLVSDV
                     VFTDYHKRLRASELELKSVFGENYNKEEVLDKILRKGDFQLSAAERRQKLEQKRNEII
                     EYVHKNFVDPKTHLPIPRMRIEQALETVRPRIDMDQSADRQVALMMSKLSACMPMKKH
                     QVEGTLRVPHGVLGASNAVIRSYCTVAREHYTSEGAVLEIMISPGDYDAFIKALNNAS
                     KGNFHLDIAGAAASAAASTEEKPGKKTKPKGTKGRHG"
     gene            complement(<622267..>623316)
                     /locus_tag="CYME_CMO241C"
                     /db_xref="GeneID:16995729"
     mRNA            complement(<622267..>623316)
                     /locus_tag="CYME_CMO241C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537567.1"
                     /db_xref="GeneID:16995729"
     CDS             complement(622267..623316)
                     /locus_tag="CYME_CMO241C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537624.1"
                     /db_xref="GeneID:16995729"
                     /translation="MSQSPTYQPLRLSVIIPALNEAQVIARAIESVYDRAVRQRAAVE
                     SLRPSCEQSLVLHEVLLVDGGSVDDTCSRAKRLAQRSAYKNFRIVHLPSTQRTCRANQ
                     QNWGARLAQGDILLFLHADTTLPFQYPQVIARTLGLIQTNTSGESKARMRHPALGAFS
                     LEFTESSWVLRLVAWGANLRSRLFRAPYGDQGIFLRKQTFQDLEGFPADWPLLDDVAL
                     GHRALRRFGWGNACRIAPEHVQTSARRYQKLGVLNTVLLNQCILLGFALGVPVDALAR
                     WYRAPRTLIRDALLRTHMHENLSPAVTLRLRRPSPTEAFTVAREMQAHHRAWISIPSI
                     FHQNGAAQEKPTASA"
     gene            <623452..>624477
                     /locus_tag="CYME_CMO242C"
                     /db_xref="GeneID:16995730"
     mRNA            <623452..>624477
                     /locus_tag="CYME_CMO242C"
                     /product="translational inhibitor protein p14.5"
                     /transcript_id="XM_005537568.1"
                     /db_xref="GeneID:16995730"
     CDS             623452..624477
                     /locus_tag="CYME_CMO242C"
                     /codon_start=1
                     /product="translational inhibitor protein p14.5"
                     /protein_id="XP_005537625.1"
                     /db_xref="GeneID:16995730"
                     /translation="MNNQCAYVCFMNSAFRRTSASNSTGFALMLAGRLRCWSAHRPRT
                     LHQVALRTSRLCGAGRAPAYGESVRNRLRTLRCRSHANLAVPSLRAYRNTLFVPALVA
                     EDGCLASVEEQLGSCLSQLDEWLRTYQDYEVATLRINVAPNHDTQLLQRLERAWAEKQ
                     LQSPAVTWLEARPLVPARDVLIEAVLGLREPAAEHSLQTVATEQAAQAVGPYVQAVRF
                     PRAATLYVSGCIGLRPPPANDLAGPDVESQTKQALANMKAILRAGGSDVVNILKVMIL
                     LEDLSDFAVVNRLYEDWLRQGGCHGSRLPARSTFAVKALPKGAKVEIECIAAIQSMGS
                     EISPSSC"
     misc_feature    complement(624727..625914)
                     /note="possible transcribed region"
     gene            <626062..>626874
                     /locus_tag="CYME_CMO244C"
                     /db_xref="GeneID:16995721"
     mRNA            <626062..>626874
                     /locus_tag="CYME_CMO244C"
                     /product="inner mitochondrial membrane protein Sco1p"
                     /transcript_id="XM_005537569.1"
                     /db_xref="GeneID:16995721"
     CDS             626062..626874
                     /locus_tag="CYME_CMO244C"
                     /codon_start=1
                     /product="inner mitochondrial membrane protein Sco1p"
                     /protein_id="XP_005537626.1"
                     /db_xref="GeneID:16995721"
                     /translation="MLRSVSYGTLRQTVRRFRGNFLRRCSSAPESKPGRPSEPTHTTT
                     GSSWRQGPVTWRSLAITTGVGAGIGFLYWQQKERKAKELERSVTAQVSSGKPAIGGPF
                     QLVDARTRQTVTDADFRGRLPLFYFGFTHCPDVCPDELTKISKALALLDQRLGHDRVS
                     ATIAPVFISVDPERDTPDVVNEFLRNEEFDERFVGLTGSVEQCAAAARAFHVYYMKTD
                     ESEEDYLVDHSIITYLMGPDGDLLDYFGKNISAEEMAQRIEGHWKRMRLSLA"
     gene            complement(<628157..>629332)
                     /locus_tag="CYME_CMO245C"
                     /db_xref="GeneID:16995722"
     mRNA            complement(<628157..>629332)
                     /locus_tag="CYME_CMO245C"
                     /product="fructose-1,6-bisphosphatase precursor"
                     /transcript_id="XM_005537570.1"
                     /db_xref="GeneID:16995722"
     CDS             complement(628157..629332)
                     /locus_tag="CYME_CMO245C"
                     /codon_start=1
                     /product="fructose-1,6-bisphosphatase precursor"
                     /protein_id="XP_005537627.1"
                     /db_xref="GeneID:16995722"
                     /translation="MAKQAPHAFVSLGAPKLRSTNIWGRVSVSVLPLETRHQRRFGAV
                     RLRAALDLPMTLGQWVLQQERQHPETADLAPLITATATAGKQIASLVARAGVSNLTGL
                     QGSVNVQGEEQKKLDVLTNEVLKNALRSTGKLGVLASEEENEPVSLMEEAYTGDFIAA
                     FDPLDGSSNLDAAIATGTIFGVMRSGEHCLTGPEDADISQRQMQCLVQTLQPGANLVA
                     AGYILYSSSVIFMLSIGHGVQGFSLDPAIGEFVLTHPDVRVPERGKIYSFNEANSDNW
                     DPVLQEYIRSMKKKGYSSRYIGSLVGDVHRTLIYGGVFGYPGDKKNPNGKLRLLYECA
                     PMAYLMEQAGGIATTGKQRILDIVPRDVHQREPFICGSPRDVEDLLKIYQGSMAMRG"
     gene            <631625..>634072
                     /locus_tag="CYME_CMO246C"
                     /db_xref="GeneID:16995699"
     mRNA            <631625..>634072
                     /locus_tag="CYME_CMO246C"
                     /product="probable RNA binding protein Mrd1p"
                     /transcript_id="XM_005537571.1"
                     /db_xref="GeneID:16995699"
     CDS             631625..634072
                     /locus_tag="CYME_CMO246C"
                     /codon_start=1
                     /product="probable RNA binding protein Mrd1p"
                     /protein_id="XP_005537628.1"
                     /db_xref="GeneID:16995699"
                     /translation="MSENASTKRRLESRRHRSIPASCCIPGHCGEVHVVDPLRTRRVL
                     HVMFATDSKENSRLIVKGFASYISEERLRAHFSRLGDVTDVRVSRTASGRSREFGFVG
                     YRTPAEAAAAKAFFDQTFLDTRRITVEYALPPRSPALAERKRFHAEVSVDRRQAAATA
                     RAGERRPPTLTAAENEHRGAEVHSTSDHAVETAGKTGTLEGVPRDQTRTSQTSLWHAA
                     HATWGQETSESEPRKVHRRPETTPSRGRQAADEGSAVLLADSPDDQALSRTVSQTEPP
                     TSAVSASSASSGAEQVSSRAESMASASKEWKLCRSSRIFIRNLGFNVTFEDLEKLLEP
                     FGELEDVHLVRDRESGQSRGFGFARFKTVTSAQQAMDALDGSVYQGRLLHIMPSEADR
                     YELDQRSSLETEGKRRSFSVERKRQRRREAGTTKDTISWNPFFLGTDGVLETTAERFQ
                     MSKARFLGTDALEGGISAAVRLAVAESSLLYEVREALAESGINVQALLDEQTRQRRAL
                     DRKQLSRTTIILKNLPARTTSADLGPKLGRYGQLGRLVVAPGGLIAFAEFLDENQAKA
                     AFRGLAYTRYADLPLYLEWAPRGIWADPTPPNGDDIAEASPKAYASVDDSGSGSEEPP
                     PNWSQTSLLIRNLSLDTTSGMLVEHLESLGVRPRIVRIPLDEETPSMDSRSPNIPSKY
                     AFAEFATCKEAWRALHILDGSALRGHRLSAAPSEKHVTSRVAASETAVVPEAGNETKL
                     IIKNIAFEASKRELHQLFSSFGHVKSLRLPKKVDGSGRGFCFVEYATPQETARATALV
                     QGTHFYGRKLVVEYSHL"
     gene            complement(<634973..>635245)
                     /locus_tag="CYME_CMO247C"
                     /db_xref="GeneID:16995700"
     mRNA            complement(<634973..>635245)
                     /locus_tag="CYME_CMO247C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537572.1"
                     /db_xref="GeneID:16995700"
     CDS             complement(634973..635245)
                     /locus_tag="CYME_CMO247C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537629.1"
                     /db_xref="GeneID:16995700"
                     /translation="MGKRKKSSKPVVKRVQPKLDKRFDCPFCNQPKAVEVLLDRSTVP
                     MRGRLECGVCGASYQCAINSLSEPVDVYSDWIDTIEEVNAAEPGDS"
     gene            <636070..>636885
                     /locus_tag="CYME_CMO248C"
                     /db_xref="GeneID:16995723"
     mRNA            <636070..>636885
                     /locus_tag="CYME_CMO248C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537573.1"
                     /db_xref="GeneID:16995723"
     CDS             636070..636885
                     /locus_tag="CYME_CMO248C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537630.1"
                     /db_xref="GeneID:16995723"
                     /translation="MPGAGRDASHPGTTSSASSRLSHAGCATEGSRQAPCTSSAAHRV
                     MGDHLEAFGRRALQAFCTPAAFWTSHRSQTRRCERPRPQRCLRRCQRREQQWCRVSPG
                     RCLRLELAQRETVEKRNESSLARVVFRYFDQWNKREIAGIIPLFAPDVFYEDALYPRA
                     LHGREALAEHLTKVARVLPPQLEFVIDDVCEDLERGKCAVRFHLEDRRTGKQVPFSRG
                     TSFFTAKRAPDAPEGWLLTSGWDLPEPLIKAGNVLLAMAGIAARILGLFRRRT"
     gene            <637761..>638759
                     /locus_tag="CYME_CMO249C"
                     /db_xref="GeneID:16995724"
     mRNA            <637761..>638759
                     /locus_tag="CYME_CMO249C"
                     /product="similar to short-chain dehydrogenase"
                     /transcript_id="XM_005537574.1"
                     /db_xref="GeneID:16995724"
     CDS             637761..638759
                     /locus_tag="CYME_CMO249C"
                     /codon_start=1
                     /product="similar to short-chain dehydrogenase"
                     /protein_id="XP_005537631.1"
                     /db_xref="GeneID:16995724"
                     /translation="MNLTLLKRIIYTLVYRPLGFLYLFFGVFYGRFVLPKQPALTLLR
                     PYVDDRTVVVVTGCNVGIGYEVALALSKAGATVFICCRTEEKCSETIRRIKQQGGRGQ
                     LKPIKLELSSFASVRAAADAINAQTAYIDFLVLNSGVMNIPKLEFSADGYEMHFAVNH
                     LGHYLLTRRLVAKVRKGIVVVSSDGHIMGATDAIDDINWDRRGRENYDGMVAYADTKM
                     ANVLFAAECNRRYPSIRTVAVHPGAVLTELIRYSVKPEAQTRLRQILKYIFRTPAEGA
                     LVVVAALVATAVPCAGKRAPLFYRDGRPSWAVAENDVAAAQHLWDESERIVRNYLT"
     gene            complement(<641285..>641668)
                     /locus_tag="CYME_CMO250C"
                     /db_xref="GeneID:16995736"
     mRNA            complement(<641285..>641668)
                     /locus_tag="CYME_CMO250C"
                     /product="phycocyanin-associated rod linker protein,
                     fragment"
                     /transcript_id="XM_005537575.1"
                     /db_xref="GeneID:16995736"
     CDS             complement(641285..641668)
                     /locus_tag="CYME_CMO250C"
                     /codon_start=1
                     /product="phycocyanin-associated rod linker protein,
                     fragment"
                     /protein_id="XP_005537632.1"
                     /db_xref="GeneID:16995736"
                     /translation="MFVQTSFFGTGVKASAKSAESQRCLAHSSWSVRMTGYDMNGSSA
                     GNLGPRRIKSSGVANDRRMFKVSYVLPSQSRVDSGRELQNVATTKMVPFTSWYSEQQR
                     IMKMGGRITKVELASGVPQRNVGNT"
     misc_feature    complement(641775..645043)
                     /note="repetitive element"
     misc_feature    complement(645498..645790)
                     /note="pseudo-gene of 3-oxo-5-alpha-steroid
                     4-dehydrogenase"
     gene            <645961..>646629
                     /locus_tag="CYME_CMO253C"
                     /db_xref="GeneID:16995738"
     mRNA            <645961..>646629
                     /locus_tag="CYME_CMO253C"
                     /product="similar to peroxisomal membrane protein PMP22"
                     /transcript_id="XM_005537576.1"
                     /db_xref="GeneID:16995738"
     CDS             645961..646629
                     /locus_tag="CYME_CMO253C"
                     /codon_start=1
                     /product="similar to peroxisomal membrane protein PMP22"
                     /protein_id="XP_005537633.1"
                     /db_xref="GeneID:16995738"
                     /translation="MRHVRGSPAVQAVANLYDRYLRSLQRYPVTTKSLTAASVGAAGD
                     ALAQLLERRQRTPTAERLGDPGPQKPFNWRRLVLFATFMGVFSAPVSHYWYLWLSKRF
                     PATNMVAVSKRVACDQLLMAPTIIPATLFFLEYAGRKFVAGENGDGLLRHALQVASEE
                     TGRTLLANWTIWPIAQVVNFRFVRNELQVLFANLVGVGWNTFLSLVAAENLQKSHKTL
                     TKAD"
     misc_feature    648622..650340
                     /note="possible transcribed region"
     gene            complement(<649073..>651607)
                     /locus_tag="CYME_CMO255C"
                     /db_xref="GeneID:16995733"
     mRNA            complement(<649073..>651607)
                     /locus_tag="CYME_CMO255C"
                     /product="similar to nuclear polyadenylated RNA-binding
                     protein NAB3"
                     /transcript_id="XM_005537577.1"
                     /db_xref="GeneID:16995733"
     CDS             complement(649073..651607)
                     /locus_tag="CYME_CMO255C"
                     /codon_start=1
                     /product="similar to nuclear polyadenylated RNA-binding
                     protein NAB3"
                     /protein_id="XP_005537634.1"
                     /db_xref="GeneID:16995733"
                     /translation="MPRGRRLRNDAQAAEEPAPAAHHHHDDDGESKVQEDTVKNVTAI
                     PEELTFEQQEASDPISKEPASPETQRASAVGVEDPVGPMSVGAHETSPVASSSRDERP
                     ACTEHTTDPKPTAECGKSEGDAMAATSAVLSSEESPARPVCLGLPEQEQTALDLPSAT
                     SPHGHCSAEAQDAEATPLQSAVAAVESVSKNGFSSAEAAQELRNRVDTTPSMHSSLDE
                     QVRGSPVPPSAVVDDDTDEVTLNDDDTIERASIEHDDLLDDDSLPPVVRRKRQKTDAV
                     ETKSGSVAEATVTLEDGTGLTEAVSGAAESSPVSFGASIPRRSKGSAFHENVASDQTE
                     LAAPAPNQSTSEEESAEPSTGGAQEEASTAHDLQPTPAVPEKSEAEWNKLEDDDSSKL
                     RPALSLKEAAEYIQTLPRRHPEGTNDARLFIGNLASETTSPVELISIFSKYGRIIEQP
                     LLLRSYAFIQYDNPESTQLAIRYEQGRLIGGRHLDLSVASGRRNDSGSGNHGTRRATG
                     REAAAHHSTGPVVEGKRGPLQQSSGWRKRDAAALETGGPRPPPRPGAPYVRILVIGTT
                     SRSMAHAMQNVIRSLGISADVAYIFSDSLGTALKEAYAQCVRYVIVVSSKDASKGTCS
                     IRTYEKTGFEYAGGGSIIPFHEALAIIFREERINLPLPPAAYTVASAAMALSPPTVAD
                     PSNISSMMSGVVPGMTPPAPSLPTAAAAYRYQNPMVAAPGTMPYPYASMPPGYLYGHP
                     GAPQPQPQPQPSAPPQATSNGPGSTIGQRAYPGYMASLPPTGMNAPVMHAQHPGFSGN
                     APYAANQPSTAPPGADMDQVKQLLATLQQFQQRNAAARSNGGHGTQ"
     gene            <652399..>653244
                     /locus_tag="CYME_CMO256C"
                     /db_xref="GeneID:16995734"
     mRNA            <652399..>653244
                     /locus_tag="CYME_CMO256C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537578.1"
                     /db_xref="GeneID:16995734"
     CDS             652399..653244
                     /locus_tag="CYME_CMO256C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537635.1"
                     /db_xref="GeneID:16995734"
                     /translation="MKETEQVSEAPHGLEGAWLDLTNRVRVSGDTVEACSAFSIGPPR
                     CRWLLQATDRGVNCAALDHYVPHICGTHTETVYHIAHHRYIKRAVCEIPFFRFHKARI
                     QVCTAKIACTEQVLPSADTDYPCLEPNDLIVGPSALNRAPRYTRAQDSTIEALILIVV
                     GPDGTSDWRDGKLDDRPPYLTPAAIESLATRYPNMRHLLTNLPSVDRRRDGGLVRSHR
                     AFFATDFAGDGTPSESPQKTITELLRVPPDWQLYDDAEGVVCISLAPIEGLDAIPSSV
                     YFKSH"
     gene            <653715..>654404
                     /locus_tag="CYME_CMO257C"
                     /db_xref="GeneID:16995735"
     mRNA            <653715..>654404
                     /locus_tag="CYME_CMO257C"
                     /product="similar to zinc finger protein myoneurin"
                     /transcript_id="XM_005537579.1"
                     /db_xref="GeneID:16995735"
     CDS             653715..654404
                     /locus_tag="CYME_CMO257C"
                     /codon_start=1
                     /product="similar to zinc finger protein myoneurin"
                     /protein_id="XP_005537636.1"
                     /db_xref="GeneID:16995735"
                     /translation="MPRIKHTPVNRPRKTHQCVHCGTLFATSSQLCRHTRTVHEGRRD
                     YRCERCGAAFTTKQSCATHVHTVHEGARDFLCSLCGSRFTQKGALTVHIRTVHEGHRD
                     HRCDICGNTFTANSSLKQHIRVVHENALDWVCGKCGARFTSRNGLKYHLRTAHSAHGG
                     RDFPCPREGCDRVFTSKGGLLKHLKAQHDRVKDQICDLCGAAFAHRTQLNQHRKRVHE
                     QSQSRSSTAPG"
     gene            complement(<654840..>655835)
                     /locus_tag="CYME_CMO258C"
                     /db_xref="GeneID:16995742"
     mRNA            complement(<654840..>655835)
                     /locus_tag="CYME_CMO258C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537580.1"
                     /db_xref="GeneID:16995742"
     CDS             complement(654840..655835)
                     /locus_tag="CYME_CMO258C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537637.1"
                     /db_xref="GeneID:16995742"
                     /translation="MRFKAALRLEKVPELVSISNVLAKYHRQVILHLTPPADDRIEFI
                     VSSTGHRDGLVGRDRERDGDLLAVWASLEKVAWFSSYQLESKAQDHIALQLEPTSLSG
                     ALRSALRGQLVQLRLRRKLGAVLSLEIALHDSTVPEWDIIQDVAVEVLPPARLQELRE
                     PPVTAGARGVVLSCPERLHAAAKRLRALHRYSITEMEPLCAHLSIEVKRETSSTARLR
                     LSVPTTTIRVGLTFTELKLAYVEGECPDAPPGSAAAPGHADDNNSSAAAVHHLISAKI
                     PVGALANALEARLVHPQQTFCFVLTDFVLLHFAGEEFEFSCYVPRYEEDETLDRL"
     gene            <658767..>661763
                     /locus_tag="CYME_CMO259C"
                     /db_xref="GeneID:16995743"
     mRNA            <658767..>661763
                     /locus_tag="CYME_CMO259C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537581.1"
                     /db_xref="GeneID:16995743"
     CDS             658767..661763
                     /locus_tag="CYME_CMO259C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537638.1"
                     /db_xref="GeneID:16995743"
                     /translation="MHYPAGNALQLGFEQCYWSLVAPNACPTNNSATSVCGEWEPVPV
                     VDAVPAQRADSGARRSSYEKLVAASSGDDSSVRLVCGSVPGHLCSEPRCSMTVLYFEP
                     AFGRMTDHLLWIEEQPDEGPLTGNAVFVMEKATHQVEIGWTQWSINLRLHPHLQFIAW
                     EPPIRSAAGASLMLHPQNGGMQLAWVELQFAAGEDSALVYLLSAKELQRLQLTRRHAR
                     QWEIADLDCIEMVVPLPTPVHRILRWIRPFVDSDKAVVLLHENQICSLPSAQRIDLSA
                     LIQPKGRIDDVVALTDDRMRQVWLARCVDGTTHAIEVDASFRASPLPMIPTYRMWPSG
                     RLEATRPPIPRVYVVRQPRFPAVAMTQPDAVTASIDGDRASLARHADEGHPAGAVSLS
                     SPSHGARSESGPSRACIVTERDSGGMRSPRLLPGNFVPNPLTQSLSSKRSGSACSDVL
                     PTEDPAQGHSSMSMSMTTAVGESAPNRSLDKRSTHRSAAQRILYSTGSGVCLVELDVS
                     SGAVGEHMVVDGVVTGLCFFDSREALVVLRLPGDPLMNERIACFPAHVVHPWLTEGRQ
                     GAWPFAPPCSMELMLDAVTEIAEDRQARLQEQHEQLERTLLAMRPAPQYAYLLGKNEH
                     DRERLATLFSVGVRTERGFAEAPSLRVAIRLSSEIRDASGSRQELPSLSDACSFVVHL
                     GAALEAIPGPLAGACMDNLNVVRCIPAGDWVSATEERVMLVPLPANSHAPVRLLVLLC
                     FHGRLEDPEAASAAVASASGSEAWQLAPRGSQAWWLVLTERHLDVFDLVERVTGADFA
                     AALPLAPYHQKPTWYGDVPILPARKRPRCQRLVAGIPGAVLRETFPSCWSNGDDRDTA
                     TIFVETLLGSRFQVHIQRQDSDLARFQVQFSGPLDVISWARVALRERCDRHRSRREAA
                     EALPVSGGRAASRTPHLVDSEFLKAWLGARTGSSAPPLYPRTTAMPLRPTPAEERHLL
                     AWIRDGLATFSERLESAERVYGIIAP"
     gene            complement(<663572..>665587)
                     /locus_tag="CYME_CMO260C"
                     /db_xref="GeneID:16995740"
     mRNA            complement(<663572..>665587)
                     /locus_tag="CYME_CMO260C"
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit D"
                     /transcript_id="XM_005537582.1"
                     /db_xref="GeneID:16995740"
     CDS             complement(663572..665587)
                     /locus_tag="CYME_CMO260C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit D"
                     /protein_id="XP_005537639.1"
                     /db_xref="GeneID:16995740"
                     /translation="MPSGALYERLSFYENPEGWGPPLDLGPDRYRHVPYAPFTRLERL
                     GRVADFAGAAAASQIGNDAQSVWAAEEDTREDELGRRGRRHQKATPRERGRASTGLTN
                     GLGDEESALATTRFTGAGSRSAGNEGFTLVEGSGRERAAQAGYGAYREQQRSGYGGGA
                     GAARGGAPARRTTAAALARGGAVASTAAGSSVSGAFGAGKQTSATTPLLGAAGAPTTQ
                     LARTGNAQASNRDESLLSPFVDAVPLLTLEGTSQWTLLVEIPFAKLIKMELGQDIPEA
                     EMLCERGAVSYYDKSCDRISCKQPRPLASFEQRKRLYPTVNEDPRMQSYRSDLEHSDH
                     GAADAPTEKRRVLTTGPLLALLMAAPKSSYPWDVVVERHGNVLVIDRRPDSQVETLTM
                     FETITDNSQRSGLAFAGANMLFALQQAQSNALEAARINHNFSQSVLRADLEPYRFAGE
                     SPFTDSATDAVLVGYRYRRWELSDELELIARCEVDAALETTGPAFAGESTAPALILLR
                     ALNEIPDTNVRAGGSSGSAVGAAGATAGGGVGDWRTRLDAQRGSVLATELRNHTAKLV
                     RWTVLALIAGADQLKLGFVSRVNPRDTRNHVILGMQAYKPNEFAKQIGVNTRNMWGIM
                     NHLVQVCFSLLADGERAILTKEAHRQSLRLYRMPSVLEGSESNQNKS"
     gene            <666095..>667126
                     /locus_tag="CYME_CMO261C"
                     /db_xref="GeneID:16995741"
     mRNA            <666095..>667126
                     /locus_tag="CYME_CMO261C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537583.1"
                     /db_xref="GeneID:16995741"
     CDS             666095..667126
                     /locus_tag="CYME_CMO261C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537640.1"
                     /db_xref="GeneID:16995741"
                     /translation="MEAQERSVDDAKDTCIGQKLSKRRPVGCSVDCALGFSAPSGPPT
                     VPLRRVLLPASRVRTPPCREASRSGTVCSTRNVPGIARIACKSRGALRARKIGTQRAV
                     IVLRHAQRPPLLWGKPSPALVFGLGTLLAAALVWNRLANLTLVEGTRARADLVGAIAS
                     SALLLYAVSAWQIEVRSTAPVRIRDGHHLEQTETIALGGELETALAWLIDTVFGACAN
                     VTTAVWLTGDNTGRIVAQRGMVKAALGSQVDLRRFEELGVLNLRDPVSSRYFADLKTV
                     PRSIEWQQLLPADTQSAWLGTFKAPLQRDGSQPAQSCFLLILGCNKIRGFLDKDLEML
                     ACFQQQWMP"
     misc_feature    667723..669196
                     /note="possible transcribed region"
     misc_feature    complement(667836..668349)
                     /note="possible transcribed region"
     gene            complement(<670733..>671845)
                     /locus_tag="CYME_CMO263C"
                     /db_xref="GeneID:16995840"
     mRNA            complement(<670733..>671845)
                     /locus_tag="CYME_CMO263C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537584.1"
                     /db_xref="GeneID:16995840"
     CDS             complement(670733..671845)
                     /locus_tag="CYME_CMO263C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537641.1"
                     /db_xref="GeneID:16995840"
                     /translation="MFVALALWRLGPEARGRHSRPACESVRNRNGSSVRNGVHLRGGA
                     TTRMLAGNESASRPPADPNELLIVGPGVLGRAVAAMWHEKYPSSRIVAESRTPASHGV
                     LRATLPFLELRLADAATYGLDRFRRVVFCAPPSQNEDYVAAVRRAVERYWVARTPDTE
                     TAAFVFTSSIGVYREPLTPTVLREDSPVVTDPTEPGASPSALKLLACEQVVRDAGGTV
                     LRLAGLYTLERGPHRFWLSRGTVTGGPPDGLISLVSYHDAARAVVAALEQPGLERETL
                     VVADAKPLSRREICEVARRHPMYAKSPMPVFTAESEAVRGGGSARPAGKRFDTSRSRA
                     KLGQFRYDFESFEEYVQRCVEEGDDAAQAPVPLDRI"
     misc_feature    672054..674387
                     /note="possible transcribed region"
     gene            complement(<672773..>674845)
                     /locus_tag="CYME_CMO265C"
                     /db_xref="GeneID:16995768"
     mRNA            complement(<672773..>674845)
                     /locus_tag="CYME_CMO265C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537585.1"
                     /db_xref="GeneID:16995768"
     CDS             complement(672773..674845)
                     /locus_tag="CYME_CMO265C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537642.1"
                     /db_xref="GeneID:16995768"
                     /translation="MFWLKPAQARSEATNALAATQPGRQRALQASVWPYAWKRPPQRT
                     TAVTETPSPPPGRSQWWRSHESSSVDSGLSVGYVSPSSTTLSAGCSNGRVVTPSTLLV
                     RERPGIPRVRCLPRAALAVGTGASENAVETEEAERLRWRELFGELVKLNESLSKQPVL
                     GGSTVAIGGRRPPSPAVLPASFSSSEDDFRLRLNEINKIMLQRWRRKRGLGGGGGLWG
                     LLGFGPWADDSQQSVVSEYDATSGAPSLSADCLPGPPMDRDIGISGRGSPLRWLERLW
                     DFIWEQVGLPTFESPPTFVLDAVKRSAVAAWERELAEWNPFWLNETKMTRNWTSGATP
                     GVGSRSSSFLGGTSGPMTPCHRSCDPLRSQAGSVPASVERGTGGCRATADSDTSAEPS
                     STGSGDAGRARSTGSATASSFPVVAPEPRHLVPAEHGAERSPLALLPRDLDERTSSRP
                     PVDEERWTPDDGIGNAKGVHEPVSDPVRVSFTDVEEVSVLSYIRSDEEFPIYELIAVD
                     TPFGPAIAFFEDAQDAHESVMCMDEAKYPHLTFETIDFQRALECCYYEGSHFLWIPKR
                     GRLPQDVKTVGTFNREGDPDVLRAPIDWHVCAAEKLYPDDDLSADEALRRQRITAENE
                     MLARGFIIEPIPAPERHVFPSSPKRTAHADGYLFSIRPRAQAGSACDSRCDAKSPARD
                     SPAVGQAQ"
     gene            <676857..>678266
                     /locus_tag="CYME_CMO266C"
                     /db_xref="GeneID:16995769"
     mRNA            <676857..>678266
                     /locus_tag="CYME_CMO266C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537586.1"
                     /db_xref="GeneID:16995769"
     CDS             676857..678266
                     /locus_tag="CYME_CMO266C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537643.1"
                     /db_xref="GeneID:16995769"
                     /translation="MRALWQRLARAPRELWLIYLLKLLSSYAYFSLSLALVLYLSETL
                     GYDDETAGLLYGLYGVVASAYGLASGWLIDRLGARRSLLFGAALGTLGRTALAVLSQR
                     LVVTTLLVTVLPFAECLGVPVLTICIKRYTSGKDGTRTVAYSLFYTVMNVAALLAGPA
                     VDLCHRFWDLRALFWTCALASAAMFGIILLGVREIEVDAEGRTRDFVSPFAGETVLES
                     LRRLAVDQRFWRLLVFTTLIVGVRLIFRHLDATLPKYMTRVFGESAPFGLFYAINPFM
                     IITLVPVLGVYTSHIDHFQMILYGSFLSGFSVFWMMLGDRYWTVALFIMTLSLGEAVY
                     SPRVYDYTMAIAARGSEGTYTSLASLPLFGVQFFTGWMSGTLLQRYCPASPASARQPR
                     KMWFIIALATAWSPLGMWFARNWLRTDVASRKATASADASPANANVEYATTVEAPDAE
                     QMTKRAVPEDSISQSVSIE"
     gene            complement(<679769..>681815)
                     /locus_tag="CYME_CMO267C"
                     /db_xref="GeneID:16995748"
     mRNA            complement(join(<679769..680929,681231..>681815))
                     /locus_tag="CYME_CMO267C"
                     /product="similar to ATP-dependent RNA helicase"
                     /transcript_id="XM_005537587.1"
                     /db_xref="GeneID:16995748"
     CDS             complement(join(679769..680929,681231..681815))
                     /locus_tag="CYME_CMO267C"
                     /codon_start=1
                     /product="similar to ATP-dependent RNA helicase"
                     /protein_id="XP_005537644.1"
                     /db_xref="GeneID:16995748"
                     /translation="MAITEIPSWIALSPSVPSARKHNSTALERSSERCYSRHRWWCMA
                     RERPRRRDASGPPSARDGPKNGYGKPASFAQKRNGNGQEALASPPGEKRRQRSGSSAK
                     LPPSPAVEKSPAEQVEAASASLIDSYLIPGDSEAEIANADADFSALVANAKVRAILAA
                     NGINAPTLVQRRAIPLLRTGQSGVIKAPTGSGKTWAYLLPTIDTLCEEIERGSARSAP
                     TLLVMVPSQELVVQVVRECERFASLSIRAQGLIGLTSVERQLERLRKLPPQVIVGTPG
                     RLIEVMIDRRGRRLPAASFETVVLDEADRLLEGVHLEETERLLRHFRSPTSSGKERQF
                     VFVSATSDQPHVLRTALQCTRKQPFLLRTGHGADTSQALLPKSIRHFYLKVPDHLRMD
                     TIRRLTYAVTRLLVSPVDPLKQSWDDPDHLRTENLELTNEAVIQTLVFVPDQRTADIY
                     AERLDARGVIAAALSGRIEGSGPRKSKFQRAQVMDYFRNGIIRVLVTTELTARGLDFP
                     DVGLVINAAGLPTDPIHYAHRAGRTGRFHRRGCVVNLISQSGQQLSILNRLVREVGAE
                     LLEVQLHRGLLRWSR"
     gene            <681991..>682698
                     /locus_tag="CYME_CMO268C"
                     /db_xref="GeneID:16995749"
     mRNA            <681991..>682698
                     /locus_tag="CYME_CMO268C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537588.1"
                     /db_xref="GeneID:16995749"
     CDS             681991..682698
                     /locus_tag="CYME_CMO268C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537645.1"
                     /db_xref="GeneID:16995749"
                     /translation="MLGTIFGTGLLFLVPVTPTLMKLRKRSLPGTCAASSRRAGAVRA
                     QVERSSPEAEAVQLPDRSAEKIQKHRLGAKKHAVAYYLVKSEGSGPRKFTVDDLAASP
                     LRCTSWDGVRNFQARNVLLSMQLGDFALFYHSNCKQAGIVGIVEIVREAYVDQTQFDS
                     TDSEAYDPRATPDKPRWYAVDVKLQLKLPRPIPFEELKQYATPGGPLDGMLLFSQARL
                     SVQPVRPEHFRFILGLF"
     gene            complement(<683556..>684806)
                     /locus_tag="CYME_CMO269C"
                     /db_xref="GeneID:16995746"
     mRNA            complement(<683556..>684806)
                     /locus_tag="CYME_CMO269C"
                     /product="probable glucose 6 phosphate/phosphate
                     translocator"
                     /transcript_id="XM_005537589.1"
                     /db_xref="GeneID:16995746"
     CDS             complement(683556..684806)
                     /locus_tag="CYME_CMO269C"
                     /codon_start=1
                     /product="probable glucose 6 phosphate/phosphate
                     translocator"
                     /protein_id="XP_005537646.1"
                     /db_xref="GeneID:16995746"
                     /translation="MRAACITTRLSFVHPGGTGTLQRSRVHHAASGLASQGSPAFRCG
                     GVVLPKRPARVGAAVSAPVHSVGVSRRALCCAVESASSPSSPMPASAGDAQTKPVFLG
                     LSRKRLKVGFWFFMWYLYNVVFNIVNKKTLNMWSYPWVLSTIQLGVGALYVSVLWLLG
                     LRRRPQVNGKLIRSLILPSLFHTIGHATSCLSFSSVAISFTHTVKSAEPVVGALGSAL
                     FLHEYYSPMVYFAMIPIIVGVALSSISELTFTMAGFLNAMASNFAFVARNVTSKVSLG
                     DTKKDASLTAFNTYGLITIISFFLELPMALLFEGLPKVASRIPGIGAGTVFGYIAVAS
                     LLYHLYNEASYGVLEDVSPLTFSIGNVVKRLAIILSSVIAFGTIMRPLNWLGVALAVG
                     GTLIYSYAKHMDQKKIDAAKKKAA"
     gene            <686142..>688988
                     /locus_tag="CYME_CMO270C"
                     /db_xref="GeneID:16995747"
     mRNA            <686142..>688988
                     /locus_tag="CYME_CMO270C"
                     /product="plant organellar DNA polymerase"
                     /transcript_id="XM_005537590.1"
                     /db_xref="GeneID:16995747"
     CDS             686142..688988
                     /locus_tag="CYME_CMO270C"
                     /codon_start=1
                     /product="plant organellar DNA polymerase"
                     /protein_id="XP_005537647.1"
                     /db_xref="GeneID:16995747"
                     /translation="MRCAASFQRPAESYHDLQPTLTLRTECNQRSSPVKRLETRPVIM
                     RLGVGSCRLWLGAFVYALRPALRRDGNVWQQWRRAHALVPAVPRRRWLCANARRSAAS
                     TWDEETDVVGDEFSSVNLVQASAAKITEGDEFTAQRLQLLNAPERESAAATLERSPPP
                     GVTVVRNRASALRVIDRLWQLQKESELLYGRRAASVPRRWRLITEGCTHSNGNGVLHE
                     DNTLQCKRLYPPTAADWMEHSQCYHAWDTETIGIDPTEDSPVGKGQVICLSAFCGPRV
                     DFGNGPRLWIDNFGDAQGTLDYFKSYFENEEIPKVWHNYSFDRAVLYNHGIDCRGFGG
                     DTMHMSRLLDAARLRYSLEALTEDFLLRKKRSMRELFGRPRILKNGKPGKEIIVPSTS
                     ELQMDPETMYHWVQYSTYDAEATWYLRDKFERLLREQEILGSERTMYDLYTECFVPFG
                     AVLTDMERIGFKIDIARLQDAQRVAEADRQRYTAMFREWAARYCADAIHMNAESENQK
                     RQFFFAPVRNKKTDELLPAERTFEVENTEQVVESAGKKPRKKRTIQISGLGLPPVAFT
                     ASGWPACTAVVLRKLAGTPSASPAQGGLLYDFLTKERRESAEDALAACKAVEALLEAG
                     AVGTLLDSFIDPLQKMVDKNHRIHASLNLNTETGRLSSRRPNLQNQPALEKDRYRVRD
                     AFTCEEGNTLIVADYGQLELRLLAHIANCRSMIEAFKAGGDFHSRTASSMYPYIAESV
                     ARGDVLLEPEPNANGQATSSKPLLKDVYAGERRRAKTLNFSIAYGKTPAGLARDWGTS
                     LKEARETVDAWYRDRPEVRAWQERAIKFAQTHGFVKTLLGRRRPLPEINSPNTNAARH
                     AERAAINTPLQGSAADVVMKAMLLIHSNARLAELGWRMILQVHDEIILEGPEETVEEA
                     EAIVVRLMRQPFREPLRVDLAVSVAHAKTWFRAK"
     gene            complement(<689392..>690762)
                     /locus_tag="CYME_CMO271C"
                     /db_xref="GeneID:16995711"
     mRNA            complement(<689392..>690762)
                     /locus_tag="CYME_CMO271C"
                     /product="cell cycle protein kinase CDC7"
                     /transcript_id="XM_005537591.1"
                     /db_xref="GeneID:16995711"
     CDS             complement(689392..690762)
                     /locus_tag="CYME_CMO271C"
                     /codon_start=1
                     /product="cell cycle protein kinase CDC7"
                     /protein_id="XP_005537648.1"
                     /db_xref="GeneID:16995711"
                     /translation="MDITSAAAIPRAYISGLAHQELCWSAAALSARWKVLARTSSNQL
                     SARAIPKDVQESLDETQYTDTSNVGGGGSLWPPLVLHERVGAGTFSTVYRAVLDQACA
                     QNRAYAVKRFYKTNEPRRIQQEVRFLCGLQGEKGIPRLEGIFRRDDEVWMVMPLYPNE
                     PFRLLIADMGIDDMRVYMRALLDVLSVLERHQIIHRDVKPGNFLFHRKHPDAAVLVDF
                     GLAQKSEQTRNRDCDSGQNLWRDPRAQTACRQLSSGANAVDTVSSDRDRLDDWRLAMT
                     APVFTPTPARAPAWKVSRLTEDRTRRRAVTMESAEAPRAGTRGFRAPEILLRYRDQDS
                     CIDVWSAGVIFLSMLSCQYPFFRASSDEEALLELEQIFGTQKLASAAKACRRPFVPAN
                     NFPGVDLRQLCLQLRVGRRPNTASETEVPDEAFDLLSKMLELNCRRRLPASALLEHPF
                     VRKSSS"
     gene            complement(<693304..>695301)
                     /locus_tag="CYME_CMO272C"
                     /db_xref="GeneID:16995712"
     mRNA            complement(<693304..>695301)
                     /locus_tag="CYME_CMO272C"
                     /product="phosphoacetylglucosamine mutase"
                     /transcript_id="XM_005537592.1"
                     /db_xref="GeneID:16995712"
     CDS             complement(693304..695301)
                     /locus_tag="CYME_CMO272C"
                     /codon_start=1
                     /product="phosphoacetylglucosamine mutase"
                     /protein_id="XP_005537649.1"
                     /db_xref="GeneID:16995712"
                     /translation="MDWEAHQLARYLPSWSDTVPEDLQCGAAGLRGSARDHAFDKAAF
                     CCGLAAGFLALRHALDGSKRASTTEARSTLPANKVGHHDDLGAPGLSASVFRTVAVGL
                     MITASHNPPHENGVKFIDTNGGMADPTWIHLAVRLVRASAGPDSLATVLEQVHREKIS
                     EARAIRDALCIPVVLLGYDSRSSSPHLASNAQEGARVVLSHYLRATRCSGGETLAFAD
                     ALLLGMTTTPAMHAVVRAWNESPVDMRESDLSNFRDAFERRPLFLLNRYKSTLVEATR
                     ALSEALHLADVEHRALMDHWVVDCANGVGAPLLCELASALRTQCGIQIVCCNQETAQT
                     ELLNVQCGADWVQKGNRLPQRWPQTPAGKPERQGASLDGDADRLVCFLADAQGVAMLL
                     DGDQTATLFLDFVLGFLHPEHAYLSQNTCAEAAAGAARKSWRVALVHTVYANGAAVAY
                     WRKRQRELESQRAHHACVIELQIICTWTGVVHLEKEARRFDIGLYFEPNGHGTILFSD
                     ALLKSHASTLPLPLRCCARVANQGVGDGIANLLLIATILQWKRWSLVDWATAYYTPLA
                     SVYLVERVSDRHQIVTSDYDQRVVEPPELQRSIDRIVASYRSARESVSANESAVAGAR
                     IVVRPSGTEDVVRVYAEAHTEADASSLARCVVNEIRRLLGS"
     gene            <697166..>698899
                     /locus_tag="CYME_CMO273C"
                     /db_xref="GeneID:16995763"
     mRNA            <697166..>698899
                     /locus_tag="CYME_CMO273C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537593.1"
                     /db_xref="GeneID:16995763"
     CDS             697166..698899
                     /locus_tag="CYME_CMO273C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537650.1"
                     /db_xref="GeneID:16995763"
                     /translation="MQRLAPHMSGADSCRNFDGLEPFRDQREPRPSGSGARSGDAVHA
                     AAGPVNDWGGGGGGSGNAVRDPADTRNLRDAGQHFPQKKRRLSEGESEALMRFRELRC
                     ERLDLSELPPLMPANDMLSPAAALTPSGAISATISETELRLVQTIAEFGQNTNTPRIL
                     AAIQEHHQKDLLGMPAGTTLGPSNMPSTLKPSDSLLSNAAPAGLSGTLDAMSSPALSR
                     DSVPNVPDSGSITPPMDSNVEPLMPGSTLEWCRQYARQISCQYVDELRRRMRGSCRQC
                     AAPYGSCSHRPVDRDAALGEWSALSPSRRRIAKNRETAAVSRFRKKVYMESLERAIMN
                     LERKYMETRNELAQLRKLFDMSVTPVTPMHGRAAPATQPERRAEADSAARPPLATAAS
                     DATGALQLMGAVTASDALGMLDADRSPPNVQQRAPGPVALAAEPAEPSPRLLEGFLRP
                     LLASVGIEGENAANAISGAMTTALQDAQSRYALLHALRMCAGTVAGTHESEENVDAAT
                     DLTGLATSPCLRPSAARARANSCSKSPVEDLAGDASPLALGRMHSSPMVSARASRASG
                     SRPPDSASSGA"
     gene            complement(<699835..>700884)
                     /locus_tag="CYME_CMO274C"
                     /db_xref="GeneID:16995764"
     mRNA            complement(<699835..>700884)
                     /locus_tag="CYME_CMO274C"
                     /product="V-type ATPase V0 subunit d"
                     /transcript_id="XM_005537594.1"
                     /db_xref="GeneID:16995764"
     CDS             complement(699835..700884)
                     /locus_tag="CYME_CMO274C"
                     /codon_start=1
                     /product="V-type ATPase V0 subunit d"
                     /protein_id="XP_005537651.1"
                     /db_xref="GeneID:16995764"
                     /translation="MDMLTFNADNGYLEAVVRGLKASLLRRQDYTNLAQCESPEDMRT
                     ILNSSDYGLWLQNEPAPLQTQALYDCLMNRLVYDFRSIRGQSYAPLSTFLDYVTYPYM
                     IDNLVLLLMGVLRNRDLSELLDKCHPLGLFEGIATLTAIHSPEELYREILVDTPLAPY
                     FAECVNVHDLTEMNVEIIRNLLYKAYLTDFYQLCVERIGGMTGSIMATLIAFEADRRV
                     INITLNSLETSLRKDERMMLFPRVPGGLDDEIIQRLGRADDLQAVAMALDLSSTYRAL
                     FQRAAERGEYSLEDQFLEFEMKLLRESFDAQFHYGVFYAYFRMLEQEIRNLTWIAECI
                     TQKQFAHASRVVPIL"
     gene            <702380..>702970
                     /locus_tag="CYME_CMO275C"
                     /db_xref="GeneID:16995755"
     mRNA            <702380..>702970
                     /locus_tag="CYME_CMO275C"
                     /product="similar to cytidine deaminase"
                     /transcript_id="XM_005537595.1"
                     /db_xref="GeneID:16995755"
     CDS             702380..702970
                     /locus_tag="CYME_CMO275C"
                     /codon_start=1
                     /product="similar to cytidine deaminase"
                     /protein_id="XP_005537652.1"
                     /db_xref="GeneID:16995755"
                     /translation="MSSSTNSHSGDEKACTIAPGQVLEASQATTEQLLRHAVELARQG
                     VRKRAGGPFGAVIVRKLPASEHSGKQFVEILASGHNCVLKTQDPTAHAEMVVLREAAQ
                     RLKRRNLSDCELYTSCFPCAMCYGAIWWAKIPRFWYASRSEDAAGAGFDDARIYECLR
                     GTGHADLRGEHVTIAEHHEPFEEYLDALKHGLSELY"
     gene            complement(<703867..>705135)
                     /locus_tag="CYME_CMO276C"
                     /db_xref="GeneID:16995756"
     mRNA            complement(<703867..>705135)
                     /locus_tag="CYME_CMO276C"
                     /product="glucokinase"
                     /transcript_id="XM_005537596.1"
                     /db_xref="GeneID:16995756"
     CDS             complement(703867..705135)
                     /locus_tag="CYME_CMO276C"
                     /codon_start=1
                     /product="glucokinase"
                     /protein_id="XP_005537653.1"
                     /db_xref="GeneID:16995756"
                     /translation="MRKLIVTGDIGGTNARLAIFDATDSDDVCAQPCVHRTSYRNEQF
                     SRFHDVLDTFVQEARAHLNDASFYIAAMCLAVAGPVVADRVSFTNRQQWILDANELRD
                     AFHIDRVRFLNDFVSNGYGLLTLREPDECYVLQRGEPSAGEPKACVGAGTGLGECYLT
                     ACAQPDVSGQGSTVWHYEAHATEGGHVDFAPITELELELLQYLRNKFGDSGHRVSVER
                     VVSGRGLVNIYEFLREKYPEKVQPSIDKSILESNDGAATIARYVYECGLCAQAMRMMM
                     DIYGTECGNAALKYLPFSGLYIAGGIAPKNLEWLQEGKSDFLKRFREKGRVSTILRRI
                     PVKVVLAEDLGLRGAHVVAARMASDTFPPTSATAGALKHPRRWYETRAILMEHTERIV
                     YFTGLLGVLASCAYTGASVCWWYFRRTRPA"
     gene            complement(705540..708562)
                     /locus_tag="CYME_CMO277T"
                     /db_xref="GeneID:16995757"
     misc_RNA        complement(705540..708562)
                     /locus_tag="CYME_CMO277T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461507.1"
                     /db_xref="GeneID:16995757"
     gene            <708765..>709955
                     /locus_tag="CYME_CMO278C"
                     /db_xref="GeneID:16995758"
     mRNA            <708765..>709955
                     /locus_tag="CYME_CMO278C"
                     /product="similar to nuclear receptor binding factor-like
                     protein"
                     /transcript_id="XM_005537597.1"
                     /db_xref="GeneID:16995758"
     CDS             708765..709955
                     /locus_tag="CYME_CMO278C"
                     /codon_start=1
                     /product="similar to nuclear receptor binding factor-like
                     protein"
                     /protein_id="XP_005537654.1"
                     /db_xref="GeneID:16995758"
                     /translation="MALVAAGFRTVVQRRFGSAQAAAAAATEFFYERNGPVDTVLKRR
                     SIEDSSSGKALPRNAARVELLAFPLTPFDVAAIERGYRSTGVAGVQGIARVTAAAPET
                     PFQVGDLVLALPAMPGTWRDHATVPNASEAFVAVPATLRRAIEDKVPGMLERAATLLG
                     APAMAYRLLEEHGIQPGETILLNDADGAVGLALVQLANMRGIKTVSLVDDEIPEDELP
                     PEGHVESYAVVAERIKALGSDVVVSSSFARQTATFRELVSELAGNRGMPRVAFNGSGG
                     ASARQLISCLRPHGTLVTYSGRRATQPLVIPTSAFTEFQLNLKGFNLMLWLENAPRDQ
                     VQAMVDALGQAMTRGALTGWLERKSFASLQITDIATIRSGTRPRQLVAITAAGQSLVQ
                     LAGP"
     misc_feature    complement(709228..711093)
                     /note="possible transcribed region"
     gene            complement(<711749..>713350)
                     /locus_tag="CYME_CMO281C"
                     /db_xref="GeneID:16995753"
     mRNA            complement(<711749..>713350)
                     /locus_tag="CYME_CMO281C"
                     /product="vacuolar protein sorting-associated protein
                     Vps4p"
                     /transcript_id="XM_005537598.1"
                     /db_xref="GeneID:16995753"
     CDS             complement(711749..713350)
                     /locus_tag="CYME_CMO281C"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein
                     Vps4p"
                     /protein_id="XP_005537655.1"
                     /db_xref="GeneID:16995753"
                     /translation="MTSFVDKGIEFANKATQTDREARRTRDHETFEAAYHYYLRAIEY
                     LMTAIRWEKSERTRVLLQTRVREYISRAESIKELLKRGAYEQASGSDDGADGLPFESE
                     SYTNGGATAAATLSPHTGSGESNGAAAAAAAAAARERRRGRGPADGSGGSGAGAEKAG
                     TAASAPTKDETERLRQQLASVIVRERPQVRWNDVAGLDGAKEALKEAVVLPMRLPLLF
                     TGKREPWRGILLYGPPGTGKSYLAKAVATESAASFFSVSSADLVSKWQGESEKLIRQL
                     FRMARESAPSIIFIDEVDALCSSRSESDSDSTRRIKTEFLVQMQEGLSTGDETRKEGK
                     HVLVLGATNLPWQLDPAIRRRFERRIYIPLPDERSRRRMFEIHIGDTPHSLSACDFER
                     LAHVTEGYSGADIEIVVRDAIMQPIRRLQMATHFRQVSPRPHHRTLQRDGGAEDTSSN
                     NNAARGVRFTNTASAELLWTPCSPAAPGAVEMNLYDVPADKLLVPDVRYSDFEEVLLH
                     TKPTVSKADLGAYERFTRDFGQECV"
     misc_feature    712112..712487
                     /note="possible transcribed region"
     misc_feature    complement(715645..717268)
                     /note="possible transcribed region"
     gene            <716942..>719698
                     /locus_tag="CYME_CMO283C"
                     /db_xref="GeneID:16995771"
     mRNA            <716942..>719698
                     /locus_tag="CYME_CMO283C"
                     /product="unknown ABC anion transporter"
                     /transcript_id="XM_005537599.1"
                     /db_xref="GeneID:16995771"
     CDS             716942..719698
                     /locus_tag="CYME_CMO283C"
                     /codon_start=1
                     /product="unknown ABC anion transporter"
                     /protein_id="XP_005537656.1"
                     /db_xref="GeneID:16995771"
                     /translation="MGRAREPAYRKRGFQRTWISKVYLANLGESSAVDETQSPNLGLT
                     CWAPSICPASQHGRAGAFLPLASGPIVGLLRHRPDRRERLQTSLNARSATAEAKRFFL
                     QRRRCHHAPQAFSRALHTPPRGQRTLHDSQFLGRASEFHRPCLLRRQARAPWSLCMEQ
                     GDRASASERTTPPRTANDVQQGIQEASQRKAGARRHPGRRFAAFTQMLARRSTYRDGL
                     VLLLLVLLAYAMAGTTSYAITQRYDPSAVRISCDPRVLPAYGFQSLMRLVLAYGFSLV
                     FSLIYAYIAYRASFAAQVLLLIIDVLQSVPILAFVPAAVLGLIAMFPGQRIGVELAAM
                     LLLFTSMAWNMLLGFYQSLISIPPDLMEAARILRLSAWRRFWLLEAPSGVCSLVWNSI
                     ISVSSGWFFLISIESFSLGPGREYRLPGLGSFLAEAADRGNMRAIFWGLFTVVSLIIC
                     IDMLIWRPLIVWSERFKFSTNASSGIGAISSLQRKASRSPSSSSSGLRSSLGSDANFA
                     DEDDDRENDNYDDDDDDDDENDASSFAWAGAPRRQFRVLELVQIPDATASATSSAPGL
                     AIMHSIEGESAPGAEQVVIQQRELDAPRSIVFAYFQRSPLMRAVHRRFFLPLWQKFID
                     ADVIWERATETTSQTLALAWKRVHQPHLLLRLWGFMVRLLTWSSVLGIAWLAFLAFRV
                     AHHALRILQTISWRSWITILSCAGLTFGRVLTALALSLLWTVPLGVAVGCSPALARVL
                     QPLVQIAASVPATAVFPFLLLGLANFGGLGLQIGSILLMMFGTMWYILFNVIAGAAAI
                     PAELWEVDAVYNKATDSWLARQWRRWRFLILPGIFPYLITGIVTAVGGAWNASIVSEY
                     VQFQGQILSTKGLGALISNAAARGDLPLLLAGTLVMSSLVLLTNRFVWAPLYKLARER
                     YTLN"
     gene            complement(<720210..>721088)
                     /locus_tag="CYME_CMO284C"
                     /db_xref="GeneID:16995772"
     mRNA            complement(<720210..>721088)
                     /locus_tag="CYME_CMO284C"
                     /product="probable 3-oxo-5-alpha-steroid 4-dehydrogenase"
                     /transcript_id="XM_005537600.1"
                     /db_xref="GeneID:16995772"
     CDS             complement(720210..721088)
                     /locus_tag="CYME_CMO284C"
                     /codon_start=1
                     /product="probable 3-oxo-5-alpha-steroid 4-dehydrogenase"
                     /protein_id="XP_005537657.1"
                     /db_xref="GeneID:16995772"
                     /translation="MNLLSDDALLWSWIALAVLVFPVLFLVSAPYGRHLRTGWGPTLR
                     SDLGWIIQESPSFLIMAVYLTRWLRQRTDKLLKLGFDEREWMTVTLAFCWLVHYANRA
                     FVFPLRMRGGSKPTTFTVVSTAILFCVINTYLNAKALFVYELVIRSRRSLDWAFCSGL
                     LLWVCGLIGNWHSDAITRALRRNPEEIKEKRYAIPYGGLYRYVSAPNYFSEFVEWTGF
                     AIAAQTWAAFSFALWTFSNLYPRARSNHQWYLENFAEYKSLNRNAFFPNPLKSAAVRA
                     RAPQRRGASSHQQKSR"
     gene            <721484..>723586
                     /locus_tag="CYME_CMO285C"
                     /db_xref="GeneID:16995773"
     mRNA            <721484..>723586
                     /locus_tag="CYME_CMO285C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537601.1"
                     /db_xref="GeneID:16995773"
     CDS             721484..723586
                     /locus_tag="CYME_CMO285C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537658.1"
                     /db_xref="GeneID:16995773"
                     /translation="MVFLIVDFSEVSRGGVKARVQVTPNSLLSEVLRQAWEQVQTRCG
                     SAVGDAAEPRLASLPANWGLRHGKRWLDLSLPFRLSGLSAQARIVVDERSVSETAKTS
                     VTGKPGQTADLAQGVTPAHSLTVAVQYESDPPERYIAPAVLEDTLWSVLERANPERLW
                     WCRPYLLVARYLETAHYGVSHFRSLRLRDLGLSPGTRLLIRIQCLTTDDDSGGWEEVE
                     ASAGAARSPVASNRHDHADATGGSDIASVDKVSSGQAATRESQATADLHLQHVEQQST
                     HLVLGNPGAKSAFVDAPARVLDTVSRTIEEPAASSPQGERVPVTGSSDPSTANGDRQR
                     DTRADASTNPRTPSPSSRGARPSTYALVEMHEVDTSVPKVDGVVAEPADARNSASSVN
                     TESGTTQIPIQGAESTSELLIPGRTASDAPVLETNGNAGAPAGQVPERYVRFYLPTTI
                     RFDAQLLDLPDTFYDLTPGELRRILHAQQRQQEEATVLRTRRHTTASRAGATQPEQCV
                     VRVRLPDQTVIEGRFWCNESLDDLYAFVRRFVTSTNGALDAFKLYQTPPKRVLHAGPT
                     TLHQVQLCPASVLVLVPSTSNTYVTLGLRPEFRSRLEKSPLEAAFAKEVAQAEALRRE
                     YAGVISSPHTTPPEAAAATADGTAANAGKQIRSEDAGTGDREPDAFSKADRARNDAEQ
                     QLKQRLPKWWRRPPGGRS"
     gene            complement(721709..724737)
                     /locus_tag="CYME_CMO286T"
                     /db_xref="GeneID:16995774"
     misc_RNA        complement(721709..724737)
                     /locus_tag="CYME_CMO286T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461508.1"
                     /db_xref="GeneID:16995774"
     gene            <724992..>725468
                     /locus_tag="CYME_CMO287C"
                     /db_xref="GeneID:16995727"
     mRNA            <724992..>725468
                     /locus_tag="CYME_CMO287C"
                     /product="40S ribosomal protein S11"
                     /transcript_id="XM_005537602.1"
                     /db_xref="GeneID:16995727"
     CDS             724992..725468
                     /locus_tag="CYME_CMO287C"
                     /codon_start=1
                     /product="40S ribosomal protein S11"
                     /protein_id="XP_005537659.1"
                     /db_xref="GeneID:16995727"
                     /translation="MTEVQTERAFQKQEAVSLNGPAVRFHGARKRWYKSIGLGIKIPR
                     EAIEGTYIDKKCPFTSNVSIRGRILRGVVVSTKMTRTVIVRRDYLHWVAKYRRYERRH
                     RNIPCHAAPCFRLQEGDIVTIGQCRPLSKTVRFNVIRVDRSAGGKDRTGKKMFTGL"
     gene            <727286..>733456
                     /locus_tag="CYME_CMO288C"
                     /db_xref="GeneID:16995728"
     mRNA            <727286..>733456
                     /locus_tag="CYME_CMO288C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537603.1"
                     /db_xref="GeneID:16995728"
     CDS             727286..733456
                     /locus_tag="CYME_CMO288C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537660.1"
                     /db_xref="GeneID:16995728"
                     /translation="MNPQRIFLHFASRDFCSNPFGNKSHKAGSEHPVHCPIPVWHTDR
                     CSSAPIRQRNRSAAPGHTAPFVFERSPSSGECVPGTIMTSQRELLRYVESDLRSLVAK
                     LGKRKVERAFVEDLPFLTERFSSWKSAVERVLTQLREDDTQARLSFSLSIDLVGHVLI
                     HNVQSVENWRKSEASTLLALGLLHRLASQAALPSHRVADVVALLSYFVLSVQKLVLRS
                     EFSKRRWLIYGERNGAQVPGTNSDQSDATDSFSRRSSPGTVSLVEEALEQATCEQTAA
                     VGQRATETQVLPGNDLVLVERQLLRVLQVLFEIPSVQHRAGAAQEYDVDASKSDSAAS
                     VSKMCQASLPQRLFTLLTLIEQLPGVTAVVARTAAAALERYCTALFEDRLWREQVAIA
                     FVEDLCLLTLERPPVHGFGTLLSLQVQTNTSSPVELPGASASAAERTSSSLQQERRAQ
                     ASPEAEDLDEAREGHPESLSAAQVTSTGAMQQKETYCLEVITPSPDVMTSLLAEALGR
                     AMRGGLAPQACLLKRLFPFVEAQLNEAELSWSICSLAAALIQAPVASFGALLASLAGR
                     MLEQLRVSMDPSYSSSDTNPNQVLLMHHRALLLIETFRDALLTGASTAEDRAFISNSS
                     SSSSSWSPQALLRYLERESDRTFASQNAAAGAGDTTSALGTEQKSLPSVDERRRLRED
                     VVTSRETSAEAFSKLPASETGGILTQWVAMLQLCVTTGTSMVTELQMLPTGPLRHQRP
                     LLRQLGQLIEEPKHRNLDGELWGQLTSAALGLLFVLLEATDPVADVDFLRRTWPDFLT
                     AFGALLARAQQVPAVVLQPLIERGMDSLLQRLAVVRSSVDAPSIMNDSSTDASGLLGG
                     SAGQPPAMHGSTSALEPFETVFICLCRTLRLVRSTRSASASASDSEAVHVLTCLGRVL
                     QSNLQRALSTMHESEYNTNTPQAVVERRPLCSSWSPNTWLALVESILIAGDDDRDAAS
                     GEPMLDPVIDSSFEHWDKYLLQQQQQQQQQRAVGCVPAVALLRALFTVAHAAQEDTST
                     RNRAFLHAVFVVKAYLNAVQRQARAAIVASNGDGPYTGNAWTIPTSNATNAAVVTATG
                     PSEWPDGTGTEQASTETGEQVASGAMSYASTTGTQPPFLFWQTPVAAQVWDLFAQFVP
                     MMASTDHVQVLNGWRGLFQQLFLAQSIDDKTAAAPDAVQHAFRPTPQAPLFAPLLQLI
                     EQRRDNAQSDRVDGAVISNAISPLRLFREILQLVMTLVQDYGELFVADGWYAVLTLCK
                     EAVLAGHDPLTFTSETDRKGIHDAGFALLQLLAKEYASSFLHQPAASEVRTLWLETLT
                     SWALHAADVNMALSSIGMLWSLCDLLQPSESTDAALWCRVLSTLARLCITERVDVRNS
                     ALKTFLGTLLAHGQNLVEHDRWRGIWEEALLPLIEGLLVRSPAPSSLAGEGTALEAPV
                     EATSTTTDASAEATAKHAPARALTSATTNDDGNDRTIVKGDAVVGMHPASAKDAIKHW
                     NASRLLLIEGLVRLIQQYLVSRWLALEAFPRHWESLLDYWEQTSCLYDVHKSPPSNQE
                     ALLIALVALWQTSLETLSQVVCCEPALPGSRSSNQSARQLWLQTWQRAQRRAFLANCW
                     PRFSVSVVESIVQALLSLCGRVQQQTPDVDILDIVQSLGYQCLEALIEDTIDPKVAKA
                     SSATLGMQRGKPVQRSALVRDVFDVLARWPGDSVGVHRCAHLNALLSFLERICGSIIR
                     ATTGSAAGVTSSDEHSVMLCIVQGTLERLVRGMPPSATCAAEQEQLVLRFLELLASIL
                     VPRRTWNGSLVAAVVDGSSTAPTDAPAASAQQQPSSLVSTKHVSGANAFVESAVFSLA
                     ALVDKLEDNEETRALLTDAVLARIAALCERFLFEHDIPLPESFDGGTLHMIHTGQLDE
                     EKCSIVMLQLGARLGLVDLLERALGLAPDISVDEHWFLLVTSAYRFNLRLAAIEALFH
                     VAAGLDSGAAPASPFALSRLASAASTVAAARVAVQRLMQRVERCAAAYRRQSGCCPLP
                     YLMRMFEAYVRFQADALTKRGVHLSSAADVGTQRAANGTA"
     gene            complement(<734328..>735029)
                     /locus_tag="CYME_CMO289C"
                     /db_xref="GeneID:16995830"
     mRNA            complement(<734328..>735029)
                     /locus_tag="CYME_CMO289C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537604.1"
                     /db_xref="GeneID:16995830"
     CDS             complement(734328..735029)
                     /locus_tag="CYME_CMO289C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537661.1"
                     /db_xref="GeneID:16995830"
                     /translation="MSDDTPASVSELGWQTVTGFEPCRCAQRLSADRSALDARVRAGV
                     LALSPDERFILAVTSRHQTSDGANQRQAGQQPARYILPAGGVEVGETPAAAACREAFE
                     EAGARVQLLRPLVRHCSLCEAVPCTDSLDGKGTLRRPAVTFWFLGRVLELVPAEGGQW
                     PESTLRQRCYLPLDTASAHNDSAAERSSIDKLRATLCWRADTRAAVEAFLRLFEAQQE
                     LHCKLDPALLDRPAP"
     gene            <734869..>735876
                     /locus_tag="CYME_CMO290C"
                     /db_xref="GeneID:16995831"
     mRNA            <734869..>735876
                     /locus_tag="CYME_CMO290C"
                     /product="ssrA RNA (tmRNA)-binding protein, small protein
                     B"
                     /transcript_id="XM_005537605.1"
                     /db_xref="GeneID:16995831"
     CDS             734869..735876
                     /locus_tag="CYME_CMO290C"
                     /codon_start=1
                     /product="ssrA RNA (tmRNA)-binding protein, small protein
                     B"
                     /protein_id="XP_005537662.1"
                     /db_xref="GeneID:16995831"
                     /translation="MKRSSGDRANTPARTRASKALRSAESLWAQRHGSKPVTVCHPSS
                     ETEAGVSSDIIGRLRPHRATGLGVAFPQTLCFGTREQRRSRSTSLLRTVRNEALYAQG
                     NVCVNRNASLRLCSLLGRLRGRMATLSFLFGTSSARFTSGHDAWSRAGVRASWNVAPA
                     QRLPRAKVGLRTLVARTKSTSSPSVENRRINFQYEVLWTLECGIELKGTEIKSVRAGK
                     MNIRDAFARAKRGTNDLWLYNCHIAPHDRTATFFNHQPTRPRRLLAHKQEIRRLLQAQ
                     EEKGLTLVPQRCYFDQRQRLKVLLAVARGKKLHDKRESIRERDEARSMKRFAKYDLRD
                     L"
     gene            complement(<736141..>737052)
                     /locus_tag="CYME_CMO291C"
                     /db_xref="GeneID:16995826"
     mRNA            complement(<736141..>737052)
                     /locus_tag="CYME_CMO291C"
                     /product="ribose 5-phosphate isomerase"
                     /transcript_id="XM_005537606.1"
                     /db_xref="GeneID:16995826"
     CDS             complement(736141..737052)
                     /locus_tag="CYME_CMO291C"
                     /codon_start=1
                     /product="ribose 5-phosphate isomerase"
                     /protein_id="XP_005537663.1"
                     /db_xref="GeneID:16995826"
                     /translation="MFDRSVSFASPTGTFLWTLKNQPRVCNIGARTDRYTRILGRSTT
                     ASTSGRWLRAHSRRLAVGGVFSTSMASADDLKKQVGYKAVDDYVRSGMVVGLGTGSTA
                     AFAVERLGQKLAAGALRDIRCVPTSVRTEEQARSLNIPLTTLDEDAELDVAIDGADEV
                     DSALNLVKGRGGALLREKMVEVCAKQFIVIVDESKLVPGLGVSGAMPVEVTPFCWQHT
                     MRKIAALPALAGCRAEARRDAAGALYVTDNGNYIVDLYFEKPIADAYQAAQALRDTVG
                     VVEHGLFLDMASVVIVAGAQGVYEKHR"
     misc_feature    739052..742860
                     /note="retroelement"
     gene            complement(740536..743133)
                     /locus_tag="CYME_CMO293T"
                     /db_xref="GeneID:16995827"
     misc_RNA        complement(740536..743133)
                     /locus_tag="CYME_CMO293T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461509.1"
                     /db_xref="GeneID:16995827"
     misc_feature    742587..745747
                     /note="repetitive element"
     misc_feature    743120..745827
                     /note="repetitive element"
     gene            <745832..>746698
                     /locus_tag="CYME_CMO296C"
                     /db_xref="GeneID:16995819"
     mRNA            <745832..>746698
                     /locus_tag="CYME_CMO296C"
                     /product="similar to EAP30 subunit of ELL complex"
                     /transcript_id="XM_005537607.1"
                     /db_xref="GeneID:16995819"
     CDS             745832..746698
                     /locus_tag="CYME_CMO296C"
                     /codon_start=1
                     /product="similar to EAP30 subunit of ELL complex"
                     /protein_id="XP_005537664.1"
                     /db_xref="GeneID:16995819"
                     /translation="MQPRRRYRGHATINEERHRAAQFATAASGYVEEREAALREQCVV
                     FQGKLQAFAREHRREIESDGALRTRFLELCMNLGVEPFLSRRSVWSQLLGLSEWYARL
                     GFLVAQIALATRDWNGGVIRLTVLRRALQRRLDVDCGTQEPSEKRARIVSNDDIARAV
                     RTLERLRAGFRIISIDEGKKECCLVSGAAGEISFTEDEKAVLQRARATGGSICRQDLP
                     WENIRWGRSIERLLQLGILWVDDGASDGQRRYWALGLIPESIEDQNPVSESGPSDRYE
                     GRPITSVASKLP"
     gene            complement(<748434..>748907)
                     /locus_tag="CYME_CMO297C"
                     /db_xref="GeneID:16995820"
     mRNA            complement(<748434..>748907)
                     /locus_tag="CYME_CMO297C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537608.1"
                     /db_xref="GeneID:16995820"
     CDS             complement(748434..748907)
                     /locus_tag="CYME_CMO297C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537665.1"
                     /db_xref="GeneID:16995820"
                     /translation="MRDLLLRAWRWNLLAFWPQFLKQAPPCNCTRRGTRFPLDGLTRT
                     GPRTVTRLHSPAVGNDCWIAPGSPVPEVYASKAPFAQPLSRLDLTLLLCAGYDSSRRW
                     ISAGLQGSRESQCKLTCLEDEANMDCASVLKKRKLKMNKHKHRKRRKQNRHKNKI"
     gene            complement(<751953..>752912)
                     /locus_tag="CYME_CMO298C"
                     /db_xref="GeneID:16995821"
     mRNA            complement(<751953..>752912)
                     /locus_tag="CYME_CMO298C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537609.1"
                     /db_xref="GeneID:16995821"
     CDS             complement(751953..752912)
                     /locus_tag="CYME_CMO298C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537666.1"
                     /db_xref="GeneID:16995821"
                     /translation="MDNGSAPGAAAHGSGGQQTPTLTATSFCATSSSPSVHEDVVTEH
                     ITLEMDTSTGTRSRSQCSAAGGATPRDGEGVTTQQQAAAHLLSTLQNPTTRPPFPLLT
                     TDAIQLILDENYDLIRAICAAQELGRIEHCAALGSRLHANLVYLATVADHQPANTPGL
                     AGIAAANTIAATEKAAAAQELQARAQIPRHVGSNAAASIAAKMAIGAAAMARKDALEA
                     PSETPTAGSIRRKRIRSETMNRHWTPEEHAKFLELVHDPSCRTEDGRYNVSLMSERIG
                     TRDNKQVRSHLQKYLLKRQHQLRRASQDAQPSSMTPAPSDSVG"
     misc_feature    752781..754333
                     /note="possible transcribed region"
     gene            <754569..>755075
                     /locus_tag="CYME_CMO300C"
                     /db_xref="GeneID:16995825"
     mRNA            <754569..>755075
                     /locus_tag="CYME_CMO300C"
                     /product="cyclophilin"
                     /transcript_id="XM_005537610.1"
                     /db_xref="GeneID:16995825"
     CDS             754569..755075
                     /locus_tag="CYME_CMO300C"
                     /codon_start=1
                     /product="cyclophilin"
                     /protein_id="XP_005537667.1"
                     /db_xref="GeneID:16995825"
                     /translation="MPNPRVYLDIEINKSPAGKIVCELFADTVPKTAENFRQFCTGES
                     KKAAGGSYEGCPFHRIIPGFMMQGGDYERKNGTGGRSIYGGKFPDENFTHRHTGRGLL
                     SMANAGKDTNGSQFFITFAQTPWLDGKHVVFGKVVEGLEVLDKVEAVGSRSGTPTASV
                     VIASCGQL"
     misc_feature    complement(754923..756405)
                     /note="possible transcribed region"
     gene            <756914..>757459
                     /locus_tag="CYME_CMO302C"
                     /db_xref="GeneID:16995805"
     mRNA            <756914..>757459
                     /locus_tag="CYME_CMO302C"
                     /product="60S ribosomal protein L18a"
                     /transcript_id="XM_005537611.1"
                     /db_xref="GeneID:16995805"
     CDS             756914..757459
                     /locus_tag="CYME_CMO302C"
                     /codon_start=1
                     /product="60S ribosomal protein L18a"
                     /protein_id="XP_005537668.1"
                     /db_xref="GeneID:16995805"
                     /translation="MPFKQYVVVGRRLPEQQLVKGAVDDTLYKMVIYAPDPVKAKSKY
                     YYFLSQLLKTKRSTAEVVAITEVKERDTTRVKNYTIWLRYRSRTGQVNMLKETRATSV
                     AGAVENIYQEMAGRHRARAESIQILRVQETPSSQCKRPATLQLIDPQLRFPLPRQRQR
                     ASKQSLRTTFKAKLPVTTITK"
     gene            complement(<757483..>758673)
                     /locus_tag="CYME_CMO303C"
                     /db_xref="GeneID:16995806"
     mRNA            complement(<757483..>758673)
                     /locus_tag="CYME_CMO303C"
                     /product="similar to mitochondrial carrier protein"
                     /transcript_id="XM_005537612.1"
                     /db_xref="GeneID:16995806"
     CDS             complement(757483..758673)
                     /locus_tag="CYME_CMO303C"
                     /codon_start=1
                     /product="similar to mitochondrial carrier protein"
                     /protein_id="XP_005537669.1"
                     /db_xref="GeneID:16995806"
                     /translation="MDENSADARTHARPRTKPVHRSFVGPTSQPETREVQRAVTLLKT
                     LLAGGTAGAVAKTAVAPFDRVKILLQVSKLHGGARAYSSIPQTVRSIYIEEGLRGFFR
                     GNSATLTRIFPYAAIQFTAFEKYHELLSRMLARGWRHQQSAASSSQSPPFLRFLAGAL
                     AGSTAVVATYPLDLVRTRLAAQAVALSGGAHPGMIYHSILDALCSLFRRGGVRGLYSG
                     LSATLVGIIPYAGINFYMYGVLRQLAQNNGFAERYPTLSALVCGGSAGLIGQSAAYPL
                     ETVRRRAHCWDHYHHHHRTTDFDVAAAAPAAAGDNMDAWETKVDRKQSRFIQRQPRIP
                     SQGVVSTIYSIVRAEGVRALYRGLSLNFIKAAPTVGISFAVYEKMRQWLKLPASSSST
                     ARPL"
     gene            complement(<760985..>761635)
                     /locus_tag="CYME_CMO304C"
                     /db_xref="GeneID:16995744"
     mRNA            complement(<760985..>761635)
                     /locus_tag="CYME_CMO304C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537613.1"
                     /db_xref="GeneID:16995744"
     CDS             complement(760985..761635)
                     /locus_tag="CYME_CMO304C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537670.1"
                     /db_xref="GeneID:16995744"
                     /translation="MSGHTKAPASTALGEAQRLPATALHSSVEPVVTDSVTGETNEAV
                     CTALHAERPGSQRLKSGGELLGYNSAVGTLLRLIARRNVWSYGELTAALGIRERSELV
                     SLLLTAIENGVICGQIDSEREVFTVHGVEASAQVETEEVQLFLQRLDAWEQRIRRVRS
                     AIQDAKQRCREYAEANEWVIEEPGRPRTANQVRIAGVEAVSEGLLASPVDSDMEVD"
     gene            <761950..>763047
                     /locus_tag="CYME_CMO305C"
                     /db_xref="GeneID:16995745"
     mRNA            <761950..>763047
                     /locus_tag="CYME_CMO305C"
                     /product="similar to adipocyte-specific protein 4"
                     /transcript_id="XM_005537614.1"
                     /db_xref="GeneID:16995745"
     CDS             761950..763047
                     /locus_tag="CYME_CMO305C"
                     /codon_start=1
                     /product="similar to adipocyte-specific protein 4"
                     /protein_id="XP_005537671.1"
                     /db_xref="GeneID:16995745"
                     /translation="MSSESGVPATSGSEAAERLTKTLCGVYALCFVIGWLYKRWLLRR
                     WKRAILEVLREQCAVVGEDLVRLAGSSASRDATTLVTDVWKRADNGVLEVYASGRRHV
                     AGVLLRLDPVPREDVFTLIHDFLFEEAPDRLSIKAFISTKMERCVFALAKKHELKRLH
                     VSYRELEHYTEQVTTVAPELSSEYGVLADTKELAQRILNASRVALLNRYVDIIQRLRF
                     SDIYEDVPQDDDEDAQEADSEKPNASVESREPPGTLHPSSWSQVVHLQLALPVNLESL
                     SEVLRFFFDLVDEVATMRMSHEAQHATQALRELVQRERQKRLNRARAKEEKEKAEERV
                     ARFEDAERRRRERREYRRRARSQRAPLRIFF"
     gene            complement(<763739..>764899)
                     /locus_tag="CYME_CMO306C"
                     /db_xref="GeneID:16995761"
     mRNA            complement(<763739..>764899)
                     /locus_tag="CYME_CMO306C"
                     /product="probable myo-inositol dehydrogenase"
                     /transcript_id="XM_005537615.1"
                     /db_xref="GeneID:16995761"
     CDS             complement(763739..764899)
                     /locus_tag="CYME_CMO306C"
                     /codon_start=1
                     /product="probable myo-inositol dehydrogenase"
                     /protein_id="XP_005537672.1"
                     /db_xref="GeneID:16995761"
                     /translation="MQAAKFCGRLIRLSTFNSNGIGSTREIFAVRQLNSTQRSLSSQS
                     SAGACVNIGIVGAGRIGQVHAETLSRLPNARAVHIVDTIEKAAQSAATKFGIPRVSTR
                     FEDLVENKDIHAVFICSPSTLHAAQIKACCAAGKHIFCEKPLAITLAEADEVIQTVER
                     SGVKMMLAFQRRFDPFFASAQAAVARGDIGEPFTFKLTSRDPAPPPIEYLKMSGGQAN
                     DQAIHDFDVARFLMNGAECTEVYTVGACRVDPRIAQEAGDTDVMVVLLRFDNGAFGTV
                     EVSRLCSFGYDQRVEVFGSKGQVSFGNAYPNDVMLEDKSSVRRAAMPYSFFMDRYERA
                     YRNEVSVFVDCLLNNKPMPTSGRDGRAAMVIARAAKKSLDEGRPVKTSEIKA"
     gene            765160..766171
                     /locus_tag="CYME_CMO307T"
                     /db_xref="GeneID:16995762"
     misc_RNA        765160..766171
                     /locus_tag="CYME_CMO307T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461510.1"
                     /db_xref="GeneID:16995762"
     misc_feature    complement(765966..766970)
                     /note="possible transcribed region"
     gene            <767344..>768570
                     /locus_tag="CYME_CMO308C"
                     /db_xref="GeneID:16995841"
     mRNA            <767344..>768570
                     /locus_tag="CYME_CMO308C"
                     /product="probable homocysteine S-methyltransferase"
                     /transcript_id="XM_005537616.1"
                     /db_xref="GeneID:16995841"
     CDS             767344..768570
                     /locus_tag="CYME_CMO308C"
                     /codon_start=1
                     /product="probable homocysteine S-methyltransferase"
                     /protein_id="XP_005537673.1"
                     /db_xref="GeneID:16995841"
                     /translation="MTDLRPTFGKRPLRRSAILEHLAAIRYRTGRRYPCAILDGGFAT
                     EIERLGHDLSTTATQGEWAAAVLHKAPHDVQRVHRRYLEAGAEILTSASYQASMASIP
                     TAVEVLARSLDRLDTQASYVLRAVSLGPLAARLGGGLEYRGYADTELFAAGDEAARET
                     FRRYHEPRIAACVPFFAENSNDRDLTGDGTVPRADFILFETVPDALEATCISELMTSD
                     TRFENIPWAISLQCRLASSSPPLAPESSERCTNMPQLAGGGPVPSVVEELLVSSFGPD
                     PESGTRNGPLFIGFNCCPPWLIRPILESLQRCRHPLARQCAILSRTLERTEVRSADKW
                     ANFAGWAVYPNSGEMWDPGTQTWGRPSASTLDPENDAFWQYHVPVWSALGATIIGGCC
                     RIGPQGISALARVVLG"
     gene            <770329..>771789
                     /locus_tag="CYME_CMO309C"
                     /db_xref="GeneID:16995797"
     mRNA            <770329..>771789
                     /locus_tag="CYME_CMO309C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537617.1"
                     /db_xref="GeneID:16995797"
     CDS             770329..771789
                     /locus_tag="CYME_CMO309C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537674.1"
                     /db_xref="GeneID:16995797"
                     /translation="METATSSPERMLVGSLIQLIQAETRLIMLGWKASDQNQPTLRTQ
                     PLPWSPRSAADEFAEPLQAYFVLGCGGELRAPAACGRVVGIYHRGFVRSVHDNDEVLY
                     ADVRLVVVREAGSALTPALERAWLRLENWVSLTIKQQNDLNADASTDGWRRRSEYFER
                     ICRDLTHLARERDRLLNQTRERLNVARRSQMHLRRVFVEAFAGHLLCFESSRPDQGFE
                     GASSEAGASKCDAASASEPVFFTGQPLVLLNDALPNDLPADGDEKEHHSWRWLTHDLF
                     GRFRIPLGRPPAIQSLGWLYIPVVDDVGNAIRVEEIIEGDPPTTDPKTKRYLHTKPIR
                     LAPDVEREVQFRLTAAKRCCTCIRETACAGAPVQPDASGTDARSANRHALHSCVTCSA
                     WALTWPGVFEVTSDMLRGWSNWQVHQNRSDENTFTFAVDGTERVYRAWSRHERDVIVA
                     CLRHWQEEARAGAHDPGAALPASGVPLSTGSMFQDK"
     gene            complement(<772300..>773034)
                     /locus_tag="CYME_CMO310C"
                     /db_xref="GeneID:16995800"
     mRNA            complement(<772300..>773034)
                     /locus_tag="CYME_CMO310C"
                     /product="60S ribosomal protein L7"
                     /transcript_id="XM_005537618.1"
                     /db_xref="GeneID:16995800"
     CDS             complement(772300..773034)
                     /locus_tag="CYME_CMO310C"
                     /codon_start=1
                     /product="60S ribosomal protein L7"
                     /protein_id="XP_005537675.1"
                     /db_xref="GeneID:16995800"
                     /translation="MEQVPESVLKKRVSEEKSKAAHLAKLKAQREKRKKSKEEAIRRA
                     ESYVAEYLAKERAVIHARRAARAEGKFYVPEGAKVAFVVRIRGIRGVPPKQRKILQLF
                     RLRQIHNGVFVRINYATLRMLQLIEPYIAYGYPNLKSVRELVYKRGFLKVGKPGGWSR
                     IGITSNDLVERVLGKHGIICVEDIIHELFTCGPKFKIVNQALWPFKLSSPRGGYGRRG
                     KLRHFVEGGSHGNREELINRLIRQMN"
     gene            <774187..>775014
                     /locus_tag="CYME_CMO311C"
                     /db_xref="GeneID:16995801"
     mRNA            <774187..>775014
                     /locus_tag="CYME_CMO311C"
                     /product="similar to mitochondrial presequence translocase
                     subunit Tim23"
                     /transcript_id="XM_005537619.1"
                     /db_xref="GeneID:16995801"
     CDS             774187..775014
                     /locus_tag="CYME_CMO311C"
                     /codon_start=1
                     /product="similar to mitochondrial presequence translocase
                     subunit Tim23"
                     /protein_id="XP_005537676.1"
                     /db_xref="GeneID:16995801"
                     /translation="MSSIWSRLTDKRRSNKPDDASGEKSDILGAGTSLDSRADPAPDH
                     LWAQVDQVDSVPDIEEENGPRVDFSNLDRIQAETVAPALGIYATPRGKSGEVDYLFAE
                     EYHEYRHKSWGEQLTFWAGVSYLGGAIIGGSLGFREGIQKGNEMVAELVSPVTGAGGG
                     PKAATSLSVSHVSKAKLRLNALLNAVGRRGGRMGNAAGVLAIMFSGFESFLHWLRDDV
                     DDSWNYIGAGALTGALYKSTAGLRAVSMWSAGLATVGLVGLYGARRGVYGRRLRQLL"
     gene            complement(<776188..>777750)
                     /locus_tag="CYME_CMO312C"
                     /db_xref="GeneID:16995802"
     mRNA            complement(<776188..>777750)
                     /locus_tag="CYME_CMO312C"
                     /product="similar to pre-mRNA cleavage complex II protein
                     Clp1"
                     /transcript_id="XM_005537620.1"
                     /db_xref="GeneID:16995802"
     CDS             complement(776188..777750)
                     /locus_tag="CYME_CMO312C"
                     /codon_start=1
                     /product="similar to pre-mRNA cleavage complex II protein
                     Clp1"
                     /protein_id="XP_005537677.1"
                     /db_xref="GeneID:16995802"
                     /translation="MADTLSSHSSGLGTGHNADAWRVFDLRAENELRLEVSDDTQSTA
                     QLRLLRGTAEVLGRELALHQSFDLRPGSRLGVFTWHGCRVEVRGSFHVPPYIAEETPN
                     PLVMNIHAVLQRQREQSFRTGRDGRSNKTPRVAVVGPHDSGKLTVAATLAAYALRHLG
                     ARLAWLDLDPGAGFGPCSRLTAVPGALVMMSLHRPLLALEDAAAFERPICWYFGHFYP
                     HDNAKSYLTLIGAIRRQLDAWMTEVDAKAAKAGDQGADTEAPLLYNAGCIAVLPAWTE
                     TRESFDLLADALHELSPTCVVVLESERLYALLRQSYDDRVNTDTKQRVDLVRIPKSGG
                     VVPRDTSIRRAERAKRFRSYFYGLHGELHPHPLWLPTADILLYRICERALAPLTALPL
                     GETFPDQESLEIEFLTELQEEMLHTVGAVSQASEQELAARLPNVISGASAAPPAAEAS
                     SHIDAPSTVWERPHLDDPTIVTRMVGTPVFGFVQITAVDRFRGRLRILSPSPGKLPSK
                     LLQVSTDLRWIE"
     gene            <778432..>779760
                     /locus_tag="CYME_CMO313C"
                     /db_xref="GeneID:16995803"
     mRNA            <778432..>779760
                     /locus_tag="CYME_CMO313C"
                     /product="DNA primase, small subunit"
                     /transcript_id="XM_005537621.1"
                     /db_xref="GeneID:16995803"
     CDS             778432..779760
                     /locus_tag="CYME_CMO313C"
                     /codon_start=1
                     /product="DNA primase, small subunit"
                     /protein_id="XP_005537678.1"
                     /db_xref="GeneID:16995803"
                     /translation="MRKRVIAETAPGEEELADQVIRIKANDVDSGLAALKSCALPALS
                     RAESLQRYYAEWFPATVLAQWLAGRPGAEGEDLLSRREFSCEADDGSGGEKRIRYLAY
                     QDAAGLRAEFLRLLPLRYDIGPVYDASPRDRYRRINKLEPVERELVFDVDLDVYESVS
                     ALGQSEPAGAAANFADDPLRACADNWLFVEAAVTVMEQALREDFGYEHVLWVFSGRRG
                     VHAWVCDTRARQLTDEARAAIVEYLQYRGISAVSNRSSLSSTFNRTATTFLHPALRRA
                     ATILLPFMDRFLEERPSIWADEGAMDTVLGMCPDAQVRETLRRFIQRSHTRESAAAVW
                     RLALEQLDSKRLDTDAAMHIVLGLLYPRLDVNVTRQRNHLLKGPFSIHPKTNAICVPF
                     RADQVSKFRPERDVPRLVPLVTGDAKAQKQLRAALDIMEAFVTELYRADT"
     gene            complement(<779813..>781126)
                     /locus_tag="CYME_CMO314C"
                     /db_xref="GeneID:16995794"
     mRNA            complement(<779813..>781126)
                     /locus_tag="CYME_CMO314C"
                     /product="photosystem II stability/assembly factor HCF136"
                     /transcript_id="XM_005537622.1"
                     /db_xref="GeneID:16995794"
     CDS             complement(779813..781126)
                     /locus_tag="CYME_CMO314C"
                     /codon_start=1
                     /product="photosystem II stability/assembly factor HCF136"
                     /protein_id="XP_005537679.1"
                     /db_xref="GeneID:16995794"
                     /translation="MTSVSVAFTNVAGLLAHGSKSRCRNAEVLRSRSAAERASGDRQR
                     WRICMSDGERVHAYTETVVESQLGFSVSRRALLHHLALGALAVALPRSGALVAAPLAE
                     TVRGAAWKQVPLPTESVLFDIDFSQKDPNHGWLVGTRGLVLETRDGGETWEPRAFEDV
                     EREEELNYRFSNVSFSGDEAWVIGKPPVMLRSTDGGKNWSRILLSPKLPGEPLLVTAL
                     GPNCAEMVTSSGAIYVTENGGINWKALVRETIDATLNRTISSGITGASYFTGSIVSVS
                     RDVHGNYIAIPSRGNFFLTWVPGSDFWTPHARSTSRRISAIGFIQNDATKGIWETIRG
                     GGLGFTKPNVNLNSTETIAFDMVDSKTGGYGILDVAFQDDRHVWAAVGGGSMYRSDDG
                     GKTWRRDPLVSKVGANLYKIKFFGSQRGFVLGADGVLLKFHPENV"
     gene            <782848..>784215
                     /locus_tag="CYME_CMO315C"
                     /db_xref="GeneID:16995795"
     mRNA            <782848..>784215
                     /locus_tag="CYME_CMO315C"
                     /product="similar to mitochondrial magnesium transporter
                     Mrs2p"
                     /transcript_id="XM_005537623.1"
                     /db_xref="GeneID:16995795"
     CDS             782848..784215
                     /locus_tag="CYME_CMO315C"
                     /codon_start=1
                     /product="similar to mitochondrial magnesium transporter
                     Mrs2p"
                     /protein_id="XP_005537680.1"
                     /db_xref="GeneID:16995795"
                     /translation="MAAYVWRCKFERFPFRSLRECLDEDSGSCTCCFRRWSSSAEYSS
                     GRESFSEDWKDRTRDASELTGKRKYPREAQPVRIWTNPREYAFSESWLSSDSAFDLIA
                     MDAQGRLSTYHWHRRRLLHELSTNSSSTRRASFTEADSRSSPVPHSQSDWESRAAILQ
                     SRDLRLLNPIYRDQPVFLMRSDLILAALDRHVLAIMQPGRLFLQQLACPESKSLNDRL
                     IQWIRVRLSEHGNAFEVVALEALLVLAHETLARRANVVKLALEERLAPFASHPNKRLL
                     EEIRVLKRELASVATEAQNYSAALERVLGDDLPWHIAEMTLVVASSGDMLTTSSDLES
                     LLESSMQKFRGWSRLANELCHRVGNAEQIIELSLAVTQMRLWSFDALLHLVTVSAFLI
                     MIPPDYFGMSIWIPVYDRVDIYWPWLLTTFLLMLLSFGFLGTGIWILRRKKLLFPLFK
                     SRVDH"
     gene            <786026..>788716
                     /locus_tag="CYME_CMO316C"
                     /db_xref="GeneID:16995759"
     mRNA            <786026..>788716
                     /locus_tag="CYME_CMO316C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537624.1"
                     /db_xref="GeneID:16995759"
     CDS             786026..788716
                     /locus_tag="CYME_CMO316C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537681.1"
                     /db_xref="GeneID:16995759"
                     /translation="MEKFADNIPEEDLSALVELVEEGEITSEELVQQLQRADLGDLSA
                     EDVYERVSRWLERQDLAENVHESVGSDEPVEAQPAPQIETDVRSGEAPRAVTSSATSD
                     ALLVSLLQKVRQRQRFYASQAERVGAELKRLRRLLLDELRPGLEAIHSEALDRLTELA
                     GDIGELRSIRDELLQRREERLREQLASASAMANTLENELTEALKEDDGERAANCMLRI
                     EALSQEIEETLGLSPGQIAKARRMALERYRTWVYKRCGAYLNRLGPWPSNPDAAFLRR
                     LEASEIAARIRALAQQSVRVFRGPDAAGFYGGTLNEEDDRRSATSEYSGSTAHRASGR
                     DRRYFEHCFLQTQVAAFEKAFREAIRAPPVQASSESKLSVEQGAQKVSSQVSETTPSR
                     AVIDFAVHYLKEFAERYRPLLRVVFDGMDEDVDLLVESMVHEFMATIAEVVFAELENR
                     YSFGEAEEDNARPASGISHLYAHTLQLVDALVTFDRDMALIIVSENHSLMHSWMEAEF
                     QSALNRFETALRTPGALGIVIPGTAASSDQLDLLTKGRAILDSFAGHQNRATTAAALQ
                     LDALQQASLIGETLHSLATRCRALPPHPHRARYRFAQSVIAPLIGWIMAQIHYLMTET
                     EAQCATSLQASMHASGAPSAERFKDCYLLSADALYRTLSYAAAAYLLAEDIRQRVEIY
                     LYELEFSNAPDQGPDSELESENEQSARSDVVGAGNPYDAITAEVTALRKLSSKALASY
                     ADTVTDMLAPCFLEADADASLATPALVAAAMSTIQDLVALSELLLRGHRTLLLWLWAP
                     FFLQLDAKLAMFIAQWRQQLQEANEASQPLHSARAHHESEARSMQQSFGASKHTALPI
                     QAGTVQQLADFAAAHFQLRHTPLHQTRLALEHMLQFSASE"
     gene            complement(<789436..>790545)
                     /locus_tag="CYME_CMO317C"
                     /db_xref="GeneID:16995760"
     mRNA            complement(<789436..>790545)
                     /locus_tag="CYME_CMO317C"
                     /product="similar to carboxyphosphonoenolpyruvate mutase"
                     /transcript_id="XM_005537625.1"
                     /db_xref="GeneID:16995760"
     CDS             complement(789436..790545)
                     /locus_tag="CYME_CMO317C"
                     /codon_start=1
                     /product="similar to carboxyphosphonoenolpyruvate mutase"
                     /protein_id="XP_005537682.1"
                     /db_xref="GeneID:16995760"
                     /translation="MFTISGHVVDYNSLWGQRRTRKGPRTLLPSAGLRSALALFERSS
                     HSWRRGRLVAVADAAGESLHPSQLERTARSGRMEAVERLRLLLQTPKLHLMPCCFDGL
                     SAKMICSAAFPLSFMTGFGVAASFGLPDTGLLSFGEIRDRAASIMEVLPASYPVIGDG
                     DTGYGNPVSVKRTVRGFALAGLAGILIEDQVNPKRCGHTRGKAVVERSEAVQRWRAAI
                     DARNEFEDIVIVARTDAIATHGLDEALWRLDKALELGADVLFLEAPRSVADMERFTKT
                     FAGVPMLANMLENGMTPMLPAKTLESMGYRIAAYPLTLLAASMKAMQAALSALQSGNP
                     EKVAPHLMDFEQVRDIVGFPWYDTEAARYRTDPAD"
     gene            <790718..>791383
                     /locus_tag="CYME_CMO318C"
                     /db_xref="GeneID:16995789"
     mRNA            <790718..>791383
                     /locus_tag="CYME_CMO318C"
                     /product="similar to glutathione S-transferase family
                     protein"
                     /transcript_id="XM_005537626.1"
                     /db_xref="GeneID:16995789"
     CDS             790718..791383
                     /locus_tag="CYME_CMO318C"
                     /codon_start=1
                     /product="similar to glutathione S-transferase family
                     protein"
                     /protein_id="XP_005537683.1"
                     /db_xref="GeneID:16995789"
                     /translation="MITLHYLNQSRALRVWWLLEELEVPYDVKRYQRDETTMLAPAEL
                     KRVHPLGKSPVIEDDGQVIAESGAIIEYLTGKYDKKGLVPPAGTPERLRYTFWLHYAE
                     GSLMPPLLLKLVFNRLATGPSPWIVRPLLRVISRRVQESFVDPQVQLHLGYVEQELTR
                     YRWFAGDQFTAADIQMGFPLLVAKSQKALDDRYPHIMDFLKRMRERPAYQRALEKSGG
                     DEI"
     gene            complement(<792283..>793956)
                     /locus_tag="CYME_CMO319C"
                     /db_xref="GeneID:16995790"
     mRNA            complement(<792283..>793956)
                     /locus_tag="CYME_CMO319C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537627.1"
                     /db_xref="GeneID:16995790"
     CDS             complement(792283..793956)
                     /locus_tag="CYME_CMO319C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537684.1"
                     /db_xref="GeneID:16995790"
                     /translation="MFAVPVFAWKPVSSLRGVARAASCFGPELVEAPSARTALQKLPV
                     STECCPEPAPDSYVVRKRQRRAVQGSRFRDSRPLPRARVYMAQEAEARWLVAPTSQLL
                     PLRQELEHVAGELLRAKHHSSDKEEELAAKVLQAKVQLLRLLTEDLVSRLRNECRVPV
                     GDEVLEQLEPLLEALKRDAQLLQEYSKNPGFRAGIPQTKSAMREKLWQLRCLLEPNNP
                     PRVLQMLVEQLRSCLMDNRFESLALGGSPGAEPGDVQPRLREQDQTVLFALQLLVQDN
                     FLMLELLSLRILQHEVQLSCASWDWVQQDENAKRYLCELRDAATQLHLGTYRVRGRSR
                     LLQAARSFAHYLGELERSSGLPTPSTVRHSLDMLQEALEEDMAYATLIPERAPALHGE
                     SMLLRPRPSDIPNFEVVLPRRLLRGGQPTSAGIQWLRDYGVRVTIDLRGTDRGNQWNA
                     PHEEAWGDVRMIRFHIEDFSAPTLEQVMQFVQLVNEPSNWPLYVSCKAGIGRTGTMIA
                     CWRITQGTSVDEALSRESLYSSDGGGMAQEAFVRNFSLIWNSLSGEKRD"
     misc_feature    793263..795248
                     /note="possible transcribed region"
     gene            complement(<795437..>797629)
                     /locus_tag="CYME_CMO321C"
                     /db_xref="GeneID:16995785"
     mRNA            complement(<795437..>797629)
                     /locus_tag="CYME_CMO321C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537628.1"
                     /db_xref="GeneID:16995785"
     CDS             complement(795437..797629)
                     /locus_tag="CYME_CMO321C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537685.1"
                     /db_xref="GeneID:16995785"
                     /translation="MDVEPELSVSRNLDELSSLLRRFRNGEESTEVDYLDTLWKPLIN
                     LLRKALEVAEPNQSCAGGIAGHFAERLLQELPPAGWLGVLCGSDATFDGINTTGAFSA
                     SSLEQLVHELEQTLDTRFSSDVTLVTQVLKLYLVERYAENGCWQQSLDVMDDVLAFRR
                     HVFCRQNRPRSTNREQRWSSALSMLEPYPKSGEISHVHALWKVIADPYRIRIIRALLF
                     LNLWEKLQERNDFSFPASVPRSESFTQLAESELAKGRHEEVSKLSTALSELVATGAPL
                     SSPRCIGRYLGVQGLTLETWEDIGFVLAQSLCQGRIAEARAQYSRAALQYVAVVFGLD
                     AFLLRLQETANGCRAHDGTGSQVWVEKPGPSAVTAIARAPAASRVLSSLASSEPEAGT
                     LRGRNGAPFGARFHRITDAEAVEILFASVFRRAFCSCVLSPADALRHRLLRYLQKCAF
                     RSATASLWVSHMRVERAYDAYLYRAPFALLDHLLAGRTIRWPLVRAGNPDDVLRSSQQ
                     VPQWLEDYCYVANEYLRPHQRGHHFYQAIAEHNLHALAQHCDALHIEDLRCLVSPPIP
                     RIDACCGALSTKDAPANQDGEQRNIVEGIDVEQVLTRMLERKQFGAFAEKSVQLDQSL
                     LGLAECTPTIDQVRGIVRFRETDKRRALAILGERSFLAYTAASIPVRQDSTTFAMDSP
                     TNSETRSSRRRGQCLDSITEDGRSTDHALLLCCRELDAFRQFRARDEP"
     gene            <798071..>799654
                     /locus_tag="CYME_CMO322C"
                     /db_xref="GeneID:16995786"
     mRNA            <798071..>799654
                     /locus_tag="CYME_CMO322C"
                     /product="similar to S-adenosylmethionine tRNA
                     ribosyltransferase"
                     /transcript_id="XM_005537629.1"
                     /db_xref="GeneID:16995786"
     CDS             798071..799654
                     /locus_tag="CYME_CMO322C"
                     /codon_start=1
                     /product="similar to S-adenosylmethionine tRNA
                     ribosyltransferase"
                     /protein_id="XP_005537686.1"
                     /db_xref="GeneID:16995786"
                     /translation="MVYAPLPQILRRAVVCKQETCLSVLQGFRSFKRGQHLLLAETRF
                     RPGFRPASHKLESAQKLRNEMNWLQRPKGQGQMFCTEAASSSQESSAANSMIPRVSIA
                     DYSYELPPERIAQYPLPLRDHARLFVFDPQQGMQHRFFYDLPSLLPPESVLVGNDSRV
                     IAARLLLRRAPPQTDSSPQAPCAARLVEVLCLEPIVPSTDPAVVLSCREPPVEWACWI
                     GGRRVFPGLELRGEHLRARILERAGQEGTVRFDWEPTTACLSFGELLEREGRTPLPPY
                     LNRDDTPRDRSDYQTVFARESGSVAAPTAGLHFSEELIKKHFEKRFIRFTLHVGAGTF
                     APVKAADIGDHIMHRERIIVRREQLVQLIRAVESASPLVAVGTTTVRILESLYWYGSA
                     LCRPGAKRAHRGAAAAFDEHLSFVVEQWDPYVRSGDVPVEHALSAVLDVLERNRASEI
                     HGYTSLIIVPGYSFRVVDALITNFHQPRSTLLLLVAAFLPGGRETLFRIYHEALARSY
                     RFLSYGDASLLWRKSVQGR"
     gene            <800599..>802623
                     /locus_tag="CYME_CMO323C"
                     /db_xref="GeneID:16995787"
     mRNA            <800599..>802623
                     /locus_tag="CYME_CMO323C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537630.1"
                     /db_xref="GeneID:16995787"
     CDS             800599..802623
                     /locus_tag="CYME_CMO323C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537687.1"
                     /db_xref="GeneID:16995787"
                     /translation="MQIDAERYKVTLTSPRSLLSPQNIKLAFTLPEQHAAEHSCSRSV
                     IARHRYYALTANGGAADQNIGDSEDTRKVGDAVPDVANITGALASGGTAHARERCYHV
                     ASAMRIPARPDKSVVLFRDRYVTQDSWKIFNWAPPLASSSKFHLYTRASPLHAKQVWT
                     ASASRLGMHWNENDPPVSRTPAPPDAHERRSQITQVLAAAKSSRSPAKPHPEPPASDL
                     RSPECRAGAFANAAEPLWDQDARISAGSNHDHMSPSQESEGMHATHPMGTDEHIEKGA
                     DPLLLAMPMTRAVAKQRRAASPMRAENARQRANRLWVPARISHKASKRRSSADSRQRN
                     GPGFSQTRPAELLIPVGKLRPESEHHEDPGRVIKPEEMARMGRVFRERFPEPPSALSS
                     IPSSGWCLERITEEASAWWRRNYSEQSETWFQRWHAYVRFVRQRLSRSRSKTARISAG
                     CARRWLAQFLRSNVAVDAHSAPSSSYTDQSDAAAERPAQTHPVPLSVRNGSMMKRSFA
                     TYPSYTPQTRARYRRYQYRECDMISLPVGCDARTLLRCFSEDAPLRQAQALPAKEPVW
                     IRGLPGQGTRRWPGYMLGTLDRRLIDVDAGVSLVAVQAADGNPEYVANAQMYVLPQHQ
                     IEPFRASEVKATFAAELALRRPASRQSARFEHAFSEVYALFLQNAGSQCV"
     gene            complement(<802843..>805239)
                     /locus_tag="CYME_CMO324C"
                     /db_xref="GeneID:16995788"
     mRNA            complement(<802843..>805239)
                     /locus_tag="CYME_CMO324C"
                     /product="4-amino-4-deoxychorismate synthase"
                     /transcript_id="XM_005537631.1"
                     /db_xref="GeneID:16995788"
     CDS             complement(802843..805239)
                     /locus_tag="CYME_CMO324C"
                     /codon_start=1
                     /product="4-amino-4-deoxychorismate synthase"
                     /protein_id="XP_005537688.1"
                     /db_xref="GeneID:16995788"
                     /translation="MRVLIIDNYDSYTYNLCQLVGIVDGGQLPVVVRHDDATVLASIT
                     TCEQGPSPFDAIIVSPGPGRPERVNDFGFCCKVIECFSLHQTPILGVCLGHQGIVHAF
                     GGRVVHAQRPVHGEVAIVEKTEQRSSQKALFSGLPSTRFRAVRYHSLVAETASLPSCL
                     EPLAWCTDVDTQERILMAVRHQKFPIFGVQFHIESAGTEYGDQILRNFLRIAQRYRLE
                     RGYPVERLAPRVPHSTDPGNAGRFQAVYEEVMGKLHRPQRCVQMHRLEAKRVCAQPAQ
                     AFLRLYGNDPNRQVFWLDSCYEYRQERWPAVRWSMIGEWESSHALDGSRFPFWEALDK
                     ELSTSAASWPELETSDELPPFIGGYLGYLGFELKRESFDAPHGGQSGRRNPADAFLGW
                     VHRLAIFDHQTGSVLLVTNDAASADPSDAAMWIERVECALTTPDSAPNRVDLQVSDRI
                     RNQETPRNAPCDQSSNAPQKIIQFEWSRSRDQYLKDIRTCLEYIRNGESYEICLTNLL
                     RLRPTKLPPKFHPLTHYLVLRRVNAAPFAAYLQLGPDTVICSASPERFLLLRNGTMLE
                     SRPIKGTIQRSADPAEDARLAFQLSTSRKDRAENLMIVDLVRNDFGRLCKPGTVQVPQ
                     LMRLETFASVHQLVSIVQGRLPSPMRNTGPHNTWAAPLGRVLRACFPMGSMTGAPKQR
                     TLEILEALEKRPRGIYSGSIGYVSANGQHADWNVIIRTAVWERRRNANGVDAPEDSWG
                     VSIGVGGAIVAHSDPQDEYEETLLKARSVIESIREALQAESVEIVEAFPCEAGPCPAP
                     "
     gene            <805656..>806825
                     /locus_tag="CYME_CMO325C"
                     /db_xref="GeneID:16995765"
     mRNA            <805656..>806825
                     /locus_tag="CYME_CMO325C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537632.1"
                     /db_xref="GeneID:16995765"
     CDS             805656..806825
                     /locus_tag="CYME_CMO325C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537689.1"
                     /db_xref="GeneID:16995765"
                     /translation="MVGQTELEVLAAERQRKALRRTPKLRARSHAVLASTGSVQGHAT
                     DTTTFGTLYGVLVDFGSTVSASCEKIASVCSALPGFRSDSLGSEELASSNALEHVRDS
                     LQSLLRSLAKLFANLRDAQVRHRLDSVELPACIVSDMRQIQNNWLDLSCRIAASIVCV
                     QQANQCIGDPQSQSFTALHSVLQKHLYLCRRECMLLERIRTIQKELRLREARIDAPNR
                     REAPAPEAFQGCSGVLRQIRSMQNEERTSKSPKRCAVRTRLEISAPTTPNLPTAGREA
                     FFVGAVNEAASRSRCSEALAPTPCLFRLFERSSATRQHPGSVGEHLDGSRWTSLLHHS
                     ALSSQWQILRFRSEGFHDEGSLQCSHGSGSLRVLADSLRTDAYHYAANFVGSPCS"
     gene            complement(<807790..>808956)
                     /locus_tag="CYME_CMO326C"
                     /db_xref="GeneID:16995766"
     mRNA            complement(<807790..>808956)
                     /locus_tag="CYME_CMO326C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537633.1"
                     /db_xref="GeneID:16995766"
     CDS             complement(807790..808956)
                     /locus_tag="CYME_CMO326C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537690.1"
                     /db_xref="GeneID:16995766"
                     /translation="MSSFARLCWIGTPVQWLHCRCRYGSRVSGKLVGHCNRGTSWSKT
                     GAALQKRSRIVHWGSTRRLCDISCAWGGGSRNGPGSGSGRGSEGPADDLFRNRVETRA
                     RWQRLWQQPFRTLFQDEYFAWSTTGVRHPPTSTAILGLFLIAIMALVIPIFLVLLAVA
                     SQLMMLALVVGVPVFLLGAVSFLGLGGLLCISGVALTGAVVMPVLALSGSVSVLAWPA
                     LCIASVGTYWLFSRRRRQRVDLQAADDIQLPTPGETSPEESYLQRVREDLAQFDARLY
                     GASAPDMLTETRENTKLPFPLRLAQESPKKIWGVSRKEVERWTERDVAEAAKSFGLPP
                     RVCKWLARELVDGRVVLALTETEQQELVSTVQPRLTFGERKMLKEFLRYLSRAI"
     misc_feature    809068..810537
                     /note="possible transcribed region"
     gene            complement(<810919..>812427)
                     /locus_tag="CYME_CMO328C"
                     /db_xref="GeneID:16995776"
     mRNA            complement(<810919..>812427)
                     /locus_tag="CYME_CMO328C"
                     /product="similar to sucrose transporter"
                     /transcript_id="XM_005537634.1"
                     /db_xref="GeneID:16995776"
     CDS             complement(810919..812427)
                     /locus_tag="CYME_CMO328C"
                     /codon_start=1
                     /product="similar to sucrose transporter"
                     /protein_id="XP_005537691.1"
                     /db_xref="GeneID:16995776"
                     /translation="MEEQAAKLSTLRLYLVTSAMLGIQYAWAVQVGVTTAVLLELGMT
                     ARWVSLAWLAGPIAGLVVQPLVGLLSDRSSSRHGKRRPFVAVGAVLTSASLLAFAYAV
                     PIARRSRFLTPLFVAVSAFWCLDFSINAMQGPLRALIFDHVEAAEQERGNVAIAVYIA
                     IGNLVGSAMAGAALTRDTFLRHVFSTDTEALYTIGAVLVLGTAAVCWVASAPLARNRS
                     CPAQTTPWTVPESDNVRLPIPDTESMDEAESDNCRELASRSPGMMRATGLTLKPVASQ
                     LLSLVQHCRRALKTASTTFWVVFLIQLGTWYGWFSLFVFGSSWFGVNVFGGDPHALAG
                     SIARERYEAGIRHANVALALQSIIAFLYAMLMPQIQYRVWRLSPMQVKYGFSLVVQAT
                     VLLALATIGARNVVLAVCLQAVLGISWATSITIPWALVGASVANSNARDAAGTFATLF
                     NASQCFPEIAVALLSPVLGRHASVAVQHNRVLTSGAIMVGLSTLLVPFVHRS"
     misc_feature    812567..814286
                     /note="possible transcribed region"
     misc_feature    814003..816988
                     /note="possible transcribed region"
     gene            complement(<814492..>817473)
                     /locus_tag="CYME_CMO331C"
                     /db_xref="GeneID:16995779"
     mRNA            complement(<814492..>817473)
                     /locus_tag="CYME_CMO331C"
                     /product="sister-chromatide cohesion complex Cohesin,
                     subunit SA"
                     /transcript_id="XM_005537635.1"
                     /db_xref="GeneID:16995779"
     CDS             complement(814492..817473)
                     /locus_tag="CYME_CMO331C"
                     /codon_start=1
                     /product="sister-chromatide cohesion complex Cohesin,
                     subunit SA"
                     /protein_id="XP_005537692.1"
                     /db_xref="GeneID:16995779"
                     /translation="MEAALVDPVHQLRTDEEPIEQTRVPDLTTSPCSPRSASFTHQVH
                     SGGGFLYDALRLRSADLSRPLSEFWSRASTDFKWTICELLELVVLAAHPVTLAEEPSC
                     RSEILQLLADSVIEGPDRVATPENAKVLVDALSTAILPRISESELGRAALIPPLSATT
                     RDARRFTQKYETCFQQLVQTCPESVWMDSDLIDAWVSWLAYLTESRLRAVRLAAVVAA
                     LHTVDGLLAVERALQDQAAAVQRNVVRNRSALEKIRLQTSDTQDLVKHLVQTVFAKRY
                     RDVFADIRFHCISALGRWIRSAPARFLEDRFLKYLGWMIYDKDSKVRHAALDAILQLV
                     SNPNYVVPMQAFLQRFRVRLVEMTRDREEQIAIQAIRLAQTLLPADWLGKAELEGVLD
                     LITEDPRAPVRAAAGALSITYIELANSAYIQRFGVEHAPKAMLREIVFLILTANQNSY
                     TRVCEALWHDAAITALCTWNAYVELLEEGEPDDGSEPLTDADRLALIRLWVAVAERVQ
                     CLEESSARCSTNPEGTFQPAVASTLLIAACREALPRLMRRFQSDPALVAALAQLVRLC
                     SDAFHAHEEVIEPLLMDAFHRHAQSLEAMRAIVRALYALENRTENDSDSIPIRLQELL
                     STCCMHTLDVCTETRCNQLLAALEWISPKDSASMDGLRRVLYIVLAQRQAGSAKIPAT
                     VASLVCRILFLDVLWHASYSNDASADNEPQSAYEHWDLAFRSIWHVAQHDEDAQIVTT
                     GLEVLLSLWSIAFGRGWAFGMETEETLSISVRDLFRDLLRARAVCDNAVLALCQRILI
                     GPASVAMEAIPLLFLQPRSTGNDILAVAARWVHQRIRERRTLSQRVAVELAALQMSFD
                     VDGHDGARRVASALSARYAFATSGDGVEALLDAVIDAALGFRADIPANPALAEAAGMA
                     LTSRLKPEVCVGAATRLYSRLEARGVDISSPDESDWWYPLWRLYRALLRDTRAETDQN
                     VDSASVTGTGTPQAPTANAAA"
     gene            complement(<819347..>820138)
                     /locus_tag="CYME_CMO372C"
                     /db_xref="GeneID:16995822"
     mRNA            complement(<819347..>820138)
                     /locus_tag="CYME_CMO372C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537636.1"
                     /db_xref="GeneID:16995822"
     CDS             complement(819347..820138)
                     /locus_tag="CYME_CMO372C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537693.1"
                     /db_xref="GeneID:16995822"
                     /translation="MRERPASAAVWSSDSDTHLSREREATEKENWQQVATSKLGQNVA
                     AASEVRARRRPLGDAANIPRIDGQVQQKKHYVHRTPRGRRAREKSPETGRKATPTSRT
                     SWGLATQPPPGAAEVAFYEPLSQFASDASRRHLDAQLASPDVVALDARLLDHDDGIPE
                     PEIVPNAISVPETDPLFYEPLVSFAEQDIDLDPSREHRLVHGMLCSLSPSGLPREKTP
                     LLMPFDEEPFPEEDHLPVTEKAHLSPGRSGSGLARLEPPILRFPP"
     gene            <821252..>822832
                     /locus_tag="CYME_CMO332C"
                     /db_xref="GeneID:16995837"
     mRNA            <821252..>822832
                     /locus_tag="CYME_CMO332C"
                     /product="similar to micrococcal nuclease, mitochondrial
                     precursor"
                     /transcript_id="XM_005537637.1"
                     /db_xref="GeneID:16995837"
     CDS             821252..822832
                     /locus_tag="CYME_CMO332C"
                     /codon_start=1
                     /product="similar to micrococcal nuclease, mitochondrial
                     precursor"
                     /protein_id="XP_005537694.1"
                     /db_xref="GeneID:16995837"
                     /translation="MLGNTRRSRGSFSIQIPPYMQQFPLWWLCSLASGYPECPENPGS
                     SLQYLWHRVQLSAAPWNQFMQQQLCALQDSWIFSTLQATGDSFSNPPAVSWPLARGLS
                     VALDSQWTQIRKRITEYVKPLTLESIPTRVPYLASLEERLRPSRMLECQKHLWGRIQS
                     RSAQSNSESRSSVRATSDNSNRYSEWLAIVLTIGATALFLRWIYMGVHRYPTAAHLPP
                     HYLALRNPRTGKIDAGRQLHGLVVHVGDGDNFRVLHTPWLLRWWIRLRWRLSGGQLPY
                     KGNLSSQTIHVRLAGVDAPECAHFGLAGQRFGPQARAWLQRTLLNQPVKLLLYQRDRY
                     GRIVAHVWRPRRIPLLGPLLPGLNVSLEMVRAGYAEVYRGAGACYGHLREALELAERQ
                     AQKRRLGMWARSGSHFLSCAGHVAIQSTRKLRSSPWQQLMGALTRPSAYKRLVQVVKQ
                     PCGSSPDWKTAPASRVATAIAVSASRTPHQQGRLLASRIPPKTTSSSVLQIRPRLLLR
                     ALSTALCQRSRKRHILGS"
     gene            complement(<823167..>824936)
                     /locus_tag="CYME_CMO333C"
                     /db_xref="GeneID:16995823"
     mRNA            complement(<823167..>824936)
                     /locus_tag="CYME_CMO333C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537638.1"
                     /db_xref="GeneID:16995823"
     CDS             complement(823167..824936)
                     /locus_tag="CYME_CMO333C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537695.1"
                     /db_xref="GeneID:16995823"
                     /translation="MCNCFRRGDLDTNDNVRTYHIWWRRSNHPKTFADLELQCLFDTV
                     RAPEALDASAASSSPEHSGGDLSHRVFGVTEQCILHRHQQSAFAVSLGLTDAEARAVA
                     RRAVLVHAVYRLWCSGTSHADCAALLDSLCKAGGLKYALPKDASYFRFEQASHGKRLS
                     MTQQQRNLQIYAKLLDHWTTVEQRTIQLSGDDVERIALLEDHELAADCGARVLVGRRL
                     APGGQLCPVHRYRLSARPFIGTTSMDAELAFLMANVAGIGPGQTVLDPYVGTGSILIA
                     SAVLGASQVLGSDLDRWVLYGTSHTARRRHRNGTAGRESQTKSDSQITLLRASPGRTC
                     TTSTIEEHPANATNRVHALEARTHDRNIAQRYHILDNFRFYGIPRHQWPELVRMDLLE
                     PAWAVPDPARPERFGWCDAIVCDPPYGIREGTRQASRACAGDSDEERTSRTMRRRRAP
                     FAAHLEALFRLAARVLCPGGRLVFWLPAVAALTAYDLPRHASFEYIGVPCCQRMRGDL
                     RRYLLVLRKTDRMFPSAAAASSPEVFYEEAPPHYQRAHEDLAARLFRVAERSEQLLQA
                     PNPSRTTVPAADSGTGDAETAVP"
     gene            <825521..>826741
                     /locus_tag="CYME_CMO334C"
                     /db_xref="GeneID:16995828"
     mRNA            <825521..>826741
                     /locus_tag="CYME_CMO334C"
                     /product="similar to nucleolar RNA-binding protein"
                     /transcript_id="XM_005537639.1"
                     /db_xref="GeneID:16995828"
     CDS             825521..826741
                     /locus_tag="CYME_CMO334C"
                     /codon_start=1
                     /product="similar to nucleolar RNA-binding protein"
                     /protein_id="XP_005537696.1"
                     /db_xref="GeneID:16995828"
                     /translation="MVGVVNRSITSQPSLMHAEAGDASPDADGSSSTPDATVTDTLRR
                     TVFVGNVPATIRRRKLEALFRSCGKIVSSRLRSFTPAKPNLPRKAAMNQGAIHPTRRT
                     CNAFLVFEDDVAVERALLLNGTPLETDDGSQVHMRVDRCYLAPQKMREQRTTRADTGT
                     GDAAAPSYTSPDALSAKIAWDHRHSIFIGNVPFTANEEEIRSVFSDCGAILNVRIVRD
                     AQTGMGKGFAYVTFAPEANMDLALSRHETVQLHGRLLRVERSVERLANRRAQHGKTDS
                     RSNAGNGARTADSRRKQTPRHKGRGAARDSQTTSKRAKRERSAKRAMIPKAGRRKGAK
                     RRAGSNLGSPVKEVAADALPPFAGRVADPSTTPFSRPKHRRRKRGPGVSGNAGVSKRV
                     RKQSKIGKPRKRVR"
     misc_feature    827668..829493
                     /note="possible transcribed region"
     gene            complement(829107..831528)
                     /locus_tag="CYME_CMO336T"
                     /db_xref="GeneID:16995807"
     misc_RNA        complement(829107..831528)
                     /locus_tag="CYME_CMO336T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461511.1"
                     /db_xref="GeneID:16995807"
     gene            <831642..>833771
                     /locus_tag="CYME_CMO337C"
                     /db_xref="GeneID:16995808"
     mRNA            <831642..>833771
                     /locus_tag="CYME_CMO337C"
                     /product="similar to J-domain protein D3"
                     /transcript_id="XM_005537640.1"
                     /db_xref="GeneID:16995808"
     CDS             831642..833771
                     /locus_tag="CYME_CMO337C"
                     /codon_start=1
                     /product="similar to J-domain protein D3"
                     /protein_id="XP_005537697.1"
                     /db_xref="GeneID:16995808"
                     /translation="MDEEQQGQSSAVVDEHPELQYYTVLNLSPDASREDVRAAYLRLS
                     QLYHPDRQPDPVLKQRATELFTRIREAYEVLSHPLKRQVYDAYGTEGLRFLESTQVTT
                     YAAVRAYFGERGSQPQRRTRGKRKPHSARHENTDELTAETLLAVNHAVQVTVDGTGLV
                     QLLPDLVAGESLYWRSAIVVRGAALDTQGSWYLTPKDCLSWQYQVATSRSAGVMSDDD
                     DDDDDDDEDDDDDMDDDFGEDGQTDEHNENQDPHTSTWESSTVDSAHERRSSAAYASG
                     STNATSKSSSRAPGTTSRDDDAHLRGTPPMLKHARDEPLFRKLTQVQCRGISVSYRRL
                     VSSEQMMEAGLAWAGSPSRTGATLFADDSWTARPLLSGKLWRRVSPHASLALEASYAL
                     GRDQRPELVLSHARQISERWQGHLAWAAGPAPGYMASFVYGAEQWNAAFTVNLGLGAS
                     GIKFTLRRLCDQAQTIIARLRAHLSLSGWSLETGLAKELALDSYVAVAARVSHVGVAL
                     RLRLSRAGHRLTVPILLFPNPDPLAFVAVASIGATTAAAIEYLALRPLRRLAQERNRR
                     RIRERVYQKLVERRRQALEERELLRPQAARSRALEQQRNGLVIVRALYGAAEVVRRMH
                     SPDVPVAVIDALEDVCDVTDALQALVDDRDSSLRLYATSKAALTGFFDPTMGDAELAL
                     RIWYLLRGEPLQVTIGDLDPLYIGADT"
     gene            complement(<833993..>835105)
                     /locus_tag="CYME_CMO338C"
                     /db_xref="GeneID:16995809"
     mRNA            complement(<833993..>835105)
                     /locus_tag="CYME_CMO338C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537641.1"
                     /db_xref="GeneID:16995809"
     CDS             complement(833993..835105)
                     /locus_tag="CYME_CMO338C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537698.1"
                     /db_xref="GeneID:16995809"
                     /translation="MEREAHPRANDSTRSVTHPASSSCSTSSLGSSERSAEARLLQET
                     VRARLQGKKHTVLANEPLTTSTTGIYEKLAVKASSGALLRQAAGWQLYLSSRFRKQLM
                     VSRHLLMSIGSLSLQLIKLVAKQLGALWRHRYMRAVRWRVYRSFCDIAQLLLRQLKRL
                     GIFLRQVIVRALGPELTQAFTQLFTSIFGLVAALVLLARCLVQQWIYPALHHCMLFLQ
                     RCYRYWQKRSTERNDVREHTTSVPRASVRCATWSPGKETTPINRMVVEHYKLVEASSC
                     HWPEYNDDDSGDTGGGGGGGGGGGGGLRTLHATVPSDSRPRASAPSWSAVADQVQGGT
                     TTSAEASLRPHSLPRRFKRRKERAILQLIDLDDTSL"
     gene            complement(835795..838190)
                     /locus_tag="CYME_CMO339T"
                     /db_xref="GeneID:16995791"
     misc_RNA        complement(835795..838190)
                     /locus_tag="CYME_CMO339T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461512.1"
                     /db_xref="GeneID:16995791"
     gene            <838301..>840316
                     /locus_tag="CYME_CMO340C"
                     /db_xref="GeneID:16995792"
     mRNA            <838301..>840316
                     /locus_tag="CYME_CMO340C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537642.1"
                     /db_xref="GeneID:16995792"
     CDS             838301..840316
                     /locus_tag="CYME_CMO340C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537699.1"
                     /db_xref="GeneID:16995792"
                     /translation="MTFWAWIALTGHSGIHSRSSLRTLPRETARVRRVLWRLSPEHPH
                     LGRSVFTPSRTTARPSEARERLPRSALPHLRSNYSLPETAMLGSGTGHGSSDGKGAPL
                     PATTTTTTHQSDERLLTLDELVLSAGFASRLPADPETANYVRVVRGAALSFVHPSPTW
                     TEPVLAVWSDRCARACLDLEVRPSERDYAARVFSGLAMLPGSRPYAQRYGGHQFGVWA
                     GQLGDGRVIVLGEYQNRCGETWTLQLKGAGKTPFARFADGRAVLRSSVREFLASEALH
                     ALGIPTSRALSLVVTGDKVVRDMFYDGNPREEPGAVVCRLAPSWVRFGTFELATDWNE
                     LELLRQLADDTIVHHYPALLAHERSHGKRTSADSSRSARNEESQNPMPYRALLLQVAE
                     RTAALVAGWQSVGFVHGVLNTDNMSILGITIDYGPFGFLDAYMPEYTPNTTDLPGRRY
                     CYALQPTICLWNLLQLVRAFEPLTGTNLSEEVSQTYETKFREEMSARLRAKLGFQTWN
                     SDADNGLVRDLYELMRQDRADFTRTWRALSWLEPVACLQKSDASLEPLLRVLPEPVRK
                     NPDRLEAWRLWVQRYAERTLAEDNFDGTARRKQMQAASPKYILRNYMAQVAIEKAENE
                     QDFSEIERLLKLLEHPYAEQPEMEALYDREPPTWSQRLGVCMNSCSS"
     gene            <841943..>843946
                     /locus_tag="CYME_CMO341C"
                     /db_xref="GeneID:16995793"
     mRNA            <841943..>843946
                     /locus_tag="CYME_CMO341C"
                     /product="similar to protease"
                     /transcript_id="XM_005537643.1"
                     /db_xref="GeneID:16995793"
     CDS             841943..843946
                     /locus_tag="CYME_CMO341C"
                     /codon_start=1
                     /product="similar to protease"
                     /protein_id="XP_005537700.1"
                     /db_xref="GeneID:16995793"
                     /translation="MLLFQSTLVRVYVVRSPPRNRQLCLRADSSQGRHLLGARPAQQT
                     TTTTTTTTTTTAAASRPITKLTVLRVQQRFWERHGSAPALACSQSPLQPHLGVGAEAC
                     TRQRISDLKPSVGERLHSAYYTRLRQAVAVVRNWVCVASALLFVYLSTSDQVALAAAS
                     LANGMPQDRLALATSTPVPDRYRILWEQALDIITNLHYQPGQHIHAASLTMPSHLPPT
                     RASTIPWGCSLGTRASTYDAIRIRLSELNDPYSRFLEPDEFEAELNPYRRARKLSGVG
                     IIPERSPKGHGTLRVIAVIPESPAEEAGINPGDELVMIDDIVVEPSPLNPIPVTPDEA
                     LALLRGPAGTRVRLTVRQTTNSLSYADASLQVASASTAPTSMMRTYTLTRRPLLVAPA
                     VYGLVAAEPTFGYIRLHTFNAEATRIVFEALNAFKNSSDRSAAAGVILDLRNCRGGVF
                     QEALVIASMFIANPDAVLVYTVDSRGIERAHRVRDQWNGWPEAPAAAARTPRTPPETL
                     GSAASARHPLYNGPLVVLVNGASASSSEVLAIALRDHGRAVLLGMPTFGKARIQHYFP
                     LLDGSAIALTVGEFLGPQHERLADHVGLVPQVSCNAAPRNFALLERHTPPDACIAEAA
                     QLLSEEPTGSSATEPVPVGGSVRSAFTSRSRSTETTLLPRIQT"
     gene            complement(<843814..>844116)
                     /locus_tag="CYME_CMO342C"
                     /db_xref="GeneID:16995814"
     mRNA            complement(<843814..>844116)
                     /locus_tag="CYME_CMO342C"
                     /product="similar to Sm protein G"
                     /transcript_id="XM_005537644.1"
                     /db_xref="GeneID:16995814"
     CDS             complement(843814..844116)
                     /locus_tag="CYME_CMO342C"
                     /codon_start=1
                     /product="similar to Sm protein G"
                     /protein_id="XP_005537701.1"
                     /db_xref="GeneID:16995814"
                     /translation="MAKDEVDTAELEALLFHSVQVYLNANRCVRGKLSGFDHYANLVL
                     SDALDCRTGAQLGQVWIRGNSVVSVDLLRDVNADRTEPPTGTGSVADDPVGSSLSS"
     gene            844230..846116
                     /locus_tag="CYME_CMO343T"
                     /db_xref="GeneID:16995815"
     misc_RNA        844230..846116
                     /locus_tag="CYME_CMO343T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461513.1"
                     /db_xref="GeneID:16995815"
     gene            complement(<845363..>848674)
                     /locus_tag="CYME_CMO344C"
                     /db_xref="GeneID:16995812"
     mRNA            complement(<845363..>848674)
                     /locus_tag="CYME_CMO344C"
                     /product="similar to acetohydroxy acid synthase, large
                     subunit"
                     /transcript_id="XM_005537645.1"
                     /db_xref="GeneID:16995812"
     CDS             complement(845363..848674)
                     /locus_tag="CYME_CMO344C"
                     /codon_start=1
                     /product="similar to acetohydroxy acid synthase, large
                     subunit"
                     /protein_id="XP_005537702.1"
                     /db_xref="GeneID:16995812"
                     /translation="MPASRGSTYTIANLIADRLAAANVELVFGGHGAAASPLITAIVQ
                     HPRLHWVLVRNETAAPFAASAYAKYYRKLGVCVTTSGPGAAYTVCGMVDALADSVPVL
                     LLSGLVSRSNIGHEGFQDTRTAQLMHGAGVQFAKAPMTADRFLSLLDSAIRFALERST
                     AAHLAIPVDVQTSPSDESALARLPFHIAEVPRCAAVSVEHAGRLLLGHRVVILCGLRA
                     AQARCSSTILKLAETLCAPVITTLDAKGAVDEHHPLVLGVDGIFGNPGMAAPRALVST
                     AECILAIGVDRCDPVVLDSTGQQQVRVFGVDDTLATRLQVYYHVECMLIDPELEALLS
                     ALTASVREMQSKRMLPPGPQQARDYSSRLWKYFLDGEWRERQASLPSSPRRAAVLSKT
                     PHAMVTGRRSMLDTDDTADEGDDEVRGFCHPRHLLTALSAKLGPDDVVVVDIGDVTIW
                     AGLCLCFDGQGTRLLSSINMGSMGYAVPAAVSMGVSLKRRKSEGVVYLITGDGGFEMA
                     EQELGTALQQGLDNLVVIVLRNGVMGRVRFGNTGVAGDEIILPDLQRLAQAYRMGFAR
                     VQRPAEAPAALESALAAQQRGDARHSFLIDLVESPELKAEYATVESNRVPVLRLIAEY
                     LPTEALTASDMELLSIFDLDNDGLISPEEMRIARQVFDSFIMVHRQRQRMDAESAGET
                     EDVAASAALSTEDREYLLQLLRSGDFFGCIASQKLLVEPLESSPDSNQSPVKVYNLHP
                     HAPQPPGSRARALGSVRNLIEGKIPSVEALSRIPIDSQDYIAGFELGTVDGRPPETMG
                     EAIIVHGTAYCTLTGELPAATSPATSDGTSNQQQSPAEAPEAPPAEYYRTVRGRYLSS
                     VAFLGMPQGAVPDFYVSYEAPGVQLPTGVQGTNAGSKKIPAGLPWSRVLNDLYLQTGT
                     TNPLFFYGIAEFSHFTATAISRAPVFNENVIANRHKYYREPNLITGSQPAAVVGLLSV
                     AEAIEDEAFRTALDAHLYRGYFQLYADRDTVDASPEQQTPQDGHVADQGDHSCHTCRL
                     MALQRIRSELQQHPSLLLSHTHALALRRPVQHLGDIEPDVVWRAVHLLANSCVTKVHM
                     SVHVVRGLDALESGT"
     gene            <850641..>852245
                     /locus_tag="CYME_CMO345C"
                     /db_xref="GeneID:16995813"
     mRNA            <850641..>852245
                     /locus_tag="CYME_CMO345C"
                     /product="probable aldehyde dehydrogenase"
                     /transcript_id="XM_005537646.1"
                     /db_xref="GeneID:16995813"
     CDS             850641..852245
                     /locus_tag="CYME_CMO345C"
                     /codon_start=1
                     /product="probable aldehyde dehydrogenase"
                     /protein_id="XP_005537703.1"
                     /db_xref="GeneID:16995813"
                     /translation="MLTSAADDLSSGYREVRAELGEAFRSGATRSLRWRAAQLEALKQ
                     ALVEQERAIIAALADDLGKSAEESQLTELQPALQELALALGNLKLWAGPRTVEPCLAP
                     KYLAPWFWLQRVWRAVLPRVLGGGNPPVASYGGVALATILERRWVVPEPLGVVLIITA
                     WNYPLLLAIWHMTSAIAAGNCVVLKPSERAPATAKLLAELVRTYLDARCIRVVLGDAS
                     TVRRLLHLDTECPADVAFRVWAQQRPFDAVHFTGGWRIGREIARACAAYLIPCTLELG
                     GKNPLVVDCASLSERDLARVARTTAWAKLLNVGQTCIAPDYVVLCGADRAQEAFFIEE
                     MWKSIEAFYGRPVENSTTFPRIVSKAHTARLADLLQQSRGEVVFGGTHRENDCFFTPT
                     IVRNVTLDDALMAEEIFGPILVVLQPCAGTEQALEVIGSLPSPLVVYLMSRDAAVVQR
                     FERASTSGSLVVNDLLGQVISPGLPFGGVGASGYGKSKGQAGFDAFSNLKSVLCKPIW
                     IERIASDRYHPLTATKISRFRRLIAL"
     gene            <854799..>855797
                     /locus_tag="CYME_CMO346C"
                     /db_xref="GeneID:16995810"
     mRNA            <854799..>855797
                     /locus_tag="CYME_CMO346C"
                     /product="similar to fatty acid hydroxylase"
                     /transcript_id="XM_005537647.1"
                     /db_xref="GeneID:16995810"
     CDS             854799..855797
                     /locus_tag="CYME_CMO346C"
                     /codon_start=1
                     /product="similar to fatty acid hydroxylase"
                     /protein_id="XP_005537704.1"
                     /db_xref="GeneID:16995810"
                     /translation="MTECYTLTRRVVRAHNHENDAWVIVRGGVYDVTGFLRYHPGGRD
                     VLLKRLGEDVTSVMNGELKGGHEHSSAAYKILQQYYVGPLADADASPAEAAALDGTLD
                     EHGRPLVDFSKPLLDQVGKLGDKYHRWVHSFPTSDHHVALFANPTLESLTKCPWYVPL
                     VFWIPIFVCGLWFVFARLGCSFVRDFLPFTTFGYIFWMFFEYLLHRYVFHVRTGTYWS
                     NIFHFLIHGHHHLAPMDYDRLVFPPIPAALVSMPVWLTAPRVFGLVRGLCFLFGFGVG
                     YLQYDMTHFLVHYGTLRTGFLAAQKRRHMIHHFKAPGANFGISVPVLDIVFGTLHR"
     gene            <858873..>860789
                     /locus_tag="CYME_CMO347C"
                     /db_xref="GeneID:16995811"
     mRNA            <858873..>860789
                     /locus_tag="CYME_CMO347C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005537648.1"
                     /db_xref="GeneID:16995811"
     CDS             858873..860789
                     /locus_tag="CYME_CMO347C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005537705.1"
                     /db_xref="GeneID:16995811"
                     /translation="MVQDPVVGSETENDALLAQLLSAEEETADALYYANGNDWIDAFS
                     WASPEGLEAERSQRKGRHKRNGRRRRFSNIDEYDEDGEDDDDEDWIETVKNRRPRSTA
                     VGRRPTASAPTAGAQPVSSERERGDSRDNSVGRDRNPSEDSPERGRKRPTAWSPEEEQ
                     RFLEALELYGRDWRRAAAHVGTRSASNFRSHAQKYFIKLYKEGRPVPPKVAETGAGHT
                     LSGKPLDPNSAAARAYLQGSVYRKELRSRHKSSGAAESPAGSEEPDLSTPKTKHASPE
                     ASVAAPTSDIHEDEIFQQMQLDAQLQAEEASAPYDEYAKENAHQDPEYTVRAPSMPGP
                     AAAAEPPEYAKRRPKRSTAGRRSIRSLYNIASADDELRFVSCLSYEPDAQPFRIVVQP
                     RALFMMDLHAHLDLREVIGFLGGRYDTTRKQLEIIDAFACRAAQGRAGHLDVELDPES
                     AVEARNTIEVSGLAVVAWYHSHPTFPPEPSVRDLDNQRNYQKQFESEGAPYPFLAAII
                     SPYDPNLPSVRSAIQWFHVGLSPAEDSFAFRLQWEPGPVPLLAPAVSSPASHATSEKL
                     SDELQKRVQQLLDNRSVKLDTNWSLRNGERGERSTLRRGEKLLRSLRSRVSETDADGL
                     ALLEELKPALLAAT"
     gene            <864472..>866031
                     /locus_tag="CYME_CMO348C"
                     /db_xref="GeneID:16995798"
     mRNA            <864472..>866031
                     /locus_tag="CYME_CMO348C"
                     /product="6-4 photolyase"
                     /transcript_id="XM_005537649.1"
                     /db_xref="GeneID:16995798"
     CDS             864472..866031
                     /locus_tag="CYME_CMO348C"
                     /codon_start=1
                     /product="6-4 photolyase"
                     /protein_id="XP_005537706.1"
                     /db_xref="GeneID:16995798"
                     /translation="MWVILTMASAVHWFRKGLRLHDNPALLDAVQNPTTTYVLPVFCL
                     DPIFLRPETVGVNRMNFLLECLQDLDQQLRKLHSRLFVLRGNPLEQLPVFFRKYHTRL
                     LTFEFDTEPYAKQRDTQVRRLCAELGIEVRTRATHTLYDPEDIRRELGDRPTPLTYKS
                     FYAFVTERLGQPMSALDAPAPASGFQTPDVDLDTYTVPSLSELEAYQGLEVETPFRGG
                     ETEALRRMENFLRERADEVRSFAKPATSPTAWPVASTTQLSPYFKFGCLSPRLFVERV
                     RSLRPLQQPPVSLIGQIWWREFFTYVAYVTPHFHQMQGNPICRQIPWREAADDARYRA
                     WEEARTGYPWIDACMVQLRQEGWLHHLARHAVACFLTRGDLWVSWERGRETFDRLLVD
                     ADYSLNNANWLWLSSSAFFHQYYRVYSPISFPQKYDPNGEYVRHFLPVLKEMPSKYIY
                     TPWLAPVVVQKKAKCIIGEDYPHPIVDHAVVMRENMRRMREALDAGAPQRVPKRPRRD
                     ANEASSSSSSS"
     gene            complement(<867178..>867846)
                     /locus_tag="CYME_CMO349C"
                     /db_xref="GeneID:16995799"
     mRNA            complement(<867178..>867846)
                     /locus_tag="CYME_CMO349C"
                     /product="similar to Machado-Joseph disease protein
                     ataxin-3"
                     /transcript_id="XM_005537650.1"
                     /db_xref="GeneID:16995799"
     CDS             complement(867178..867846)
                     /locus_tag="CYME_CMO349C"
                     /codon_start=1
                     /product="similar to Machado-Joseph disease protein
                     ataxin-3"
                     /protein_id="XP_005537707.1"
                     /db_xref="GeneID:16995799"
                     /translation="MVCFAPRFLSRGRHSGAIDEEGPPRVPSRKQVLSAVYFEHQEPD
                     SYLCVLHCLNNVLQGPYFSLDDLISISNELDEAERALLQGHELLQAYTPASLNASLTG
                     FFSAQVLLAALASVGIHPEPLRWKASETRSLQRAAQKAVQYGAVLVHYDSHWLAWRRV
                     VCGLKLYWVLLDSYRAGPEIRRTEQAMAQIELYLRAKAVVYGIPKEALPETPLDQFCG
                     RHTM"
     misc_feature    868216..868836
                     /note="possible transcribed region"
     gene            complement(<871072..>872373)
                     /locus_tag="CYME_CMO350C"
                     /db_xref="GeneID:16995838"
     mRNA            complement(<871072..>872373)
                     /locus_tag="CYME_CMO350C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537651.1"
                     /db_xref="GeneID:16995838"
     CDS             complement(871072..872373)
                     /locus_tag="CYME_CMO350C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537708.1"
                     /db_xref="GeneID:16995838"
                     /translation="MSAQSQSWLQVLRPKARSAAFARALAQAERLPELSDGSERALQR
                     VVAVVQKLPQHSLDAAALYAHVATLDSWSTRAGISRALRFYRKAWVALQRSGEDFYLD
                     SMACWNSQQFLVQCLRTVQLGDWHSTRCSRMTGTISDRESPRGLLKSGVHLFSLLSRA
                     QQLYAGNPSADAASREIHARLVSDAKRFLDELRASASGSALLGRALLSLGAALHSEDM
                     LQAALTHIEHESPPAGNHSDMRLFGKVVALSENASVAFWRTQRPQVTASLSFDDEQCE
                     SMLTEALSRAKETEHPGFALIPLTALANFYWQVRRDPVIAEGLYRACLERAPPQRSLS
                     GHSGTSKPGEQQQQQQQCPALSPASHQVLYIGALVRYAQLLAHMEWNGRRRTTESEQV
                     AAQARQWLGPDTHVRSLETTAVSSWCVWLAEKSRLCHDVTF"
     gene            complement(<874063..>876390)
                     /locus_tag="CYME_CMO351C"
                     /db_xref="GeneID:16995783"
     mRNA            complement(<874063..>876390)
                     /locus_tag="CYME_CMO351C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537652.1"
                     /db_xref="GeneID:16995783"
     CDS             complement(874063..876390)
                     /locus_tag="CYME_CMO351C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537709.1"
                     /db_xref="GeneID:16995783"
                     /translation="MEAAGAADAHVGNMPVRSFFRHRAANCTNIDTAPMKRRPEKRIR
                     APAHVLSGVRLAVVTPNAAAVNCQQQRSAWRRGCQLAVVHPSTDMSSTVTRMEQRECT
                     ARSALHADARRVWYQRTCAKREAWQWRALSATRGEAWYTRERLTAARRPLHNGQGMLR
                     ALDTHPDVALVACCTAESAFLWNIRQAASMEHWHVMGYLMPPSTSSSGGNGSSGSGNV
                     RPGLQRRFGDQGIQGSASPDLWGGIQWQSTRSEGKLLAWTNRALGVYSLERTDSGIHP
                     WTAPEQPSPIAPFWHFSLPAASSSRIQAAAWYTDAAAFSDPHPTLMLLCGCNRDGPFA
                     GIMDQRERPDWRRFARFLIRDRTHGHASMPVGIWSSHHRLAPTLVGVVYTDVLQLHDA
                     RMLSTNSLTSSAASVLGQIGVGLGPQVCPGSSKSPWNTSGQNRQESGGSFAKQYRGGT
                     SASTAHLWDAYETVTNTTMIARFPTPCRFSSIQPLPEDAQHPDCLSLAVTTPTFRRCA
                     ILDIDRQAFGQSVERGASTSWNGPLRLRWCFEPETEATCATRPYRAAAEDGRILSSAA
                     PFARFPNSSNACEQEYRRNLLITLARNSSSVASGLESSPLQARLEQPAIPGALPQATS
                     ALHTTSAPLNSILSHEYRYPAAQYLQSIGEESASLRYTSWRFGNNIRPSIRADTHHGT
                     VLLACPLTDQNDCAHLCLFDLSIPGRDTKCTALDDASVPLSASWILDEMLGLPRGRGT
                     VSGLALGCGMPTPAILLGCIEANQRTLPHFFLGSI"
     gene            <877042..>880686
                     /locus_tag="CYME_CMO352C"
                     /db_xref="GeneID:16995780"
     mRNA            <877042..>880686
                     /locus_tag="CYME_CMO352C"
                     /product="ATP-dependent RNA helicase"
                     /transcript_id="XM_005537653.1"
                     /db_xref="GeneID:16995780"
     CDS             877042..880686
                     /locus_tag="CYME_CMO352C"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_005537710.1"
                     /db_xref="GeneID:16995780"
                     /translation="MAFLPLVPRPVGTRRWSGTWNNASVESRKAAAWRQSDRLKPAKE
                     VPAKQRTSSSRTPPRSSLTQRLRALANVPERKDNGSLLDAEQEALESMFSFSLDEFQL
                     RAIRSVLQSRSVVVSVPTGSGKTVIGEAALAIALKKGMRAFYTTPLKALSNQKFGDFC
                     DRFGTEQVGLLTGDISIRPDAPILVMTTEVYRNMLYRCRTGVLAELSVAASPVDEVLA
                     PATEDAHSIAPLLRAGYLDDLFVVVFDEFHYMNDRERGTVWEEAVIGSPTHTILVALS
                     ATMRNAAEISEWFEAVHGVTDLIVANDRPVPLEYVYLDADGLHPLLVPLKRSSGDKGK
                     GFGRSRQRGARNESKLPTIEGRYQMNPELVWNVGQESKQIAERRQRWRDANDPNLRRS
                     AEVLERREARRLRELYRVSVPSYPFLVRCLRNRQLLPAIVFVFSRSGCDRAVSEVLRE
                     RSALKLVSKAERAMLESEMEAFFEVHPELRENPDSQKRYESIMEGVAAHHAGMLPLWK
                     ALVEQLFQANLIKVVFATETLAAGINMPARSTVVTALSKRSRSEGIQRLTPNEFLQMA
                     GRAGRRGMDPIGYVVVMQSAWEPSAEVACQLLQRGADALRSNFVPSYGMALNLLRYPG
                     TPLQSARRYLERSFGSFLASRGRLNQWKPEIHDEVEALERQVKEAHRIFAQHGGEKVV
                     AAYDKLLERLRCEERILGYLHEQHEESAVSIMEDLLVFSDPGTIVLLPDRAERAVLAG
                     VVVERTLDTPLRFALVAADGRIRVCGPRYIAAVLSKEPLAKVSLPDSLTGLKAEALSV
                     LHWRELFSASSRYGEVRETFEPVMDCGLVDVGTAPALEYSEMTTWDDLAAPPLAVPEI
                     RRQQKLVVDLQERLASFSLHDHPDCELVLKAYRSLGVAEAHLGRLRQRLMRQTMQATA
                     TESWNIFRALVDVLERYRCLERVEEVEDDARAESGQDVTRAAPEASDDTGSRYTFFRL
                     TEFGSIVAGLRVENELWAGLALIHAEQQLAGLAPHELAAVVASIAADTSLPPGGYCRF
                     LPSVRVLDLCREVLGPLRKQLAAAQQEALETYWSPSMATLNGELMIPDVRLSYDLAGV
                     VEAWACETPWSTLLNGVSLDEGDIVRLLRRTIDLLRQIANLGTSSGLGWSRRVAALVS
                     SQLVVNAKRALTLIDRYPVNDGGLERASGGQVAESLELDNDSDEDSAEVEEDVAWDSG
                     EDAILATSDE"
     gene            complement(882676..884745)
                     /locus_tag="CYME_CMO353T"
                     /db_xref="GeneID:16995781"
     misc_RNA        complement(882676..884745)
                     /locus_tag="CYME_CMO353T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461514.1"
                     /db_xref="GeneID:16995781"
     gene            884827..886730
                     /locus_tag="CYME_CMO354T"
                     /db_xref="GeneID:16995834"
     misc_RNA        884827..886730
                     /locus_tag="CYME_CMO354T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461515.1"
                     /db_xref="GeneID:16995834"
     gene            <888413..>894724
                     /locus_tag="CYME_CMO355C"
                     /db_xref="GeneID:16995835"
     mRNA            <888413..>894724
                     /locus_tag="CYME_CMO355C"
                     /product="guanine nucleotide exchange factor"
                     /transcript_id="XM_005537654.1"
                     /db_xref="GeneID:16995835"
     CDS             888413..894724
                     /locus_tag="CYME_CMO355C"
                     /codon_start=1
                     /product="guanine nucleotide exchange factor"
                     /protein_id="XP_005537711.1"
                     /db_xref="GeneID:16995835"
                     /translation="MAGSTLPGSSPGDESVRETSTPEPPATDGNSNMDGEGSVSEITA
                     MRSRTSVSNDALVLERNSEQRVDQDTWVRSREPAASARELSPDLGPMQPGASPETAAE
                     SDSEEASGCASPALASGSSADSPHSPQFPVQSAENDNPTLKEMQKASPASIAESGTQE
                     SFPGERDSPVPVHSLASTLEEIGKPVAAERKNSANENAIVPTEPEMHAQVLSRRADGH
                     EYVDEDETASTGPSPTVTTTPTAHKHAGLLTSRPGQKSAEAARLLALRGLRRIVETCT
                     SRKYAETVASCRRAIEKLEVGTEPDVPEVLEAIKKAIYCGKIVAADIALDTLHRLLTY
                     GYVDPLRGADLDAEQFENLIECACSCIDTKDEGVYIRLTQVLLASATSTVYGLHQTVL
                     LAAVRTLYNIYLSSKSSATQTTARAAIIQIVSLVFGALQGVPVSTESMLSTGSLEPTA
                     MLAGTLLVHRKYRQREAASGAGDDPEAVSQSSIVVPGQATAASKGVLDLEPVEQCRKD
                     AYLLFRALCKLASKQSTENSSLPTESIPIRSRLLALQLIRDITETCGAALLQHERFVF
                     ALREYLVPTVLQNCMIPNPQVLDVALQLFERMLQLYRAALKLEIAALFHAVVFRFLES
                     LTVAPWQRLRIYQTVECVVRDQQLLMDLFVNYDCDVSSPKIFERLVDDLSRLAIAALQ
                     SGGPRKLSAADRKRCLELLATMLHSLKEWSQPLVDARRQLGIDDEDVFQVLATPSAPV
                     DERNAADGVPSSSSSSSSSSLGQHSSATEVGSGLSAVKPVGTSNGSAAPLAERSLIES
                     LRRKRELQEVAETFNRDAVEGVRLAASKGLVDAADSSSVAGFLRNYAGLDRRQVGEYL
                     GGADPFQVKVMHAFTDMVDFSNMRIDVALRKHLSAFVLPGEAQKIDRIAEKFAQRYCA
                     CNPTLFASADTAYILAYSIIMLNTDLHNPHIRRKMSLEDFIRNNRGINDGADLPRELL
                     TDIYRSIQAEELRLLDSMTGSWGVNDFRYPAAIQSGEQQRATLFKEESERLLTQTREL
                     FAQRRHIQSLPPSGRAASPERSSRAEQSQPGARADAGLRATGNPLDAQVPVTEVYYTA
                     NNVGHVRLMLEVSWQPILAGLSQILENTPDTDRELLALCIDGFSVAVQIASLFEMGTE
                     RQALASALAKFTKLHALPDIRLKNVDCIRILLKIALEDGDTLGETWVDVLRAVSLLQQ
                     YRAVLWPGTRDGTSLPVSPGGRTPTANESDVQGRNSEAAVDALDALAALQHVEADYDE
                     ASGLRSRPGESLPRRTTAEAPNSPVPLIPAAVREQLVHVLQSPDLDRLFMQTTSLSAA
                     AMLDFMEALCLVAAEELDVSPAPRFFCLRQMVRVAHLNMDRIRLEWSRIWKHIANFLE
                     YCLQRKQRPVVGIRALDALRDMARKFLEKEELSNFNFQREVLQPLERCFELDVSEMLK
                     LRTLSVGEVLVREHATRMRSGWKCIFTVLQRAAEERSEKVVERAFSLLDFIVRTYFGE
                     IPEVFVDGIHTLAVFAVNRVSTTCATQAVEHIGVRAPVMVAEQRTGVTGGPAGDDGSL
                     WFPILTALANVCTDGREVLRAYAVELLFRSLLEYGGGFSGEFWVLVFRGVLAPIFDDL
                     HHMPGGDRFEEPPAAETASGQSWAQTTGAGALHGLLMVFEAHHVHMKSLFTDMLEILR
                     IWICQENEAICREGMRCLQRFVDQAAAWMEAADWDLVVNFIDDLVRMMLPVDISREGS
                     LVQDVVAGAEPKPTGSPRQAAVPSTLERIAVAADSVPAPVLEPALEQDAPPGYANETS
                     GAPGAAVRLSRESVQSPTASLPGIESATTASAPAPVTASSTRVDIHADGDSGLLTSMS
                     PGQAADLKDTVSTERRTSGQRSATRGVSERRQAAFVAIRCKCVVQLLLIELVRDLVSE
                     HYPRLEAVQVLALGKAVHCSFRFAHRFNADLALRFDLWRAGFMSQVPNLFRQDTIGRM
                     VYLQILFRLVVDQRAAYATQALEPLLELSAETFAHYNRKASARYAGLSGDARNTAVGV
                     TSTTETTATPSVEEQRELQAFAPVVAFVLENIAAAPDAVFDYLVRGLFKELADLIRTA
                     GEPADVRVALASIFHRLGSVWLDKSCALS"
     misc_feature    896144..898293
                     /note="possible transcribed region"
     gene            complement(<898720..>899565)
                     /locus_tag="CYME_CMO357C"
                     /db_xref="GeneID:16995832"
     mRNA            complement(<898720..>899565)
                     /locus_tag="CYME_CMO357C"
                     /product="similar to ER membrane protein; Hsd1p"
                     /transcript_id="XM_005537655.1"
                     /db_xref="GeneID:16995832"
     CDS             complement(898720..899565)
                     /locus_tag="CYME_CMO357C"
                     /codon_start=1
                     /product="similar to ER membrane protein; Hsd1p"
                     /protein_id="XP_005537712.1"
                     /db_xref="GeneID:16995832"
                     /translation="MLLVSNREDTMGGDAAPAQRRQRRTSPAVSAVGGSATVRKRLAE
                     TQALHWNRRLFHFLNGYLLVLAFRSFSSKRVFLTTLAVLWTAQLFLEIMRLLNPRLNA
                     LVMVLMGPFMRSQEQHRFSGMVPFILGALITIALYPKGVAIIAIVVLSVSDPVAALVG
                     NMVRRYIPELDHSTRARHNKSLVGSVAGFAAATLTMFVVFRASSLRPGNTLCLWLNCL
                     VPSAAAMLAEWLTPSPQRTLPLRWFPFALDDNLLIPLVVALVLQFTVPCLGGVDFDIS
                     PWIFL"
     misc_feature    complement(899646..902035)
                     /note="repetitive element"
CONTIG      join(AP006497.2:1..902900)
//
DBGET integrated database retrieval system