GenomeNet

Database: RefSeq
Entry: NC_010142
LinkDB: NC_010142
Original site: NC_010142 
LOCUS       NC_010142             908485 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 16, complete
            genome.
ACCESSION   NC_010142
VERSION     NC_010142.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 908485)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 908485)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006498.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..908485
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="16"
     misc_feature    770..3351
                     /note="repetitive element"
     gene            complement(<4035..>6323)
                     /locus_tag="CYME_CMP002C"
                     /db_xref="GeneID:16996096"
     mRNA            complement(<4035..>6323)
                     /locus_tag="CYME_CMP002C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005537656.1"
                     /db_xref="GeneID:16996096"
     CDS             complement(4035..6323)
                     /locus_tag="CYME_CMP002C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005537713.1"
                     /db_xref="GeneID:16996096"
                     /translation="MVIIRVKPTVCFFLYLFVSFAVRTLVATPVNTVSWTWVGGNQRT
                     DGSGIYGNKSLPATGNTPGARHGAASWSGPNGHYLFGGEGKANASIGHLNDLWVFNKS
                     SLEWTWIGGSSVPDQSGTYGTLGKANSSNMPGARENAAFWQTSTGIFYLFGGYGLDKN
                     GDIGRLNDLWQYDPFTENWTWIAGNDTVDAPGASGQKGSFSSSFSPSARDGAAFWTDM
                     NNNLWLFGGTDHIFRDRADLWVFNTTTSEWGWVGGSLVGNEYGNYSAPGVGNSSNAPG
                     ARHAASTWVDLDGNLWLFGGRGYGNSTTQYGNLNDLWMYNISTGIWVYVTGGKTSNNF
                     GVYDVFGGYSAMNTPGSRLGSVSFVDSLGNLQLFGGAGLAAASSLSGCLNDLWVFDPE
                     LGQWAWINGSAMPNSLSFYGVVNETNSSVKPGGRFGSTIWVSQSNDATFAAFDPVLFG
                     GFGYANGSVPITGLLNDVFSLSEVFVSPYPTPTPTPTITPTASPAVSVSASYSATMSA
                     TTNVTEVPVGTGSAVCFPAEASVMVDRLGNTVLMSELRPGMVVIGVNGRGQLVEDTVL
                     GWLHNEPGAVVEILAIKTLSGKQLRLTRQHLVYRMHEHSRVLDGSIITIATGHLRNQQ
                     QRIHKSLELETSAIEAAFAEDIRIGDALLDVASDLPDPVVAIDTLVTRDGLYAPLTRS
                     GRLVVDGILVSCYGTYPSHVVAHAVLWPARVGALRTIWGSMLGTDSTVGIMPYAEGLY
                     RMWTIAARILKEARVSVVAAAC"
     gene            complement(<8884..>10425)
                     /locus_tag="CYME_CMP003C"
                     /db_xref="GeneID:16995975"
     mRNA            complement(<8884..>10425)
                     /locus_tag="CYME_CMP003C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537657.1"
                     /db_xref="GeneID:16995975"
     CDS             complement(8884..10425)
                     /locus_tag="CYME_CMP003C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537714.1"
                     /db_xref="GeneID:16995975"
                     /translation="MVRTFERQAVPGAAVYHITSPPAETPLEQVTKGSKQASRRNVRD
                     VRARTGAHAAQIQLLQDLEFPGSCVRVRSTPSGTHLVAVGTYPPQLRVFEFAELGLKF
                     VRHFDAAPVDLLVLEDDWRKLAILRNDRFIELHSQGGLHEKVRIPHAGRALAYHPSNC
                     DLYVAAAGSRVYRLNLDEGRFLPPLETFSASNETLQLNKEFNLLGAGGDSGFYEVFDP
                     REEPHRRAGCFNPAKHATELGNSTVTCSVFQGLHLGVGLDDGTLLLYDIRSERPLGVR
                     SLGFGLPVQSVSIHVGAHEPNRSWLVAADRKCVKIFGDLRLEDAPFLSFETPADIEQL
                     ETSFGGAGLVMAACSDRPVHCYFIPALGPAPKWCAYLEHLTEELAESTVSQQDSVVAI
                     YDHYRFVTRDELSALGLESLLGSDALIPHLHGFLIELSLYRKTRSAINPAEYEEWRRL
                     RIQERIAQQQQQRIRAVDSQKNRTSSRRREKDDERFRARFTDADFAVNESHERWRRLH
                     ASNKA"
     gene            10595..10690
                     /locus_tag="CYME_CMP359R"
                     /db_xref="GeneID:16995899"
     tRNA            join(10595..10630,10655..10690)
                     /locus_tag="CYME_CMP359R"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:16995899"
     gene            <10728..>11576
                     /locus_tag="CYME_CMP004C"
                     /db_xref="GeneID:16995944"
     mRNA            <10728..>11576
                     /locus_tag="CYME_CMP004C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537658.1"
                     /db_xref="GeneID:16995944"
     CDS             10728..11576
                     /locus_tag="CYME_CMP004C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537715.1"
                     /db_xref="GeneID:16995944"
                     /translation="MVSEYTTNVLDLVSRTKTLQEAVEELVSHIHGAALAQALHSWSL
                     DLGAASQNATATRERAIAALCSWQVLDALDAGTAPAGCVIFRDITEAEAHQLRERFLS
                     IGWAAEEPEPTVNGARVPESQDTGSSEPSGFSLRALKPSDSAHFGKVFQLQDATVATE
                     YIDDEELISSTELSGAQNSEQANGKTSGCGTSGVALANRQPCANCTCGRRDQQDAAVN
                     GGSFSENTAKSDPAGKTPTMETGSCNSCHLGDAFRCASCPYLGLPPFKPGAPLKIDAK
                     LLEGDL"
     gene            complement(<12141..>13658)
                     /locus_tag="CYME_CMP005C"
                     /db_xref="GeneID:16995889"
     mRNA            complement(<12141..>13658)
                     /locus_tag="CYME_CMP005C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537659.1"
                     /db_xref="GeneID:16995889"
     CDS             complement(12141..13658)
                     /locus_tag="CYME_CMP005C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537716.1"
                     /db_xref="GeneID:16995889"
                     /translation="MPKLETATDTDGVAGPPIAYMVSKQNGTPPGRHGKASHAAQGIA
                     PAMDTVDAPAEQGPVSTDAHWIGMHSQQRMSSTGHEAEPGGARADSSPNASLGNRMQG
                     ASSMGSFRQRLKVVGFELAPDQEMKYFQLLRGFFKAQLTKMELQDALQGIFSTSELRE
                     HNMFLRDLQSRALHGAHTNVPPLPNVWEHNRSSRQRQQYLLQLKPFSSLEAEQLARAE
                     HRGRSTARRPAKRRRSEGSTPVANLDAAGDAETAEVSSHHTELVATVRKKGTRPRVRT
                     RAAANAATTDRRSRLHVAERQAGGALGKGLQGESNATGTVSTASYRDEAIFQQATADL
                     RQRELLRRSERLDAPAVANAMTVAMAKQRGMPLRRAARLGSSGNGSGDPGSVGYPSLP
                     FSPLPPGLSLDIEIFLKLKRRLVQLLEAVEQMSSTNTGNEVWLGYECVPLGFNGMPRS
                     ASRNAVTGIRDEAVALLVHSIEMHVRDLFDVIYGIPDIYDEGDASSEATLYRLRA"
     gene            <14283..>14921
                     /locus_tag="CYME_CMP006C"
                     /db_xref="GeneID:16995890"
     mRNA            <14283..>14921
                     /locus_tag="CYME_CMP006C"
                     /product="60S ribosomal protein L13"
                     /transcript_id="XM_005537660.1"
                     /db_xref="GeneID:16995890"
     CDS             14283..14921
                     /locus_tag="CYME_CMP006C"
                     /codon_start=1
                     /product="60S ribosomal protein L13"
                     /protein_id="XP_005537717.1"
                     /db_xref="GeneID:16995890"
                     /translation="MRHNNAIPANRFRKHWQERIRTWFDQPGRKKRRRLARARKAEKL
                     GKRPLAGPLRPVVHCPTQRYNWRVRCGRGFTLEELRAAGISPKLAPTIGIAVDHRRRN
                     RSDESLQCNVARLKEYMSRLVVFPRKKNRPRKGDETDPTILAQATTLKDKEIIPIQKK
                     QGVLLGTRAITDEERQFQAYRELRKLRTLQRYDGIRKKRAMEKAAQEEEKKK"
     gene            complement(<15423..>15848)
                     /locus_tag="CYME_CMP007C"
                     /db_xref="GeneID:16995891"
     mRNA            complement(<15423..>15848)
                     /locus_tag="CYME_CMP007C"
                     /product="40S ribosomal protein S16"
                     /transcript_id="XM_005537661.1"
                     /db_xref="GeneID:16995891"
     CDS             complement(15423..15848)
                     /locus_tag="CYME_CMP007C"
                     /codon_start=1
                     /product="40S ribosomal protein S16"
                     /protein_id="XP_005537718.1"
                     /db_xref="GeneID:16995891"
                     /translation="MVNAVQTFGRKKTAVAVAHCKEGRGIMKVNGVPLDLLEPELLRV
                     KVFEPLLLLGEETFANVDVRVRVRGGGVTSQIYAIRQAISKAIVAYYQKYVDEASKRT
                     IKDILVSYDRSLLVADPRRCEPKKFGGRGARARFQKSYR"
     gene            <16884..>17285
                     /locus_tag="CYME_CMP008C"
                     /db_xref="GeneID:16995892"
     mRNA            <16884..>17285
                     /locus_tag="CYME_CMP008C"
                     /product="RNA polymerase II subunit"
                     /transcript_id="XM_005537662.1"
                     /db_xref="GeneID:16995892"
     CDS             16884..17285
                     /locus_tag="CYME_CMP008C"
                     /codon_start=1
                     /product="RNA polymerase II subunit"
                     /protein_id="XP_005537719.1"
                     /db_xref="GeneID:16995892"
                     /translation="MADDNLPDRFESIVLPEGVKKLRYVPDTRLPNCASFVIEREDHT
                     LANALRAQLLRDRNVLFAAYRVPHPLEHHVILKVQTRRSEYTPLEALCAALVALKNEI
                     HVLEDEFANELQNWAAVRKAGIDAGNAAWRT"
     misc_feature    17785..19281
                     /note="possible transcribed region"
     gene            complement(<17978..>21136)
                     /locus_tag="CYME_CMP010C"
                     /db_xref="GeneID:16995907"
     mRNA            complement(<17978..>21136)
                     /locus_tag="CYME_CMP010C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537663.1"
                     /db_xref="GeneID:16995907"
     CDS             complement(17978..21136)
                     /locus_tag="CYME_CMP010C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537720.1"
                     /db_xref="GeneID:16995907"
                     /translation="MLERVQAKDLRNDSSVYQHARSKARLESRSGKGAFVSAAPLPHR
                     VGPCGTLNNLRQGQYVQVIALRTPAVEEPARNLSLRNSKRRRESEATSEASIPHWPAA
                     CTCMAWSDGRLIVYAHDRVPSVEGNGDGASLSESPGCILVGKWRDDPSLSPDLSLAAM
                     NQLGAGPFLGRITALQCSFDESNEFEPAKRQRSHVVDPSPAANAEQLNRFPAAPEQGY
                     PQARTRLLIVVGYESGALRLFTVDISRCVDLNASQRRQTKTGSEIDLALTLELCDVCR
                     LPGRIESLVVSAHSPRQEEYLRGGCLQHVYAVCRDSDPIVWALQVRRSSDRTVDGQCN
                     AVYCWSDTQHHRRLRIMHTRGTSLQALAISPTDRYLAVAAGECLSAYELPRWCADARE
                     PGASRDVEVERIWRFTGHSSTICCLAFAGPVLLASAALGDTLISLWRLDQENSSALHS
                     ENANFIESPPWRSVLCHAVNSAPASVVQLVAAEHSPEARLPSMKRAADTSRTTNGICS
                     SGTATDHALDEHPVGRDAVSPRASNAADADSARIAMDASPETFLLAVLGDGSAQLFGV
                     KERLSTPGQVSAMKAGEKRSTVLHPLLILQPQEPCFSGASVMRWVNNAGEQQLGFALF
                     YGSLQQPKIVFVPRKLWSQDAPTMNGSESGAAPVISLQNDALSKVEHQRSSNVARANS
                     NPISSDSVHTNENTPVLNGARANHSGGILGYAQLPVEASAPSDSERKKHALDTQTMPP
                     SLSLTSSVVADGADGVCTSIQRIPGNDEHGAAANVGMKLNAVEAASHQKTALLPEPVD
                     PAASSANIMAGNELLSLAEQLSYVQQQASVASAPELFNKSSGERPLAVDTVATLIVQA
                     LDANDNQLLDRALAAVQTAAGASRTVRKLPARAILSLLGALVARFCSHSVRAPALSLW
                     IRAVIRCHAPFLLSQRDARLPQHGANLQSVREAMVALYYAIEEQRRLREALVRLEGRL
                     ELIMAFAQSVSFSGQPQPQQPVSKLRRIIRERPVHVQAQTADEEVASVADTTSSTSTT
                     SSSSPDASDSSGNSSSEESSAL"
     misc_feature    21490..22121
                     /note="possible transcribed region"
     misc_feature    22799..24648
                     /note="repetitive element"
     gene            <24954..>25385
                     /locus_tag="CYME_CMP012C"
                     /db_xref="GeneID:16995965"
     mRNA            <24954..>25385
                     /locus_tag="CYME_CMP012C"
                     /product="60S ribosomal protein L34"
                     /transcript_id="XM_005537664.1"
                     /db_xref="GeneID:16995965"
     CDS             24954..25385
                     /locus_tag="CYME_CMP012C"
                     /codon_start=1
                     /product="60S ribosomal protein L34"
                     /protein_id="XP_005537721.1"
                     /db_xref="GeneID:16995965"
                     /translation="MPDTRITLRKRRPYATKSNKIRKVKTPGGILRVHYLKKRTKAPR
                     CGDTGTKLNGVPVRRPRELARLSKPKKSVSRAYGGVLCGNAVRDRIHRAFLIEESRAV
                     KQRLRQQEAIARQTKTAAEREESRKKKSKKSGASASTVKKA"
     gene            complement(<25391..>26389)
                     /locus_tag="CYME_CMP013C"
                     /db_xref="GeneID:16995863"
     mRNA            complement(<25391..>26389)
                     /locus_tag="CYME_CMP013C"
                     /product="mitochondrial DNA replication protein YHM2"
                     /transcript_id="XM_005537665.1"
                     /db_xref="GeneID:16995863"
     CDS             complement(25391..26389)
                     /locus_tag="CYME_CMP013C"
                     /codon_start=1
                     /product="mitochondrial DNA replication protein YHM2"
                     /protein_id="XP_005537722.1"
                     /db_xref="GeneID:16995863"
                     /translation="MPDLSSLQVVGTKAAEESRLESRKPSRKPIDWTNLGLGAALQLF
                     EVTTLGQPFEVIKTHLAANRNDTLLEAVRKLYARGGLAAFWTGLVPWAWIEAATKGAV
                     LLLTQTETTFYAQHVMGLSPGWSAAVGGMAGGVCQAYTTMGFCTFMKTVEVTRSRSGP
                     GKDMSTWQVAFDILKRDGIAGMYRGVNAVALRQLTNWGSRFGLSRATEWIFRRNDPER
                     ALTTSERLASSVIGGALACWNQPIEVIRVEMQSAMKREDWPQNRPVNMWSVARWIYQR
                     NGIRGFYRGVTPRIGLSVYLTSVMVFGGDQLKERVAARREARRLQRESSASSSSAA"
     gene            complement(<28578..>29627)
                     /locus_tag="CYME_CMP014C"
                     /db_xref="GeneID:16995864"
     mRNA            complement(<28578..>29627)
                     /locus_tag="CYME_CMP014C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537666.1"
                     /db_xref="GeneID:16995864"
     CDS             complement(28578..29627)
                     /locus_tag="CYME_CMP014C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537723.1"
                     /db_xref="GeneID:16995864"
                     /translation="MAFVKASCWSATNRDARRRIINEGVCGSEHHVTFGGFGVFNTSR
                     GSRTATSPALGEQAKATASGQSWWPPQVSVGGFVHTTRLPVGRVSVRRRPRNEAPALA
                     TLLSNSSEERPASGRRMRRRLASHAVSRTVPERNRTSVYEDPSMPLVRVCLEAADERK
                     AQELTAIRVSHLTYVTSFFVFATGLSRTQISAIARRIEERVAEVLSRKPLSASFRGVN
                     ASPPGQSGWVTIDYGEVIVNIMSPEARSYYDMDTLWGRGEAVDVDRVLGAQQLDARTS
                     PGTSKPLPTGATREGENDASVFPDDSEWDLEPGAEASLFSEDFHSEERTDAEEDGEII
                     PISVELDTSSDEVDV"
     gene            <31778..>35803
                     /locus_tag="CYME_CMP015C"
                     /db_xref="GeneID:16995865"
     mRNA            <31778..>35803
                     /locus_tag="CYME_CMP015C"
                     /product="similar to Raf/ATN-like protein kinase, with
                     ankyrin repeats"
                     /transcript_id="XM_005537667.1"
                     /db_xref="GeneID:16995865"
     CDS             31778..35803
                     /locus_tag="CYME_CMP015C"
                     /codon_start=1
                     /product="similar to Raf/ATN-like protein kinase, with
                     ankyrin repeats"
                     /protein_id="XP_005537724.1"
                     /db_xref="GeneID:16995865"
                     /translation="MNLSDESTCRESSGVSDSKTPVTADERLSSKSTVYSIFGLRPQS
                     LEEPNEQRFSSDVLVQSQERGKNDQEASLPVTRQAAAAGCGAQSCDSIATVPQLTGTS
                     LQSRNSEPGLSNPKEAANSFEPASSSSSLSSSSAPYAKPLDTSCAPAPTGIFQTRHAQ
                     LKLDRGELWKLRSVFEAHDPQHRGLELPDFYELVHEYFPQASLNDVAFIFRLFDVEQN
                     GRLSLRDFMCGYAIICHATAEERLRLCFAMVDRDACGHLDERQVAQALHLLSSYADLL
                     VQFSSVGDHENTGDHDVDADALLEMARLMVETATKERLKGTLGSARQSRSVCPIATEH
                     AESEVNTHKIAFDEFLEIALRNPHIQHWLADIGSAVGAVHPSLRDQKEVEMIVLEIER
                     LGFIRTEACANAAALPLESRPSTSEASMASSAPVARSLSSSLEETAPSSQEYLQLIHR
                     GRSRESSQRGGSLYLSQSFSTVHLAEQGGQRQLSLPQTPELHQNEARASIPRLHEFSD
                     AELRFGSSPMRMERRYGSFLRASRSVLSHERASAPDSPPVTRNAGEGRALATVADMNE
                     EDQANLDNDGEQSLQEHPSKRLEEHPELLSNEPAAPTMMTTTTSAENLRSSDQAAIAK
                     MTSFLLHSPFVIEYTALRFERKIGEGSFSEVWSGEWLHLPVAIKVFKRFDPSMTGTWP
                     MLRDAGASLTGTCEPPGIDDQTVGTAAASAKTATRPECSTAATIDHGLASSSSSDSES
                     SVEAMTFETDVQGHSAGARLDEALFAADAAAGLSMYGIDKSQTHYNGQQQQQQRKHPR
                     PGMHLLDETPRRLDEFNLVSFVREVELLSQLRHPNVLLYMGATADPRKPLCIVSELFP
                     GGSVHDLLFKRRKRLSKHQKLRIAIAVARGMLYLHSCKPQILHRDLKSSNVLVDESLN
                     RIAICDFGLSALRRAGAGESSNYGSACDADTMGTPYTLAPEVMGGEPYTDKADVYSYS
                     IVLWELLTRKKPFENLMPVQLMYKVYAQNARPPLGEVYAEFQALLSRCWERDPQSRPD
                     FGTILDILEDISLELATNAEDASRSSSDDDTDNTGVGGGSGSSGGGNVGADAHERAAA
                     PSQTKQLQLMNAVVQNDLARVKRLLERGVSPCFCDYDRRTPLHVAAAEGFVDIAVCLL
                     EHGAEVNARDRWGSTPLSEAIRFRHEHCAQVLRDQYGGRIFDQKSHFELIDAVARGDI
                     AAVRSFIGEGVDVRQADYDRRTALHLAAAEGYTEVAKLLVEAGADVMATDRWGSTPLQ
                     EAIRFKHPETAVYIESVMGAQLRQRARGLRRDIGGSSSNGAASPQRSLLRTNTPESDQ
                     FGRGRSSPAPQSPGNVDYYGD"
     gene            complement(<36734..>38950)
                     /locus_tag="CYME_CMP016C"
                     /db_xref="GeneID:16995881"
     mRNA            complement(<36734..>38950)
                     /locus_tag="CYME_CMP016C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537668.1"
                     /db_xref="GeneID:16995881"
     CDS             complement(36734..38950)
                     /locus_tag="CYME_CMP016C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537725.1"
                     /db_xref="GeneID:16995881"
                     /translation="MQVWTHHCHFCGALLPGTTLVQRLRRWIRHAFFSSQSGQGSAPI
                     SHLICAHCDAYNGFDPQSESGYDEHWPAFYAARCGRPSPALTPLPASTRHTLTLSAQE
                     VASPDSRPLGGSLKATDPLDVPCPMHVFCATCLDTLERWRLARAALLEPGQPLPATRQ
                     RGKAALRGVGTPHFEQYDRELQAIDAAYALCPRCKEAVERQLEQVEAAVRKWYIARRL
                     EASLRERLDGVLGKRERPSQRALLGPQPSRTQDEPATVQLRANSPSTMITAYPRFVPV
                     KLLPKRFVKWIIAFMSGLTLASVFAARGRRFGCFWPFGEKLLLATSAAQSKAIAGICF
                     SRVAWRFCEPLIQSGRRLMPCNMALVWRRGDLCIIAWTISVLLACVMSRWLLCKCKQL
                     FRASVAAQKVHAPETFDGQLAVALSQRLHLSSGGKAKSAMAPSAPPTPESHSTCPPRQ
                     RRGAISSSSSSKCAGTFMPATPQPRHAIASSQRTLSQHSIEAAQVRGPFATSSCRLLV
                     SCVRQSALFRAWDWYDSARLLLLGIRLAEAGCSRTFCCSVWWSLSTSLCQFLLLNCSL
                     YGIIGGRRDSPTTSTATSTSAAPAAAPENVCADAAFTPASERASLPQFPCTGFAGTPE
                     RCTPRETAATSSLERQPALESCWHLRTSWYWWRNLFCARRSPNTPRMIIGLHLVLCID
                     VVRRFLRALTSGSAWRPVGTLSAQWWRWLRKLVTVDTLTLASMVVLVLVLRRRAFT"
     gene            <42121..>43218
                     /locus_tag="CYME_CMP017C"
                     /db_xref="GeneID:16995882"
     mRNA            <42121..>43218
                     /locus_tag="CYME_CMP017C"
                     /product="probable CGI-27 protein"
                     /transcript_id="XM_005537669.1"
                     /db_xref="GeneID:16995882"
     CDS             42121..43218
                     /locus_tag="CYME_CMP017C"
                     /codon_start=1
                     /product="probable CGI-27 protein"
                     /protein_id="XP_005537726.1"
                     /db_xref="GeneID:16995882"
                     /translation="MRYSRREAQHAGSWYQSDTERLSQALEQWLRRVPSQLTPLRPAD
                     DAILFRNLWGKRDHFLDDSNVEASLSSEQNPQQVQTQTQVQGRGTLEILVVPHAGYAY
                     SGETAAFAYAQVDPARFDRVVIIGPSHHVYMQKCGLSGAERLATPLGDLLVDTALVQS
                     WSQLYPELFEILSKSTDEDEHSIEMQLPFLAKVFQGRLQQVRFVPIMCGALSPSKEKA
                     CGRFCAEQVLQPRTLLVVSTDFCHWGQRFGYTPGCKDKLAQERQRLGVGLSDYIRALD
                     SMGMYLISLKDAEGFRAYLQKTGNTICGRHPLAVMLWAVHFAEPSAWRLVFLRYAQSS
                     ACVDAHDSSVSYVAGAGYRVYEEPRETKSLR"
     gene            complement(<43807..>44949)
                     /locus_tag="CYME_CMP018C"
                     /db_xref="GeneID:16995876"
     mRNA            complement(<43807..>44949)
                     /locus_tag="CYME_CMP018C"
                     /product="probable coclaurine N-methyltransferase"
                     /transcript_id="XM_005537670.1"
                     /db_xref="GeneID:16995876"
     CDS             complement(43807..44949)
                     /locus_tag="CYME_CMP018C"
                     /codon_start=1
                     /product="probable coclaurine N-methyltransferase"
                     /protein_id="XP_005537727.1"
                     /db_xref="GeneID:16995876"
                     /translation="MLLSVAQRLLERNLLPDWVIRAGIRKLLRERLAELYSPLPGVRP
                     GSEPETSLVTIIADKEELFLEDLHRRSSIAEHTTAANEQHYEVPSAFFELVLGPRLKY
                     SCGYFACRGTGSLAEAEEAMLALTCERAELADGQYVMDLGCGWGSLSLYLAERYPNMR
                     IVAVSNSKSQRAFIENRLESAGWTTKGESNPRIQVLTADINDWDGPSNVSAGAAFDRI
                     VSVEMFEHMKQYDRLLAKIAGWLKPDGQGKLFIHIFVHRAVPYHFEATSEADWMARYF
                     FTGGTMPSDRLLYRFQEHLLLERKWSVNGMHYANTAEHWLSNMDRNREAVRKLFRQVY
                     GSEREAIRWEAYWRTFFMACAELWSYQGGDEWFVAHYRFRTRLCSR"
     gene            <47928..>52406
                     /locus_tag="CYME_CMP019C"
                     /db_xref="GeneID:16995877"
     mRNA            <47928..>52406
                     /locus_tag="CYME_CMP019C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537671.1"
                     /db_xref="GeneID:16995877"
     CDS             47928..52406
                     /locus_tag="CYME_CMP019C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537728.1"
                     /db_xref="GeneID:16995877"
                     /translation="MSRPRYLTSEEPSPHASPVQPARVRKAQLSSPLWEHACPQALPE
                     ESMLSLGQKRALGDRHAYHRAFDDAWQRPGPRERSTSEPLLMGVDAFVSGDLKFSTAA
                     EVPLDRSAAHWNPDSTPLPGRSFDGACLQQTDFSNWYADEPNSSLMIHDECFDTSAID
                     GETYSDSTSGGVDVRPERPPFASPLSETDDTTEDRPLVHPIRESTSACLCQYRIEFMC
                     EACVSRAGNADGVVSASPSDSENDHCRLPEQCPIERPDACCGLGTTEAAGSSNDQTQV
                     STAQHASGNAERSSSDTQHERRCEVCTSCTMQRASQCAHHAQSSVVCPLSTGERSSRD
                     SGLSSLRNVPAASGDAPPLRSSVADASAYDARPEDRDAACMALLPGYGGTNSAAQEQT
                     RNGFPLDRHLDCTAAETLVGSGRRRSLAAANAFRSLLQGRQLPSRTTQRCSAAHEPSD
                     LMDTESGCDDSTSNASSPPSSSIVARGSMFSSDASTFPADDGAKRSHHLPSANSPPGS
                     CSSSDSIGALRSAPMRDASAERAQQSARRQREPRGPPDEQAAGALVTCAHLSQIDTTQ
                     AWSAPIGESGCALVKSATPLCTHDLAPVDGACGVDAAHEKPAPLLHLVDSKQTAAYSS
                     GAWDSSASYDVSKDDDNDDEAAAAAAAAAAMRWTLEHHQRMQQTALSPSAAVLDHTTS
                     IELRLALEQDVPVSGRAQVNNADRGDAPVSRCGLRGVGAWHAVDTTACKATFPSVHEP
                     AFPRTDQPSDSEDASGPRSLKWCRTTTIADPGDGSGLRADSRSASNAPTLLVEGDTSH
                     VTAGSGKVPCSAAVAPGIADCLAPTKSSETLPEHRRDRKHALRKGQSVWRRTRSAVAR
                     SFEHAVQSVQRAAKRASGPGACTHPSGARPQAADRCPESVSVASNTAVKQTAQGFTDL
                     SLEQSLYDRLAADLERTIERLKAPVVANAVAADRPLAKAPKQHAHHFGLHMFEQLRGH
                     SFACRRRKAATRPGPSETAADAGAASACLPAADATDLFRAADWDNDAVPAAAAAASQT
                     EALFAVATCADGFAVSFRALDRRLEREGLAAGATSDAARLPCNWVKNRYADILPFDRT
                     RVRLLEVQSAAAGGPPWLPATDYINASWIRGAIPESRRFAYIATQAPRANHESERDFW
                     HMIAEQRVPCIVMLTRTMEQGREKCAPYMRTGVFGAYQLRIVREYHWRVEGACSAWCL
                     QPPCASVQSDANAAVLAAIRDAETTTPLIVRVIELQRVRPLNQKRDAASTQSTVSLPL
                     ERIGDRWRLVQLQYTAWPDHGVPQSVVPLLQLVDLVNDARTLYGASQAAMLDRLRGNL
                     DARERLLTVSLQERGTAMGPCSQAAAAAAGAGAGPVGDSAPLVRSASRTRYGPVVVHC
                     SAGIGRTGTWIALHLLLEKLKHGDGPAPGETFADFTAQTVLQLRAQRMGMVQTAAQYR
                     LLHEACLLGLRRDSQPLIKLPPDEDLFAEASTRSQMTAADRAGAFPAPQHDDSVSR"
     gene            complement(50590..53015)
                     /locus_tag="CYME_CMP020T"
                     /db_xref="GeneID:16995878"
     misc_RNA        complement(50590..53015)
                     /locus_tag="CYME_CMP020T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461518.1"
                     /db_xref="GeneID:16995878"
     gene            <54210..>56945
                     /locus_tag="CYME_CMP021C"
                     /db_xref="GeneID:16995854"
     mRNA            <54210..>56945
                     /locus_tag="CYME_CMP021C"
                     /product="probable two-component sensor histidine kinase"
                     /transcript_id="XM_005537672.1"
                     /db_xref="GeneID:16995854"
     CDS             54210..56945
                     /locus_tag="CYME_CMP021C"
                     /codon_start=1
                     /product="probable two-component sensor histidine kinase"
                     /protein_id="XP_005537729.1"
                     /db_xref="GeneID:16995854"
                     /translation="MDVACAPYRTQSLGWGILATPALGEKPRCVKLRRETTPWPSLRR
                     HWPGCLRHGTKPLSRDIGLLDAVHLYLRSNVQLRGGAAAGGPSSCCMSADSPAQHQRR
                     WKRPGQTSGKRRPRKSLTSPDSERATNEEEQSTPRQADTTRKSPSGSAALAVKSQPPT
                     ATTESTIPQCSREFIELCRVQFEVLASVLGVTRCALCVRREAPDGALEFVPLCVYPES
                     QCVWVVGAAPGSRPPVGPAALPGGVAAGRLLPEYPFIDLNADTAMPLTDGGLSAPLLD
                     GNTVLGILVVWRDHGTDSTPKPRILPEEPSHWTMDERVRLVSIAKTLALALVLDQRHR
                     HKASGASQASTRAVVSSSPTNDGDMQEVGSRCEPRASAEAPPHSHADPLAPASAREPK
                     APTGERTSLKRNRRKRTENSAQLPASETLAHWVDTRVLSSHERQTWGSAQARESAMIA
                     QIRDVLSNILHQAKSPITALRTFGKLLLRRLPPGDVNRDLARDIIVQCERLNELLSPL
                     DTVTLQVAQLPPAKDIDRVSPAAASKNARPWPRSMPHPTTTTTTTTTTTTAATYALPG
                     RMLPPPPRSLLLPAPGTNAQDAVVTPSNTNDDDDDELLHSRSSALENGRLHLCWMNDI
                     VRPLLGTATALAMEHGVELRARLDQVPAILADAFALREAISNVLENAIKYTGTVQPGA
                     RGRLVLLWIQLVSLNAGRDRSAGEITELRPLEAVPGGTFDAEEPQAHDDLAVALFVGD
                     TGPGIPRGELERIWERGYRGRRARQDSAAERASLEAGSAGAENRENSPISLPSTSRRM
                     QSGASDTDSAQHGLGLYLTRQLVERMGGMVILQSPWPQSERARSPPGISGTTNDAQWA
                     THILPQNAPPLEEMHVYVNAPAADSTTRTGQRAHRRGTLVGIVFQRAISAGTPAS"
     gene            complement(<57407..>59734)
                     /locus_tag="CYME_CMP022C"
                     /db_xref="GeneID:16995855"
     mRNA            complement(<57407..>59734)
                     /locus_tag="CYME_CMP022C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537673.1"
                     /db_xref="GeneID:16995855"
     CDS             complement(57407..59734)
                     /locus_tag="CYME_CMP022C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537730.1"
                     /db_xref="GeneID:16995855"
                     /translation="MKFSKQLMYNAVAEWREHYLDYSELKKYISRLGSVRQQLRKYGA
                     GDPAMSCSPLREVTLAIWIRGDAVCGRGASSSTASVSSPPPEEEIEVDTLHARATARI
                     APLRSPVEHGSWGAEAVALAPETADGAGAAPHAQTDAKFERLPSDAASAPSTGLEHHA
                     TEQERARLARVSVISAGSEDIEQRTRASVWMHAIGNEKQVSGGISAQASTAVEPRSAS
                     PGDCSESARGATRMPSGVSQVSESPGWVEDHAERLRVADMASSGGASAANDSRTRNRN
                     TVTKNDNDNDDHDDDDDESDDDDDDDDDHIGDPGGNALRSQHSFSVTGCVPDSLRGFP
                     SAGENAGHRDAPCPAARVPLNGAQTAPAEDEAASPSVHQDAHAAGTARAADAHVTALN
                     LTPAMHTDTYPRPLASPLASTGDTSAAAIERRESRSARLAPALRKTASANVLYELEHG
                     APRHAPSDYFAAAPERSANACSSAAPPPLQLARPLPGAALREDASARRDAPGTSPRTS
                     VGSDRASPACYPASAVRSKPVHERTPLLGEIIPPRTPPAQDRNETPPGACCNKRPPSR
                     FQTAETTHTLAYSSPLAAPVVAVPQRSTLASRNPTMRAQPWNGALPSTPLMSSEQWAQ
                     SHREAFWRMERRFFERLHIEAVKVDAFFCAMERELERISQALAVDAEASLRRQDQQRL
                     ALLRQRYREHYVEIMELVNFIELNATGFEKILKKHDKVTGLQTKAVFQRQVLQTFTFY
                     QAAQQTRQTDTHDDDDFDEEDDHHAGNGAPTSSGH"
     misc_feature    complement(60096..61056)
                     /note="repetitive element"
     misc_feature    61011..61907
                     /note="repetitive element"
     misc_feature    complement(63389..67009)
                     /note="pseudo-gene of triacylglycerol lipase"
     gene            <68866..>70584
                     /locus_tag="CYME_CMP026C"
                     /db_xref="GeneID:16995857"
     mRNA            <68866..>70584
                     /locus_tag="CYME_CMP026C"
                     /product="probable low-affinity phosphate transporter
                     Pho91p"
                     /transcript_id="XM_005537674.1"
                     /db_xref="GeneID:16995857"
     CDS             68866..70584
                     /locus_tag="CYME_CMP026C"
                     /codon_start=1
                     /product="probable low-affinity phosphate transporter
                     Pho91p"
                     /protein_id="XP_005537731.1"
                     /db_xref="GeneID:16995857"
                     /translation="MAHKQKAGCISVLKRGVEAEFAKLFHDGDLEAARTELNESVRDL
                     IVWERNTVWRDMLLQERRLRDTHAKRSGTRDSPFRAFRVVPFLVAVVLFLGVLFAPAS
                     QFMFLQRALEERENQGHPISAAAAAARNAAAQRCLALVTFASVLWATEAVPLFVTSLA
                     MPLLAVILRVFLDEKGERTLGPTEAAHKSITSMSSPVLLLILGGYSISGALSKHAIDK
                     AVAIAVLRHARRPPELLLLLMLLAVFLSMLVSNVAAPVLTVGIVTPLLRSLPPGTPFI
                     KCALLGVAAACNVGGMTSPIASPQNAIALDALRGAASISFRQWVAIALPLALVTVFVM
                     HAYLIVRFGRGPMQAFPLIPMHSPLKWKDTGMAHLVVILTVLVTVALWSSKTVSDRFG
                     GDGIVALVPVVVFMGTGLLSKEDFNALPFNVIYLVSGGVVMGAAVRSSRLLELVAASV
                     HSAVVGAGLYKTYLTFMLMTLLVACIMSHTVSSIILSPVLAELGAALGHPRLMVLGGA
                     LACSCAMALPVSSFPNMAVISVEDELGNPYLSARDFVWVGFPLTLLAGAALASLGYVL
                     SFYAGL"
     misc_feature    complement(70414..72772)
                     /note="repetitive element"
     gene            <72951..>75197
                     /locus_tag="CYME_CMP028C"
                     /db_xref="GeneID:16995858"
     mRNA            <72951..>75197
                     /locus_tag="CYME_CMP028C"
                     /product="ATP-binding cassette, sub-family D"
                     /transcript_id="XM_005537675.1"
                     /db_xref="GeneID:16995858"
     CDS             72951..75197
                     /locus_tag="CYME_CMP028C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family D"
                     /protein_id="XP_005537732.1"
                     /db_xref="GeneID:16995858"
                     /translation="MPETTRLFRVKQRSCGANSLPCILRSSPITFVFLQSGGALTQGT
                     ARSAGARVAFRLRARAALSSLAQPARLAWTCAGQKQVQFQATCSRVGFLGRFPSRKAI
                     SQAARRCSRLRMAGVSADGQARLQSRRERAIALLKRLKELAVPFWTEPSSRNAAWRWT
                     LGTLALAFVCTLYAVSLSFIQRFFWNALNAKDAVKYQKFLVLYVAALIAGPPFLTLFE
                     WMRQRTALVWRRFLTERLLGGYFHDRKYYTINILRLQNNETVHATPATSAGGVRVVQD
                     ALDNVDQRISEDIRAFTERAVGFGCTVVIALFDFLLFSVILFRIRAQLFLLLVLYSTI
                     GTAVTLWLGGRLVHLNFAQLRREADFRYALVRVRENAESIAFYGGEEQEQRAVSRRFR
                     ALFDNMIQLLRWQRNVTFATTWYRYLIQVVPALVVSRDYFSGRIPLGALSQAFFSYNH
                     VLNDLSLVVNEFVGLSAFAAAVNRLYELHCAVEPRLLAGQRHERDAGSQADTEGIVTL
                     TGNGTAAGVKPAALRLEKLTIYTPEGRRRLVDQLDLMLEDGARILLMGESGVGKSSTV
                     RAIAGLWKRGSGVVYRRPHPRNTLFVPQRPYLMLGTLRENLFYPLHGEDAANVDEKTI
                     RNVLVRVNLPDLVDRLGGLDVEADFAAILSLGEQQRLAFARLLLQPEPVQLAILDEST
                     SGLDVENERRLYELLREMGISVLSVGNRPTLIRYHNQVIRLFANGSWQIESPSEAVEH
                     LLGSSLLD"
     misc_feature    complement(73869..75695)
                     /note="possible transcribed region"
     gene            <76189..>77760
                     /locus_tag="CYME_CMP030C"
                     /db_xref="GeneID:16995848"
     mRNA            <76189..>77760
                     /locus_tag="CYME_CMP030C"
                     /product="probable chromatin assembly factor 1 subunit B"
                     /transcript_id="XM_005537676.1"
                     /db_xref="GeneID:16995848"
     CDS             76189..77760
                     /locus_tag="CYME_CMP030C"
                     /codon_start=1
                     /product="probable chromatin assembly factor 1 subunit B"
                     /protein_id="XP_005537733.1"
                     /db_xref="GeneID:16995848"
                     /translation="MRALVLELEWHEQQRGVFSVDIAADGTIATGGQDKRVSLWRLEP
                     DWEQLRALAAQPHEPSKKQRYALAQAAAQSVRFLDTLEGHAAAVSVVRFDPVDSGRLV
                     SGADDGYAVLWKFDAVQGKWRLEATLHEHNDMIMDVSWSADGKLLATASVDNTVAIWN
                     TTDSTRPQLLLSLREHTNYVQGVSWDPLGTYLCSMGADRLLRVHEWSSDRRRVIRSTA
                     VGSMVHSDSTAHPCMTADASCPPSHSETQQITPVPSHPLESEPRKPSSRRLFESEGLM
                     HFFRRLAWSPDGSFLVCPAGIVPEPRDAAPTCSSRDAAPHRTKGAHVFARSNLSTPLL
                     HLGGHEESILGARFCSRRFARRQDPTLDEDLGCWRSRLPYRLVFAIYSARGLYMYDSE
                     TPHSFAAVQGLHYGAVTDVAWSPDASFLLMSSLDGFLSLVWFERETELGKFFEESGEL
                     QTGSRSSPSTPLTTGSCSLDGGQGSHRSADPVMRCNREQPIASTLVSSDADSGHGRNT
                     DHSTKVGEHAVSSTT"
     gene            <81460..>82242
                     /locus_tag="CYME_CMP031C"
                     /db_xref="GeneID:16995849"
     mRNA            <81460..>82242
                     /locus_tag="CYME_CMP031C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537677.1"
                     /db_xref="GeneID:16995849"
     CDS             81460..82242
                     /locus_tag="CYME_CMP031C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537734.1"
                     /db_xref="GeneID:16995849"
                     /translation="MRSILRTFRKTSVFWRQFWAFDCEKALNASYGTWMQSQARLLPT
                     LVPVRRRFASSSWGQQGSETSSATNSAGSDSAASVASQTKRDFRPRTILRSQTPVGEL
                     IRGRGERVYQIAANDTMQNALKKMFIHNIGCLLVVEQPQQNDEACKPVGIISERDLTR
                     LLISRGSSGAASAGRTTADLLLTVKVHEFMTKANALISVTPDTDLASVLELMASRRLR
                     HLPVVRDGQAIGMVSIGDVVRRLIEESREEADALKEYIAGTY"
     gene            complement(<82956..>83729)
                     /locus_tag="CYME_CMP032C"
                     /db_xref="GeneID:16995850"
     mRNA            complement(<82956..>83729)
                     /locus_tag="CYME_CMP032C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537678.1"
                     /db_xref="GeneID:16995850"
     CDS             complement(82956..83729)
                     /locus_tag="CYME_CMP032C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537735.1"
                     /db_xref="GeneID:16995850"
                     /translation="MDRRYDDSPHRWVICGNSIGGLIALMTGVMLQHRQVTTSSIVAA
                     DNPIDTMKHYPKEERQRDRLAGLVLLNCAGGLTGIRFSELSPIGAALWWLFTTIFFRS
                     PLVYWLFERIRRPASLRQTLRQIYRNAEAITEELIEILRAPAHDDGARDVFAAVLRGD
                     AGPTPRELLQQLSPEKQVLVLWGRDDPWTPFDRGLHPGTAFPNWVPVPTQLRLICIED
                     CGHCPHDDAPERVNAEMCTFLRELWLVEQDRRGQQTSDL"
     misc_feature    complement(86165..87219)
                     /note="possible transcribed region"
     gene            complement(<88071..>88838)
                     /locus_tag="CYME_CMP034C"
                     /db_xref="GeneID:16995852"
     mRNA            complement(<88071..>88838)
                     /locus_tag="CYME_CMP034C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537679.1"
                     /db_xref="GeneID:16995852"
     CDS             complement(88071..88838)
                     /locus_tag="CYME_CMP034C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537736.1"
                     /db_xref="GeneID:16995852"
                     /translation="MAFTEDTLPSLEAWKCFVRRLEERYGLREVPRASWLGAQRPDFL
                     SHALQQRVAYLLPAAVCDDLSQKEARFCSISDQSSTEAKVAVPGAIIAAYVGRNLQGP
                     SGGVHGGAIASLLDASIGMATNPRSDPDGYVTAQLVVNYRQIVPLGSYVLALAYVHDR
                     EPARRKCYGMSRLVDAGALAQSTDTCALQLQRPLEAARRDTARERVYADATALFVRQR
                     HRPETHGERSLQTAAVNRVESVSGFLGAQARPWRASL"
     misc_feature    complement(88949..90861)
                     /note="repetitive element"
     gene            complement(<92514..>94352)
                     /locus_tag="CYME_CMP036C"
                     /db_xref="GeneID:16995853"
     mRNA            complement(<92514..>94352)
                     /locus_tag="CYME_CMP036C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537680.1"
                     /db_xref="GeneID:16995853"
     CDS             complement(92514..94352)
                     /locus_tag="CYME_CMP036C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537737.1"
                     /db_xref="GeneID:16995853"
                     /translation="MHADGLESGDSRASNFWYQAVSSVLYDSQPRWYFQDPSGARRGP
                     FPTLFLVAWWRYGFLDERLPISQQPESTSPQPMNRVLWSLVQRTAADLQCRTASALST
                     DATIRSAAEAPPLGSEATPGQPPDLSVEALSVRDQSIPAPGPASGSVSSTKPKPGIAT
                     PSAGSSRPWPAVRSSPEVDAMPRALQSAAVRPGHDSESISSTLKCTRDTGFAGVSTDP
                     GTSEARSVSDRGSVVSSAMVTEAASSSNQSVASKDALAAVAADAAGSTSANEPQEQAA
                     GSRRRRRRKKNSTDATLRTGEQGDHSLGDASLAPSEAAASTTSKLEGWQQVKARNRAA
                     ATGADRENPNPTLLLWPSAASKEIEPPEHAYLERQLRTRLAPQDSHVRLTSVDALDQL
                     NKLVTNPGVHSDTGSRSSSAEQQAGSHRPGYRSGSVARPAPWASNAASTLATGAGNAH
                     LSLAGAAARAAESQVQRAQQQQRPSRRSFLEIQREEEEQERQRLLDMLQNRPRLGETE
                     TTSASGTARYRTMADVLASGLARDRAYRGTVWMAPSTRSTGGDGTAPTTDAAALQVSD
                     NRERAAPSRAPDAPAQVTDAAGSAMPAAAASFWNRIVQDSGRSKEL"
     gene            complement(<98053..>99438)
                     /locus_tag="CYME_CMP037C"
                     /db_xref="GeneID:16995924"
     mRNA            complement(<98053..>99438)
                     /locus_tag="CYME_CMP037C"
                     /product="unknown transcriptional regulator"
                     /transcript_id="XM_005537681.1"
                     /db_xref="GeneID:16995924"
     CDS             complement(98053..99438)
                     /locus_tag="CYME_CMP037C"
                     /codon_start=1
                     /product="unknown transcriptional regulator"
                     /protein_id="XP_005537738.1"
                     /db_xref="GeneID:16995924"
                     /translation="MTWIVCNCSSRGQRTRVQQQSLQRHRRLSVCQWSGSGLGYGSSG
                     SVSSPRTVPISFRVRACASNTGEPPEQDHNHGAGADANTPDSSRRRRRRSQRRHAGYE
                     AHVRERLRDWRAFRMQLLRRELEYGDAFGTVETEGSAPAESPENAATENRASKAGELL
                     DPSSSTGDALHASPQRVQETPRMNSMEWTGADIDMRWVHPVTAIETGNILVASPKHFL
                     NEQQYFAQTVILVLEHGSDGTTGVIMNRRAAQRISFVSSLAGTDLGRVFGREALYLGG
                     PVGLDSLLVLHDESSLLASNDRQQLPGSAADEVAYEIVPGGVYCGGLGRLTELARRGS
                     LARPDRVRFFCGYCGWEPGQLEREVHQGVWYVASASAELILGPRVPPPPFVAESPERD
                     LDASTSAGKSTAWRERSRFSWNISKRLGEYRAQAVSQGAEGPVALWREVVDKLAIYRR
                     FIEGFPHTSDS"
     misc_feature    99780..102519
                     /note="repetitive element"
     gene            complement(101963..103500)
                     /locus_tag="CYME_CMP039T"
                     /db_xref="GeneID:16995925"
     misc_RNA        complement(101963..103500)
                     /locus_tag="CYME_CMP039T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461519.1"
                     /db_xref="GeneID:16995925"
     gene            <103657..>104589
                     /locus_tag="CYME_CMP040C"
                     /db_xref="GeneID:16995928"
     mRNA            <103657..>104589
                     /locus_tag="CYME_CMP040C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537682.1"
                     /db_xref="GeneID:16995928"
     CDS             103657..104589
                     /locus_tag="CYME_CMP040C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537739.1"
                     /db_xref="GeneID:16995928"
                     /translation="MDNWSSDYESDTTVGLQNIAFRVLSVLGIGLWLHCKGRRRRRLR
                     RAASNSQGREQVAVSSHDAQSFPKYVSGQQMVSKSSSVKRQEGTQGCDKDDSRIEGAT
                     SPWSHDAWQRLQLACQRAQQQCISLEDELKRVLREREELQEALSMARGALQPCEQSTG
                     CAAHAAPLLASLPPPRKAVDQKPSKPEAQRMAGATVNLDDATQPWLEHTTPVPSDQSS
                     PFQQDEAASGAHSPAARSGPVLPDTLGGLRLDPVEVAAAMALRQRGFGGGLLNEASID
                     DVRRRLGFGGSAHSCKNAAQAPTHAMDAFTYYGD"
     gene            complement(<104974..>107199)
                     /locus_tag="CYME_CMP041C"
                     /db_xref="GeneID:16995929"
     mRNA            complement(<104974..>107199)
                     /locus_tag="CYME_CMP041C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537683.1"
                     /db_xref="GeneID:16995929"
     CDS             complement(104974..107199)
                     /locus_tag="CYME_CMP041C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537740.1"
                     /db_xref="GeneID:16995929"
                     /translation="MQPWLSTSLFYIAEAPAVLFLTLYLLVRYPTRLPGLGTPWYVYT
                     TVGLAWFLSFLALILLPADLAETLFRRCEYLNKRSGEDLSLHLRNCAPPSLSPAALLA
                     TWQALYWTSLVLGWILLPLVQSNISLEHLPLRERVRKALRPQLIALAVLAVVLSALAA
                     AVRSPRHHGLQLETWRATIIGLNNAFGLFLLMIFLGFGLVELPRTLWERSDPRRRLRA
                     YAIRIAELHARHLETLQSLSRLRLQAAVLGIGCTDDQTLQSQEQSHMPGHARSATHAY
                     RQELCSRIETLLNLVPLHSSDLEIGQQPQKTWSSATPRATRMAESASLGTLFVEVRRA
                     VLEYRRIEYLWQRISQRALFLQDLLQWRSAGCSSSAAASSACAGVLSTGSVSTSDVDR
                     MPSTLVYACRAGESPGATASRMGSFHDAGEDLSPERSMRIVHDRALSNGDATSMPHLT
                     KHATGAGAGSPQRIYISECERSVNAAVGTKRWIDGMQRSLALRWRAYGEPFCLRVQAV
                     VLFIVASAVCLSELTIWTVLLTPPRSFSPFARALHSLPLSPLGVQAMALSLVCTLTSL
                     VYFAVFHLQIYRWYELVPGYVDGQMLCLNAMLMSRFLLPLCYHLIFLLHENREAVARL
                     LLYQYPQLMRHSGQDSSTVPVTAFETLMGSMHIVPLFGKAFNYFYPCSLVISALGTYF
                     RLWGRLLDRFGLSRSLEFAEETISAAANNEVIGRQLLQRERARRQEASPCGLEPETRE
                     R"
     gene            <108544..>112194
                     /locus_tag="CYME_CMP042C"
                     /db_xref="GeneID:16995930"
     mRNA            <108544..>112194
                     /locus_tag="CYME_CMP042C"
                     /product="similar to U3 snoRNP component Utp13p"
                     /transcript_id="XM_005537684.1"
                     /db_xref="GeneID:16995930"
     CDS             108544..112194
                     /locus_tag="CYME_CMP042C"
                     /codon_start=1
                     /product="similar to U3 snoRNP component Utp13p"
                     /protein_id="XP_005537741.1"
                     /db_xref="GeneID:16995930"
                     /translation="MDRSELHASSCAWEITYALSSLHTGGKVVPWPIERHSQEGTTAT
                     PEQQRHSRVPEFHSWVGLLTQKANRALGCILTADPCDESDVDRTASAEEGAGEAPPCC
                     ASLLPVVALRTLPRTRDQLHDTTRAAGYIDDAFEDDDDDDLDDEALTAMACSPDGDQA
                     VLATRSGYAYLFRELCRYHDLAETHVAARKTPGTRSEPPRIEEPFWTWLPFGTDTQVV
                     VACEFDATGQYLAVASAVGEVRLYYLPTRTVVQRFRCTKGHGMVTCLRLLRGHEATDT
                     SIGTRLTAMPTDSEKEQRNTEAVHGAGAPDEHAVTAADVSATASLPAVPGSMTVDRSQ
                     VDVAGDHPQALLSSSRSPFKGKKSTTAASEQVRQRETCVPPSLPRPSLLLGCEDGTIW
                     ALPGSPGARPRSVHEHTSAVLHLQVLGGDQHVHPSHRRVISAGLDTYLLEWDERFGRP
                     HGAVPVGEAITALLPIHRGVHLGGWLIATMSGVVYLLPFSGADTPDAHARHQQVANRT
                     ARLVPLLRMESGSVQLIDSSPQTQPGTTFPSKSSDETSSTDTVTVLGFMPWPRSHETS
                     GGLAQPAGIERVLITTSDQCLHLIELSVHHDRHGNRVCRAHVVASVMTNLDEVYSLAP
                     LRLRSAGSRAPALAFATNAHAIAVARIIGVDRVETLCFQRMLRGHCDAVLGLCVPPAL
                     PPTSKVGPLAYAPDATLVSVSKDTTVRLWDVDRGVCCGVGRGHTAALSAVTCGWILTR
                     HRWSLWIASAGDDGALKLWTPPGLPSVADHDNDHALATQGMRRDAPLECWCTVAHAHD
                     GEIHCLATAPNAPYLASGSQDKSVKLWRISSDPDGNVQVTAWRMLSGHRRSVWAVCFG
                     HNEPVLASASADRTIRVWSIADGQCLRQLEAGGAAFSSRAPNLGSFLCCSFLAGDSRI
                     VAGSAEGALYQWHWRSGQLLGEIYRCRSMEVPQRSSSSSSIRSRTHESAHQDRLWSLL
                     VIEHDLRDTHLESASTDSNNCSRCSLLVTGGADGRIRCWRDVSAEERARQLVEQEARL
                     QMDQELQRALAMGNFTEALRGAIQLEQPLRAFLILEKMGSGAFAQSPLQHIAAVETVV
                     RALHEPSEVGRLLEYAREWCAQRRTAFTGHLLLRAVFRVHYPPYRLRSLLQAAGYRAE
                     AIDNLKHALIAYAERQARDLLRIQDALQLLPYAEARSGLPERFTGDGTGEASAVPERE
                     LARVPDPYGCAT"
     gene            complement(<113538..>115139)
                     /locus_tag="CYME_CMP043C"
                     /db_xref="GeneID:16995956"
     mRNA            complement(<113538..>115139)
                     /locus_tag="CYME_CMP043C"
                     /product="RNA polymerase II third large subunit"
                     /transcript_id="XM_005537685.1"
                     /db_xref="GeneID:16995956"
     CDS             complement(113538..115139)
                     /locus_tag="CYME_CMP043C"
                     /codon_start=1
                     /product="RNA polymerase II third large subunit"
                     /protein_id="XP_005537742.1"
                     /db_xref="GeneID:16995956"
                     /translation="MNGVSAGNGALAPGRTESTESASLQRFPKLRLTRLAATECDFTL
                     SDTDISVANALRRAMIASVPTMSIDLVTIYVNDSPLHDEFVAHRLGLVPLRSDTAEYF
                     NYNRDCDCTQSRIAALSGNPMEATNCEKCSVEYILDVTCPPDGELEEMNVTSRHLQMD
                     PRYFDGPAYVRAVVPIHRPDQPWELAPDSSRDRTSADAGIVICKLRRGQRLYVRCIAK
                     KGTGREHAKWSPVAAASYRMDPSVRLDLGRINAVLSSEQKRLIVKMGGGALRVEANVV
                     TGDVEIVEDEAYLRGRIEISNDCLRELQFALEEAGQNPFQLITLSRGSDAEGQRTFYF
                     TLESTGVLPPEAIVQSSFRVLIEKILSLVPCLRDEAESHSIALNQDLSYLLLSYEQRR
                     NQQERLQMAIYGNLPGGMTQTVGAAGAFGTTQYAGPFSTPAIATGSATALYAQGQTGY
                     TPRYAGEAVAAATPYAAYQNLAAGAWGSQDLTGTLRTPQFGGADAARWSTGVTTGDQF
                     PISGNSVAGAEQEDQPPPPPPPLPQ"
     gene            <114922..>115890
                     /locus_tag="CYME_CMP044C"
                     /db_xref="GeneID:16995957"
     mRNA            <114922..>115890
                     /locus_tag="CYME_CMP044C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537686.1"
                     /db_xref="GeneID:16995957"
     CDS             114922..115890
                     /locus_tag="CYME_CMP044C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537743.1"
                     /db_xref="GeneID:16995957"
                     /translation="MVTRSMLIVGTEAIMARRSAFATEISVSESVKSHSVAAKRVKRS
                     LGKRCRDADSVDSVRPGARAPFPALTPFIVWDGVRFPHYSAEEESKTIRTRDEVVSVL
                     QECYTGERVRASKPPPRLHDRHHHHHHHHHHPREHCSWRRARHPRDDADSICGRTGVS
                     PGEAHNDVARTTPVLHAAWLQGYRGYPETFLRRLSVDTEKTDRLGASLVRVTTGIRLN
                     CTAGQYTRTQTRNVVRYVMIHACRFLIRRVRYVMIHACRFLIRRVRMHAEAWTRMHAC
                     SRACSDRASILPQRPRIPIIDACAKLSPCRVRLITEHFRNFKLSGL"
     gene            complement(<116847..>118007)
                     /locus_tag="CYME_CMP045C"
                     /db_xref="GeneID:16995958"
     mRNA            complement(<116847..>118007)
                     /locus_tag="CYME_CMP045C"
                     /product="replication factor C subunit 3"
                     /transcript_id="XM_005537687.1"
                     /db_xref="GeneID:16995958"
     CDS             complement(116847..118007)
                     /locus_tag="CYME_CMP045C"
                     /codon_start=1
                     /product="replication factor C subunit 3"
                     /protein_id="XP_005537744.1"
                     /db_xref="GeneID:16995958"
                     /translation="MENVDVDEHHAEYAGLLWVDRCRPTTFEACVVHKELNERLRRLS
                     ESPAHLPHLLFYGPAGSGKRTRVRLLLRELYGIAVDHSHVEHRLVRVGDPPRSLEYTT
                     VSSAYHIELNPSDVGYSDRLLVQAVIKEIAGSRPLLSSAEQDAMVEGGTSTETASKRL
                     PYKVVVLHDVDRLTREAQQALRRTMEKYAQTCRLVLIADSATRVLEPLRSRCLGIRVR
                     APSETELRTVLRQVWQRMVHSAESPPEALLDHAIRASDGNLRSALLSLEASYWTSKAG
                     RKGSALPEPDWRSICDEIADQIRKEQTPPSLLRVRALYYDLLTHCIPVDIILSMVLRR
                     LLERVPVALGQQLCFWAAEYEYRACMGSKAILHLEAFAAKCMALIRMAQTAG"
     gene            <119096..>122065
                     /locus_tag="CYME_CMP046C"
                     /db_xref="GeneID:16995949"
     mRNA            <119096..>122065
                     /locus_tag="CYME_CMP046C"
                     /product="probable mycolic acid methyl transferase"
                     /transcript_id="XM_005537688.1"
                     /db_xref="GeneID:16995949"
     CDS             119096..122065
                     /locus_tag="CYME_CMP046C"
                     /codon_start=1
                     /product="probable mycolic acid methyl transferase"
                     /protein_id="XP_005537745.1"
                     /db_xref="GeneID:16995949"
                     /translation="MESELPCIVVGGGVAGLGAAWALHDAGHRVCVLEADPTHLGGHA
                     YTMEVPVSGSSQIPIDVGFIVYNTEAYPNLVAWFDALGVETEPSDMSFSVSVPRGATG
                     GARLEWSSDSLWTLFGDRRNVLCLQFYGMLRDLLRFNKEAIALLETLPLELTLEQFLA
                     QGRYSDAFRDWYLTPMVAAVWSSSPSEVLHFPARSILAFFRNHGFLRIFGRPQWRTVR
                     GRSQAYTSRVMQALTSPSQANGVVSEVRLGARVTRVLERKQDKAVVVVELEDGQVVRG
                     SRVIFATHADETLRLLAEWATPEERAFLSAFEYVENEIVIHRDARFMPQRRSLWSSWN
                     FVPQEDGRAQVEAASTCKVQVTYLLNRLQNLPKDVPPLFETLNPAFPPEEELVLARLR
                     LAHPMLTREAVLAQTQYRESLLRDGCKRDIYFAGAYCGYGFHEDALTSGLEVAQCITE
                     LPMRSLLKQTASPADNKHRRALNNHQGALPPARVSLSGTVGRAVHANVLSYLQRSIRY
                     GSLIVVLPDGTEHVCGTLKVSASDNPHLHRLLVTYGLNESPVRVHIRRYDFFWRVVSG
                     ADIGFAEAFIAGDCDVGGWTSRHGAVYTCAGTELVRLFKLFILNRDEGALSPAKLGLA
                     ARLGMWYNAALHLVWRRNTLRGSQKNIESHYDLSNDLFATFLGDLWVYSCALWARPDM
                     DLDEAQRAKLQRIIEKLRLDTAESVLEIGCGWGALAIEIARQYPRVRVLGITLSREQL
                     RHAQAWAARVGVADRVTFRLEDYRTLTRMPKEEVARGDAAQAGRPVDSRNGLMKTAAV
                     GGHGRHDLTFDRIVSIEMLEAVGHEFLGDFFAACDRLLSPSGLVVVQVITTPEVRYES
                     YRKSSDFINKHIFPGSCCPSFHALVHACAVAAPALSVVDVESIGVHYAPTLASWQQRF
                     MENLGRVRQLGFSEAFIRKFLYYLSYCEAGFATRTLDDLQIVFSRPGNVLSLGGEPRV
                     STVARYRERGALDSSTS"
     gene            complement(<122586..>123929)
                     /locus_tag="CYME_CMP047C"
                     /db_xref="GeneID:16995950"
     mRNA            complement(<122586..>123929)
                     /locus_tag="CYME_CMP047C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537689.1"
                     /db_xref="GeneID:16995950"
     CDS             complement(122586..123929)
                     /locus_tag="CYME_CMP047C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537746.1"
                     /db_xref="GeneID:16995950"
                     /translation="MRSALYCGSVTHSRRYPAAYQFSYALFMVYLDLDELARERWRFP
                     WWPLFSARRWLPAVAWFRSKHHLRELGPEKSALGAGSEAELLAVAVRRYVQRELRLES
                     APKGRVCLLTHLTYLGIAFNPVSFYYILDEDGKNVEYIVAEVNNIPWFEQHAYVLRAR
                     EYSSVAWPPFSRTNSLNDAAQMPPDDENEDCIQPATDGDRYHKLAGNEKRHACSSVTT
                     TAAAVEGASSQEVAAAASTGTSSASAWRWCPRPMSRVDSGASLNGGTPSSPCFVISVV
                     HPKEFHVSPFIAMEGIEYRWLFSQPGCRQLRVFVELLQRQPTANGDASASPSGFQKFF
                     GASLKLHRVELTAMNMVLCLLVYPLITLQAMVAIHYEAAKLYFRGFPFYPHPQGTQTL
                     LARLIALIVAIAQPGIYLVNLLRALVRVLLRPVRLVMRRPRGRRARPHEVPASHM"
     misc_feature    124850..127735
                     /note="repetitive element"
     gene            <129286..>132300
                     /locus_tag="CYME_CMP049C"
                     /db_xref="GeneID:16995941"
     mRNA            <129286..>132300
                     /locus_tag="CYME_CMP049C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537690.1"
                     /db_xref="GeneID:16995941"
     CDS             129286..132300
                     /locus_tag="CYME_CMP049C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537747.1"
                     /db_xref="GeneID:16995941"
                     /translation="MSSLAGSRPQARRSDTTQPRQPLHETPVRSTVFQSLLECVPEST
                     WSVELARLCDELSTEEPCDLTGPLDQTEAAVSPRTQAEHSEPRSADLHSFTSETLESF
                     LTKLNTSVKVLEDDWLCPATELGDSLQVAAEAFQRLRANTARWFLGSAVPDQALGSAV
                     RRLLRLYAIAKQAHGYFEHLGVLSEEADTLDRALAEGSIDLRSAWEIWERLHREKELL
                     AEELAIECEFSTVSCSAPTNETESEREQLQTVLTQRCEKRIAARIQQACRWRLRDLVP
                     SLEQHPEDIHVIVAIFKEEPQLLAHLFPDVIREAISRRADHHERSIVGAASEAEHAAE
                     TGAPERSPGAHWLREVLADLDARNTSEQNASPERSAPSRAEEYGTAAAAVASKAQTSE
                     SASRLSLESVSREPEEPQFVARMLQRCELLIEDIRIVQKHVAALGEPAFPLDRWYALE
                     TNQIMNAVFWGIITRASLIPSRDILDLLGWIHRYRDFLQQTFPMLDPEGSASPAGALV
                     WDRTHQETLVRGLDMPAERLIEGYAARALEMMRRWIRNCIKVDTEGPVDVRDDDGSLY
                     TQGPLDVFRIVNDEMTIVQERLELGNPRFVQCISDACCAALLDYRTWSLDALEGTESE
                     DGALERFCATVNNHRRCESLAAQFATRCHTILNQAVYGLGDWERETSATPQTPTQVPG
                     PSPGTACARESEALNETTYVLAVDNLAAQFAVSAEFAATRVCNVIFEDMDDAPGLWPR
                     LYTPAWISGEEEIANSIVATVDDFFHDIDTYLRVEVDRALVGSECATRVADRYAAALA
                     SYLGATGAAPEVGDAQRASPEALDPAGATPPLLGPRSRDRIAQRIAGGSSSRLLQVRA
                     AGSEDARQGRRFRDAHPVANLDRRMVERLRKDYGILAAHFLHARRGGSHARVVRALAA
                     IDAIADMLAAAFANNADAVSVHFSHLLDARLSRHTLYLWQPSTVERLLVAVAEATERT
                     NALDTWKEAVAACRRAWSAREQRDWGEQPVSS"
     gene            complement(<133084..>134307)
                     /locus_tag="CYME_CMP050C"
                     /db_xref="GeneID:16995942"
     mRNA            complement(<133084..>134307)
                     /locus_tag="CYME_CMP050C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537691.1"
                     /db_xref="GeneID:16995942"
     CDS             complement(133084..134307)
                     /locus_tag="CYME_CMP050C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537748.1"
                     /db_xref="GeneID:16995942"
                     /translation="MKPSVETEPVLHRRSRSTSAQSALTGTEVSRQPGLESAGVLVRS
                     RSLSRSDFALAGDLLKPKDSGRGAVLGARTSRAPVRGRQRTQPSGHVADHTDVSVGCS
                     ASTDVLDMRTNPSVCVGERRANLWVLVTAVTAVLALGVVLLVLHKQVAFAFSAAVSWM
                     RGLPWPLRLVSYASMYIILAALEFPAWLMAIGAGMLFGLVCGIAVALCCHLAAALLCL
                     YTSRYYLRERMERLIENSERRNTYLAVNRALSRQALRFVTLMRLSPLFPFALSSMAMG
                     VSQVQIGSFCLGTILGILPGIILLVTIGAQLRWSTNPAKQNGADVVTEADAALARHRG
                     PKNLLRLLSIGSMILLIMMITRAAQRAIQDELDHESLSEAEDCEQAVDDEQGRFPNAN
                     DANDQGTESMRLSAP"
     gene            <135191..>138550
                     /locus_tag="CYME_CMP052C"
                     /db_xref="GeneID:16995943"
     mRNA            <135191..>138550
                     /locus_tag="CYME_CMP052C"
                     /product="DNA mismatch repair protein MutS, chloroplast
                     precursor"
                     /transcript_id="XM_005537692.1"
                     /db_xref="GeneID:16995943"
     CDS             135191..138550
                     /locus_tag="CYME_CMP052C"
                     /codon_start=1
                     /product="DNA mismatch repair protein MutS, chloroplast
                     precursor"
                     /protein_id="XP_005537749.1"
                     /db_xref="GeneID:16995943"
                     /translation="MRRPPATFVVPSRAIRNTGENVEYRNSLSVENLGKHLWKERRQR
                     RRYVPPLPDANRHSRQRVPVAPARCRGLLLCCQDCSEYELKSFVDRDEDEHGTGGGRG
                     ESSGSRSSPNFISWRQVDRAQLTPLFRHFLSVKDRFPDAVILYQCGDFFETFFDDAVV
                     LHEKLELALTGKDAGKEVGRVPMAGVPLSSLDRYCAALLEHGYHVAVVEQVEPANGRS
                     GGDGALVRREVTRMLTPGTVLEEGLLDARSNNYLVALWGQRLTSVRGDVDRRSPSKSS
                     RCTADATNWLFGLAYLDVSTGDFGSTAVENDVEDLQAELGRLHPAEVLLTDDISEEVS
                     SCLEGVLERTFTTNGWRASITRRPRAFFDLECARKRIEERFGSQLDSVFDERQLKSIV
                     QIRVIGALLALVNETLERAQAPIAFAMPQTAANATPLEPIVSGNLLTPLQPPRPYQIQ
                     GSMMLDGTALRNLEIVHPARDSRSRRGTLLWAMDATVTAMGARLLRRWLLRPSRDLET
                     IRYRQQQVQRWQRDHLQRERLRRLLRGVADIERLAGKVATRRANPRELYALAASLCRL
                     STLLSEVEARIGAGTGSAEAPCWPAAASSATKDLIKLAHQVVFDAFLTRDKEEGSPSA
                     SESAVAGSTLRGREPRGVALSPPPPYGVPVRLPSAAEDRPIFRSGFHAELDLLREQAA
                     GDLAWITAYEAQERERTGIASLRVSYHNVFGYYIQIPSRFTNPSNTSQNGRSQPTALP
                     TNYVRRQTLKSVERYVTPELREREQLILGARARVAALECRLFYDLLEQFGAAIDTIRS
                     MASWVAELDVLLGFAEIALERNYTMPEVVDSSDPVSGRLVDIEDGRHPVVECTLPPNE
                     RFVPNSLRIGDGTVDMVLLMGANASGKSVFLRQVALIQIMAQCGSFVPAKRARLALTD
                     RIFTRVGAADDIAAAKSTFVMEMEETATILRHVTPNSLVLLDEVGRGTSTADGLAIAQ
                     AVTEYLVSEAVRARGIFATHFHELAQLEHAFSNITCFHMAVIERYPTGNVEPAIVFLH
                     RLERGAASRSFGIEVAQQCGLVAAIVQRARELVRDDSSANHEPPKGPGTATEAAQASN
                     VKVQVQRMQPRRWRPRNKPSDLDAGFCAARV"
     misc_feature    complement(135660..137563)
                     /note="possible transcribed region"
     gene            <140463..>143285
                     /locus_tag="CYME_CMP053C"
                     /db_xref="GeneID:16995983"
     mRNA            <140463..>143285
                     /locus_tag="CYME_CMP053C"
                     /product="coatomer protein complex, subunit gamma"
                     /transcript_id="XM_005537693.1"
                     /db_xref="GeneID:16995983"
     CDS             140463..143285
                     /locus_tag="CYME_CMP053C"
                     /codon_start=1
                     /product="coatomer protein complex, subunit gamma"
                     /protein_id="XP_005537750.1"
                     /db_xref="GeneID:16995983"
                     /translation="MSVSDTLKDFAEDARSVLRSLGTKVEDDGINPLVVLDKARVVQQ
                     VRVFNETRLRPDRCLQVLTQLMFLVNRGERLTSSEATEVFFAATKLFSCDDAALRRMT
                     YLAIKALAHTAEEVIIVVNCLTKDITSTVDTRRANALRVLCKIMDATMVAQVERYLRQ
                     ALVDRNPNVASAALLSAETLLRAGKAEAVVRRWVSEATQALNHPHPIVQYHALSLLYT
                     MRHRDRQAVSKLVQDVARQGARSPMSAMLLLRYIGEILETDTLLDDGLRQQYVGFLES
                     MLRHRSELVVVEAARVLLAVSTVEESTLQTAANALQMLLISPKPVVRYAAARTLCQVA
                     SLKPAAVAPLNRDIESLVADPNRAVATAAVTTLLRTGTETSIDRLLQSVSRFLHELGD
                     DFRVTVIQAIRTLTLKYPHKHVALVRFLGEALRSEGGLRFKQATVDTLRELIERIPDC
                     RSECLSHFIELVEDCEYPMLSVQVLHMLGEWGPQAPTPSSYVRTIYNRIILESPMVRA
                     AAVSALARFASVPELASSIRMLLRQCLLDADDEVRDRAAFALELLGDHVEAAESISDA
                     SSDAESVTEYRRLQPAPLDVPLESLEKALVEYLGHDLYLHSAFDVNAARSLALKATQR
                     PGAAATACERLSSATTATAAATAVAPTAAACTATDTEGIQRSEFRGALLANETLHALG
                     YRTAPFKSSATCALTDTDAEFLVVAMKHVYPQGLVLQFRVLNTLEDQMLQECSVELDT
                     KELTSLKIRESIPASLVRYNEPSWCFVILESPDPDAELLVPDFGVVPAKLVYRVSEVD
                     PLTQEPLDAQGFPDTFTLEELELELKDYIQPLVLTDSFDNVWSEMEASAATVRETYVL
                     PHETVATAVEAVADYLAMAPCGDSLAVSSSATQHELLLAGIFLGGFRLLIRASFSKSL
                     PSGIQLALSVCSENERVSELVALCIA"
     gene            complement(<143760..>147512)
                     /locus_tag="CYME_CMP054C"
                     /db_xref="GeneID:16995985"
     mRNA            complement(<143760..>147512)
                     /locus_tag="CYME_CMP054C"
                     /product="probable tRNA splicing endonuclease positive
                     effector Sen1p"
                     /transcript_id="XM_005537694.1"
                     /db_xref="GeneID:16995985"
     CDS             complement(143760..147512)
                     /locus_tag="CYME_CMP054C"
                     /codon_start=1
                     /product="probable tRNA splicing endonuclease positive
                     effector Sen1p"
                     /protein_id="XP_005537751.1"
                     /db_xref="GeneID:16995985"
                     /translation="MTENVSLPFFWFEGTFTLDQEFPTERLRAARGEAYRCKMPLGDS
                     PVAATPARTPSNASGHTADTVANTVSLFWYRLREQNTLPTAFISTTGAPFANVNVGMR
                     AALDRILSSEPKNWPNSLTSVNAVAGACKRSSEAENLPFRNPDEYIAFFTQLVDIEVC
                     SELYNAFDSVLRTLSAALTPEKSGLVVLVSTRGDPVPVEPRGATKVSAEPVSTHDEPG
                     SSALVEVPIKIQSKETIFDHDILLLLPCTREDQRLTGAQLREIRQQPLLGIVQHRAGS
                     PLMLRMQRARAEAWLEQQQQQQQQQQRQWETARTDCSSGPLNSAIGSENAACTPPTPA
                     IRLMSTLNHARELGALSSIAEMELAPVILDPAGAAAEQQRELAPGPQRSELDAYLAVI
                     SNQRGLNRSQYEAVRASVHRQRGFALIHGPPGTGKTKTLLSLLNLLHMSKYQEYYDAY
                     LSALGSPAAQEEERPRTSCDQSTLPTAGTDSTPKPILEQLLDSVRNTTAAATAAVKLS
                     ALRTARHTAALQRKPRLLVTAQSNAAVDEIVVRIMREGFVDGKLRTYYPDIVRIGAGA
                     RVHPKARAVTAEARAEAFLQALESAKHSAEWIQHWEQQCRALLGQLETPAPPQHDLEA
                     RGRLMRLWDRLDRLQRDERRYRMATWPDQRISREQRIAWIAGTYLEEAEIVLCTLSGA
                     ALIKSWLRDAPLASEARSLPERSGESVSTLDGAFQARASTFPIVVIDEAAQATELATL
                     IPLQYGCERCVLAGDPQQLPATVFSRGDAGVALARSLMERLLQAGWTGHLLDTQYRMH
                     PAIATFPTRWFYQNQLKNDDCVRSELYRPAFHRTGPPPPLLGPYCFVDIAEATEERDA
                     TTASLSNPKEAAFAMQLVEILYERYWKASDRVWHLGILTPYRAQMRLLQQALDQSGLI
                     LPGQQMPCTIEIDTVDAFQGREKDVIIFSAVRTAQHRSGIGFVGDVRRLNVALTRAKV
                     SLVVLGHAAALRAHSADWDALLCDAEQRGLYFESSSDLVQSWLQRHRSSATASGSGSG
                     AAGSIPPRPSSTRSVSSDAMDTRDGAATPAAAASSQAPTSAARDSSTGAASTAAVAFA
                     SALDPRLQRTAAVYSIRNGSDAPISGGVSGQSTPQVQAAAIDARSFMIASLTAGFSLP
                     SVVAAAYQAFPHEADQVAQLATELAAQTGAVLAAMVTNAPQHAVETVGRARRACARRK
                     HKATGLRERTASKHGSVGNPLHQRHSGEGANGAASEAASTSTRSPR"
     gene            149040..150860
                     /locus_tag="CYME_CMP055T"
                     /db_xref="GeneID:16995972"
     misc_RNA        149040..150860
                     /locus_tag="CYME_CMP055T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461520.1"
                     /db_xref="GeneID:16995972"
     misc_feature    complement(149517..151139)
                     /note="possible transcribed region"
     gene            <150579..>152891
                     /locus_tag="CYME_CMP057C"
                     /db_xref="GeneID:16995974"
     mRNA            <150579..>152891
                     /locus_tag="CYME_CMP057C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537695.1"
                     /db_xref="GeneID:16995974"
     CDS             150579..152891
                     /locus_tag="CYME_CMP057C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537752.1"
                     /db_xref="GeneID:16995974"
                     /translation="MRADTVAFLVWSGLGPNSRQPRASSSRSLLRLQAGAASHENEPP
                     VGSREQKQSASLKYEAAKELPAGANENASPPANHKITPTNGVSPRISLQELTGRTGRL
                     LRSQRNGSAGGAPAACWDQGAAKVPSAPAAAAWLAKRRAILQEPVSVSALVEDVIPGG
                     VRHNGTNQVRNHAMDENAASRANCSQHEAPTAAAAYRESLSGSVVVQNSPFREVVVIF
                     GKRLVRDQITYEYAVRILTLVRHMVTGRIKPSAVCFTGGRDHPDSLVSEAVAGYLFFR
                     HVCEEFSISLDSVAIILEEQHLNARDCMSSILTQLGEQLVGSHFTFVSSDYHLIRIRE
                     VEAAAPNLSLLAPLRKLRGTVSYAYTTYPFALSKNAAVALAGRAIVIAAELGIMIVAL
                     RSYIEERGLFQRDVFRRFQEATIELGNLCEKCSAALQVQIPTASSTTDDIVFTQDIRL
                     VGEVIESAYFELRQVIRVLEQWVLEKSPLSRMELQNILQQITIVEQRIRSSLDPDRPL
                     TAMEWNHLPLVFLAPVLGPGFEQHSLSGDPGTQPWIPTSPAGATPAPTTATVTSSVHG
                     STIAPATAAYATSRTESALSSAPAANRNATTTDSSWESSSFVSPSSSMTTSAAVAAEH
                     AAAAAAWHLRKPSASPLNGAGARLRHFASIVAEASQAIFHEVLRPENHEEKARRISEE
                     NRRRRRQAAAESGPGLSPAKLRAHRESHAASGTANRRSARTTAASRPANGHVPNGTSA
                     YHEPKPPASGRETDADTTTSDRFTDKRTAT"
     gene            complement(<153002..>153418)
                     /locus_tag="CYME_CMP058C"
                     /db_xref="GeneID:16995969"
     mRNA            complement(<153002..>153418)
                     /locus_tag="CYME_CMP058C"
                     /product="similar to ferredoxin-thioredoxin reductase,
                     variable chain"
                     /transcript_id="XM_005537696.1"
                     /db_xref="GeneID:16995969"
     CDS             complement(153002..153418)
                     /locus_tag="CYME_CMP058C"
                     /codon_start=1
                     /product="similar to ferredoxin-thioredoxin reductase,
                     variable chain"
                     /protein_id="XP_005537753.1"
                     /db_xref="GeneID:16995969"
                     /translation="MMRRACFLAGPYAPRTRDRTSSSCLWHKDRLARMPVSRRGTELW
                     RTAARAPRLCLSAERRGDFKVGDRVRVTQSVIMYHTPMSKGQPHDVRGLEGVVTKFVD
                     EYQGVPISATRPIQVMLEGSKKFIAHFEASELEKVA"
     misc_feature    153718..154563
                     /note="possible transcribed region"
     misc_feature    154705..156699
                     /note="repetitive element"
     gene            complement(<158019..>159029)
                     /locus_tag="CYME_CMP061C"
                     /db_xref="GeneID:16995971"
     mRNA            complement(<158019..>159029)
                     /locus_tag="CYME_CMP061C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537697.1"
                     /db_xref="GeneID:16995971"
     CDS             complement(158019..159029)
                     /locus_tag="CYME_CMP061C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537754.1"
                     /db_xref="GeneID:16995971"
                     /translation="MRLQRQKRQEKHVKFYATRFGYRPPFRVILDSAFLGELVQRRSS
                     KALPSLFIRVFGKNQVRTLVTTCTMRAISRKIKIADRENQTGKVPHSTGGGAEVQRSS
                     AEQKRVGDHWRRVSWLARQLELLPCGHPKHKELDPGQEHFEADCIQACVERGPETAQQ
                     AGLTRSRGRFAVAALDSTLRSRLKATAGTMLLQLAVFSGGLHVQIEPPSTACLQEARE
                     QHQRVYAATPAEVAAAHEAQRALQQSSSPAASGYRLSLAKVNEPAAASELQVRTGELG
                     TNPDASRALPDSANVARVSRPKRTTKLPWMDAKTNITKAFKRNKSRGPNPLSRRKPQR
                     KT"
     gene            <159235..>160086
                     /locus_tag="CYME_CMP062C"
                     /db_xref="GeneID:16995962"
     mRNA            <159235..>160086
                     /locus_tag="CYME_CMP062C"
                     /product="similar to TGF beta receptor associated
                     protein-1"
                     /transcript_id="XM_005537698.1"
                     /db_xref="GeneID:16995962"
     CDS             159235..160086
                     /locus_tag="CYME_CMP062C"
                     /codon_start=1
                     /product="similar to TGF beta receptor associated
                     protein-1"
                     /protein_id="XP_005537755.1"
                     /db_xref="GeneID:16995962"
                     /translation="MSEQTPLLSQRSPEGVPEGAGTRAAPGRAASAQITGGLDYDFEE
                     DDLEAGSDDENPEHAQHMWPKTGPNSTGSSFVERAAQTVTDFVLGERSRTPIAGTSST
                     PPEHSTQLTRDTDEDDRRDDGDAGAKKKKKKSKRKERDVDDIEACPYDTIESARKPVK
                     GDDLKTHMANERTFFKWLFTGFHIGAMGTFILSFYSDDSGRPGTGKILLCLAIWMVAL
                     VYVMYGLINFYRRRRALRQGLGKEEWDSGAGPAYVVAGLVLVIGSVLVYSLVTGQAPR
                     RWQQAQT"
     misc_feature    160666..162228
                     /note="possible transcribed region"
     gene            complement(<161231..>162325)
                     /locus_tag="CYME_CMP064C"
                     /db_xref="GeneID:16995964"
     mRNA            complement(<161231..>162325)
                     /locus_tag="CYME_CMP064C"
                     /product="similar to solute carrier protein"
                     /transcript_id="XM_005537699.1"
                     /db_xref="GeneID:16995964"
     CDS             complement(161231..162325)
                     /locus_tag="CYME_CMP064C"
                     /codon_start=1
                     /product="similar to solute carrier protein"
                     /protein_id="XP_005537756.1"
                     /db_xref="GeneID:16995964"
                     /translation="MSSKENKNAFTKTTGTVIAVSAGAATTTGVDALSQLTFTEKLLA
                     GSSARGVAQTLLHPIDVVRTRLQARGVRRDWSPRVFIKGVIPQVVLAVPAGGVQFVAY
                     EWCKQRLTELLLPPASHTKQASTKVTSSGRNHAWRQVVVDLVSGAAGAFAASFIRVPQ
                     EVLKQRIQADLYPHIGVALPTILQKEGFGGLYRGYWATVSRDVPWNALSFLFFLQESR
                     LFERIQKRAPNRQENLVLAAIGGATAALMLTPVDVVKTRLMTQGADGTYRGILPTFRR
                     IIAEEGPATLMKGSVPRVMYLAPLAAITLTIYNAIGRKLLEARKRRVVTLAPRFRGIG
                     HGYQVACAKRSLFVFERNLPQCSAQVSYTL"
     gene            <165409..>167757
                     /locus_tag="CYME_CMP065C"
                     /db_xref="GeneID:16995959"
     mRNA            <165409..>167757
                     /locus_tag="CYME_CMP065C"
                     /product="DNA excision repair protein ERCC2/XPD"
                     /transcript_id="XM_005537700.1"
                     /db_xref="GeneID:16995959"
     CDS             165409..167757
                     /locus_tag="CYME_CMP065C"
                     /codon_start=1
                     /product="DNA excision repair protein ERCC2/XPD"
                     /protein_id="XP_005537757.1"
                     /db_xref="GeneID:16995959"
                     /translation="MIFNVENVKVYFPYDYVYPEQYAYMRELKRALDSNGHCILEMPT
                     GTGKTVTLLSFITSYQLAHREVRKLIYCTRTVGELEKVLSELEVVIRYRDAQLEKAGK
                     RDQAAAVLAVGLTTRRNLCLQSAVSKAESREEADSLCRSLTASWVRESHSAAIARFEK
                     NPDLEDLPTTLCQFYEGYRREGNDAILPSGIYTLEKVLQIGRERGWCPYYTVRHTMNF
                     ANVIVYNYQYLLDPKIAGLISRELSRECIVVFDEAHNIDNVCIDALSVSLRLDDLRRA
                     QANVVSLRNRIQEIRTHDERRLLEEYRRILQGIRRPADVDAFTIEASPVIPEDVLQET
                     IPGNIRRGEHFLLFLLRLIDFFRQRMRSTQVTQDTPRNFLHALMPSVQIPDSKPLRFC
                     SDRLASLLQTLEISNVRDFVSLQKLAHFATLLGTYSQGFSVIMEPYDERAPNVPDPVL
                     QLSCLDASIGMRPIFTRFQSVILTSGTISPLDLYARILGFRPAVAHSLNISLHRASIC
                     PMVIARGSDQIAISSKYDSRRDPSVIRNYGALLVELASVVPDGVVGFFTSYIYLESVV
                     QMWHQMGIIQKLLEHKLVFIETPDIFESSVALENYRRACDSGRGAIFLCVARGKVAEG
                     IDFDRHYGRCVVIIGVPFQYTESRVLRARLEFLREHLQIREGDFLTFDAMRQAAQCMG
                     RVIRSKVDYGLMILADRRYNRAQNRSKLPLWIQSHLDEGKVDLSTDMALGIIQEFLIR
                     MAQPLDRKEMIGTTLLREIDLQAPGDTSFSETASPIALMGSA"
     gene            complement(<169876..>170838)
                     /locus_tag="CYME_CMP066C"
                     /db_xref="GeneID:16995960"
     mRNA            complement(<169876..>170838)
                     /locus_tag="CYME_CMP066C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537701.1"
                     /db_xref="GeneID:16995960"
     CDS             complement(169876..170838)
                     /locus_tag="CYME_CMP066C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537758.1"
                     /db_xref="GeneID:16995960"
                     /translation="MICSAVGVSLLVYWACALSLTVGKIWSTRLDAWTRYGGLRHSED
                     DTLDQRKTQRRWGTLSRAQTFRAFYLVAFIWNGALLYHTRLANLCRYSARREQVSCSC
                     ATAYGWVATLFQVHTLRRLGESYFIHSFTEQKLPLVLTAAGLSFYVSLPILWVWGRSC
                     CHHHGQCLSDLDLLPALHMRKQSTIPLTLLLICFSAANFAQFWAHYELARVRKAHKRP
                     RSHYAVHDAVSCSPKYAIVTRGLFRWSTCPHYLAEILIYGILIGYLVVSGCVGLCAAL
                     PGMVMLFVATNLGHTAVLSKECLRRRYPLVEFVQKRPALVPCLL"
     gene            <171078..>171830
                     /locus_tag="CYME_CMP067C"
                     /db_xref="GeneID:16995961"
     mRNA            <171078..>171830
                     /locus_tag="CYME_CMP067C"
                     /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
                     N-acyltransferase"
                     /transcript_id="XM_005537702.1"
                     /db_xref="GeneID:16995961"
     CDS             171078..171830
                     /locus_tag="CYME_CMP067C"
                     /codon_start=1
                     /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
                     N-acyltransferase"
                     /protein_id="XP_005537759.1"
                     /db_xref="GeneID:16995961"
                     /translation="MEGEYRLTRSYAVVDITAQVDDSAILEPFACVMARARIGPRTRV
                     GAHSVVGVGVSVGADCCIYHHVTLLNCDIGDRCVIHSGVAIGQDGFGFEVDQQTGKVR
                     KKPQELSVRIGNEVEIGANTCIDRGSWRDTLIEDAVKIDNLVQIGHNVQVGANTFICG
                     QAGVAGSTKIGRYCRFGGRSGAVDHLEIGDHVDVAANSVLTRNAPGHAVYAGFPAMPM
                     REWRHQQVTLRRLSRAGKRQVDVSADDPEFPK"
     gene            complement(<171889..>172899)
                     /locus_tag="CYME_CMP068C"
                     /db_xref="GeneID:16995989"
     mRNA            complement(<171889..>172899)
                     /locus_tag="CYME_CMP068C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537703.1"
                     /db_xref="GeneID:16995989"
     CDS             complement(171889..172899)
                     /locus_tag="CYME_CMP068C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537760.1"
                     /db_xref="GeneID:16995989"
                     /translation="MRSASSSFLPGLAAAFERELLKDQGFVVLRGFLEPSTVQALGEE
                     ALFTLQYEADSVTHTGVAGHGGVIACYEALPASTISAADYITNFRLNPNADSTEVLSV
                     SRRLAALAAEALACCFGYTALTEVFLYNEQFICKPPTQTIYSAFDIHRDRDYDVEDKF
                     ASVVGTVAVWAPVSGTVSRLNGALCMVPRTHEAAFLAFLERLGGSASRPSAFVTEALC
                     KALMTSAEAPVAASQASLLMLSPGDVVVFADDVWHWSLPYRLESGGQVPECPQAPRAS
                     VLQSRVAWMAQYSGDVIRSRRRGGSPAALAVRLPLGCGESPLPGRNEDGSSQHHCTNV
                     QT"
     gene            <173389..>174570
                     /locus_tag="CYME_CMP069C"
                     /db_xref="GeneID:16995990"
     mRNA            <173389..>174570
                     /locus_tag="CYME_CMP069C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005537704.1"
                     /db_xref="GeneID:16995990"
     CDS             173389..174570
                     /locus_tag="CYME_CMP069C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005537761.1"
                     /db_xref="GeneID:16995990"
                     /translation="MTADNACTGREPSDSRQERDSQARASRPRMQGRFTDRELEQLED
                     GLRAVCTELGLPATPQQFSELATRPRAVRRACAHQLPGSEVLLRNWGGIWKRVATFVP
                     GRSWRQVYDTARRRYAGNNYLGDWTEEQLALLERAVEQHGPCWSKVAEEVGRFASSCR
                     DKWRQSFESRGRLRGRWSPDERRRLLEAMRKYGEAPAAASEFGNVTTRPDQLDGTTDP
                     RTMDVLEGNGKPAVSRKRGRSSAYTESEGFWTRIAIYVGTRSEFQCRCEWQRHMDPRR
                     ISRRGSAHRAASLNLQFLGVLEKFVTPDGTRRVPRDVSEIKWGEVHPDLNAYRCYLWW
                     RQLLQRFYPESPLLSNDMQARRNASLLETIREVRLRILQHYPESAEAGEVRAVDTLER
                     A"
     gene            complement(<174974..>175948)
                     /locus_tag="CYME_CMP070C"
                     /db_xref="GeneID:16995994"
     mRNA            complement(<174974..>175948)
                     /locus_tag="CYME_CMP070C"
                     /product="stress-inducible pyridoxine biosynthesis protein
                     SOR"
                     /transcript_id="XM_005537705.1"
                     /db_xref="GeneID:16995994"
     CDS             complement(174974..175948)
                     /locus_tag="CYME_CMP070C"
                     /codon_start=1
                     /product="stress-inducible pyridoxine biosynthesis protein
                     SOR"
                     /protein_id="XP_005537762.1"
                     /db_xref="GeneID:16995994"
                     /translation="MNSHVDGASFAETERAVNGGSEWSHLNGDVHASTFAVKVGLAQM
                     LKGGVIMDVVTPEQARIAENAGACAVMALERIPADIRAQGQVARMSDPGLIKRIKAAV
                     SIPVMAKARIGHFVEAQILEALGVDYIDESEVLTPADDLHHINKHKFRVPFVCGCRNL
                     GEALRRIQEGAAFIRTKGEAGTGNVVEAVRHARQVVGEIRRLQTMDDDELFTYAKEIG
                     ASYALVKRTKEMGRLPVVQFAAGGVATPADAALMMQLGMDGVFVGSGIFKSADPEKRA
                     RAIVKAVANYNDPKILAEVSEDLGDAMVGIEMDKLVQKWAADSRHKAQ"
     misc_feature    complement(179240..180562)
                     /note="possible transcribed region"
     gene            <180399..>182729
                     /locus_tag="CYME_CMP072C"
                     /db_xref="GeneID:16995996"
     mRNA            <180399..>182729
                     /locus_tag="CYME_CMP072C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537706.1"
                     /db_xref="GeneID:16995996"
     CDS             180399..182729
                     /locus_tag="CYME_CMP072C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537763.1"
                     /db_xref="GeneID:16995996"
                     /translation="MNHESVVQERECDPPEQISRDRANAVGSEGGVRWLPTWFQSFGR
                     SGRNAARASPTSDFIGTADANCSAATWFYVYFMSIATVLGTGVLGLPVSLYRCGIAPF
                     LVFFTVTVVAEACAVVVAVELLQRTQASLALERRTHTDHAQDGFRRYHGTQYRAGGSP
                     ENDHMPPSSTIPKHRLEHDRMEYYDTTEETRSRSTSTVSQELSAARRASPTDQTILTL
                     SPAVERNAAYPPYATVRALEPDRTGALASSPNRSEEAVDTAPCNRDTQHTTPSLSAMA
                     LAFLQKRWLRLLFQAAVYLHFISIMISYGLAGPQAYVALFRPSLRRLSKQTLMNAFIA
                     PRWSIALFCAVGTALLIFCLGAVLPVLTIATGIKATLLVVIVLVVGVFGAEIANPWRN
                     QWSAFLEPFLMGTVALGGLTTVMPVTYARLGEQPSASGVRRYRAAVIAGLITCYFLNI
                     VWCVSVLAVVPQATPDAPSQGSEGVVVSLEAANALGEISTVPLIAALEQHRAQAAPAV
                     AVLVNIFITVSITVSFLVIGSGLRHMIDGVVASWARMPGAFHQTAEQGAKNQTLNEDG
                     VLESQTLSTFAGDGPAAVAGVRFVSEKPARVSEEATSVGAHLPSQHGKSWEHDSFPVE
                     SGDGDQGQWGSPTVPHSSAPLNRVVDNMVDGSVSSSAGIASNGQRTRPGAKTLRYALY
                     VLFYGFIALVAVMNPRGFLAVMEGFASLGLNLACGFFIALMLFFARNQPQRNIPAPLD
                     PSLLQWICFLCFGFFGLASALDAAWWLPRRLLAALF"
     gene            complement(181258..183025)
                     /locus_tag="CYME_CMP073T"
                     /db_xref="GeneID:16995986"
     misc_RNA        complement(181258..183025)
                     /locus_tag="CYME_CMP073T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461521.1"
                     /db_xref="GeneID:16995986"
     misc_feature    183257..184359
                     /note="possible transcribed region"
     gene            complement(<183749..>185107)
                     /locus_tag="CYME_CMP074C"
                     /db_xref="GeneID:16995966"
     mRNA            complement(<183749..>185107)
                     /locus_tag="CYME_CMP074C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537707.1"
                     /db_xref="GeneID:16995966"
     CDS             complement(183749..185107)
                     /locus_tag="CYME_CMP074C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537764.1"
                     /db_xref="GeneID:16995966"
                     /translation="MSESENKENLSGQAASAASSELGRAFPSKVFTDQALAPLTDTQQ
                     ALGERKVDDDAACLAKQGQTPAEKLVVWEAIDALPRNTFVLLSVLSIFPDDEKLVQAS
                     LTQLLELSVQIGANQAGAYNAAVPEEQVSRAPTTPSTAALGLLRARPCIIALVETLFE
                     SWSGKNERIPRLLCGFIFDLSTVDAGREALAARSRLLELLCEAVTTASAVLRHPLPAT
                     SDPSARNDDQLYSLYYALGALGNIAVAGALTQMVLQRQIDQFYLCVRDRVAELSGVFE
                     ESQREVHYASSLVHLVLIVKILREALRLLLNLMYHAGAQAVPRHVQSGLIDALEQIRS
                     WHVGDTSIMSLGLESTASLEDATVSKASMPPVLWQAAARMMPLVSRLHRLVVELQGQT
                     IITEAVDAAIDTTAREPSTIPVSGVDQEESAPGVWGAPILFITIFLGAAVHVGAHVLR
                     DR"
     gene            complement(<185913..>187748)
                     /locus_tag="CYME_CMP075C"
                     /db_xref="GeneID:16995988"
     mRNA            complement(<185913..>187748)
                     /locus_tag="CYME_CMP075C"
                     /product="protein phosphatase 5"
                     /transcript_id="XM_005537708.1"
                     /db_xref="GeneID:16995988"
     CDS             complement(185913..187748)
                     /locus_tag="CYME_CMP075C"
                     /codon_start=1
                     /product="protein phosphatase 5"
                     /protein_id="XP_005537765.1"
                     /db_xref="GeneID:16995988"
                     /translation="MRGTEDLNRLEDRLPEILEKVNKLKEDANEAFKGCRFQHAAQLY
                     TEAIRVITTEALSCESESQAVALLSEGLYENEHAEPTDSATANGQVNGSSAAKSADES
                     SPAETLRFLLVVLFANRAFTHLKVEAHGFAIKDAGLAIKLAKKPYPKAFYRRGAAYFA
                     LGKYKLALADFRKAAAAAPTDKDVRLKIRECERRLREEAFSAAIDSSRDTPASLCRNI
                     DVSGIVVEDSYDGPRLVATHESNSGRIAAGDGSVTQRFCSDLLGHFRAQKRLHRKYLL
                     QIIGAAYDLLRGYPNIVKLKLDSHDGSTDASATNAQQHRDSFTRPIPPAAADSNSFVT
                     SSPVHVVPQLTVCGDTHGQFFDLVRIFELNGLPSAENPYLFNGDFVDRGSWSVEVVTT
                     LLAFMVYDPRCMHLTRGNHESRNMNKIYGFEGEVRHKYSEHFFELFEELFQALPLGYL
                     IEGANQKRALVVHGGLFSRNGVKLDDLLRLDRFVEPPSTGLFAELLWSDPQKEHGWGP
                     SKRGVGVAFGPDVTKRFLDDNQLELLIRSHEMKDDGYEVEADGRLITIFSAPNYCDQM
                     GNRGAFIRLKPDMKPEIVPFEAAEHPADVRPMMYASGGGGLFGLV"
     misc_feature    187277..188965
                     /note="possible transcribed region"
     gene            complement(<188799..>189869)
                     /locus_tag="CYME_CMP077C"
                     /db_xref="GeneID:16995981"
     mRNA            complement(<188799..>189869)
                     /locus_tag="CYME_CMP077C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537709.1"
                     /db_xref="GeneID:16995981"
     CDS             complement(188799..189869)
                     /locus_tag="CYME_CMP077C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537766.1"
                     /db_xref="GeneID:16995981"
                     /translation="MTGRKSVRRLLVIFCSCLVGFSAVLTIWRQSFFFSVRSGKAFIA
                     GPKQLQARAEPAARAPMLCFGAEFEHHGFTTRLLASIDEPVKHVVVVLAGEDPSILEL
                     EQTIRQDYPFCTIIRKKQRIGNVGIWNTCMRYMLDVAKVPWALLLNNDIMMPPGSLGN
                     VSVEAQRVVQNPEFCLGPTKLRNVRKMLWSALVVSRRTAQIAGFFDENIFPAYYEDNE
                     FSIRIRKIHESGTPCRLFPVRVRNTFHHGPADSPDYISGTVIYYNGGGDRSKKVIQDR
                     ANAWNPHYVALKWDCPLYLWEKCKNMHPFGRSDLSPKDWAFDPGYRHCLETGESGGQF
                     GCRYNVSVLPREPASSQISRVS"
     gene            <192737..>195070
                     /locus_tag="CYME_CMP078C"
                     /db_xref="GeneID:16995982"
     mRNA            <192737..>195070
                     /locus_tag="CYME_CMP078C"
                     /product="probable beta-galactosidase"
                     /transcript_id="XM_005537710.1"
                     /db_xref="GeneID:16995982"
     CDS             192737..195070
                     /locus_tag="CYME_CMP078C"
                     /codon_start=1
                     /product="probable beta-galactosidase"
                     /protein_id="XP_005537767.1"
                     /db_xref="GeneID:16995982"
                     /translation="MSWNSERREITYDSRSLRINGKPFFCLSGAVHYVRSHPSAWPQI
                     FRCMRRDGLNTVETYVFWGDHEFEPPEMPDAEPRADFSGPRDLVRFLRCAKLHGLNAI
                     LRLGPYVCAEVNYGGFPWWLRQVCEKGSSKPVRFRTWDPAYCAQVERWLKYLVDHVLK
                     PARVFAPQGGPVILAQIENEYAMIAESYGPDGQQYLDWIASLANQLALGVPLVMCYGA
                     SQRESGRVIETINAFYAHEHVESLRRAQGANPQPLLWTECWTGWYDVWGAPHHRRDAA
                     DLAYAVLRFLAAGGAGINYYMYFGGTNWRRENTMYLQATSYDYDAPLNEYVMETTKSR
                     HLRRLHESIQPFLSDRDGVLDMSRLELKVFEGERRAILYERSTVSGDADHRSEESVRC
                     VFDSADIRVHLALELREIIVNAASRDTGQDLRWRMLPEPPPLRAALSDTSATLATIPD
                     LVDATAGTSDYAWYILRCPTAQGSGLLQLEVADFGRVWRRKAVDQGDDAERQPLEWAA
                     AGPEPPVEDRFPNAWNSTEYGYGIVEVGAIDCHEEYVVLVSSLGMVKGDWQLPPGYGM
                     ARERKGLLRASYRSDVTFADDEWRDALVVGFAAGLRGERIRSVIEGDADAYPYLWTPQ
                     KAALSGRRFSWPRWYRASLAIPPPNADETEGIILDLYESGVEKGWIYMNGEPCGRHWR
                     VHGTMPKNGFLRQGDQEAPIEQVGHGQPTQRYFYIPPWHLHAKGRPSTLVIFDEHANG
                     EYREFEPHRLRVYRAVLRVVESTPTSDNESKSEAFIV"
     gene            <196538..>197668
                     /locus_tag="CYME_CMP080C"
                     /db_xref="GeneID:16995991"
     mRNA            <196538..>197668
                     /locus_tag="CYME_CMP080C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537711.1"
                     /db_xref="GeneID:16995991"
     CDS             196538..197668
                     /locus_tag="CYME_CMP080C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537768.1"
                     /db_xref="GeneID:16995991"
                     /translation="MSSDSGSNTIRCGHAVTCDPAVKRVPFEVAFAVTPLGWTRSAKL
                     GSAVTEERALSSRLVSRYWQVARSSLTAPNSDTKVRASSLRVRWFMSSTQQDCSESVN
                     RVANLRTESHVLSDRGEKDNLQLPLDTSFSASSSDPGSALHGELPRSPRLARLVPLEV
                     QLFLLALLPSGVRSRSQYARRVSQRVARLRYILRQRKWNRTGTRSSESDHPFESNQMQ
                     ISVSLHPRSPRSGSTTPDDLAVMPSSREQLERIWERASPMQQSVERPNPEHHEVNDSA
                     TVWEMGERALSFLLQTRRRRLLMYALLLTMILAPARAEGLARWAGELGIRPLAIRHPI
                     FAVLSVLLDMYQELVGSNLIPDDSHWSLIAHVVEVVLLMVAM"
     misc_feature    complement(196622..197288)
                     /note="possible transcribed region"
     gene            complement(<198429..>199205)
                     /locus_tag="CYME_CMP081C"
                     /db_xref="GeneID:16995992"
     mRNA            complement(<198429..>199205)
                     /locus_tag="CYME_CMP081C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537712.1"
                     /db_xref="GeneID:16995992"
     CDS             complement(198429..199205)
                     /locus_tag="CYME_CMP081C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537769.1"
                     /db_xref="GeneID:16995992"
                     /translation="MRATACVKGYLGFLLAPRLTTTRPVSQGLVRGRRTASVRSEART
                     ARRVSRGTRLPSARSTFQQLQMVRTESAMVELGTVMPAFALPDVTTGEIVSLDSLYAD
                     SPPPKALVVVFLAAHCPFVKHIAGELSRLSADISSGKFGPVKMVGISSNFVGTHPDDA
                     PERMAEEIKTRRYQFPILYDETQDVARGWKAACTPDFYLLDHERKLFYRGRLDGSRPG
                     NDIPVTGEDLRNAIQLCVNGQSPPENQLPSIGCSIKWKPS"
     misc_feature    complement(199246..202440)
                     /note="repetitive element"
     gene            <202874..>204241
                     /locus_tag="CYME_CMP083C"
                     /db_xref="GeneID:16996014"
     mRNA            <202874..>204241
                     /locus_tag="CYME_CMP083C"
                     /product="uroporphyrinogen decarboxylase"
                     /transcript_id="XM_005537713.1"
                     /db_xref="GeneID:16996014"
     CDS             202874..204241
                     /locus_tag="CYME_CMP083C"
                     /codon_start=1
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="XP_005537770.1"
                     /db_xref="GeneID:16996014"
                     /translation="MFQFAVLKLTRTPRCAGHTAPRSLQAASGAKFRLRSERLRYHVA
                     SLALRAALDTDYEGCLSESSVVETCNEAPLLLRVLRCDPSVPRPPVWFMRQAGRYMSA
                     FRMYSGRYAFRERAETPEIAVELSLQPWRAFGVDAVIMFADILTPLPPMGLDYQIVSG
                     QGPSIKTPVRCMEDVELVRPLTPEDTETALSFVGTTLSTLAHTLADARPRPALLGFLG
                     APFTLAAYGIEGEGGRASSGKQVKRMMYTAEGRELMHRLLQKITQSMIVFAAYQARKG
                     AEAIQIFDSWAHLLSPEDYQEFSLFYVEELVRGIRAHGVETPLIFFANGSCGKLGVIS
                     AMYPADTREANGYRGLDALALDWRTSIAEARQLFGKRAVLQGNIDPTVLACGDTASVK
                     AAIDRCVCAASGGAHILNVGRGIQPDTPEEMVALFCEHVRALPETDWYQQLRHRHLVE
                     NGVPG"
     gene            <205770..>207143
                     /locus_tag="CYME_CMP084C"
                     /db_xref="GeneID:16996015"
     mRNA            <205770..>207143
                     /locus_tag="CYME_CMP084C"
                     /product="mitochondrial phosphate translocator MIR1"
                     /transcript_id="XM_005537714.1"
                     /db_xref="GeneID:16996015"
     CDS             205770..207143
                     /locus_tag="CYME_CMP084C"
                     /codon_start=1
                     /product="mitochondrial phosphate translocator MIR1"
                     /protein_id="XP_005537771.1"
                     /db_xref="GeneID:16996015"
                     /translation="MSIGSASSFLVQRISLTMRQQLASFLGLLLLWRGRSFLVRRAVK
                     RSPHLHQPAVVLFVLCNVILGWSLLASLGVDWARFLKLFAAGGSCAVLMHVLTTPVDV
                     VRTKMQLEPERYPSVLACVSRIINEDGPFMFLQGFGATALGYLIHGGLKYAVYEQLRT
                     LTMVLTRTPAGQPLSSLHFVTSATVAELVASTALCPLESVRIRMVQDRTFARDVWQGL
                     AQVWAEGSRSMYKGLMPLIAKQCPYTLAQFWTYEWLLAGLRATWIGRNAPLDAQLPVS
                     LERRLSLLAGLLSGIAAAFASQPGDTILSRINKHHAGLAGLMLTEIGQALSTPPGAET
                     DANIRSPSASLSPTVADKNRKQMQPNEIPMRADQGSASNMKRFLFERFRLRSATCMWL
                     DSIRQSWMDMWTIARELGPRGMFLGFVPRCAQVMILVSGQFLFYAEIKAFFGIPETLG
                     RGSTHRP"
     gene            complement(<208645..>210072)
                     /locus_tag="CYME_CMP085C"
                     /db_xref="GeneID:16996016"
     mRNA            complement(<208645..>210072)
                     /locus_tag="CYME_CMP085C"
                     /product="similar to phosphoserine phosphatase"
                     /transcript_id="XM_005537715.1"
                     /db_xref="GeneID:16996016"
     CDS             complement(208645..210072)
                     /locus_tag="CYME_CMP085C"
                     /codon_start=1
                     /product="similar to phosphoserine phosphatase"
                     /protein_id="XP_005537772.1"
                     /db_xref="GeneID:16996016"
                     /translation="MSPSRSSPRKRPKERGSTHSKRLLVITLHGAVQPSWLSRFLSLL
                     AQAGDVVQLRDLSSFTVGNRFTATLAVEVTPTQLRKRRSTETGTEAMSTESTSGSAPQ
                     SFGVGSPAEPGGTLSSTEAHIEHEFGIEGYLLREFLLTAYELGGIETEFEVLDSLEAE
                     SNAALEGDSGEPYTFTFIGTPRIPADFLATATHVLAENGINLNAIQSLNEPGGRSTCF
                     QVMAALRGPLADRVRSELLHLGKEFLVDIAFERAGALRTKRMVVFDLSWTLVQADSFE
                     LLCQAAAVDADAVAEVRRCHSLGSEDYLRACAALLRGRSSTGLAERLHALIEYTDGAA
                     SVCRVLKKLGYRTAVLSSGPLLLAELVKADLGIDFVAANRLETDSNERFTGAILEPLV
                     NGERKAELLTMLAMREQLSPEQIIAVGDGPVSAKMLDSAGLSIAFEQPGARDGTNIGG
                     KIQSKSLTSILFLLGIHERDLRSFS"
     gene            complement(<210894..>211361)
                     /locus_tag="CYME_CMP086C"
                     /db_xref="GeneID:16996005"
     mRNA            complement(<210894..>211361)
                     /locus_tag="CYME_CMP086C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537716.1"
                     /db_xref="GeneID:16996005"
     CDS             complement(210894..211361)
                     /locus_tag="CYME_CMP086C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537773.1"
                     /db_xref="GeneID:16996005"
                     /translation="MYGFVSVLPVASALQRQQCTCAARCSFTTRAARVAPVRIALSRP
                     QRLVGASSLRMFEVSDGEPYPLNPAVIFIALIGWSAVAAIPSNIPVLGGTGLTQAFLA
                     SIQRLLAQYPTGPKLDDPFWFYLIVYHVGLFALLIFGQIGYAGYAKGTYNRSA"
     gene            <212089..>214017
                     /locus_tag="CYME_CMP087C"
                     /db_xref="GeneID:16996006"
     mRNA            <212089..>214017
                     /locus_tag="CYME_CMP087C"
                     /product="probable dehydrogenase"
                     /transcript_id="XM_005537717.1"
                     /db_xref="GeneID:16996006"
     CDS             212089..214017
                     /locus_tag="CYME_CMP087C"
                     /codon_start=1
                     /product="probable dehydrogenase"
                     /protein_id="XP_005537774.1"
                     /db_xref="GeneID:16996006"
                     /translation="MRSRYCFLLSSTPCKYAGQRSPFPASALAGVCAGGRLRNVTRNL
                     RPGLRTLRASAETEHSQGTRQAQYDFIIVGAGAAGCVLANRLSTAQFSNGDRRYPRVL
                     LLEAGDALAEAPYFEHIPLGFPQLIGSRLDYGFFSRENPTHLGGRGAVYLPRGRGEGG
                     SHAISVMLVHRGSRHDYETWVKDYEALGWGPDDVLPYFKRLESNERTAQRGADGEAAT
                     ALHGSDGPLRVSDQRSPNPLSLAFIEACLERGIRRNKDFNDWDHGQEGAGLFQVTQRD
                     GRRESPATAYLQPVRSRRNLHIETNALAEHLVWSKDGRRVEGIRFIDRHGRRRAALAH
                     CEVILAAGAINTPQLLMLSGLGPGAHLQDFGIPVVRDLPGVGQNLQDHAAVMLSYYAP
                     DPYGKDRDKKRIFYTERLGKDPLVLAEYFLLGRGPLTSPVCEAGAFVHTQAVIGEPSC
                     DLQLRFVPFFSDADPYKSLGEYRSGGHVLTNTSIRPAGFGLQAVAIRPRSRGRIELAT
                     IDPRARPIIHTGWLEDKRDLQTLLSGLKLGREILSGDSMRPYRGREAFPETLEDDLVT
                     YIRRTCHTANAIVGTARMGTGRDAVVDPELRVHGVERLRVIDASVMPKIIGGQTGVPT
                     MMIAERGADLVKKTWKLV"
     gene            <216037..>216900
                     /locus_tag="CYME_CMP088C"
                     /db_xref="GeneID:16996007"
     mRNA            <216037..>216900
                     /locus_tag="CYME_CMP088C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537718.1"
                     /db_xref="GeneID:16996007"
     CDS             216037..216900
                     /locus_tag="CYME_CMP088C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537775.1"
                     /db_xref="GeneID:16996007"
                     /translation="MFPLVMQRQLLEANMAHGLSFCFVAAFGSGKTRTWRQQQLDQRC
                     RPQHRRPQLAVTATLLERELIAGSARGAALETFKLFFRCQPGRWRSERCYFYRETADV
                     ADRGGESVERSETLFQVEPLTAETTTKVLRDNGTDESKLISEGFHSLEYAAGFKVSFN
                     TRMEHSGDVSASTNLLFVPQVLDVQLARQLGLVRGLYFRDKGYEEDRPIVGQFEFHVT
                     TRELVMVTAYARTVSVDRILLCSERQRLRQIANYRRPEAWQRDAPLDRNRSLLTEVRL
                     LGAGIEDRLPD"
     misc_feature    complement(216295..217198)
                     /note="possible transcribed region"
     gene            <217604..>219295
                     /locus_tag="CYME_CMP089C"
                     /db_xref="GeneID:16995967"
     mRNA            <217604..>219295
                     /locus_tag="CYME_CMP089C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537719.1"
                     /db_xref="GeneID:16995967"
     CDS             217604..219295
                     /locus_tag="CYME_CMP089C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537776.1"
                     /db_xref="GeneID:16995967"
                     /translation="MVREPTFVPCHLKSARTRFVHACALGVCERATTRHGAQLSIRKA
                     RVSGHSAPATHLRHRGGTRDLVARSFGEPPFEGDLDSERDWKAAANYDAPAPSAVSPC
                     FPLLDWQVPSLRAAEERWLAEEVRLWLDREWEPLAAHREIGEKAAKAALDARMALEGS
                     GRTAKFGEVLITVASELERGPNHQVGRDSWREAYVNPFDVANKVSDLYMVRYFVETEL
                     TAPAEDESDATDIDSSWTALPLSDTCRCTCLDYEDILAIQKRARDLGLSVGRIAYDKS
                     RLGGQAQVRKNRTDTGASPTGSSVYERSYAADHVDKTIQSFDDVMYRERVLYEALRTK
                     RLVQERGLYGDFALGCNEEYVKAAFPSDKVWGWDPDPHQQSDARPPSMPIESTPFDGI
                     VGSIRDVHPFDRHVFFMGTLYGDIPSVVVNRVVSETARLANHTMLLHHDFDVEALLRG
                     VDGTDAIVDQLNGLSVEVAFRALRPAPAAATSQGDSAAAEAHMAGTQSDAGTHAADAD
                     ADAELRMQIQRDLDLLIETLYGEVAAQVALQEKDRSFRVRSAIVRYLAAFTWGTP"
     gene            complement(<220019..>221686)
                     /locus_tag="CYME_CMP090C"
                     /db_xref="GeneID:16996009"
     mRNA            complement(<220019..>221686)
                     /locus_tag="CYME_CMP090C"
                     /product="cyclin G associated kinase"
                     /transcript_id="XM_005537720.1"
                     /db_xref="GeneID:16996009"
     CDS             complement(220019..221686)
                     /locus_tag="CYME_CMP090C"
                     /codon_start=1
                     /product="cyclin G associated kinase"
                     /protein_id="XP_005537777.1"
                     /db_xref="GeneID:16996009"
                     /translation="MFTWTKGALDWFQSWATSPTTDRNAERGAALHPGGFPEHFDGED
                     GGLLRTLVIRDREIILWSPPIATGGYATIHAASERCDDKNSRYTAPYVVKATHFGTSA
                     DIRRLAENERAIYEYLESCRCHDRPQLPNGVVRFYGSCVLEGTESSVFLLLERVRGGS
                     LAELFEREALARQPLPESRLLRIALDLLGALRYLHALQPAAIIHRDVKLENILYDPQA
                     QRWLLCDLASAQLFVPEGDHRTSPGESALASHPVATANVPHDPNSSTIAMTTRWYRAP
                     EMIDAFASASLVHSMPEKQDIWACGCVLFSLAYGFHPFANDGELQIISGAPWHLIDSK
                     RRAQYSDRVEQLLRGLLKLDVQRRWSANEAIAFLLQESEQDEHPFSSRDAQLNVHDAS
                     LNSDALQAHGSACSAPMDDELCWATFPEVDTSRHFEFSGKTCSGRQREVHGGSASVKR
                     SFAGAPHSLNSIASEYPGSQRVNADYTQLAVAESMARKGTSHAALNPSERSDITSEPV
                     SGIATRQHVYGIAGKEPPQTATIASTTTTKHSNQSNGTSERDLIDWH"
     gene            <221899..>223020
                     /locus_tag="CYME_CMP091C"
                     /db_xref="GeneID:16996012"
     mRNA            <221899..>223020
                     /locus_tag="CYME_CMP091C"
                     /product="mRNA (guanine-7-)methyltransferase"
                     /transcript_id="XM_005537721.1"
                     /db_xref="GeneID:16996012"
     CDS             221899..223020
                     /locus_tag="CYME_CMP091C"
                     /codon_start=1
                     /product="mRNA (guanine-7-)methyltransferase"
                     /protein_id="XP_005537778.1"
                     /db_xref="GeneID:16996012"
                     /translation="MDQALVAEHYNRRKDEGKEGRKSSRIIRLRNLNNWIKAVLIGLH
                     SRPGCVVLDLACGKGGDLLKFARAQVSHWVGVDHARVSLEHAVQRYNDLGPKQRSFPA
                     HFLCGDVFGVDLEANLDLEWPAFDLVSCQFAVHYAFESEQRVRQMLHNVTCRLKPGGF
                     FIGTTPDANVLVSKLRAASGLSFGNSIYRISFENSSQSIDADGTSADLGNLEHDPAPT
                     LETATSAAKRFPPSRPFGIRYHFTLDENVEDCPEYLVHFPTFERIAAEYDLELLLRMN
                     FHAFVNAFALQADAPARFRDLFQRMQVLDPESGTISPEEWDAAYLYLVFAFRKRGQGP
                     SAATERHAPVQTEQAAPLDPQLSIRDLSAPSKPGNSGDT"
     gene            complement(<225221..>225778)
                     /locus_tag="CYME_CMP092C"
                     /db_xref="GeneID:16996013"
     mRNA            complement(<225221..>225778)
                     /locus_tag="CYME_CMP092C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537722.1"
                     /db_xref="GeneID:16996013"
     CDS             complement(225221..225778)
                     /locus_tag="CYME_CMP092C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537779.1"
                     /db_xref="GeneID:16996013"
                     /translation="MFVGLSRGFVSRTSISGIGNSTVRGTHGVCRSASWRSRKTAWGA
                     RVRPASAAGVYAQVPQQPQGNRFDPALIVVRYLDPVFGFGPETVFIIAEDPSTLYELG
                     QPPDRFSQWNASRKIYRARRIVSSALALLLGLVWWPLSIIAAAAYSTFTVVATVIFVV
                     AALVFGFVFWALGEAENRIERLMRS"
     gene            complement(226341..228053)
                     /locus_tag="CYME_CMP093T"
                     /db_xref="GeneID:16996032"
     misc_RNA        complement(226341..228053)
                     /locus_tag="CYME_CMP093T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461522.1"
                     /db_xref="GeneID:16996032"
     gene            <226426..>230001
                     /locus_tag="CYME_CMP094C"
                     /db_xref="GeneID:16996033"
     mRNA            <226426..>230001
                     /locus_tag="CYME_CMP094C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537723.1"
                     /db_xref="GeneID:16996033"
     CDS             226426..230001
                     /locus_tag="CYME_CMP094C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537780.1"
                     /db_xref="GeneID:16996033"
                     /translation="MEKLVFADEDGRCRCCRSDACYSQGDRMHTSVHACERCMTRIDR
                     CTHIRVLFMAGIRSVNSRSYSSFVLCTCVARVPTAIRTMSDREARAQQNVDETPTPAV
                     LQSTAQLALQTPCPSSRTACAQVLDSPSKSAGWTSRMQKRMRRLIQSVAAGRKRLFAF
                     DTDAGVDGDSASHQVRERVSLSLNVVESSANRSDLLDTTAVSTIRTNTDVSPVGDRSA
                     GLDIPDQNRDQSLMCVSPWCSIEDARQNASLRQCQFQARGALVQTSMQPGSRGTETTR
                     VSCSPARVPRSMPVADNDPNAPAMERALTSSPVGQCQVSTPVTIPRIPRDSEETDAAP
                     GSAHPLRPRNASIADIHSSPEPLQHSVTIRARSPAIFGDIGIRDPRTGHDGGIIQYGD
                     EHVERVPAAAASPAQDLVRLTPASGALGAVESVPYAFHENSLQPARKPSPDQHCRDVA
                     TAADRFPLGIANETPETEQTLSLPKPGALSGPSGEIPLNPAPVPTPLLLGAFMRAQVR
                     NDPFAKDATQQGGPSQAPKDVQRSVHSTSFRQRSISPEMQYGAASTLRSKVAGALAQS
                     LWQATLRKPSLVAVFLHPNVTPHALIAHLCFRHVAEHRSRVLILLDDNPATNLNISFV
                     TRYAVELLAYLRAALGDRMAAASALGFSPNAIVNVALVTSQPMLSPSYRRVHFGLIIV
                     LVGGSVEQPYAGNPMDDRIEPALQATWLKQWLAPVPLTSTVLLLPLLPDSGQAIQIPE
                     TSSGHPRRQRSAYRQLLSVVDAPSIGQSVNGADVAVTSTSNPNAGVARVEAQLLVTNP
                     ENALVQEESLRQRQCALAAAYRITPADAIFTLVCCGERLLRLLLNETAVEVQRDVPAT
                     DAVTALPCGCQFLQHTAADYSHMIREVEDIIRRSLRHQTSSRRARKRSGRALRSEAHR
                     LIALHTLRQAVSMACFEGADVALAFLNQAHREYSRFYGDSAASVQIIENATLQFFDRV
                     RDTPAPQPHPLVTIIRTALSDIVRSDTGTESAAKRKILIVTETKASAALLKAWIASSA
                     RPVTGQERDTCHRLDARLAGDRQLVIRHVEEFQQNDQLPSETVGSLCTFEPFDKILLI
                     APSVRMADLCGRARLWSDLGCGSCFQVTLYTVLQEELTPLSRCSLTVDYDSEYAEIWS
                     MMKQRQLHAYHDEQQQPDFEASVSTWIAPLSCIERSKVRPSEETR"
     misc_feature    230744..232199
                     /note="possible transcribed region"
     gene            <232615..>233607
                     /locus_tag="CYME_CMP096C"
                     /db_xref="GeneID:16996035"
     mRNA            <232615..>233607
                     /locus_tag="CYME_CMP096C"
                     /product="similar to C-methyltransferase"
                     /transcript_id="XM_005537724.1"
                     /db_xref="GeneID:16996035"
     CDS             232615..233607
                     /locus_tag="CYME_CMP096C"
                     /codon_start=1
                     /product="similar to C-methyltransferase"
                     /protein_id="XP_005537781.1"
                     /db_xref="GeneID:16996035"
                     /translation="MVFLEKLDDLLKGYAPARVVMTGFELGVFTMIAEGKTTAEEVAR
                     AAASSTRGMRMLLDALTSLELLQKHNDRYQLVPGSEAALVKSSPQYIGSMWETNHLWS
                     AWSALTQVVRTGKPYTRLETESDAARFFPMLIRSLHVYNLEPARKLAGLLLPSQIPPD
                     SRVLDVACGSAVWSIPFAEASSEVRLDLLDFGDALAVARSYVERHKVDAQVSYIQGDL
                     KHTDLENDRYHLIILGNIVHSEGAASSRDLIQRCARALRSGGKLAIIDLFPNEERTGP
                     PRAVLFALNMLINTSEGDVFSVSEYNQWFEDAGLSEGTLVQLGSTTTALLAAKP"
     misc_feature    234866..236242
                     /note="possible transcribed region"
     gene            complement(<235710..>237191)
                     /locus_tag="CYME_CMP098C"
                     /db_xref="GeneID:16996037"
     mRNA            complement(<235710..>237191)
                     /locus_tag="CYME_CMP098C"
                     /product="similar to A/G-specific adenine glycosylase"
                     /transcript_id="XM_005537725.1"
                     /db_xref="GeneID:16996037"
     CDS             complement(235710..237191)
                     /locus_tag="CYME_CMP098C"
                     /codon_start=1
                     /product="similar to A/G-specific adenine glycosylase"
                     /protein_id="XP_005537782.1"
                     /db_xref="GeneID:16996037"
                     /translation="MAYSVCALRRSGSILKPNLCHKKVAAPAHMKERNVQLNSHTKRG
                     SARHQHLATEKLRLWDLEELAQLRGALLRWYDSQALQLPWRQRGGRPDPYQVYVSEVM
                     LQQTRVKTVEMYFMEWMRRFPTVEALAAATEEEVLQQWAGLGYYRRARMLHAGAKWIV
                     AQNRGKIPASVRDLEQVPGIGVYTASAIASIAFGAVVPAIDGNATRVVSRLAGMCCTN
                     VWKGDGKRLLAAVASELVDANRPGDWNQAVFDLGRSLCTAQVTEEACAVCPVQKFCRA
                     AALPISVRQSTPYGVAEISEGKLKLQRHMPRVRARQELLLAFVLVASVAPHAASDSTE
                     TLYYVRRRASHGLLGGLWEVPNIVVERLPHADPHPLAQQGFIEPEEKDGGESAAGSEV
                     FRQLAAALNSQKSFKLSVVSITPIPKMVRHLFTHIRQDIQVFRVEVTGNPCFLDDGDQ
                     GRWVRAIALEELGLSTQMRRVLRAAGIPLTRKRFGDASTATHS"
     gene            <237777..>238589
                     /locus_tag="CYME_CMP099C"
                     /db_xref="GeneID:16996038"
     mRNA            <237777..>238589
                     /locus_tag="CYME_CMP099C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537726.1"
                     /db_xref="GeneID:16996038"
     CDS             237777..238589
                     /locus_tag="CYME_CMP099C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537783.1"
                     /db_xref="GeneID:16996038"
                     /translation="MEPGSPAGAGAEAPAFYSERKLSRKQLKKLAKAEREYEEERRKE
                     LEAAQAVDTAQKRELARIESILRTHALRMEYVEPDGHCLFRALVRQLRPLIQSGLFDT
                     YFPAADTETRSALLTWSTIPDEMEAVWLLRKTLASFIRRRGTEFFPFIVGELDPQGTL
                     LDASDDPAERVAQYCARLEDGTLWGGQPELQAVALALRCRVFVFADPEILPNGMLVMG
                     ADDASTDTGAESVTALRVSFHKQFFSLGEHYHAVVPADDSRGDARDPRISAS"
     gene            complement(<238951..>240024)
                     /locus_tag="CYME_CMP100C"
                     /db_xref="GeneID:16996030"
     mRNA            complement(<238951..>240024)
                     /locus_tag="CYME_CMP100C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537727.1"
                     /db_xref="GeneID:16996030"
     CDS             complement(238951..240024)
                     /locus_tag="CYME_CMP100C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537784.1"
                     /db_xref="GeneID:16996030"
                     /translation="MTSSAPSDAEALKSAEDTEEQEAIQHLTSVVPAVDSSTNSATSK
                     AELNQRLEDAARKAQETLEHASLELRKRLSKLSTLVGTLYEEQHTTSESVSSEQRGEH
                     KPPDPGEAASGSLLDSWRSFSNFVSAHMNLDESGYRFLEPARESKNSVVSSDVVDADA
                     AFAALLESNDPACFQKLFERYFAQKESRELGASEQRDTGGPEGAPDAEHDTTRAQRVV
                     DAFRVALVQRYRCSHNDLTPERRYLLPGRLFITKTHVAFLSSMDAARMFDETSYETDI
                     RPSFIRHEPIRLLLALQDVTKVQRGKGMNLRLVTSEDQSYIFGEFRSTVEFEAALCMI
                     EQTWRSLQLRGRVLQTTSEEQRS"
     misc_feature    239719..241332
                     /note="possible transcribed region"
     gene            <243601..>244962
                     /locus_tag="CYME_CMP102C"
                     /db_xref="GeneID:16996026"
     mRNA            <243601..>244962
                     /locus_tag="CYME_CMP102C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537728.1"
                     /db_xref="GeneID:16996026"
     CDS             243601..244962
                     /locus_tag="CYME_CMP102C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537785.1"
                     /db_xref="GeneID:16996026"
                     /translation="MKPLLVAWCSQRPAWVSSVTSLRPVYSSVDTRCGACCRTRHRPQ
                     RVRRLRNSCRSRVVASGTEASDHSPTGELKLSKRSGVRGRVFLLAVPFIWSTYSPSMR
                     FLFQLSDVPPSAALLNLGPALCGALGFLVPILMKLGGRSASAWGRSGTSAAGGGRSAL
                     PFSIPHFPAGFAVGIELGVYMFLGTVLQLLALRFSPASQVGFLLQTSVVFTALLQRFW
                     ASRAASAKSSQDLRQGAAIACSLCGTTLLILDDDPDMFRRMLSGLGLASKPALHPGIA
                     FIEGCTPLSAKLAGQISALAAAVLYALFTIRLSSERVRKSDAITVASVKTATLAVLSL
                     IWYSMRADWQMDAAFFHRAGQSGLIAYILSTIWNGIFGTALTTWLQVKGQGAGRVSPT
                     EAGIVYATSPLWGAFISVTLLQERMGWLGWFGSALILSSVVLMNLRQSDATSNANESK
                     SAS"
     misc_feature    complement(245638..246874)
                     /note="possible transcribed region"
     misc_feature    247014..249108
                     /note="possible transcribed region"
     gene            complement(<249871..>252078)
                     /locus_tag="CYME_CMP105C"
                     /db_xref="GeneID:16996029"
     mRNA            complement(<249871..>252078)
                     /locus_tag="CYME_CMP105C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537729.1"
                     /db_xref="GeneID:16996029"
     CDS             complement(249871..252078)
                     /locus_tag="CYME_CMP105C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537786.1"
                     /db_xref="GeneID:16996029"
                     /translation="MGELAWLHQSLGLLGAGERAANPGSLATTSERLRVFQPAKQSLG
                     AEFTISKNAATRNGFLCSFLGGIRTWRFCENALPCRWRLTLKSEHRRKDLLSVFAFRE
                     PYFVRKLNEQAPKRTVHKRIKLQTKLLSGEKFSETDSYARKRRAMVTIQRHGCAKKAR
                     TAACCRAVSIPSGDPFPGETRASTASMLYTNARVEAQRATIAMIVTNPSGASVSPSNR
                     KALANIIPLLFFLIISAALLVVASANVSLFHEASQKFLSIASQALRYFANAGTRVARE
                     FRAQVGTLSRNLVKSGTFAGDRVRHVRGTQPELSSRTQSAFWTRDPSSEAEPQHTAAL
                     VIRVFGNLLLLLRLQLLYLAARANAFMGYSREQANKTLKMTSAQLETALRRIHTEHAS
                     ETAAVASGVATAWAQFQRRLAALGRPDDEVITEDPQLSWETYQEEFERKLEEICKRNF
                     SEFEQKLKSERLDIEAILCKYASLSKLTEQPTEEAERAMRLATPEQRRAFMEAAVEDL
                     ASARKALAPFLEGILDPSNPDAEFSIREAEKRGITSLRGRPLDENLRRELSQLFTGGY
                     DWDGELYTAETEGAKLWKAAVERLKKREDVVFRLQQSIQDMRAASTTQVPIDANTRDW
                     SASARSISDTKPPVLENDKTTGTIAPKPLADELKLIREQLSVMSDEELVTWIRTNVRD
                     VVRSGLAEKVLGRLALAVIAAYIFVNLVIKNDIVQQLELVRPYAERIVRFFIL"
     gene            <254794..>255558
                     /locus_tag="CYME_CMP106C"
                     /db_xref="GeneID:16996020"
     mRNA            <254794..>255558
                     /locus_tag="CYME_CMP106C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537730.1"
                     /db_xref="GeneID:16996020"
     CDS             254794..255558
                     /locus_tag="CYME_CMP106C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537787.1"
                     /db_xref="GeneID:16996020"
                     /translation="MFGFVIPANRARLHLHYPQPKNNNGCVSRRRLGALQKPQLRKPC
                     PVVACAPGNNTPPSVPEKTTARLSLAQRLSIPLLTMTTTIPGVVLAAEETAAPESPLK
                     ALFKSLPLSLVHPLVMDGVLLGTLYAFYLGYQARTMRTTKDKELKMKLAQAKPGDRHY
                     QIASILLAVMTVTTFEGMANTYTRTGKLFPGPHLYVGLASVALMSMMASLAPAMRRGN
                     TAARNAHFAMAFAVTGGLVWQLQSGFEIVLKLLGWK"
     gene            complement(<256548..>258380)
                     /locus_tag="CYME_CMP107C"
                     /db_xref="GeneID:16996021"
     mRNA            complement(<256548..>258380)
                     /locus_tag="CYME_CMP107C"
                     /product="probable glutamate decarboxylase"
                     /transcript_id="XM_005537731.1"
                     /db_xref="GeneID:16996021"
     CDS             complement(256548..258380)
                     /locus_tag="CYME_CMP107C"
                     /codon_start=1
                     /product="probable glutamate decarboxylase"
                     /protein_id="XP_005537788.1"
                     /db_xref="GeneID:16996021"
                     /translation="METRNAPGSATNKLKEVGFGGEIEFARELQELLGIVERKLGLCT
                     SSDAGSENGVERTPEAQLPLVYVPPSAIWRQLDHYVQCVISGESAGSRDLLEQFLEDL
                     LRYSVRTKHAFFLHRLYGGSDPVGQIADLICSVLNNSADTFSAAPYLVLLERRVIEAL
                     SSCIGWKTPLQGDGIFCPGGSYANLIALTTARHVFQMNARRPQTKRTQRHHCNERRMG
                     IFTSVQGHYSVRRNAAMLGFCDAPGEDCSDVVLVPCDEQGRMDPEALRRLIHCFRNTR
                     PLSSVFVNVTAGTTVLSAFDPLPEIWTVLAEAFPLNSVESASAELEQRLEADTMIRER
                     LPQPTFWVHVDGALGGSFLFSERFRPVALAGLEKYANSFVLNAHKLLNAPLQCSILLV
                     RERGLLQAAHAARAPYLFHDDLDTDAQYDIGDMTLTCSRRSDALKFWLMWMWRGSAGF
                     GARVEAAARNARAIAEAMAKRPCFLLVHWPLDRSYPATNVCFYYLPSDMRESIRNLAD
                     IKAETAAQLLGSISVRLCRALQVSGKALLNYCTLEGTDLPIFLRLALHGLHVYEEQEI
                     QDLLNRIEDCGDHAIRPGTPASISGNVSGGVSPVGDDGAHNAVL"
     gene            258505..260486
                     /locus_tag="CYME_CMP108T"
                     /db_xref="GeneID:16996022"
     misc_RNA        258505..260486
                     /locus_tag="CYME_CMP108T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461523.1"
                     /db_xref="GeneID:16996022"
     misc_feature    complement(258889..261211)
                     /note="possible transcribed region"
     gene            <262483..>263598
                     /locus_tag="CYME_CMP110C"
                     /db_xref="GeneID:16996018"
     mRNA            <262483..>263598
                     /locus_tag="CYME_CMP110C"
                     /product="similar to retinol dehydrogenase 8"
                     /transcript_id="XM_005537732.1"
                     /db_xref="GeneID:16996018"
     CDS             262483..263598
                     /locus_tag="CYME_CMP110C"
                     /codon_start=1
                     /product="similar to retinol dehydrogenase 8"
                     /protein_id="XP_005537789.1"
                     /db_xref="GeneID:16996018"
                     /translation="MFDAFEADDLQQWGYAQATLKPLASRFEHATSLPVVVVTGTTTG
                     IGLHTAAMLAASGLFRVIATMRPSSLPTGEPRLRELVQRYTESGNTVTTTTTTRKVAS
                     ADALRVCALDVTSEASWKALATQLPGPERRVDVLINNAGYGVSGSTEQVTVEQAQQLF
                     DTNVFGVMRGVQVLAPYMRAQSKRNQAQGLYTVLIQISSLAGLRAVPFSDLYSASKFA
                     LEGLTEAMRYSLEPFGIRCICVNPGPVRSAFSTRFGIASRDRGCRQIPDEDPLVKHKL
                     DTMHDLFVRDLAERMASAEVGQSSAQVAVSIVQAVVDGLSLSEAPSLHYGTSPVVDET
                     IRCLRTDPAARTSEPYRRFWDAVARAQKQATDTAGMP"
     gene            complement(<265470..>266264)
                     /locus_tag="CYME_CMP111C"
                     /db_xref="GeneID:16996019"
     mRNA            complement(<265470..>266264)
                     /locus_tag="CYME_CMP111C"
                     /product="similar to second and third steps of methylation
                     pathway for phosphatidylcholine biosynthesis; Opi3p"
                     /transcript_id="XM_005537733.1"
                     /db_xref="GeneID:16996019"
     CDS             complement(265470..266264)
                     /locus_tag="CYME_CMP111C"
                     /codon_start=1
                     /product="similar to second and third steps of methylation
                     pathway for phosphatidylcholine biosynthesis; Opi3p"
                     /protein_id="XP_005537790.1"
                     /db_xref="GeneID:16996019"
                     /translation="MDTLGARFLQLEKEALIVLRAYALAFERWTVFVRKPLEVVAQRL
                     AQQSAYLDLASARAITYIIAAPLLWNVLARLEYYTSVWSRLCRGRRRFACLLLACWVF
                     SFSLYRDLVVLEAMQTSAVRLPPFPQAFIPAVVWRFCTPRTIASAVDAVAWAAFATGL
                     VLVTTSFLQLGLFGTYLGDYFGILKPSKVSAFPFSHFEHPMYDGSSLLFLAEALFERS
                     TLGLLLTLLLFAMYRIATIWEGSFTNYIYANRARQRATFSGRKHAD"
     gene            <266989..>271308
                     /locus_tag="CYME_CMP112C"
                     /db_xref="GeneID:16996048"
     mRNA            <266989..>271308
                     /locus_tag="CYME_CMP112C"
                     /product="5-oxo-L-prolinase"
                     /transcript_id="XM_005537734.1"
                     /db_xref="GeneID:16996048"
     CDS             266989..271308
                     /locus_tag="CYME_CMP112C"
                     /codon_start=1
                     /product="5-oxo-L-prolinase"
                     /protein_id="XP_005537791.1"
                     /db_xref="GeneID:16996048"
                     /translation="MVVANGRFRFAIDRGGTFTDIYAEQPDGTVRLLKLLSEDKEHYS
                     DAPQEGIRRIIAEFYGTRHHSTDTIDPHVIEWIRMGTTVATNALLERRGERCILLVTA
                     GLRDLLQIGYQSRPDIFDLRAARPAVLYEDVAEIPERVRLVSAAAYESLEAVERQHLI
                     ATRTGQWVQVLRPPALDVAESALKEALQKGIRSVAVVFMHAYAYDTHEQQVGHLALSL
                     GFQHVTLSSSLTNMQRVVPRGLTCLVDAYLTPCLRKYLESFRDGFKGRLQDTLVELMQ
                     SDGGLCPLESFTGYKAILSGPAGGVVGYAKTIYPLTALSSPDGKPQPVIGFDMGGTST
                     DVSRYAGQLEHVLECETAGVMIQAPQLDIQTVAAGGGSRLFYRSGLLQVGPESAAADP
                     GPVCYRKPGGQLAVTDANVVLGRLQPRFFPSIFGPDQNESLDVEAARAAFASLREQLT
                     RDDPERNLLSIEELALGFIRVANEAMCRPIRSMTESRGYDPAQHVLACFGGAGGQHAC
                     AIARNLGMSTVYVHRYAGVLSAYGIGLSESVEDLQEPCALELARDLERAQQLLQELEL
                     RCRKALERRGIASDRIQCERFLHLRYQGTDLAMLISEPGAAATCEDYASAFEQAYERE
                     HGFLLRGRSILIDNVRVRVAGQSTVSPVQTYSTDATGAGHSDSGEDAATRAPGPQQQQ
                     QQQLETLSSTGALLSVPEPLDMVAVYFATGWHTRTPVYALEKLAPYQTFSGPALLVDP
                     AGGITILVEPACQAAVLADRTIRIDLSSVAGAATHSSSSSSSTDSLSVAQSVIQVPDA
                     VKRSIFAHRFMSIAEQMGRTLQRTAVSTNIKERLDFSCALFDAKGGLVANAPHIPVHL
                     GSMQDAVRQQVTLLGADWLPGEVVMTNHPAMGGTHLPDITVITPVFHDGRPVFFVASR
                     GHHADVGGLTPGSMPPFSRTLAEEGAAIASLKLVQGGVFQEGRVRELLQHAGCRCLHD
                     VLSDLRAQIAANQRGIQLMNQLIQEQGLGVVEHFMHEIQRTAAGFVRDVLRQVGKRHG
                     KRTPTGRWLLEAADVMDDGSRIQLRVEIDDNDNDNDNNNDNDNNVDDGCSAVFDFTGT
                     DAQVVANWNAPPSVAASAIIYCLRCLIGRDVPLNQGFLDPITIRIPAGCLLDPHPEAA
                     VVGGNVLTSQRVTDVVLRAFGACAASQGCMNNLTFGTEHWSYYETIGGGSGAGPGWHG
                     EHGIQVHMTNTRMTDPELLEWRYPVLLRRFRLRSGSGGRGRWSGGNGIERELEFLEDG
                     IQVSILSERRVFAPFGLAGGEAGARGRNWLIRAPDTSRAARAETKETDPQQTLGASAP
                     SSSSSSSSSSSSDIVGGAAFHAGTVQAAAGGLVDTAGRAGQPKSHKSETRSSIDSWTR
                     TEAPLERAWLDDQAGVGSHRHWLVNLGNKQSIRVVAGDRIRICTPGGGGYGTPGAVVE
                     RNT"
     gene            complement(<271591..>276408)
                     /locus_tag="CYME_CMP113C"
                     /db_xref="GeneID:16996049"
     mRNA            complement(<271591..>276408)
                     /locus_tag="CYME_CMP113C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537735.1"
                     /db_xref="GeneID:16996049"
     CDS             complement(271591..276408)
                     /locus_tag="CYME_CMP113C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537792.1"
                     /db_xref="GeneID:16996049"
                     /translation="MPPPCFVQVHTLARRKSTPFENRLACIAALADRTPNQGIAWFVP
                     AAEREALQITTHMLLGTVQELEAAGENPENPANAELTRQLEALIRQLEQLLTRLAATE
                     PLPLSSALVDVVVFALSRCVVDWSAAVCTDPSYWLRTLDDELAMEEQSFRATAEQEQK
                     ALASAPPAPEHKRRPELVHMPLLRSVLAVLVALLERPAFQPATEALLRLVGAVVRVCM
                     LAEQQPVLERCRQLDQLLIQVRTRILERLQARAEFRNATLKQLETLFQSVPGLLGCLS
                     LISLREAAWGVPLKLLLHRSIDDLSKASGGRKHATIGAAYATWIIDTLKQLGEHPALI
                     LDPGSSANESLRLGSRVATTTQTLMSVASLIQCFRLGAECLSQASSPEVSDSAPVTRE
                     RVPGAARKRSRSAAAAASQGIASTLPRNLDSVAGESQRPRNGVAYLTTFLHHLASLPS
                     LPDELWRCLWSSVLTDAWQFRLFTRLDSDDASVSSLLRSMVPLAAQRRLLPRLLTRLT
                     TEPLLDPQVVSFCFFDRAATDPAVDAFRVAFVTDLGGHRDGSRLFQLLIKHCIETGQA
                     VRWSPRLQLRMEQDLAKHWSVAQRWSLFMQLLQMLQPALEQSVRAPAASSSPEAAGCD
                     TNRTERASLAKWSLLPLLVTSIESIASQFSAAAEALESTLGDIRDPLITDACRACWRW
                     SRESAPQLLPELARVSLALLQLQQTMQPGLSTDSMQLLTELRSWQPDTATRSVLELWL
                     RQLQIPAMRSHHRETSLGALWLPQRDCRLPIRQERTMLWAHAALQLVRISEERALLDA
                     VLEMALDEPRINEWICEDVDIWELRIRPSEEQVLETPDTGLDTPHLRIRHDDSDYTTT
                     AGCVLAFLARQHADTLRSIPCLRLVTAIPQLPRDTPKVAALVELLLCRLLCAFAQAPC
                     SADLHPLSTWSIVHLSDLWMEANASTVAVTIPSAATSPTTTEALRTAAEAALFQCLQC
                     VWPAEASPSKTDGSAPQTLWLRQRFLLEPFLDTLLRLLPASRVLALLERCAWTPDTWT
                     RTPRLLLALCRMGLAYGPRFALRWTGSAALAEHLSTLWKQQLAGEDAQVPYWTHQHMG
                     LYQELCSAFLRSLWTHPPDAWRLIYLHCCDTLLNTTNFAAGHELEPQQQQQQQQHQLL
                     LPLLSSLQPLTPLDEIPRALRPRCWALWRRLLTERWEIPTEMPSQSLANALVTVLATC
                     SPVWLDSQPFAGLLWIQHWLEQLARRLPRRALRFIWDCFEDTWRALSAPESQPATTQR
                     SLGPGRTALLLSMLVLASSAEAPSAPGIPASVLDVAGEASAASAGSTQRSAAGYIEMR
                     LGIWLTSMDAATLEAVLERLLEYRLPELQPDGSIQYDTPALWYLLRLVERLWRPLQRP
                     ERYGTAVTAAAARPRPEHLARGARFHGLGTHWRRQHQALLRVVKALLIASARALTQTG
                     TQRRCRLVETLVRLLIALVDRSADPAGALFHPVLALALRVTEQYPGEASIATLWYAMV
                     QQHPRLVRRVAPFLVPLLVRAWINLRQQQQQQQQHQQSSRFSVGVRERATDHRPWIDT
                     ALRNLHAILLELWSMVEERARWHVYALTPSPVLPYLHQWERDYIRQEKYRGLG"
     gene            complement(<278185..>281127)
                     /locus_tag="CYME_CMP114C"
                     /db_xref="GeneID:16996050"
     mRNA            complement(<278185..>281127)
                     /locus_tag="CYME_CMP114C"
                     /product="mutS family DNA mismatch repair protein MSH2"
                     /transcript_id="XM_005537736.1"
                     /db_xref="GeneID:16996050"
     CDS             complement(278185..281127)
                     /locus_tag="CYME_CMP114C"
                     /codon_start=1
                     /product="mutS family DNA mismatch repair protein MSH2"
                     /protein_id="XP_005537793.1"
                     /db_xref="GeneID:16996050"
                     /translation="MVHVQGAHGSDALVQVFGGVSGVDKFGREWFESQLEADAAVAYD
                     PSTVLLVLQFASTSAGFWLLSGDAGLLSTQLQTESVRVSVTCQAQQRVLEWYLARVRA
                     STNATLATWVLAGLEAGKAVAVYAAGSRLGSASTSEARGFGFPLQIANKWFLAAAGSP
                     ARVGPLTSYLPGNTRAQDSSGLADGDSVVDAEGIALVGETAGVLAVRTRATGEQSNTG
                     HRHCRMVAACHCIPHAGLFRVIECQEDASGEAFLLTDWIERALVRSGARELVLQDGDL
                     AEYELHQLDAALERIGGIARAMLRPVRRGGLGAEHDLRWLVAESETPDSCQRDDDAWR
                     PEALTLDEMFSMKLATDCAHMCVRFLDLGQRVGERGRYRIEQLAWRQNLQLDAAALKA
                     LHVLWGDETGPASPSSPPPGSLWCLLDRCRTPMGSRLLRTALIEPLGNREAIERRLDL
                     VELLVHDVIARQRLADYHLKGFADLITIARRLARDKTSLRQLVRLYQSLVRLPALRSE
                     LEDLLLAHTETRPRCCQVLRSDIADRLAAVAPAAQEFIEDVERFIDLERITNHEYLLR
                     PSMSTEMTQIRGEMDTCLEEMNRTYQQTIAALQQDDGVRGSGGDWLKLERKDGLGFCF
                     RVTRKDEVCIRGKESITVLETRKDGVRFTTSALRRWSSAYTAAEQRYVAVQRSTLAQV
                     FGHFAKYASMLEVLGHVLALLDMLVAFAMISAERQFCRPRLVESDEFEAHESSGVILR
                     GLRHPLVELALQGEHTFVANDVVLTHPRRLLLITGPNMGGKSVTLRSVGLAVLMAHCG
                     CFVAADAASLPVVDRILVRVGAGDMQTRGISTFMAEMLDMSTILRHATSSSLVLVDEL
                     GRGTSTAEGFGLAAALCEALASRASWTLFATHFHELTKLAQGAWSHRMLNAHVAVAQV
                     HRDNDDSEINDRGRGTPAASLVFLYELRPGPSERSFGIHIAEMAGFPHPVIDMARAKV
                     SALENTDA"
     gene            <282408..>283469
                     /locus_tag="CYME_CMP115C"
                     /db_xref="GeneID:16996051"
     mRNA            <282408..>283469
                     /locus_tag="CYME_CMP115C"
                     /product="similar to Ap-4-A phosphorylase II"
                     /transcript_id="XM_005537737.1"
                     /db_xref="GeneID:16996051"
     CDS             282408..283469
                     /locus_tag="CYME_CMP115C"
                     /codon_start=1
                     /product="similar to Ap-4-A phosphorylase II"
                     /protein_id="XP_005537794.1"
                     /db_xref="GeneID:16996051"
                     /translation="MQLWLADAVARAVVHARAKGAIFGIETTSTVVLDHGIPFLVRIV
                     SSLRDKPVNEQGESAASSEEPPGPVDAADGALGLAERAATSHVELGVFPDPFLPYEED
                     LYVGDVPPAHVCLLNKFNVVEGHLLVVTRAFREQTHLLDSGDCTAIWHCLRQYPGLGF
                     YNSGKVAGASQRHKHLQLIPVAGVEAVPIHEKVEEAARSREEQTGCFVVPALPFKHAI
                     IGMHDLYSESKSDAEIGAAMHSRYMQLLHFTIEELGVPASSWMAWEARSHHPPASAVG
                     HPANDSETAHPFPYNLLLTSNWMMLVPRRHEKFLGDISVNALGFAGFLLAKNESQRDL
                     IVKHGPLKVLAQVGIPWNH"
     gene            complement(<285295..>285552)
                     /locus_tag="CYME_CMP116C"
                     /db_xref="GeneID:16996052"
     mRNA            complement(<285295..>285552)
                     /locus_tag="CYME_CMP116C"
                     /product="similar to transposase"
                     /transcript_id="XM_005537738.1"
                     /db_xref="GeneID:16996052"
     CDS             complement(285295..285552)
                     /locus_tag="CYME_CMP116C"
                     /codon_start=1
                     /product="similar to transposase"
                     /protein_id="XP_005537795.1"
                     /db_xref="GeneID:16996052"
                     /translation="MTLLDSDVSHSSIDVLDKLAFVHEKSVKQHVAGIGVELLFVPAY
                     SPRLNPVESILCVVKSQFTCSRMNRRVARIRETAVLPQVAL"
     gene            <287164..>289218
                     /locus_tag="CYME_CMP117C"
                     /db_xref="GeneID:16996042"
     mRNA            <287164..>289218
                     /locus_tag="CYME_CMP117C"
                     /product="block of proliferation 1"
                     /transcript_id="XM_005537739.1"
                     /db_xref="GeneID:16996042"
     CDS             287164..289218
                     /locus_tag="CYME_CMP117C"
                     /codon_start=1
                     /product="block of proliferation 1"
                     /protein_id="XP_005537796.1"
                     /db_xref="GeneID:16996042"
                     /translation="MADWISSGESSESEAEINTIGNVPLRWYDGYEHIGYTRDGEPLR
                     RRYPANALQQLIAAGDDPENWRKLYDEKNDREIELTDEDVKLLVQYKQRLLSSLSGDE
                     EIIAWAPRQVLPLHQSEEPKRRFLPSKHEAARIRKIIRGLEEGRIVPLSQRYQQRAQQ
                     HARWRYPQVDVWTEDDDSASDTLERKQSRAARARARSYVAAPKLAPPGHIESYNPPDE
                     ALPTPEERDAWERAAPEDRLLPYLPQRFSSLRAVPAYKAYVEERYKRCLDLYLCPRVL
                     RRRMQTHDPTSLLPELPDPSELAPFPARLSMTYSDGSQQSAAALRCVAVHPQLGHWLA
                     TGSDDGLVRVFDVITGALVCRLDMCARHSGSAPDLAKTARDPVVSLVWLHALEPSVQE
                     MLLLVAVGRCIYILRVYPLIMGQRATGARGDDPVQTPESAVPQRAPSTLPLPADVQWR
                     ELNDEDCGALPRGTLLIEHGKRIRHVAVHARSDYIAVVGSDSNGSTVYVHQLSRRHSQ
                     TPFRKHIADVQCTAFHPSRPFFFVATMQHIRVYSLATRSIVQKLTPRVRWLSTLDIHP
                     GGDNVLCGSYDKRLCWFDLDYGEKPYRVIRNHSMAVRKVCFHPRLPLFASAGDDGTVH
                     VFHATVYDDLGKDPLLVPLRILHGHQVSQRLGVFDIAFHPRLPWLFSVGADGACHLWT
                     EV"
     gene            complement(<291512..>292024)
                     /locus_tag="CYME_CMP118C"
                     /db_xref="GeneID:16996043"
     mRNA            complement(<291512..>292024)
                     /locus_tag="CYME_CMP118C"
                     /product="E3 ubiquitin ligase SCF complex SKP1 subunit"
                     /transcript_id="XM_005537740.1"
                     /db_xref="GeneID:16996043"
     CDS             complement(291512..292024)
                     /locus_tag="CYME_CMP118C"
                     /codon_start=1
                     /product="E3 ubiquitin ligase SCF complex SKP1 subunit"
                     /protein_id="XP_005537797.1"
                     /db_xref="GeneID:16996043"
                     /translation="METADGASEAPLIPGYRGGRVIRLRSAEGEVFDVEESILKVSNV
                     IRNLLEDVADSDESGILLEDIDAKTLAKVIEYCRYHAQPNRPKGERTLWDRDFLRVDQ
                     SLLFSLTLAANFLDIPSLLDLCCRHIADMIRGKTPEQIRATFNIENDFTPEEEAQLRA
                     ENSWAETDSH"
     gene            complement(<294419..>296074)
                     /locus_tag="CYME_CMP119C"
                     /db_xref="GeneID:16996039"
     mRNA            complement(<294419..>296074)
                     /locus_tag="CYME_CMP119C"
                     /product="GTP cyclohydrolase II / 3,4-dihydroxy-2-butanone
                     4-phosphate synthase"
                     /transcript_id="XM_005537741.1"
                     /db_xref="GeneID:16996039"
     CDS             complement(294419..296074)
                     /locus_tag="CYME_CMP119C"
                     /codon_start=1
                     /product="GTP cyclohydrolase II / 3,4-dihydroxy-2-butanone
                     4-phosphate synthase"
                     /protein_id="XP_005537798.1"
                     /db_xref="GeneID:16996039"
                     /translation="MFQCVPARVSWSVSGVHARRQLASNFLGRRNYFKIIGTMKNLSL
                     MRGALAQSAGDGTAAERAPGATPAPAPAAVNSSHVQSLAARGVFCEAERLGDSLRDAP
                     EAEMETENGSVGASGFATTDKDVGWCFGEQSVLNAIAALQRGEFVVVTDDEDRENEGD
                     LILAAEKATPQAIAFMVRHTSGVICVSMEEERLNELRLFQMVPDNEDPKRTSFTVSVD
                     LKHGVTTGISAADRSATIRALANPRSTADDFRRPGHIFPLRYAKGGVLKRAGHTEASL
                     DLCRLAGLAPVGVLCEIVNDSDGSMARMPDLEVFSKQHGLVLTSIADLVCFRRRREKL
                     VRRIEPQGARMPTKYGDFTVYAYVSELDGCEHLALVRGDPQQFSNRPVLVRVHSECCT
                     GDVFGSLRCDCGLQLQFAMEKIAAENQGVLVYLRGQEGRGIGLSHKIRAYTLQDAGRD
                     TVEANEDLGLPVDSREYGIGAQILVDLGVQQMRLMTNNPRKYTGLSGYGLSIMERVPV
                     KVTPNKWNIRYLRTKKAKLGHLIEIEDEFDREKEVQVEIRDLN"
     misc_feature    complement(296263..298552)
                     /note="repetitive element"
     gene            <298496..>298885
                     /locus_tag="CYME_CMP121C"
                     /db_xref="GeneID:16996040"
     mRNA            <298496..>298885
                     /locus_tag="CYME_CMP121C"
                     /product="retroelement, dead"
                     /transcript_id="XM_005537742.1"
                     /db_xref="GeneID:16996040"
     CDS             298496..298885
                     /locus_tag="CYME_CMP121C"
                     /codon_start=1
                     /product="retroelement, dead"
                     /protein_id="XP_005537799.1"
                     /db_xref="GeneID:16996040"
                     /translation="MYGGLPRSYRSSKRTLTYTDMNIYRPIGLIPSIMKLLCAIPTNR
                     TQRRFEERKFFAPEQAGFRSHEECMSHALTLIEVAQRRFISGQQPAYVCFIDFQKAFD
                     TVPHEAPFLKMERVEVSGKCLPFFRAL"
     gene            <301061..>303460
                     /locus_tag="CYME_CMP122C"
                     /db_xref="GeneID:16996041"
     mRNA            <301061..>303460
                     /locus_tag="CYME_CMP122C"
                     /product="unknown kinase with aarF domain"
                     /transcript_id="XM_005537743.1"
                     /db_xref="GeneID:16996041"
     CDS             301061..303460
                     /locus_tag="CYME_CMP122C"
                     /codon_start=1
                     /product="unknown kinase with aarF domain"
                     /protein_id="XP_005537800.1"
                     /db_xref="GeneID:16996041"
                     /translation="MTLGFIVPVPRTQRWAAHSIWLGATDRVPHPRSAVAAGNAIVRR
                     TRLVGAGAQPQRLKRGTLASLRSVHGGSGHVWDNVSCANSGSTESGDLTRNRFAVHRR
                     LGSSEWRRTWSERLAGARRFLVERARTTLRRSPQLLRETRQQVQRGAVWCEQRLRLLA
                     ANMLKYLEWMSKLRQRRRARSPSAEWGLVLEAGWARRGFGSPASRAVEIWSFALHQVW
                     MELRLRRVQDSKQRAALRRRNARALKEGLLRLGPTFIKLGQLASTRVDLFPREYIEEL
                     VSLQDRVPPFNIRVVRQIIREDLGRDIEELFDTFEEEPMAAASLGQVHKARINGQDVA
                     VKVQRAGLRELFDVDLKNLRLLAQMLDWLDPKTDGASRNWVEIYNESARLLYEEIDYE
                     NEAQNAREFADNFERSTRAFGGANDWVRVPRILDAYTSKRVLVMEYVKGTKISAVEAL
                     DALGLDRKLLAERLGRFFLEQTLRHGFIHCDPHPGNIAVDEEGRLLVYDFGMCQRLTA
                     KVRRAVVNLVFATYENDVAAFVDALAEMGVLKQTADRLTVYRIARYFLKAFRERLDGT
                     AVQLGGVAGAEATGEQPPAPETTTNPLPSLPVVDRKLARQMTLEKRLSAIGEELLAVA
                     DDQPFQFPAVFTFVFRALTSIDGAAKALDPAFDITRLTKPYLRDLIDLRDGSIAKTAL
                     KTATKALGWRKEDLASVVTQPRKVAYIESVLRKIETGDLKIRVRTLEIERSFKLLSVM
                     VEILGHGMLASIFMNMALAGVFASACYLGAAVCGVRALVGFLNLRIIQQRQAKYARGG
                     N"
     gene            complement(<307317..>308795)
                     /locus_tag="CYME_CMP123C"
                     /db_xref="GeneID:16996046"
     mRNA            complement(<307317..>308795)
                     /locus_tag="CYME_CMP123C"
                     /product="V-type ATPase V1 subunit B"
                     /transcript_id="XM_005537744.1"
                     /db_xref="GeneID:16996046"
     CDS             complement(307317..308795)
                     /locus_tag="CYME_CMP123C"
                     /codon_start=1
                     /product="V-type ATPase V1 subunit B"
                     /protein_id="XP_005537801.1"
                     /db_xref="GeneID:16996046"
                     /translation="MESTKVESHRFEDVKPRLTYRTVAAVNGPLVVLERVRQPRYAEI
                     VTITLSDGTRRRGQVLEVNGDRAVVQVFEGTYGIDSGGTVIEFTGDVLRMPLSRDMLG
                     RVFDGSGRPIDGGPAFLPEKLADINGSPINPQRRMYPQEMFQTGISTIDVMMSVARGQ
                     KIPIFTSSGLPSDVVAAQICRQACLVRPPGTKKNDANDDQFAIVFAAMGATQETARFF
                     RRDFEENGAMTRTVLFLNMSSDPTIERIITPRLALTTAEYLAYDCGLHVLVILTDMAS
                     YCDALREVSAAREEVPGRRGYPSFMYSDLSSLYERAGRVEGCKGSITQIPIVTMPNGD
                     ITHPIPDLTGYITEGQIFLDAALHSREIYPPVNPLPSLSRLMKSAIGEGMTRRDHSDV
                     SNQLYAAYAIGKDVMAMKAIIGEEALTAEDHLHLDFLAKFESKFIHQGRNENRSVYES
                     LDLAWSLLRTFPAHLLKRVSQKILDEFYHREGVMDGPLNKKP"
     gene            <309280..>310458
                     /locus_tag="CYME_CMP124C"
                     /db_xref="GeneID:16996047"
     mRNA            <309280..>310458
                     /locus_tag="CYME_CMP124C"
                     /product="probable lactoylglutathione lyase"
                     /transcript_id="XM_005537745.1"
                     /db_xref="GeneID:16996047"
     CDS             309280..310458
                     /locus_tag="CYME_CMP124C"
                     /codon_start=1
                     /product="probable lactoylglutathione lyase"
                     /protein_id="XP_005537802.1"
                     /db_xref="GeneID:16996047"
                     /translation="MATEETTRRFRALHWVFKDPDRRKTYEFYRTVLGMKVLRHEEFD
                     SECKASCNGPYDNRWSKTMYGFGPESEYFACELTYNYPIKKYALGNDLRFVELASTTI
                     QERVRNSGWPFEEIQTGSVLELRAPGGYVFRCCGDDALTEAGKPPSKRLRTDIKQDGK
                     SVSAAQNAEQRVTEPDPFRKISLHVTDIERSISFYRDELGMQLEGRSSDPEDCVRLRY
                     PGDAFVVELVALPAGTALDHGEAYGRIAFSISGSPLDIEKKINENPKTLGRVQTPLVA
                     LDTPAKATVEVVILQDPDGYEICFVGESAFNELCVPDPDAEACLQEAMDADRSDEVPL
                     WRAAPEATDKDSKAAEETHAVDANEPAAATEDRKSSKKHLENDTQNDAPGSTAEPSAT
                     "
     gene            complement(311040..312734)
                     /locus_tag="CYME_CMP125T"
                     /db_xref="GeneID:16996058"
     misc_RNA        complement(311040..312734)
                     /locus_tag="CYME_CMP125T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461524.1"
                     /db_xref="GeneID:16996058"
     gene            <313296..>314123
                     /locus_tag="CYME_CMP126C"
                     /db_xref="GeneID:16996059"
     mRNA            <313296..>314123
                     /locus_tag="CYME_CMP126C"
                     /product="similar to 3-oxoacyl-(acyl-carrier-protein)
                     reductase"
                     /transcript_id="XM_005537746.1"
                     /db_xref="GeneID:16996059"
     CDS             313296..314123
                     /locus_tag="CYME_CMP126C"
                     /codon_start=1
                     /product="similar to 3-oxoacyl-(acyl-carrier-protein)
                     reductase"
                     /protein_id="XP_005537803.1"
                     /db_xref="GeneID:16996059"
                     /translation="MAAAAAPGSTPPGTPTEYDPFRFRSIEPDLRVAMVTGATGVLGQ
                     ATVRAFLDEGFRVVVHDNSVEDLNALVAQLGASATAEALYPICFDISRPEAVAAAMHR
                     IQTDFGQVYFLVNNNAVVSATHALDTSPEDWQYAFAQNVHSAFYMSREVLPAMRAKRF
                     GRIINTCSLAGKTGGITTGIAYSTTKGALQTLTFSLARETARDGVTVNGISYAYVQTA
                     TLERFPKEVVDQLLSSIPVGRFMRPEEFAFAVMFLSSPMAGFITGEIVDLNGGLLTD"
     gene            complement(<316502..>317167)
                     /locus_tag="CYME_CMP127C"
                     /db_xref="GeneID:16996060"
     mRNA            complement(<316502..>317167)
                     /locus_tag="CYME_CMP127C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537747.1"
                     /db_xref="GeneID:16996060"
     CDS             complement(316502..317167)
                     /locus_tag="CYME_CMP127C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537804.1"
                     /db_xref="GeneID:16996060"
                     /translation="MAESGEHRARLRYSRANFQRRLSTIQPNLESIQSLAQFILFMAP
                     TFASSLVQEWVQVFTESDRERRLHLLYVANEVLQHARHRLPVSTLEQLASLFFAGLEN
                     HLDVLFGDERFEKLMDVWQSRQVFTEEQLDRLRRRMKERLEWRARVQDAGKHIEAAIA
                     SLKDSESREVSDAQARNVEGVVIKLEEALQLVKRYLDGPDECASPEGRPNEDGSKSET
                     AFV"
     gene            <318868..>320118
                     /locus_tag="CYME_CMP128C"
                     /db_xref="GeneID:16996056"
     mRNA            <318868..>320118
                     /locus_tag="CYME_CMP128C"
                     /product="casein kinase II, alpha subunit"
                     /transcript_id="XM_005537748.1"
                     /db_xref="GeneID:16996056"
     CDS             318868..320118
                     /locus_tag="CYME_CMP128C"
                     /codon_start=1
                     /product="casein kinase II, alpha subunit"
                     /protein_id="XP_005537805.1"
                     /db_xref="GeneID:16996056"
                     /translation="MGTVRRKPPCSVARVYAHVNENRPREYWDYENLVVNWGNQDNYE
                     VVRKVGRGKYSDVFEGINVVNGDRVVIKILKPVKKKKIKREIKILENLWGGPNIVKLL
                     DLCRDPVSKTPSLIFEYIQNTDFKQLYPALTLNDIRYYVYEVLKALDYAHSMGIMHRD
                     VKPHNVMIDHERRELRLIDWGLAEFYHPGRLYNVRVASRYFKGPELLVDLQDYDYSLD
                     IWSLGCMLAGMIFRKEPFFHGHDNQDQLVKIARVLGTDDLYAYLAKYGIELRASFATL
                     IGRHSRKPWDQFVVPENAHLVTPDGIDLLEHMLRYDHQERFTAQECMAHPFFDAVRPP
                     ALVETLPTTAEPSDAEKNAHVSEYAVPENGAISPRSLAVDGPQGARRSMGTNAYERGA
                     ASATASAVMRVDNSTLWTSSSGAS"
     gene            complement(<320652..>321689)
                     /locus_tag="CYME_CMP129C"
                     /db_xref="GeneID:16996057"
     mRNA            complement(<320652..>321689)
                     /locus_tag="CYME_CMP129C"
                     /product="fructose-1,6-bisphosphatase"
                     /transcript_id="XM_005537749.1"
                     /db_xref="GeneID:16996057"
     CDS             complement(320652..321689)
                     /locus_tag="CYME_CMP129C"
                     /codon_start=1
                     /product="fructose-1,6-bisphosphatase"
                     /protein_id="XP_005537806.1"
                     /db_xref="GeneID:16996057"
                     /translation="MTTKGAPTFLEGTEAMTLTRYVLVEQRRHREAQGDLTLLLSAVQ
                     LACKVIESCVRRAGIAKLYGLAGDQNIQGEDQKKLDVIANDTFKLNLIASEKCACLVS
                     EEEELAILVDPSLRGHYAVAFDPLDGSSNIDANVSIGTIFGIYHIDNPQELNSSEDVN
                     RYMLQSGRSMVAAGYAMYGSATNLVFSTGETVNGFTLDPSLGEFVLTHPNMRCPPRGT
                     IYSINEGNSRDWDPAVREFVQRMKYPEKGKPRSLRYIGSMVADVHRTLLYGGVFMYPA
                     DSKSKDGKLRYLYEAAPMAFLMEVAGGKATTGREDILDVRPRHIHQRVPVFMGSAEDI
                     EEFLEIASKFQ"
     gene            complement(<322489..>325830)
                     /locus_tag="CYME_CMP130C"
                     /db_xref="GeneID:16996077"
     mRNA            complement(<322489..>325830)
                     /locus_tag="CYME_CMP130C"
                     /product="similar to microtubule-associated protein"
                     /transcript_id="XM_005537750.1"
                     /db_xref="GeneID:16996077"
     CDS             complement(322489..325830)
                     /locus_tag="CYME_CMP130C"
                     /codon_start=1
                     /product="similar to microtubule-associated protein"
                     /protein_id="XP_005537807.1"
                     /db_xref="GeneID:16996077"
                     /translation="MEVRLNQDVISRLQEVWAEIGLDEAERVRRVEALREQVIRVYVD
                     TLESAADERDTLENELDAAEALLLELQAEVAAAQKSAPAAWLPADVLSSSRRTVGGDM
                     TERQWGAASAANNTIELSTTFGAGGLGHTAAPDMSVSCTLPDEPSLRREAPTVERLLP
                     GASTNPGLAPHERSGRSGDSSGRQGTLLQCLDEVSRQVAALEAQKRLFVERLGELQKR
                     VLTLWVDELGEVVDDLPEEYRDALVITGSRRTRDVPSAVELGANVSPSHEANFTQITT
                     IASDLNNPLRKISIREYGQRIRALESKISELLELRQQRVQTIASLLVSIRGLLRRLCI
                     VSPEETESELDRLALTFDGTQEPLGASLVSIDVLTARVAYLEREIELRVEELDRVSNI
                     AAELYKALRYPAERFSAFQAEHSTLSKHSLEAWHSHVEELRATREKRLRALIAKEKER
                     LTALWNELDIAPAQRVSFAFCSNDEASEEVLEAIEQETSRLESIARRIRPIHELLRRR
                     EELLEKKMELDREMQNPERLFGRSGGKRIVGGLLREEQLRKQVRQLPKVNNVLRSLLE
                     SYAHEFQKRFIHKGVDILERLQQEEAAEAAMRVSRSGQRETPTNANSGAFVPVATVPA
                     NAASAAGSAGRLAAPSNATSARSTPTPRPNAPNTWNGTSAKKVLAAQVRKRVESKHDA
                     NTPFAVIGQAKTTTALAAASAEVPGAWCAWLSAAGPANQHHAIAREGSAAPYSMSCRA
                     PMIGDLRTPQFASKVADSPQSPGVAGIRPPGGCANQSTGQNDRCFTENASSSSGTEMS
                     TSNSHGCVQGGSVSERSTRTLDRSPAQTTPTERAGAKLAEHSYGSSAAAPSFVGVEYR
                     STPTGNSARLIGSLHSSQSDGHHSGGSAPSLRCASEAKLLDPSLSSGTSVSGSTLSPC
                     RQSQGTEHQQQQQQQLMEAGMQTHEHNAPALDTTSRASHIETPSRLSQEKKRAVQTSD
                     PESDQENSSLQANVAAEQSFRPVETPRAIKGVSDRGSPRLQESDLTMNCMPKKRVRSA
                     SSASSASTCTPNTTKMKCTAVDNQECTTGMPSNAPTRAHSCAEDSLSEQPGSTHSSTR
                     PPAASGEPYPVQFSADFPCAESPIR"
     gene            326183..329405
                     /locus_tag="CYME_CMP131T"
                     /db_xref="GeneID:16996078"
     misc_RNA        326183..329405
                     /locus_tag="CYME_CMP131T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461525.1"
                     /db_xref="GeneID:16996078"
     misc_feature    complement(329522..331126)
                     /note="repetitive element"
     gene            <332264..>333190
                     /locus_tag="CYME_CMP133C"
                     /db_xref="GeneID:16996079"
     mRNA            <332264..>333190
                     /locus_tag="CYME_CMP133C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537751.1"
                     /db_xref="GeneID:16996079"
     CDS             332264..333190
                     /locus_tag="CYME_CMP133C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537808.1"
                     /db_xref="GeneID:16996079"
                     /translation="METLRLTTKAFKVGALLVPSRKHIAHRSDLFRPIGAKARFATQT
                     HSEAAGDSPVTKAAFLERCTLDHVPTRGFSLEALQAAAEDVGLSPAWVARFDRGPVEL
                     VEWWREHELRTARVLLLEKGDWRLVDSTVAALARAPSTQVPEYAWTRARLLSFLQTIF
                     RLRAPYRRFWPQALALQLQPNSWSQGLGVLTKAVDELAWFAGDRSADMQWYWRRAAVA
                     SLLQTTELYWIATLPDTTMLEQNATSDSFQDSETWNFAQRQLADDSAFMTVWWRPNQN
                     LSSRSQSEIVALLRILGQGASAWARAWSKGFS"
     gene            complement(<333218..>335656)
                     /locus_tag="CYME_CMP134C"
                     /db_xref="GeneID:16996072"
     mRNA            complement(<333218..>335656)
                     /locus_tag="CYME_CMP134C"
                     /product="similar to transcriptional adaptor like protein"
                     /transcript_id="XM_005537752.1"
                     /db_xref="GeneID:16996072"
     CDS             complement(333218..335656)
                     /locus_tag="CYME_CMP134C"
                     /codon_start=1
                     /product="similar to transcriptional adaptor like protein"
                     /protein_id="XP_005537809.1"
                     /db_xref="GeneID:16996072"
                     /translation="MPSERPLKRRRSRVGTAEPENIANNGDDCAAPERRAVNQHLRGP
                     SSPTQKQKRSAESANLAGDVVALASSPLQEAVSTRHPSLAPRVFGARYRCNYCSRDIS
                     NCTRITCAVCPDFDLCISCFSVGASVYPHEASHPYRVVEYVSRPVFSTEWSAEEELRL
                     LEGLEMYGPGNFQLAAEYVGTKSKIKCEQHYLEVYLDAVDTAPLPNPERILSETRAPH
                     PSLPPGTARSAAVARELALTAAAAASLNPALARLIHAYPVTGDAKTTAADNSRTSKAS
                     RFPEASVATGELDHAAASLSSPATSQSDGIQTPKASNDARSQDGSQGMVKGPTSGDSP
                     ETVTCDASWPQGLSDDTPEVRISPPGRPRKGDIAGYMPKRQDYDVEPFQNDAELLIAD
                     MYITDEDTAEERELKLRILEIYSFWLDERSKRKTVVEQRGFTDLPAARARERAKSPLE
                     RRVGRLLLPFVRLTIGQGLQFDEFAQRLVTEVCLAREVTEIWEALRSGVRDLSEFEHW
                     KRERLLRERLHTTPFPVDVAEPPVRPAESTGALVSNTFQIVPESAAPRRRRGRPVRIR
                     TEEAAPGAAVVLSNAEHRSGLSTSDRRTPTVTTLTTGTQALAMRVLQSESAAEVTSWS
                     SIVHRQQTPQPRGAAPLSGSSDSSPTPNLLFVDNWPSAKRLSPLEKELCAILRLVPDR
                     FLEIRTVIAKHWKEMSEQSVGSAHAGGAQDPLPAMRLALDLRPRTGAATQHQQHQQHQ
                     QHHAPGTPSSGRSETLAEMQPVATERMRSNEQASSGSSQPADMHISGRESRTPRPYTR
                     HERERHHRRKASGQ"
     gene            <338402..>339367
                     /locus_tag="CYME_CMP135C"
                     /db_xref="GeneID:16996073"
     mRNA            <338402..>339367
                     /locus_tag="CYME_CMP135C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537753.1"
                     /db_xref="GeneID:16996073"
     CDS             338402..339367
                     /locus_tag="CYME_CMP135C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537810.1"
                     /db_xref="GeneID:16996073"
                     /translation="MSWHVPCEPYRREPSSRSVRVYPIQKNCPAVQNVQRWTCWGGWW
                     LPTSFAGPTSLQPLWEPCLAYPLSWRGSFAVACGAPSQLQSRVRLPPLSAYFPPHPDR
                     YIPDNTIALDHQECTTDEPDVQSATSTDTVVPLETLEWPQTTASTAATTTVTKSPLCI
                     PGRDATADDSRSDAHCVRGHDARSDGRQCYHCGVSKSPNWYLMENDRTRRLCNACGKY
                     WKRTGAQRPAHLVQCSQRIPRRRGRAPTSVRERQIRGALGSAPRKLQAMPFVGSPLTP
                     PSTSEGDAPNALSKVSQNTHAARPLLPSFERAADPSSRGANDGEM"
     gene            <340962..>342008
                     /locus_tag="CYME_CMP136C"
                     /db_xref="GeneID:16996074"
     mRNA            <340962..>342008
                     /locus_tag="CYME_CMP136C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537754.1"
                     /db_xref="GeneID:16996074"
     CDS             340962..342008
                     /locus_tag="CYME_CMP136C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537811.1"
                     /db_xref="GeneID:16996074"
                     /translation="MFSSGRAARFGEAPAGATSVYALDFDGVLCDSVEELSRCAYYAA
                     LVAFPAQLEAPRWTGHDSSRSASFTERGESPGKIATNPGLGAEDPSPAAAAAETARIP
                     TISENIWQAVPPAWLLDKMRKLRPYIETGYESILLVRMLIEERLVSERAERRPRPLTV
                     GEIAANWKSVLHDRLLRDWNIQPSFLIELFGTIRDAWIARDKSTWLSMNPIYPGVADA
                     LNMSQQPVYIVTTKQERFVKLILEHAGIRPGRIPPANVYGMDRKMTKIATIKEILRKE
                     EERSQDSQRKVVVHLVEDRLETLEAATISLLGAPVTYHLATWGYNDPAQRARAEKHPF
                     IDLLDLPSFTMKMH"
     gene            complement(<344574..>347039)
                     /locus_tag="CYME_CMP137C"
                     /db_xref="GeneID:16996075"
     mRNA            complement(<344574..>347039)
                     /locus_tag="CYME_CMP137C"
                     /product="similar to RAN binding protein"
                     /transcript_id="XM_005537755.1"
                     /db_xref="GeneID:16996075"
     CDS             complement(344574..347039)
                     /locus_tag="CYME_CMP137C"
                     /codon_start=1
                     /product="similar to RAN binding protein"
                     /protein_id="XP_005537812.1"
                     /db_xref="GeneID:16996075"
                     /translation="MHGSGPCPEAETPDSGLDSKASQYDTSRGDATSEMFSAARTPAT
                     SASTVFELYTLMGLQGWLENPLQPTTKRERAQRFRFQPFAAETAAAGTDVVSDEQQPS
                     EDPLKINWSEGLAREWLQIGLDGRHWRVRQFGDWYRRWKDQELPYLAAYGHVGPFERN
                     AIGDASTAAEFASEQTYPGNDDEVMADSSEEAPTSARHRRHRRQRPSCRVIEIGRARA
                     ASVGHKRPGVEATASVPEISFPSHWSSTDKAVGVDLEKHTDRPRRAYYVGPGKLDTDA
                     AAVRANVPVPTEACIYYYEMTVVSAGAEGFIGLGLCAGDVALERLPGWEKNSIGYHGD
                     DGHIFRDSGVGSPYGPTYSTGDTVGCCWNCITGDVFFTKEGVRLKRAFRNVRPTRLRR
                     GVASIPGERRAGNGGARSGSSNSSSSSSGGDGGAGTSGASHLPWAAGATRSPQWLSSY
                     EGWYPVVGMRTVGEIVEANFGQKPFRFDIEPYVREEVEMFLDSIVAATADNDDEDEHS
                     SVLHEQCALQNVVLDYLLTEGYVETARAFAKTVFPLERLVSQGDVHAAPEMDPPRSSP
                     RHQLRQQKLPQALSDASIRASIMDYILRGEIEQARSLGAEHYPRFFQSPASLGDCSGP
                     ASETALDQQLAAILLRCQEFREVLAHQSERSSESYSVFQYACGHLWPLLLECAGTAAG
                     KSALCSGPAEAQRDASQPPLGKHGRKSAPGNKAPAQTSNRTEEHRQLVQLLLLHHLIL
                     VTHADAAVLAPASLQRWRLLVAAAVNRALVLERPCRARPAGSSLEAPSLLARMLQHLS
                     TVMEMAVEHGAGYLSLIQTNHLL"
     gene            <348169..>348468
                     /locus_tag="CYME_CMP138C"
                     /db_xref="GeneID:16996076"
     mRNA            <348169..>348468
                     /locus_tag="CYME_CMP138C"
                     /product="U6 snRNA-associated Sm-like protein LSm6"
                     /transcript_id="XM_005537756.1"
                     /db_xref="GeneID:16996076"
     CDS             348169..348468
                     /locus_tag="CYME_CMP138C"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm6"
                     /protein_id="XP_005537813.1"
                     /db_xref="GeneID:16996076"
                     /translation="MLSGEQSSASGPGSTAGEYEGQAPATRTPTHFLRKVLGRPVVVK
                     LNNGTEYRGTLVCLDGYLNIVLENSAEFLNGELKRRYGDTLLRGSNVLYVGTIPD"
     gene            complement(<350085..>351239)
                     /locus_tag="CYME_CMP139C"
                     /db_xref="GeneID:16996070"
     mRNA            complement(<350085..>351239)
                     /locus_tag="CYME_CMP139C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537757.1"
                     /db_xref="GeneID:16996070"
     CDS             complement(350085..351239)
                     /locus_tag="CYME_CMP139C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537814.1"
                     /db_xref="GeneID:16996070"
                     /translation="MSRQTGLSQTPSRQRFICAECSRHPYQNKMEHARLANLGIHANA
                     WASSGFHGQNLLRDFSRMLPFPRPELRHHVWRSLLSFWFCFYPSKDVDDSVQVPISQL
                     LAIGNAIHAQVKAAIHASLAIFMFFACRLDAPVIAMKPGCGRVCVCVCAWVKHTGFSE
                     LRPMVRERLLYRSVHARDLWRWFNPISISVSVLSTVNLDHAALLGHPFGEHAVRCIHK
                     RSLFHSIIRHLSPCKLFFVCVSDSRNVRISITVIEVPGSLMGIVCTCSARLGQCSCGL
                     CYSILFWSLIGLCTDFSASTETNMNGARVELATVGGSQRVPKLLVWAHYRLPHGNCGA
                     LRVSRKRRCRCSLCLRPDLCRSHWRSSCRDGVLVLLVVHTCVASGEWECV"
     gene            complement(<351588..>352379)
                     /locus_tag="CYME_CMP364C"
                     /db_xref="GeneID:16996071"
     mRNA            complement(<351588..>352379)
                     /locus_tag="CYME_CMP364C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537758.1"
                     /db_xref="GeneID:16996071"
     CDS             complement(351588..352379)
                     /locus_tag="CYME_CMP364C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537815.1"
                     /db_xref="GeneID:16996071"
                     /translation="MQTAIESYLSQASKDESKGPKKARQERNRRKREAPDEPAPSSSE
                     EHAQVDTVPAGVPDAATELDVPSGMSAETPPLRNAARADESSEPSGDVLWLQLRIDRI
                     KKESEKTALLVFENDEFDLAGDTGTIGCVQWSHNADSGAVRLCLDLKGVVYETRTFSL
                     CGSALAVDPTSQRVEAVLHDITYSIPTNVADERAQLIRGKIEPYTGAGSIAADNADTT
                     WTVTAAPDDSSTASNAGTSGHRKEPPADSETGESAVSSGGHAASH"
     gene            <356634..>359165
                     /locus_tag="CYME_CMP140C"
                     /db_xref="GeneID:16995968"
     mRNA            <356634..>359165
                     /locus_tag="CYME_CMP140C"
                     /product="probable mitochondrial ATP-dependent RNA
                     helicase Suv3"
                     /transcript_id="XM_005537759.1"
                     /db_xref="GeneID:16995968"
     CDS             356634..359165
                     /locus_tag="CYME_CMP140C"
                     /codon_start=1
                     /product="probable mitochondrial ATP-dependent RNA
                     helicase Suv3"
                     /protein_id="XP_005537816.1"
                     /db_xref="GeneID:16995968"
                     /translation="MSVITRRPCFMPAAALRSQQQTFALVQSGFTCRLQLRYSSQGAF
                     LPSERPWRRRQVLELIRQVQQGERYRERLRRECQLPLGLWDLVAQRISGWKLKRLRRW
                     LRGAENLLLTHKQLPLKGQETLSEGAELSCAAHAPQELVFRAMLAYCRQRYGEELGSL
                     ARLAVCADLSLPATWFPLARARKRKVIYHAGKTNSGKTHQALQRFLNAESGVYCGPLR
                     LLAWEVYDRLNKQGIACILRTGQEFAMPPGSPSTANVKDAAMMPGSVSGALNHALSPK
                     TDDHEEEDEDEDEEESNASAAFDDERIHLGRHAHSGLARGVALDQSVTDPLDFPKQVR
                     FVSCTVEMADLYRPVQVAIVDEVQMIAERERGGAWTRAILGLPADELHLCGCPSAVDV
                     VRAMIEEDCHEQLEVRTYERLGPLRVSEKALGETQRQWSRGVRAGDCFVTFSRRELFR
                     IKHQLERNAIKPLQCAVIYGSLPPETRREQAQLFNEADTHSILVATDAVGMGLNLNIR
                     RMIFSALDKFDGTQRRPLTTAEILQIAGRAGRYAGPDRRPQCGEVTAFRQDDLRRLRS
                     ILHGAGIDTHGWPASIVPEKVTKAGLSPTREMMEAFAARCTAELASRSASGDDLMRRA
                     ATKRPPLSELYEKFENLAQVDASGRYFVCDLTDVKRICRLLERARVDEWMTFDLLYSA
                     SMAPLKLDDAAACEAMVQFMRAFTTSGVVRLTLQQCGSRMALRWLSGAPQWSSGPRTV
                     SELRELESLYHVLDLYNWFANRYTDAFVDRDRASELRQRCAEAVARGLANLSQSAIED
                     EHDDMQADTLSQRRPRRTRYRLRLDENERLQYVSYLRKHQPLYLR"
     gene            complement(359210..360620)
                     /locus_tag="CYME_CMP141T"
                     /db_xref="GeneID:16996067"
     misc_RNA        complement(359210..360620)
                     /locus_tag="CYME_CMP141T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461526.1"
                     /db_xref="GeneID:16996067"
     gene            <360880..>362220
                     /locus_tag="CYME_CMP142C"
                     /db_xref="GeneID:16996068"
     mRNA            <360880..>362220
                     /locus_tag="CYME_CMP142C"
                     /product="similar to acyltransferase Tafazzin"
                     /transcript_id="XM_005537760.1"
                     /db_xref="GeneID:16996068"
     CDS             360880..362220
                     /locus_tag="CYME_CMP142C"
                     /codon_start=1
                     /product="similar to acyltransferase Tafazzin"
                     /protein_id="XP_005537817.1"
                     /db_xref="GeneID:16996068"
                     /translation="MIHGNESQQRRCASPLWSWMRGSLRSHLQAGRQHLCSAPGDAQA
                     AGSEVTSDNHGAVQTSARVQRGARDTPRNLWSVLLGRDRTHTSALAAAEPPAVIALLP
                     SPVGVVAVAPKEPELLTWNRDRFDGSRTDAEITAESASREPLERQCAVASRQAAPVPD
                     SYQMLDVGSGRSFLNALTIAGVGIPSKLLMGSLERIHAYHLDRLHEAVMSRPRNTPLL
                     TVSNHKSVMDDPFLLAWMLPTRTLLHPETMRYGLCAVDICFRSKWLNHFFTAGKVLPI
                     RRGGGLNQPELYRAAEKLAAGAWLHVYPEGRVSQRCLGLIRRGVGKLLALAHEKRNAN
                     DPEILILPIYHEGMQTVMPQDEETNELVSMVPRIGREIFVWVGEPFTVSDILHKWQDL
                     GTISLAEDGPQQLSMYEEICDRIAGVLVELRAELRRRVLEDHGIDLRERLQSYD"
     gene            complement(<362598..>364067)
                     /locus_tag="CYME_CMP143C"
                     /db_xref="GeneID:16996069"
     mRNA            complement(<362598..>364067)
                     /locus_tag="CYME_CMP143C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537761.1"
                     /db_xref="GeneID:16996069"
     CDS             complement(362598..364067)
                     /locus_tag="CYME_CMP143C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537818.1"
                     /db_xref="GeneID:16996069"
                     /translation="MSSVASKGTKVELLPPGHAVYGQVYKVVLEPATTAPSQTGSGCD
                     AAPEEPAAPVALLPPPAIGERVAIHYRAYVAASDTDLKGEPDSQGRILFDVCDSDVAD
                     AVAPFTFVLGRHQVIPVVELALFTMRVGEKALVCCRAPKYAYGDRGRKGRGGRWVVKP
                     NCASIELEIHFLGTVRIVDGRPQLLALNGVTSLPWRPEAKALDGACQGGDAPNAPQSL
                     SSGALETEANGSSASCGDGTTSPPTGSTAGTQSVTAPPLLRFRKTRAFADLETDADRL
                     AYALEAKELGNYYFKGGQLEAAVQEYEVALQTLQLWGKAPSNQSGSSKTNEADDTGDL
                     SIQTQREQLTRTLLSNLARTHYRLGAYHDAIRLADLVLESAQHGKSDKREEDRVAPAA
                     EGAAAAGESAHCSLVGKALFTRGQAQRELGNYEDAKRDLLQVLRLEPKHTIAKKELEQ
                     LQRLIEVHRKQEKRTFGGIFSSTARRAPTASHVTTFDGD"
     misc_feature    365015..368410
                     /note="pseudo-gene of NAD-specific glutamate
                     dehydrogenase"
     gene            complement(<366427..>368412)
                     /locus_tag="CYME_CMP145C"
                     /db_xref="GeneID:16996084"
     mRNA            complement(<366427..>368412)
                     /locus_tag="CYME_CMP145C"
                     /product="heat shock protein Hsp70, cytosolic"
                     /transcript_id="XM_005537762.1"
                     /db_xref="GeneID:16996084"
     CDS             complement(366427..368412)
                     /locus_tag="CYME_CMP145C"
                     /codon_start=1
                     /product="heat shock protein Hsp70, cytosolic"
                     /protein_id="XP_005537819.1"
                     /db_xref="GeneID:16996084"
                     /translation="MSKAKAIGIDLGTTYSCVAVMEGNKVEIIANEQGNRTTPSYVAF
                     TETERLIGDAAKNQVALNPENTVFDAKRLIGRKFSDPTVQEDMKHWPFKVVQGPGDKP
                     LIQVVAHGDVKRFSPEEISAMVLTKMKDIAESYLGTKVTDAVITVPAYFNDSQRQATK
                     DAGTIAGLNVLRIINEPTAAAIAYGIDKKTSDNKERNVLIYDLGGGTFDVSLLSVDSG
                     IFEVRAVSGNSHLGGEDFDSRMVDYFVKEFKRKYKEDITGNNRAMRRLRTACERAKRT
                     LSSATQATIEIDSLYNGIDFYSSITRAKFEELCGDLFRSTLDPVERVLKDANLSKSQV
                     DDVVLVGGSTRIPKIQQLLSQFFNGKELCKSINPDEAVAYGAAVQAAILSGHESETTK
                     DILLLDVTPLSLGIETAGGVMTVLIPRNSTIPTKKSQIFTTYADNQPAVTIQVYEGER
                     AMTKDNHLLGQFTLTGIPPAPRGVPQIEVTFDLDANGILNVTAVDKTTGKSERIAIKN
                     EKGRLSEAEVERMVKEAEAMKAKDEEVRRTVEARNSLEQLAYSAKRTVEEEQVAQSLS
                     AGDKQKILDKTKEVLEWLEENGATASLDQIKNMQKELESVTMPIFTRMYQQAGGAADG
                     MPGAGGMPGAGGMPGAGGMPGAGGAGTGSGPTVEEVD"
     misc_feature    complement(368703..371379)
                     /note="repetitive element"
     misc_feature    complement(372682..373333)
                     /note="possible transcribed region"
     misc_feature    372696..374374
                     /note="possible transcribed region"
     gene            complement(<374578..>376170)
                     /locus_tag="CYME_CMP149C"
                     /db_xref="GeneID:16996065"
     mRNA            complement(<374578..>376170)
                     /locus_tag="CYME_CMP149C"
                     /product="probabale Mg2+ transporter MgtE"
                     /transcript_id="XM_005537763.1"
                     /db_xref="GeneID:16996065"
     CDS             complement(374578..376170)
                     /locus_tag="CYME_CMP149C"
                     /codon_start=1
                     /product="probabale Mg2+ transporter MgtE"
                     /protein_id="XP_005537820.1"
                     /db_xref="GeneID:16996065"
                     /translation="MSVVLGTQGTPKRLRSTSNAAMTSSERFGASFLSFVTSSVRWTG
                     QVAVHSGTAHRNACAWRTRVAGGLSYGATAARGVAGTRPASMGRSRVRLRRRVLSATA
                     STGPRAEHSNDTLRPLPDGLWQDSRSPTAETGDSLLKARVADREACVATIMGPGCVPA
                     GGVWTDTTSRREAVTVPLGYTVRECKGLLWQLHRVHDTAPVPDPATVNGTVRDSNSQA
                     PGSLQLPITAAMQVRNQSAPVLDALYVLDPCTSGLVGFLSLEDLLLAADDEQKIDQFV
                     RQCSVVLSVDEEFEAAVRRLRNVGALTAPVVDREMRLVGLVTAADIIREMELEATDDI
                     LRFGGVESPLQRDDIESYFQTSTRSFVIGRSAWLVALLLLQSLSSIVLGQYSALIERH
                     VVLALFLTMMVGAGGNAGNQSSALVIRGLATGEISPANAGRVIRRELLVGCAIATILS
                     AVGFTRVYIGGGDFLACVTVSTSLWITVFTAVLIGTIAPLILAQMGLDPCHCASPLLS
                     TLTDIGGVLALCLVGSIILGSL"
     misc_feature    complement(376665..378232)
                     /note="possible transcribed region"
     gene            <378443..>380353
                     /locus_tag="CYME_CMP151C"
                     /db_xref="GeneID:16996080"
     mRNA            <378443..>380353
                     /locus_tag="CYME_CMP151C"
                     /product="unknown DNA-binding protein"
                     /transcript_id="XM_005537764.1"
                     /db_xref="GeneID:16996080"
     CDS             378443..380353
                     /locus_tag="CYME_CMP151C"
                     /codon_start=1
                     /product="unknown DNA-binding protein"
                     /protein_id="XP_005537821.1"
                     /db_xref="GeneID:16996080"
                     /translation="MSRENGNNGQNGNTTDEEAFLVDERTMTVDGLPLHIWCRTPGNL
                     AKVRALVERGADVNAVDEHDATPVYYCALTGNAPVLRFLLEAGAVLDPKTFVGERVLY
                     AALTPEIKRLLLQYREQTLPSYTDALTEHLRAVLEGNENVGGHVDDDADVGFRLEGNR
                     CIWAHRVVLAARSPVFEKILEKRTSPGKVLRLKHVSTDAFEAFLRYLYTSTVSVRVRH
                     AEEFMTIAQRFHLDELAQEVDRQRQWLLRKREHKYEVVTHQRLEDLHINLFGASRVHR
                     LEQDLEHLLSRTDNMPFVDVYVQVTCPGPTYEECSLLVYPAHWLFLRRAEYFRALRDF
                     YRDRSSACAIVRIPSNISPFAFECVLHHMYHSSLPRNWREKALDCARLRREPCNHHAV
                     DVDMNEFLVEIIAAADLLGYPHVKQSAASAMEINRINVFGLIYAAACYQSRALRAACV
                     RILAEMLLDAVQPLLVPSVTAISCSATRVPEPGSIAEALVPHVDSQLRLPPADSRTRD
                     SSIATSQESNHASQCSSIAAVSATDTCTMPSWQVLNQCPTHVVQVDRHATVFQRARDF
                     IALRQVLSAVEFSEIMEDVREEALRLGLVHKFSSAVRDALGETLDCIVFEITDGLVLA
                     EGSAERTTRHHA"
     gene            complement(<380394..>381212)
                     /locus_tag="CYME_CMP152C"
                     /db_xref="GeneID:16996081"
     mRNA            complement(<380394..>381212)
                     /locus_tag="CYME_CMP152C"
                     /product="cytochrome c reductase cytochrome c1 subunit"
                     /transcript_id="XM_005537765.1"
                     /db_xref="GeneID:16996081"
     CDS             complement(380394..381212)
                     /locus_tag="CYME_CMP152C"
                     /codon_start=1
                     /product="cytochrome c reductase cytochrome c1 subunit"
                     /protein_id="XP_005537822.1"
                     /db_xref="GeneID:16996081"
                     /translation="MQVLTRLLNGAAFAAGVSGAGYLLMSAQPALAEEDHLPPPKYPW
                     SHRGPLSAFDAASIRRGYQVYKNVCSSCHSMNRVAFRNLVGVAFTEEEAKQLAEEVEV
                     EDGPNDEGEMFTRPGRLSDYFPAPYPNAEAARYANNGALPPDLSLITKARHGGADYIF
                     ALLTGYRDPPAGVHVREGLYYNPYFPGQQIAMARALYDDGVEYDDGTPATTSQMAKDV
                     ATFLSWAAEPEHDQRKLMGVETMVSLGILAGLMLYMKRFKWALLKSRRIEFRDM"
     misc_feature    complement(381615..384406)
                     /note="repetitive element"
     gene            complement(<387221..>387724)
                     /locus_tag="CYME_CMP154C"
                     /db_xref="GeneID:16996082"
     mRNA            complement(<387221..>387724)
                     /locus_tag="CYME_CMP154C"
                     /product="similar to cytochrome B5"
                     /transcript_id="XM_005537766.1"
                     /db_xref="GeneID:16996082"
     CDS             complement(387221..387724)
                     /locus_tag="CYME_CMP154C"
                     /codon_start=1
                     /product="similar to cytochrome B5"
                     /protein_id="XP_005537823.1"
                     /db_xref="GeneID:16996082"
                     /translation="MAMGRTTQFTLDEVAKHADKDSCWLVIDGKVYAVEKFLNEHPGG
                     EDVLLETAGRDATREFEDVGHSKSAREQLKEFYIGDVREPTAEELAAKRAVQASAAAE
                     RRDGDGVRANGLGKERLFAGGAFGAEPLSGGSSTWTLLKRLFVPVCIAVLVYLVREYS
                     KQVQTGG"
     gene            complement(<389373..>390524)
                     /locus_tag="CYME_CMP155C"
                     /db_xref="GeneID:16996092"
     mRNA            complement(<389373..>390524)
                     /locus_tag="CYME_CMP155C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537767.1"
                     /db_xref="GeneID:16996092"
     CDS             complement(389373..390524)
                     /locus_tag="CYME_CMP155C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537824.1"
                     /db_xref="GeneID:16996092"
                     /translation="MIPEQGACGQRHCRLSLLTGSATRTPSECFLISPFRAASGRSFS
                     LRTTAESERVHLRPVQRSARVLKRTRSACGTCVNRSVAHEPRRWTRRRTRRPSRLALD
                     STLQPAADSLVVFITGGSRGLGWALTRAFAQGGHRVAVCGRDTTRLADIRSELPPTLL
                     FAQRCNVASEDELESFVESAFSYFGESTMDVWINNAGTVGRRGSAVDVPAAALREVIE
                     TNLLGTMLGCRTAALHMTRAQNKHGHIFNVDGAGVFGNGTPYFAAYGTTKRAMPQLMR
                     SLNRELAGTNVSVHTISPGMMITDLLLRDSTAQMRLFFNLLAERPETVAAFLVPRIIQ
                     VARSQPPLRGAYIRFKTLPGAFASIAWNAIVPGRRYRFFDRHGNLVEEE"
     gene            complement(390602..390685)
                     /locus_tag="CYME_CMP156R"
                     /db_xref="GeneID:16996093"
     tRNA            complement(390602..390685)
                     /locus_tag="CYME_CMP156R"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:16996093"
     gene            <391195..>393531
                     /locus_tag="CYME_CMP157C"
                     /db_xref="GeneID:16996089"
     mRNA            <391195..>393531
                     /locus_tag="CYME_CMP157C"
                     /product="similar to triacylglycerol lipase"
                     /transcript_id="XM_005537768.1"
                     /db_xref="GeneID:16996089"
     CDS             391195..393531
                     /locus_tag="CYME_CMP157C"
                     /codon_start=1
                     /product="similar to triacylglycerol lipase"
                     /protein_id="XP_005537825.1"
                     /db_xref="GeneID:16996089"
                     /translation="MFVQRTFIAQHAREKSRPFNPSRSGKVGRRQHPVACSYLPLSPT
                     SPGPGPSRPEKELQKKIDNFLKQVRTSFARLTRRGQSREAERSAGPLPAPLSEALAAL
                     RKRFGDDSAQPSSSSTEDGSISSILKSASEFVDNIVSSGTGSMPDLGAVLSDLVEDAQ
                     SRLGQTRKEIERWSRDTSRYIQDQLPDDTAQRMRDLNDAVRSVAMTGPGDIDMPARLR
                     SAEQTLQNLRGDFENLKPYLSNTLSPVVSEAQRFLESIRSQYNRFVETKLAEMTASIG
                     IAESSYIAEPLRGRRVPFDAQLALLMAGFTFDAYRDPEPHEGKRCALGDLQTVYLSLD
                     FVRECFEGVLTGQTGRNWALEYPPEDSAREDSSYSFYIRDFENDDATVIENKPFFRTE
                     RRKVKVKQIPESRFVRFKLNGNGNEEHGLNSEQMVTSSESSLIGFANQATRRWTDAAQ
                     YAFHRTVQLAQRQANSTEIARSVEQLIRESNVPPGELREWDELQRRVLDEISCYKDTE
                     RLMFVKHVGTDTEFYIWRSPPGEPNRRVVFAFRGTVQMSWRDFLTDAKLNQVDFSEET
                     RVEGACVHAGFAEAYRSIRETVRRVALYFVEKSRREGTLSSEGLEFFFTGHSLGAALA
                     TLAALDVTRVLEDRGIPLSQRARNGVRIRMYNFGSPRVGNGVFARTFNTLVPDAYRIV
                     NDADVVARMPRTLSFDYHHVGSTVLVNADGKLWIEGQSPGRDPLKERWSTIEDLIKLE
                     QRAFESIFNNEALLHHLEDAYFVALARTIVRISESAIL"
     gene            complement(<393861..>394910)
                     /locus_tag="CYME_CMP158C"
                     /db_xref="GeneID:16996090"
     mRNA            complement(<393861..>394910)
                     /locus_tag="CYME_CMP158C"
                     /product="similar to dehydrogenase"
                     /transcript_id="XM_005537769.1"
                     /db_xref="GeneID:16996090"
     CDS             complement(393861..394910)
                     /locus_tag="CYME_CMP158C"
                     /codon_start=1
                     /product="similar to dehydrogenase"
                     /protein_id="XP_005537826.1"
                     /db_xref="GeneID:16996090"
                     /translation="MDRNICIAVLGLGEMGTIHAESLRRLGGVELALASKRSEVLHEL
                     AERLYVPCALRFESYEDALASPRVDAVVVATAPADHTERIVRAAQAGKHIFCEKPLGL
                     SAASVEKALAQVEHARLERGDFGKKVFMVGFMRRFDPAYARGKLLVQSGALGKPTVLK
                     CTSGDAEYPAKYQRDLGYNSMLLDLAVHDIDLARWLLGAEVHRVHVVCRSLVYPQLAG
                     LGDADNALALLEMDSGALVSAHFCRAFNYGYNVTSELVCERGSVYLGELKRPGDAIRV
                     ADPAGALSERIAPVFRERFEQAFQREMEVFAEAVRKGTLPAGAPGPLDGLAATRVAEA
                     LVRSWQTGSPQVVQH"
     gene            complement(<398687..>398995)
                     /locus_tag="CYME_CMP159C"
                     /db_xref="GeneID:16996091"
     mRNA            complement(<398687..>398995)
                     /locus_tag="CYME_CMP159C"
                     /product="U6 snRNA-associated Sm-like protein LSm5"
                     /transcript_id="XM_005537770.1"
                     /db_xref="GeneID:16996091"
     CDS             complement(398687..398995)
                     /locus_tag="CYME_CMP159C"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm5"
                     /protein_id="XP_005537827.1"
                     /db_xref="GeneID:16996091"
                     /translation="MAAHANQPSLYPLELVDAAVGTRVWIILRGAREFCGILRGFDEY
                     VNLFLEDVDEYTYSEEGIEKQHIAQMFLNGSQICVLAAAPTLDGSQQLGCAYVPSSTT
                     "
     gene            <399839..>402316
                     /locus_tag="CYME_CMP160C"
                     /db_xref="GeneID:16996086"
     mRNA            <399839..>402316
                     /locus_tag="CYME_CMP160C"
                     /product="protease IV"
                     /transcript_id="XM_005537771.1"
                     /db_xref="GeneID:16996086"
     CDS             399839..402316
                     /locus_tag="CYME_CMP160C"
                     /codon_start=1
                     /product="protease IV"
                     /protein_id="XP_005537828.1"
                     /db_xref="GeneID:16996086"
                     /translation="MWVRGRWLLQPLRSNRATCSSLSTGRAQSSPQEDGATAKAGRFW
                     GGGWVSRLSRTLRNTLALIGLSTIALSALTAARADQAYRAAVGDRPASVILEIPLDRI
                     VITEEEPIEDLAVWRRLWRRLSSGSMSPPEPVSLFQVTRALEDAARDPRIAGILTTSG
                     SNQGRAFRAYTNPLGVLEEVTAALRSFALAGQPTAFYAPSFENTAMYYLAAAHEKIFM
                     HPTGIWNVVGLSAGGLFLRDLLDAKGVRIDVIRCGEYKTAANIFTQTAYTPEHREAVQ
                     ALLDTMYVTIVQAIAANRRKEPARVEALINTAPLSASEAFEANLVDALAYPDAVRSQM
                     QALVLARMQERAAERQEARELLEQALLNPQALEDLSDSVERWLRTRPWEANPPSVERE
                     PAAEWFAAYEAVQRARSTVANSDSEIPAENATVLVERIQALLKLSTAQETRLGDAVPD
                     ASIDAKRPASRSEGHARRESTESLRFCPVTDYIAERSLFRSRLERAQQSGLEWLKRRF
                     SRTEPLGNADRRASIPVIAIVPVTGVLTDGSVRSPLRALRKASKDPKVCAVVLRVVSP
                     GGTVTASENLRQAVEQCAQAKPVIASFGEVAASGAYLAALGAKHIIAPTCCITGSIGV
                     ILLRLNLLDVAKRNGIQFDHVSIGKNAPSFAAVSSLFQPLDEEQQQRLQSLVHWQYKL
                     FCERVSRARRLSEEAAQRVARGRVWSGADALRNGVVDQQGGLQDAIRLARREAGLAAW
                     DPASVDARYGQYSGSAVQTLRRLTSRDRDDTEQEQLAELVLRSPMITVPSEVQRYLGQ
                     CLQLLGHASVPEPMALWLEGIGFWIHS"
     gene            complement(<403369..>404274)
                     /locus_tag="CYME_CMP161C"
                     /db_xref="GeneID:16996087"
     mRNA            complement(<403369..>404274)
                     /locus_tag="CYME_CMP161C"
                     /product="similar to dual specificity protein phosphatase"
                     /transcript_id="XM_005537772.1"
                     /db_xref="GeneID:16996087"
     CDS             complement(403369..404274)
                     /locus_tag="CYME_CMP161C"
                     /codon_start=1
                     /product="similar to dual specificity protein phosphatase"
                     /protein_id="XP_005537829.1"
                     /db_xref="GeneID:16996087"
                     /translation="MTAGSTRQAAGGYLREPHAPILVVPPALYIGSLETALEVARRGV
                     LYPVQVIVSLGCGDAVRALEDWTRQAPGRFWYEAPDLKDTPDQDLWPILGETVPLIQS
                     AQRERHGVLCHCVSGRSRCLAVVCAYLMHSYGHDFAEAEAILKRSGVEPDMNPGFVLQ
                     LQRWKGGRTAIAKASHGLTYMGLCRAWSSEYALDWKTVEQEARCGFVCACCRWCRVPL
                     FRLAEDVVREDARTFQLYAISWMQQSTEVPGAACGVVQSGGGRLRCPGCSRKLGAFRF
                     EPFRDALFLVEKQVVIVRRQWKPGA"
     gene            complement(<408110..>410737)
                     /locus_tag="CYME_CMP162C"
                     /db_xref="GeneID:16996088"
     mRNA            complement(<408110..>410737)
                     /locus_tag="CYME_CMP162C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537773.1"
                     /db_xref="GeneID:16996088"
     CDS             complement(408110..410737)
                     /locus_tag="CYME_CMP162C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537830.1"
                     /db_xref="GeneID:16996088"
                     /translation="MGESSSVQQSDRACTEWSRGRPAGGFGTMDRVYIRRQVLQTVWR
                     LRVGDAEQRALAMRSLRPVEDAAWCEEWALQGGWVLTAWIARIWRLACNQATSKKLFR
                     TGFSSEQGHASGDAMQHASRPISRAVMESLRDACVSASAEASRLLLRCAPYSVRGSTP
                     HLLEFARQAAVAPVLLESWSQLVAASPAVAGERRTVGRHSVESALPDPAATTLAHERT
                     ANHSLDDTQMFAVLRGTLERILEADPSPLRRLPLFPDDTDGLLALPTETPEQEYARLL
                     ASACVRHADTRAVTLLFEQIDGNPKADECMRTLMLLADSRQQQGAGLVNMNAAETPRP
                     SSPNSRDRSGTAGVQAADLLRMEIAKRITDRFSVTLAQQYPEWIRIFCEWKCRTDHTL
                     LQACADRALENACEELLGYSSNRLDLEVYLLSPEPTLARACAPLVDVVFVHGLRGDPL
                     LTWRCGAYDVRKPTDEDLVEAPVQATAARKSMKAWQERLWPREWLAPDLGASARILSV
                     GYSSALTAWGSSEESGATLSLSEQAADLRRKLLRAGVGKRPLVLVAHSYGGLIAKQLL
                     VDDAAASAADTPGAGTLSRALRGIAFYSTPHHGSAVAGRFLGGILDKAVRPAAPVREL
                     LPYNESIEKLHRAFLTLIRHPCRELRDDQGRTRLPGVLWGLWLAASAGQQQRDGSRSA
                     LDAGTTKYARRPAEGGAGIRSELQSTVADQHAHRGQQSSREPSRRQVFRERGDQVLDV
                     LGPVSVGTEYVQGLLREEIKRRSAADDDEQEAAASDCDVPSSPAKKLSLEPSCILPPV
                     QVLSIYEGTTTRTWGGSRFLFVSEESAYAGVGELVRVDRADHLQVCKPPSREDVRYRS
                     VLDMIQRIVQETSVWCDEC"
     misc_feature    411598..414725
                     /note="repetitive element"
     gene            <414905..>417016
                     /locus_tag="CYME_CMP164C"
                     /db_xref="GeneID:16996099"
     mRNA            <414905..>417016
                     /locus_tag="CYME_CMP164C"
                     /product="similar to ribonuclease III"
                     /transcript_id="XM_005537774.1"
                     /db_xref="GeneID:16996099"
     CDS             414905..417016
                     /locus_tag="CYME_CMP164C"
                     /codon_start=1
                     /product="similar to ribonuclease III"
                     /protein_id="XP_005537831.1"
                     /db_xref="GeneID:16996099"
                     /translation="MCMVVAKGVIARFSGSVHNLGRWRSWLVSRTALFRPFSLRGERA
                     LLADPRCQNDNVAAPLLPVQLSSSHPRGLLSANLVYRTARFICTKQCLPATAAEPPVQ
                     QQHQQQQDGNVTDSACHRKCLSFLQAWSIPEFPVVSGTQLGAFHGWPLLLRALTHASA
                     LPPRLCPRESGVLTDAQRWERYQLHNAALEFVGDRVLNLCVVDWLVRTQPWKTQGADT
                     ALYRGSNIKERLTFYVQQYVYNAHLTDVAYRIGLDRIVRRRLPAEKEHPGRGTELVLA
                     NAFEALVCAIFLEHGFLQAQKFVRQTLFEGPGSSLKQPMGDSWHADTRFAATDTARVR
                     QEAAALDRMRQPVLRPPHNIPLSSHPKEALEKELLLWGLCIGGNRSAGGEDLRTRAQQ
                     QKRSGVCLSYCLEHEERRLSHHSLYMVRLELSGVVVARGRGRSIRSAENAAAAAFLKA
                     LGLDCASFRTPYASGEALSSREIWKQFRDLNVPLCIPDNYKPASPFDEDADWATILLW
                     NRERFGSVSRQEQKTRAKAEEREERSPGDAVFWHQALGFDDWANARQVLPSLLALVLP
                     NEGPEPEAARTALAAAELVELKYLGHCGLKLFAASSSLRIYGPGAWSTGALHDDYVRA
                     IASTAVTGQAAELLRRLQRAGAWRTRQRLSAAAQRELLLAFLGIAQVLFGYEKGPDLL
                     LRTLDEEKRASTPVSFDRPHL"
     gene            complement(<419497..>420852)
                     /locus_tag="CYME_CMP165C"
                     /db_xref="GeneID:16996100"
     mRNA            complement(<419497..>420852)
                     /locus_tag="CYME_CMP165C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537775.1"
                     /db_xref="GeneID:16996100"
     CDS             complement(419497..420852)
                     /locus_tag="CYME_CMP165C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537832.1"
                     /db_xref="GeneID:16996100"
                     /translation="MLSLQEASTAAPRQSWTLPKVWVLCVAASQKAQPAAFTQLSGVA
                     CLQHCTVHNLSWLRPCSAFVLSGSGGKSVLNTRQRSVSCTSTVCASVPSARTRPVRGT
                     LCAGTRALERTWLGPPEQRLLRPSCSASMTRVRSAWRSGCAATRLQAKTEPDLESRER
                     KPERRSLKRTLYLFGLAGGAIGAVSVLGHSLGTLSIENLHDLVKWFESMGPAAVLYYF
                     GLYFVLELVSFPALLLTIGAGYLFGVWRGLLVSSAAATAAAGTSFLLSRYFLRNLIQE
                     KLASRFPRFRAIDRAIAKEGFKIVLLLRLSPLLPFSASNYLYGLTSVRFVPYIVASWL
                     GMLPGTLAYVYAGRTGNAVLERVASRAASDAGEELAASGTGVNTALLIVGLAATAGVL
                     VLIGRTTRQALKEMDEEMAADAALQSNGKDAGKFPTTQRGEVVAVDTPRGPSPERMKR
                     P"
     gene            <422229..>423464
                     /locus_tag="CYME_CMP166C"
                     /db_xref="GeneID:16996094"
     mRNA            <422229..>423464
                     /locus_tag="CYME_CMP166C"
                     /product="phycocyanin-associated rod linker protein"
                     /transcript_id="XM_005537776.1"
                     /db_xref="GeneID:16996094"
     CDS             422229..423464
                     /locus_tag="CYME_CMP166C"
                     /codon_start=1
                     /product="phycocyanin-associated rod linker protein"
                     /protein_id="XP_005537833.1"
                     /db_xref="GeneID:16996094"
                     /translation="MIGFVGSVSSLGARVSSFTASCSASNSCSVVAAPRRAFDLRAAE
                     EKPQTSSSSAAGSSSASSSGAGSSERAAPSAVSSPPAAATSTQSGAAKMPTMTALKTA
                     ANRKLGEVTQARLRKVGDSVTPSYRQIDSFRVPAYPIPGKDDEVSRRTERMYMILRQI
                     FGYGHLFERDGEEMDKLQSCYINGELSTKDFVRAVAKSETYKEKFWNNRPPFGRYGAV
                     ELAYKHLLGRRTFDAKENAAAQAVYHAHGYDAMIDYIIDNEYDRAFPFRNDGSDNVPH
                     WREPAWFMGRRPEPQALRGGLERAMSGARGAMLYQYRVRLGSQNMGVVAGGCPPPVNL
                     KNKTDEPVFRVVTAGYREPAVNSGGLGYSVGRSYTRQNKYSTVARSQRTYLVPLSELN
                     NTITRIHRSGGYIRTVERA"
     gene            complement(<424517..>425500)
                     /locus_tag="CYME_CMP167C"
                     /db_xref="GeneID:16996095"
     mRNA            complement(<424517..>425500)
                     /locus_tag="CYME_CMP167C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537777.1"
                     /db_xref="GeneID:16996095"
     CDS             complement(424517..425500)
                     /locus_tag="CYME_CMP167C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537834.1"
                     /db_xref="GeneID:16996095"
                     /translation="MERSGEASILELAKSIAEGTTVESPDFEASLADIERFTTAWKTR
                     SVLLSEHLVSASRCLLGGAPANPEAVCQGPSAASQAGTLESLSLAASQCVTGEREAAN
                     ILRTARKVREALLSCQEPTPTGTEGQTTESFTDTWRRFEETGRSARSASSGETITERN
                     RDKVRRLVEGGTMQSASADSLSDPSLAATQQASPDPIVGDSTAPTYVAADWEPDASRI
                     RCPVSGVVMQQPFRNRDCQHSYEKQSIEQLIRAHNRLRARERLTDRHAAPCPVAGCVA
                     TVSIGSLEPDTELMLVIERLQRRQERLQNRPMPWGPTECTDSRDPIEDSPR"
     gene            complement(<426688..>427491)
                     /locus_tag="CYME_CMP168C"
                     /db_xref="GeneID:16996101"
     mRNA            complement(<426688..>427491)
                     /locus_tag="CYME_CMP168C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537778.1"
                     /db_xref="GeneID:16996101"
     CDS             complement(426688..427491)
                     /locus_tag="CYME_CMP168C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537835.1"
                     /db_xref="GeneID:16996101"
                     /translation="MEAVTENPPRLVLMTAERSKNFACTSELVYWTISIFVRHQISRA
                     LGHRKRADNTKRPHAGKAIITVMFPYIIVPRNDSFAHTCRAATVPSGSRTQGASLRSV
                     AGNAHQESLRGELLCKRFRPDKDMLRWESLYSTKICSHTPGQLNWSQTPVYLGICRGF
                     ASDNVSGSSFATRGHHMGSIYEMCAALGQGRSWVRSNPVFGRMIAALRGVHQSNDSAK
                     SSVRLGYWPETARQFRTRRVFFVNACEHRLQCRGTGAEVSFASVLWKCP"
     gene            <428869..>430935
                     /locus_tag="CYME_CMP169C"
                     /db_xref="GeneID:16996102"
     mRNA            <428869..>430935
                     /locus_tag="CYME_CMP169C"
                     /product="similar to expression regulator of ATP synthase
                     Nca2p"
                     /transcript_id="XM_005537779.1"
                     /db_xref="GeneID:16996102"
     CDS             428869..430935
                     /locus_tag="CYME_CMP169C"
                     /codon_start=1
                     /product="similar to expression regulator of ATP synthase
                     Nca2p"
                     /protein_id="XP_005537836.1"
                     /db_xref="GeneID:16996102"
                     /translation="MDFKDLVALRCELSVQSLTEVSAALRRVILSKSYYEYQVTRAPL
                     RSFLNNGPLWIFQTLSGAGSLWVSNFYDTCRDLIASGTRPATGTSSSAAGGAPARASP
                     TRASDKTEKKKARRLLELCQAAQPPGLRSLCELERARCQAAVHALGRLERALAVYLGR
                     AQEELSRLRSLVEKDPQNSSELRALFLSCDELHHRTLTALEATDVDAIEEAVYAHLLV
                     DSDVLADLDRWASIMKEDAERFITLLRDVPRRWNVYLTLEELSRIMPAAGRQSGKRRG
                     LGFIERLQRVSLIYPSHFARNWIRYLCGTLTIFWSWTKISAHREHVMHIALSVRQVVR
                     GFWDERIITPLTMIYREIFQSSYRTFMDPKAVQAEKETLKRMVVDFTREAYARLPDDQ
                     RQEAELLAANGDLTPVMKVYERQIRSPVVNMLAGDVIRALLIQVQKLKVDVEQEMVAV
                     DSLVRSNELNLQIAAAVPGVLGCCLAVALLYRWFRRWWSSIRLTEVDRFGGGGYLWAN
                     AFAEKLPTRERARLLLRDIERYLVLTLSLRGPEAASARLQETPLLQKAQVLNGRAPAS
                     LASASPERVQRVSDRTLATFFPGGLAQGETGENLKSSENSVIFLSTACIAEYEDKGRI
                     LLTLDELEAMVTSRAGEFGISRGSQLETRLREDLLDLRSFALDAEQKLLTILRMRSTY
                     PFLWDR"
     gene            <433407..>434189
                     /locus_tag="CYME_CMP170C"
                     /db_xref="GeneID:16996103"
     mRNA            <433407..>434189
                     /locus_tag="CYME_CMP170C"
                     /product="similar to formamidopyrimidine-DNA glycosylase"
                     /transcript_id="XM_005537780.1"
                     /db_xref="GeneID:16996103"
     CDS             433407..434189
                     /locus_tag="CYME_CMP170C"
                     /codon_start=1
                     /product="similar to formamidopyrimidine-DNA glycosylase"
                     /protein_id="XP_005537837.1"
                     /db_xref="GeneID:16996103"
                     /translation="MPELPAVERARRMIDALCKSYRRINVQSAPDPKHASEFVDKLFE
                     GRLGLDLLERRVCVGHVLRQLGRHGKNLWFEFDEPPHVFVRFRMAGSFVVRGHEDGYV
                     YETFRRRTAACRFHDSGTPLVSVWPPKHTHIVFSFAPCSPGVDSASINGISVREFALV
                     DPRKVTRMRLSDSSCPSVEIRSLIGGFDALHALPPIERFERKMLVYPKANIKSLLLGQ
                     RFIAGLDNWMVDEVLYYAHIHPESRTCDLTRIDVAALHQSIA"
     gene            complement(433804..436111)
                     /locus_tag="CYME_CMP172T"
                     /db_xref="GeneID:16996115"
     misc_RNA        complement(433804..436111)
                     /locus_tag="CYME_CMP172T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461527.1"
                     /db_xref="GeneID:16996115"
     gene            <434517..>435191
                     /locus_tag="CYME_CMP171C"
                     /db_xref="GeneID:16996117"
     mRNA            <434517..>435191
                     /locus_tag="CYME_CMP171C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537781.1"
                     /db_xref="GeneID:16996117"
     CDS             434517..435191
                     /locus_tag="CYME_CMP171C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537838.1"
                     /db_xref="GeneID:16996117"
                     /translation="MPRIKHASTSDGRSKTVTTHGKGGSSTVRSSRASARAGTDAPRS
                     LARTGGAQDHNLRRCSSESTEALSDSDTSWKRSDAESADETSGEHDRSATRKRKQTQV
                     SGSAVNGKRAVRGNGVRELEQPTAAAATVKTEAASLKKKPADSAKKLKASEVTFVFDE
                     LRNDQRFITPRQLMRAIMCQMGQQEAEQMTDSDITAMIRLADTNGDNRIDREEFENFV
                     QREIRL"
     gene            complement(<436805..>437650)
                     /locus_tag="CYME_CMP173C"
                     /db_xref="GeneID:16996116"
     mRNA            complement(<436805..>437650)
                     /locus_tag="CYME_CMP173C"
                     /product="similar to protein-S-isoprenylcysteine
                     O-methyltransferase"
                     /transcript_id="XM_005537782.1"
                     /db_xref="GeneID:16996116"
     CDS             complement(436805..437650)
                     /locus_tag="CYME_CMP173C"
                     /codon_start=1
                     /product="similar to protein-S-isoprenylcysteine
                     O-methyltransferase"
                     /protein_id="XP_005537839.1"
                     /db_xref="GeneID:16996116"
                     /translation="MTFLAGDELAFVPAALCRETLSPLWGRSTSRRHSGRTGLACTPS
                     SRAQRATLLMRKVDEAPKASKSAPEIVDATPANESVTVELGEKLQKVLESIEKIPEAI
                     SKKIANFDVEKFSRDSAAYWKRVLDNTVAGEWFNRGETYVVIQLALILLILRDPGALD
                     PVFGFLMGPVPLFLGIYVVVQAIRELGPENFVPWVKPPASAALKTDGLYGLMRHPIYT
                     GIVLTSFGFSTVSHSPERLVLTLALFYFFTRKATEEEKYLIERFGKEYEEYAARVKAF
                     IPNVF"
     gene            <437367..>437834
                     /locus_tag="CYME_CMP174C"
                     /db_xref="GeneID:16996118"
     mRNA            <437367..>437834
                     /locus_tag="CYME_CMP174C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537783.1"
                     /db_xref="GeneID:16996118"
     CDS             437367..437834
                     /locus_tag="CYME_CMP174C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537840.1"
                     /db_xref="GeneID:16996118"
                     /translation="MLSNTFCSFSPSSTVTDSFAGVASTISGALLLALGASSTFRISS
                     VARCARELGVQAKPVLPECRRLVDRPHSGESVSRHSAAGTKASSSPARKVICGCTLRR
                     ERSLSGSLYRRDTRTFCRRRKYAPYIVIHFMRSTWTRRPWHSIGAGMSVNVHN"
     gene            <438017..>438370
                     /locus_tag="CYME_CMP175C"
                     /db_xref="GeneID:16996119"
     mRNA            <438017..>438370
                     /locus_tag="CYME_CMP175C"
                     /product="60S ribosomal protein L31"
                     /transcript_id="XM_005537784.1"
                     /db_xref="GeneID:16996119"
     CDS             438017..438370
                     /locus_tag="CYME_CMP175C"
                     /codon_start=1
                     /product="60S ribosomal protein L31"
                     /protein_id="XP_005537841.1"
                     /db_xref="GeneID:16996119"
                     /translation="MVRATKQALLKEDVTREYTIHLHKYIHSVVFKKRAPRAIAAIKA
                     FARRTMGTEDVRIDAKVNKEVWKNGIRGVPNRVRVRLSRRRADTDASKPKLYTYVTLV
                     PVTSFRGLQTVNVDE"
     gene            complement(<440385..>445307)
                     /locus_tag="CYME_CMP176C"
                     /db_xref="GeneID:16996110"
     mRNA            complement(<440385..>445307)
                     /locus_tag="CYME_CMP176C"
                     /product="similar to TFIIF interacting component of CTD
                     phosphatase Fcp1p"
                     /transcript_id="XM_005537785.1"
                     /db_xref="GeneID:16996110"
     CDS             complement(440385..445307)
                     /locus_tag="CYME_CMP176C"
                     /codon_start=1
                     /product="similar to TFIIF interacting component of CTD
                     phosphatase Fcp1p"
                     /protein_id="XP_005537842.1"
                     /db_xref="GeneID:16996110"
                     /translation="MAMEGDWETWELRAPSCWPPVLEGPTRGPSECADAALTCSTSSS
                     VSTAAEATAWRGSTTPLSSSTTPLEDSTAANASVEAQNDSSWASEKAGRKETRSLNTE
                     VVAFPFYVIMHWYAEDGGDVAAGSSVAELVRFSVEQPSRTDESVKVVLFETEHSGQGP
                     VSTTNGQSGLVTRKGSGQEPMFRVGRAHLPSRVNGTLKHLAAQLPTDLAQKLASIMES
                     ESDKEQLSEVIRACAFSPARVEPGQVIGTVQYCTHSTVYRGICVNCQRDVSSEARAVP
                     TVARPQSQESTTFSYGPSMGHGSSFRRVAWMEDSGSDILRSSRKFHIPVAYQNHQLSV
                     SLRKAEELSEENARRLLRQRKLPLVLDLDHTLVHATNDPRAREILCVLSSTLHASLQL
                     TGALSEWERILQDPSAPIAERLLRELTRMDSPNRVVSKVSADRADLNATEQSAATVDR
                     LLQNLFQRLGIFAFAIGKDTSASRGCAPLDNTTDAKLVPFWRWWRTDPASLQQTNSSK
                     GIGQTADANTSLYYIKLRPGLHEFLRTIADRFELHIYTMGSRPYADTVASIIDSDERL
                     FQGRITSRDDFEDGRLNQKNLKHVFPCDDSMVLVVDDREDVWVAQDQSLHGRHFPNLI
                     RARPYYFFRGLEETFQREQHTATTDILTNTHDHSDLSLIVDGDPAPSREGVLLSENSQ
                     NSPSSAVKSALWFLQQWIAADHQDHSHLRRLAEILAECHQRFFTLYDQYVASGIEQHP
                     IAASELDPSTSVSKSDQLQSLSIEYPRQRLAEVAHERDVFEKGSRIQRLRRHSDSVTA
                     RYPDQCPLERRTLDGNVSEAVLQANAPQHEPTQERSSSDPAVNALSGSPLIASSKAEG
                     SFLPGSYSTVADIHGYKARGGELLQRTGAAVNAKASNAYDGDSEPNMHTFPSYCDNQS
                     PKGTSTELFLTKGPSKMPDEGGCAVYRGTSAGAMQMMVWDRHEKRTKSGTDSPLSAET
                     GMRMLPATFEVQEATGAARILHAEDANLAFTYDLGTGGAKDYPSSILGTDGGGEFADG
                     NQASSVVVEARSLHVADSDGAEDENVDDDDDDDESAAIASPSPAPTVHDFTAAADVAE
                     EERDPGLSFSTKGDLSEQSRTDGLGDTPTPITQRSWDSMVDRNTPAQVESGSTFLLIS
                     QALGGESCADGKIIRRSRRLLEQSLKRSNGESGKQSADSGSTAWATLGSAVGYTRTGR
                     KRNLSASREMNTGGIALKDSVSERTSFTIDPNCEGEIGRYDKPTIADSSERQSVAPTK
                     KTRNRFPERAREQRRSPSPATQLRQNLLRRTAALALAEGDEQNRITSGTLAESSTTQK
                     PSPGSNPEHDGATRRPRRVLRPRCHPEATPESRSTPPVPPPSGGLDPVKRGKAYTVSA
                     SLPLWRPPASIKDILAELRRSVLTGCELCFTGVFAKHAGMAPEDHELWRLAVRFGAVC
                     HREVLPQVSHLIADPQRGRDTLKTQTARAMNSVFIVKPTWLVCSAEDMRRANELEHLL
                     DDGESASATFAGDSVAQRASGQDGSSISKLVNLEAYRAQMASLRAERLQHGLHAVSPA
                     SEAEEGREFAQEHVPWRTGHIPDSCDDGEAPCNNVGERDLSGASLGFPNHRQAEALSP
                     DAEDACDSLLERELEHCMCGDTRTDQGPQA"
     gene            <446119..>446388
                     /locus_tag="CYME_CMP177C"
                     /db_xref="GeneID:16996111"
     mRNA            <446119..>446388
                     /locus_tag="CYME_CMP177C"
                     /product="transposon"
                     /transcript_id="XM_005537786.1"
                     /db_xref="GeneID:16996111"
     CDS             446119..446388
                     /locus_tag="CYME_CMP177C"
                     /codon_start=1
                     /product="transposon"
                     /protein_id="XP_005537843.1"
                     /db_xref="GeneID:16996111"
                     /translation="MTTLSSVLGTVYAYGGLSFAYKEGSYIRTLFVELFKIFLLTSGG
                     VILLDNVAFHHSPCVRAFADAVGVELLFTPSYAPWLIPVQECFLS"
     gene            <447812..>448273
                     /locus_tag="CYME_CMP178C"
                     /db_xref="GeneID:16996107"
     mRNA            <447812..>448273
                     /locus_tag="CYME_CMP178C"
                     /product="similar to ubiquitin conjugating enzyme E2"
                     /transcript_id="XM_005537787.1"
                     /db_xref="GeneID:16996107"
     CDS             447812..448273
                     /locus_tag="CYME_CMP178C"
                     /codon_start=1
                     /product="similar to ubiquitin conjugating enzyme E2"
                     /protein_id="XP_005537844.1"
                     /db_xref="GeneID:16996107"
                     /translation="MYGRDADVKVPRNFRLLEELEKGEHGLGDVCVSYGLVDDDMTLS
                     NWTGTILGPLNTVFENRIYNLRIYCGPDYPTKPPVVFFRTRINISCVNGATGQVDPTR
                     CGILHNWTPDCTLETLLVELRREMTSATNRRLNQPPEGSEFPPPRDIERFG"
     gene            complement(<449025..>449681)
                     /locus_tag="CYME_CMP179C"
                     /db_xref="GeneID:16996108"
     mRNA            complement(<449025..>449681)
                     /locus_tag="CYME_CMP179C"
                     /product="60S ribosomal protein L10A"
                     /transcript_id="XM_005537788.1"
                     /db_xref="GeneID:16996108"
     CDS             complement(449025..449681)
                     /locus_tag="CYME_CMP179C"
                     /codon_start=1
                     /product="60S ribosomal protein L10A"
                     /protein_id="XP_005537845.1"
                     /db_xref="GeneID:16996108"
                     /translation="MTSKLPVSVTRAAVQEMLRESREERKRNFVETVELQVGLKNYDP
                     QKDKRFSGSVKLPYIPRPKMKVAVLGDAAHNAQAAALGIDFYDLEKLKQFNKQKKPIK
                     KFAKSYDAFLASESVIRQIPRVLGPGLNKAGKFPTLIASNETVEAKVNEVKATIKFQL
                     KKVLCLAVAVGNVQMTEDELVANITLAINFLISLLKKQWQNIKSIHVKTSMGKPHRLY
                     "
     gene            complement(<450770..>451216)
                     /locus_tag="CYME_CMP180C"
                     /db_xref="GeneID:16996109"
     mRNA            complement(<450770..>451216)
                     /locus_tag="CYME_CMP180C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537789.1"
                     /db_xref="GeneID:16996109"
     CDS             complement(450770..451216)
                     /locus_tag="CYME_CMP180C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537846.1"
                     /db_xref="GeneID:16996109"
                     /translation="MRSEPVTDILEACLRSMVENDMLITLEKSNRTMVATTGVSGTQQ
                     LVRVVLNTQGYSRKKVEFHAPPSSTDIATTELLGRLDRWEAQARRSVYLVGKTPFGRN
                     GRIVYGYSHRRRQLYIRSNSKRKISSSVLAAVDIFGGLGFSRREGS"
     gene            <451608..>452243
                     /locus_tag="CYME_CMP181C"
                     /db_xref="GeneID:16996124"
     mRNA            <451608..>452243
                     /locus_tag="CYME_CMP181C"
                     /product="similar to ubiquitin conjugating enzyme E2"
                     /transcript_id="XM_005537790.1"
                     /db_xref="GeneID:16996124"
     CDS             451608..452243
                     /locus_tag="CYME_CMP181C"
                     /codon_start=1
                     /product="similar to ubiquitin conjugating enzyme E2"
                     /protein_id="XP_005537847.1"
                     /db_xref="GeneID:16996124"
                     /translation="MSSQEIPCSSQNTRIEFGRAAKRLQSELSSLMLESVPGVSAFPE
                     SDDILTWRGTIRGTEHSPYSGMRFHLALKFPQNYPFSPPTVTFVTRCFHPNIDYASGT
                     ICLDILKEHWSSTFTVKTILLSIQSLLDEPNVESPLNVQAAGLWETDPREFREVCIAK
                     YEEATGEKIVSADYSQRNEGKSEQHARRVPAPLYKSNPMVANRVHRYRNQS"
     gene            complement(<452624..>453769)
                     /locus_tag="CYME_CMP182C"
                     /db_xref="GeneID:16996125"
     mRNA            complement(<452624..>453769)
                     /locus_tag="CYME_CMP182C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537791.1"
                     /db_xref="GeneID:16996125"
     CDS             complement(452624..453769)
                     /locus_tag="CYME_CMP182C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537848.1"
                     /db_xref="GeneID:16996125"
                     /translation="MKCPYLLCSSRLEGTELLAELLDGEETYRFRALVRDPSSIVLEN
                     CDFWIAASQTEVLFVDAAEVSAALADISYQPGGSCWNEIIGAGESSTDLSSVSAASVS
                     RLLSRVRHFLRPSTHEAGCSGTSVEQAAKQPQEGVCTAKRKVVLCQIPLSFVSQNATS
                     SISNEFEFRTRLGRKLPLLSDSTLLHVLAELEWFIYREFYPQCPVFTDEVPGHFDKHG
                     HFFPMDTFAVIWVPDTNSAIRMLEQFSSAKLSCRVRESETRDHQQFLDWRFRALIVRS
                     RTARPETAANRADDNNRTLKIDSRTLAKTPGIGLRRLRTLEEQPVLIPFRLLERDTDE
                     IDQLTEEEMIIIVGLRRFLTQNLFPEAESATSLLHLDFISHRRLWFE"
     gene            <457624..>458937
                     /locus_tag="CYME_CMP183C"
                     /db_xref="GeneID:16996126"
     mRNA            <457624..>458937
                     /locus_tag="CYME_CMP183C"
                     /product="probable 2-epi-valiolone synthase"
                     /transcript_id="XM_005537792.1"
                     /db_xref="GeneID:16996126"
     CDS             457624..458937
                     /locus_tag="CYME_CMP183C"
                     /codon_start=1
                     /product="probable 2-epi-valiolone synthase"
                     /protein_id="XP_005537849.1"
                     /db_xref="GeneID:16996126"
                     /translation="MSLVKDESTETRFVPLERAPRNVFKREVFSYKDEQFPETQGPRA
                     GNIAKIVHWRNCFPLPIEYSVYLCDPLLRAENALLGECLLPANLSRRFCVVDDSVWAI
                     YGEKLKAYFDERNIASKYVVLPGGEEHKNIGAVFQVLDALCDFGLHRREPILAIGGGV
                     VLDIAGFAASLYRRGVPYIRVPTTLLAIVDASVGVKTGIDYTHTVTDEHFKNRMGAFY
                     APVASFLDKTFVATQDERQIINGLGEILKLALVRSAELFALLEEHAADLVRMKFQQSF
                     VPDRVIELSVEIMLEELGPNLWEQKLERCVDYGHTFSKVLEMKCLGELCHGEAVNIDG
                     FFCVLLSEGRGWLDSRTRNRILRVMRDCCRLPFYHPLCEDVDTMWQAVMDGIEHRDGL
                     QRIPLIYHEIGRCTFVNDLTKDEIKVAAQKLVHIKKNLSEAQASQ"
     gene            complement(<458900..>459511)
                     /locus_tag="CYME_CMP184C"
                     /db_xref="GeneID:16996127"
     mRNA            complement(<458900..>459511)
                     /locus_tag="CYME_CMP184C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537793.1"
                     /db_xref="GeneID:16996127"
     CDS             complement(458900..459511)
                     /locus_tag="CYME_CMP184C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537850.1"
                     /db_xref="GeneID:16996127"
                     /translation="MFGKSYSSAFLSPFVSFRGPLTCEVCKSSVRLSRNWSIHFSAGS
                     RKRLFVDSSLPKLFCTVAQNGVATYGGIQHAGIIVSDLNRSLDFYVGVLGMEDDSHLR
                     NPKLPFGGAFVKVGATQIHLMVADNLEIPEPSFRENRPAHGGRDYHLAMTVDALEPLE
                     RRLREKGIPFTMSRSGRRALFCRDPDGNALEFIETPALRTSSS"
     misc_feature    complement(459857..461610)
                     /note="repetitive element"
     gene            <466770..>467411
                     /locus_tag="CYME_CMP186C"
                     /db_xref="GeneID:16996122"
     mRNA            <466770..>467411
                     /locus_tag="CYME_CMP186C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537794.1"
                     /db_xref="GeneID:16996122"
     CDS             466770..467411
                     /locus_tag="CYME_CMP186C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537851.1"
                     /db_xref="GeneID:16996122"
                     /translation="MYFHELIARGFISRTEDYGPVLSILERLAPSTNPGVEFAELERL
                     YRIPSALNTNRHLRFSQPEVVVRFNLLPENEAPEPAAQVDLYVRTVQRNEGTVRARRF
                     CRTTLPPVDALCFVEGFLPEATFAFERVRRGNRFCFRDGTVMDVFRLERVCSDSKGNF
                     HSELLSELKWIVELRCLRSLNALGSEISAEPQCSISDMLGKRLSLLAPYVVQV"
     gene            complement(<468599..>469330)
                     /locus_tag="CYME_CMP187C"
                     /db_xref="GeneID:16996123"
     mRNA            complement(<468599..>469330)
                     /locus_tag="CYME_CMP187C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537795.1"
                     /db_xref="GeneID:16996123"
     CDS             complement(468599..469330)
                     /locus_tag="CYME_CMP187C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537852.1"
                     /db_xref="GeneID:16996123"
                     /translation="METGGGAPLTKSSEAVEGDFVEDRLRGNEAFRRGNYEAAASYYS
                     EALEKIRLAKTELPTQDRYPWSLEEVLIRCNRALVFLRLASAAALPNVGSNRFEEDAC
                     TAEHESEEATPCSLWQRAAEDASVALDLITDFEDEGESERVTELRVKALYRRMVANKG
                     QNNFADAAKDAEALAKIRPEYRSEAELLAQRAAAESERAKQEALQKLKEVGNSFLSLF
                     GVSIDNFQTKRNPDGTYSVSYCPKS"
     gene            <470078..>477298
                     /locus_tag="CYME_CMP188C"
                     /db_xref="GeneID:16996132"
     mRNA            <470078..>477298
                     /locus_tag="CYME_CMP188C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537796.1"
                     /db_xref="GeneID:16996132"
     CDS             470078..477298
                     /locus_tag="CYME_CMP188C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537853.1"
                     /db_xref="GeneID:16996132"
                     /translation="MDKFCSKLSCSDEESARQSSEGRPTLGGEALDFGAPPALPFPPD
                     ASLGLCRRLEIHGATCSCVCEAFGNMGSHLDSLVPLNTADVLAKVRSAAKRLATRLDE
                     TADEERLRQTCLSLCDLFGDGIHHDLIQAVLDAGVVPRVVRILEPLIDDDGSGSGTTQ
                     DADGHTSDAFHSPMQRQRDGAATSRLNEERTAELLETPDRSGDSPGPEMRHSRVTSRD
                     HARASSGHAASTVRKRSRRREVSLGLQSAALQVIGNIACGDDRQTQVIIDCPNALTIL
                     RTLLASVEPCIQKECCWIISNITESAHQVQDIVRAGILEPLVGIFSGGHESCDEDAAW
                     VLYNVTASGDPEHIRYLANIGGISALCALILSPAELEVAWKGCATVAAVALHALSNML
                     TVLPNEMPYRIAAEYGVECLDLLAHGGGRHIEDDENRRQARELLSRHFQGKSVSETAA
                     ARRRSANETPMLASLGSQRPSASKMEASANDAQVHLVASGTAGKHAPQICTDESVQTS
                     TYIDEVDYAQACSTATTGGLVQTGSADAERLCECSASEVTLKQLPYGDISDVKQMRNL
                     RACSFCSGLEPRYDVDASDFIGCTRRDKCTALMARAVRVDHNSCLESIIDAWLTMDDV
                     DLVVERLIPDAGKIYVEYQEFVSRICNFLRSVMMETSTLSCAVQMVPPEVGTGTPGTQ
                     PPWPSERASSLTASRSVDCEQSTQDRNRCSIITLASQLGRAECLQTILSRMQPLLVPE
                     WRDFLYSSLLAGAAYKGHLNVVQTLLAYWCNSVQENGRTRSMRGSANEGHGTLPLETI
                     DFNALHLAAAAGQYKTCSLLLKGFPEALNLTSSMGHTALSFAALFGYTDVCRLLLEKG
                     ADIWSMDTYQRTALHLACVHGRTDTVALLVEHARKVLADQDRDAFTKWLNARTTTGIT
                     ALHYSIQSRVLACVELLVTNGACIKDRLPNSGPNPLLVLAADADSLEIVQFLLEAGAP
                     VRSVVPLRIRIGDTSDTLSLSSPEDSLHAEIEDFFTPLHVAANKGSLQLVQMLLESGA
                     DVNVRGVTGWSALDLAVLNGFDAVASLLLSKGAIVDPHLKIIPSGIVGQMPSAKTLVQ
                     IAAMNHRKDLVRMLVERLRVQSLNSESANAGVSSACLVSASPAGGADVSTTCSVEGPD
                     TGQHGAGESVGALDAPNDRGSASVDVSESTGSKKRQESDKDSQRNRELRRRELEANDA
                     RERLRDAIQTRSLTKLQDAIGIANRVILQLAASYVKSGSAKLVGPEIGLGAEVERARR
                     VLAALQEQQQRVAADRERLALEARQDAAHRKLLESIASFFSSSDVRVFDKAIRRASKA
                     GLDPSDSVMQSVTELRSRWTEMQDAARGLDDYLNDEHRLGEDAATVVRGLEGIISKAE
                     HALERFSAFSPEAAKCSAAERVRDSIRRAKERANEVQKLVEEKARLFAVEEAKCREIC
                     ERLDQICAVLRQGRSLVDAPSSLTEAENAIELFAVQVTKSLQDSTLQLRAEEHLEQAR
                     RALQKIVRNERKRLRSVATLEDITAIDELIDSVRQLGLKALSADLSSAMEVRERRILQ
                     REALADWEEVEARRSSALELDEVLALQSRLEQLGLIEAAEKARQLADHLAREQRAAQT
                     LKTATDEAREALSSYAEVDADSCLQQLLSRAGDSLDRASLEKLRRLRVAIERARKFDS
                     LAEIVHEAQHVYEAFLEIQRERLQRICNCLRAVPLEDVPSLVQLKTALCHDNSEKSES
                     DTGVTRDEARCLVAAQVLREISDRVQVLMNVYANALNVDPENAENSSRGPYSVIPSAL
                     VDLRSWLEKATCRCTELHEAARQLQESRATESLMVESNADGASEKARSQTPEVVDVTS
                     KLASPLELGSSVPSEMPSSGERSVSSQRRSGRRARNRRGSASAVPAASESREAASYIE
                     SGAERMTASTTVDSHAEDNQARRSTKGKSLSEKKKGGKAGRSADSGIVLTDAGADETE
                     SVQRKAGSADPVAEEVSRRATPSLETTHRKRQTAKRAETGESAGTGKQETRPSEGSGI
                     RESGELVAPEAGCPHYYIWTKSNIVVCGKCGDVRISHNQNWLERVKKRTQKKKDQVPA
                     EFLEAVESALLARRRRSTSRSDTNRAPGDEQTAALQNDDSYDSVPYTGPATSTGDDSR
                     ASDPHQDRYPRPTSSMFWTTPAAFPIGEMSFVARPSVMERSPSSFQMRQARLGYAAPA
                     ESLEMSSRPGTPARPVSPFVNAFPSPGRNVVDGRANTPLYADMILGMPDTRLSVAANG
                     AARSPCVTLYREARAAAATPMGRYPPSLGGDVCDANAGVWLQPGLVAGATTQVPFPNS
                     IHGSGQAAEPSLDPVAHGHPLRDERGHLFGMTDVFHGHGVLNGVDDALLSSSPVGVGD
                     SEFASQNFGFNIDAIVDENPQPRTTSKDKLAVESDSSQYRIF"
     gene            complement(<477634..>479406)
                     /locus_tag="CYME_CMP189C"
                     /db_xref="GeneID:16996133"
     mRNA            complement(<477634..>479406)
                     /locus_tag="CYME_CMP189C"
                     /product="probable selenophosphate synthetase"
                     /transcript_id="XM_005537797.1"
                     /db_xref="GeneID:16996133"
     CDS             complement(477634..479406)
                     /locus_tag="CYME_CMP189C"
                     /codon_start=1
                     /product="probable selenophosphate synthetase"
                     /protein_id="XP_005537854.1"
                     /db_xref="GeneID:16996133"
                     /translation="MSLDSLLEKVPRPSEFDPCDYEALREYFPPPLKDQERLPLSLEE
                     HSEKAFRKLHETGLPTLQRADEHVRRRAEDWFERVTQYAAKQKAADQVLDLQTLRFRL
                     TRYSTLKGCGCKVPQSELLEWMTATKNLLRSPMKSFSRPGGLMSTSNTESSTPGDVSV
                     ELGVGMDASVVRLTQLSSRQQSTEKDAENAPSFGTQPLYLISTTDFFFPLVEDPYLMG
                     RIAAANVLSDAYALGIRTPPSTMLMLVCAATEIEPPALRAGVTQTMMAGFIDACHEAG
                     TQVTGGQTTLNPWPLIGGVAEVVLPRGEFLMPDAAQPGDTIVLTKPLGTQVAINLYQW
                     LGQMEDAHYLHLLESLETTQQQEYGPEDTRRSVHGQFVPPSEETHARDIPGPGPAHTT
                     HDARLSRALSSSILEQLPPAARKTLAQGRQARVHYSKIEQVLTPADICRAYDVACLSM
                     AHLNARAAQLLLESGAAHAVTDITGFGILGHAQNLARNQKAPVDMEIDVLPIIRGMTS
                     ADRALQGGKMFRLLEGFSAETSGGLLICFGASSTERSSQVVARQFCEKLATVDDHWPA
                     WIVGRVVPGSREARILDHVKILEV"
     gene            <484267..>485865
                     /locus_tag="CYME_CMP190C"
                     /db_xref="GeneID:16996134"
     mRNA            <484267..>485865
                     /locus_tag="CYME_CMP190C"
                     /product="myo-inositol 1-phosphate synthase"
                     /transcript_id="XM_005537798.1"
                     /db_xref="GeneID:16996134"
     CDS             484267..485865
                     /locus_tag="CYME_CMP190C"
                     /codon_start=1
                     /product="myo-inositol 1-phosphate synthase"
                     /protein_id="XP_005537855.1"
                     /db_xref="GeneID:16996134"
                     /translation="MTDNDALRAKSLRAPRSVAPAGVRYSNWQVKVESPRVRYTDEFI
                     YADFECDEVKACPNDEKKETIVRTLRRKLQFRTAIRPPRLGLLLVGWAGNNGSTLTAA
                     LIANRENICWQSRCGVCKPNFYGSLTQCASMHIGYDGGADVFVPLHAVVPLVHPKDIV
                     VGGWDISSVNLADALERAQVLEADLRQRLRPFLEHQKPWAGAMDPTFIAQNQLGRADN
                     VISGSKFEQLEKLREDIRSFKAKHGLETAVVVWSANSERYSELSPGAAHDPELLLEAI
                     RRNEAEVSPSILYAVAAILERCPYVNGSPQNTLIPSVVELARRHAIPVSGDDFKSGQT
                     RLKSVLVDFFVGCGLKPRAIVTYNHLGNNDMYQLTDGTMWKPKAVAKSGVLTDIVQSN
                     GALYPNGEEPDHVVVVKYVPFLGDSKRDVSEYTSEAFMGGLYTNIIHNEALDSVLCAP
                     LILDTAVLCELLTRVSWRDSPSEAYQPMDSVAVALSFFMKNPVMPHGLPAVNALWRQR
                     QCLEDLLRALVGLGPHHELQYMLA"
     gene            complement(<486527..>487147)
                     /locus_tag="CYME_CMP191C"
                     /db_xref="GeneID:16996130"
     mRNA            complement(<486527..>487147)
                     /locus_tag="CYME_CMP191C"
                     /product="similar to high light inducible protein"
                     /transcript_id="XM_005537799.1"
                     /db_xref="GeneID:16996130"
     CDS             complement(486527..487147)
                     /locus_tag="CYME_CMP191C"
                     /codon_start=1
                     /product="similar to high light inducible protein"
                     /protein_id="XP_005537856.1"
                     /db_xref="GeneID:16996130"
                     /translation="MAFEANSCGFCSHWLAGRHRRSPSATVCLKGANKRNYGSRVRHE
                     FSETGRERVGSWRSCSSQSLRTRLSALAEGDAASRPGQADRGPVSQTTDSSSGRSEAA
                     GAVPTGGSSQSSATERVPGRYKLSAIELAEQRRALRAVAERYKAARLAKEAESRRVFG
                     FCRNAEVINGRTAMFFFVTGMLTEYWTGQTMPQQIELLLRILGIIE"
     gene            <487620..>488846
                     /locus_tag="CYME_CMP192C"
                     /db_xref="GeneID:16996131"
     mRNA            <487620..>488846
                     /locus_tag="CYME_CMP192C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537800.1"
                     /db_xref="GeneID:16996131"
     CDS             487620..488846
                     /locus_tag="CYME_CMP192C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537857.1"
                     /db_xref="GeneID:16996131"
                     /translation="MLVCDQVFAIGLSCVDLALHQVDRLPLHADDLVQFCGVDFVPGG
                     GVYHTLESLASLLRCAADEGNSTVPRLQAVTLVGDDIFGRFYARRVSEDVSPEASRTV
                     AFTNEANTALAVVPIYRDGSRGCFVDLGANRVLSGERIVQSVAELLAGAKLAHSADTK
                     PTVLVHLAYPHLLPMLRGERLEELFRELTIQAGLVNAAAVFSVDVNGATRDSGSSTDI
                     KKGALESILHHVDIFHANYEEACALLDEQMIVTRETSGADLEAATSSAALVHCVREHG
                     RRLLQRLKDRFFNPASPEKSGDRLLVVGVTIGREGAWLVAGSRDDLQTFTCTQEQYIP
                     PPSIPDQQRINANGAGDAFVAGLCFAYLRASRGRESGTQRPQRSPAAWTQFFADNALR
                     AVTRKLSIKRGNHAIW"
     gene            complement(<488848..>490107)
                     /locus_tag="CYME_CMP193C"
                     /db_xref="GeneID:16996128"
     mRNA            complement(<488848..>490107)
                     /locus_tag="CYME_CMP193C"
                     /product="malate dehydrogenase, mitochondrial precursor"
                     /transcript_id="XM_005537801.1"
                     /db_xref="GeneID:16996128"
     CDS             complement(488848..490107)
                     /locus_tag="CYME_CMP193C"
                     /codon_start=1
                     /product="malate dehydrogenase, mitochondrial precursor"
                     /protein_id="XP_005537858.1"
                     /db_xref="GeneID:16996128"
                     /translation="MNVARRFGARLVQRLGCRWLATEATASPKSAAGAASGSGAVGKL
                     SDLLPPLRVAVTGAAGQIGYQLVTRIASGEMLGKNQPIHLSCIETPQGMKALRGVVME
                     LEDCAFPLLKSVSATDQVDKGFADADFAILVGAKPRGPGMERRDLLASNAQIFAEQGR
                     ALNKVASREVRVLVVGNPANTNALVAAANAPDIWAEQITAMSRLDQNRAITQLALKMH
                     CDVAEVERVIIWGNHSTTQYPDLSHALVRGEWIRPRIDEDWYRNEFIPRIQKRGAEVI
                     EARGASSAASAANGAIDHMRDLWLGAGNKWLSMSVPSDGSYGIDACLWYSVPCLCPGA
                     HFRRILELPVDEFSASMMERTRKELIEERDAVRHLLPRDYERIISMSNPLARSQQPKQ
                     SASIPVADSASNDTQASMKAVGSGKRK"
     misc_feature    490228..491240
                     /note="possible transcribed region"
     gene            complement(<492638..>494014)
                     /locus_tag="CYME_CMP195C"
                     /db_xref="GeneID:16996153"
     mRNA            complement(<492638..>494014)
                     /locus_tag="CYME_CMP195C"
                     /product="similar to bestrophin"
                     /transcript_id="XM_005537802.1"
                     /db_xref="GeneID:16996153"
     CDS             complement(492638..494014)
                     /locus_tag="CYME_CMP195C"
                     /codon_start=1
                     /product="similar to bestrophin"
                     /protein_id="XP_005537859.1"
                     /db_xref="GeneID:16996153"
                     /translation="MTIYYKDPIATFGKDYVFPLSWTRVFFHWYGSLVQRLLFELLSW
                     IGAAVLVIALKLYVAEWPIPFLNTLAALVSVLSPILTFMLGFYTSTIYSRWWSVRVVM
                     CGTGQIAAYNIALEMTSFVYDDNDPIGAARLKQLIVRWICIPFAMVLRDVFLGGDHAY
                     RTTEAMERIGLITPEERYRLENDVDRAQWTMPVMWAGHLLSRLRDQNHRYGITEFVHL
                     QLVQQLALVRGYFGYLYVPMWVPVPLMYRQLVNATVRIYVICVILLAGNLNLLSATSS
                     SIDIGNYRWLDIIYVLSVFLIYIGWLHVADELANVFRIAPDSLDFDDYLSSQRVDFAT
                     MVDDHCIKLPTIESIAEEPLPGEEGFNCFPIMRDHRYEAVPGWQKFQHLRRRPRDVGT
                     SGSRTYDAFEQLRAAELRRQAHKVMASLRGFVHDLRGDSDETDDRRDGFADGTRRKKK
                     PPVRYLGY"
     misc_feature    492638..493327
                     /note="possible transcribed region"
     misc_feature    complement(494605..495033)
                     /note="repetitive element"
     misc_feature    495052..496167
                     /note="repetitive element"
     gene            <496537..>497913
                     /locus_tag="CYME_CMP198C"
                     /db_xref="GeneID:16996145"
     mRNA            <496537..>497913
                     /locus_tag="CYME_CMP198C"
                     /product="similar to bestrophin"
                     /transcript_id="XM_005537803.1"
                     /db_xref="GeneID:16996145"
     CDS             496537..497913
                     /locus_tag="CYME_CMP198C"
                     /codon_start=1
                     /product="similar to bestrophin"
                     /protein_id="XP_005537860.1"
                     /db_xref="GeneID:16996145"
                     /translation="MTIYYKDPIATFGKDYVFPLSWTRVFFHWYGSLVQRLLFELLSW
                     IGAAVLVIALKLYVAEWPIPFLNTLAALVSVLSPILTFMLGFYTSTIYSRWWSVRVVM
                     CGTGQIAAYNIALEMTSFVYDDNDPIGAARLKQLIVRWICIPFAMVLRDVFLGGDHAY
                     RTTEAMERIGLITPEERYRLENDVDRAQWTMPVMWAGHLLSRLRDQNHRYGITEFVHL
                     QLVQQLALVRGYFGYLYVPMWVPVPLMYRQLVNATVRIYVICVILLAGNLNLLSATSS
                     SIDIGNYRWLDIIYVLSVFLIYIGWLHVADELANVFRIAPDSLDFDDYLSSQRVDFAT
                     MVDDHCIKLPTIESIAEEPLPGEEGFNCFPIMRDHRYEAVPGWQKFQHLRRRPRDVGT
                     SGSRTYDAFEQLRAAELRRQAHKVMASLRGFVHDLRGDSDETDDRRDGFADGTRRKKK
                     PPVRYLGY"
     gene            <500373..>501815
                     /locus_tag="CYME_CMP200C"
                     /db_xref="GeneID:16996155"
     mRNA            <500373..>501815
                     /locus_tag="CYME_CMP200C"
                     /product="similar to bestrophin"
                     /transcript_id="XM_005537804.1"
                     /db_xref="GeneID:16996155"
     CDS             500373..501815
                     /locus_tag="CYME_CMP200C"
                     /codon_start=1
                     /product="similar to bestrophin"
                     /protein_id="XP_005537861.1"
                     /db_xref="GeneID:16996155"
                     /translation="MPIMYMDPVANLGKDYVLPLSWVRIFLYWHGSLLQRLLFEVCIL
                     FGLAAFIIAMKLYVAEWPRFLLEVFANIVNILSGVLTLLLGFYASTIYSRWWYTRTNM
                     FGTAQGGVYNCGFMLNALVYDDENPELCARFKQRFLRWMNLAFGIMLMDVTSGGSHLF
                     ESFDSMERIGLVTPEERYRLEHDVERVRFTLPIMWAGHMLTRLRDNNHQFHITDRVHM
                     QLSIELAYLRQGLGGCYLMKNTPVPLLYVQFVEVAVRMYVISMILLVGDLNLLSGTFQ
                     ERGNDRWVDLVYIAALFFIYVGWLHVAEELANPFRIAPDGLDLDDLLSGQRCDVMTMS
                     DSTRQRLPKPEVIQEAPLPGEQGWYLPIITRDHSYEPVPYWYSFWYNLIRRRKCSTAP
                     SPHSIIWGFYPEKQPLLTEPEKKHAASNPSAWSNVVHVHPGASQHWNVSHRNDGPAPM
                     ASHCPSGLVSSGFGGLGVDSSSADGGGSVL"
     gene            complement(<502504..>503139)
                     /locus_tag="CYME_CMP201C"
                     /db_xref="GeneID:16996146"
     mRNA            complement(<502504..>503139)
                     /locus_tag="CYME_CMP201C"
                     /product="similar to transcriptional regulator"
                     /transcript_id="XM_005537805.1"
                     /db_xref="GeneID:16996146"
     CDS             complement(502504..503139)
                     /locus_tag="CYME_CMP201C"
                     /codon_start=1
                     /product="similar to transcriptional regulator"
                     /protein_id="XP_005537862.1"
                     /db_xref="GeneID:16996146"
                     /translation="MFVSIFTSPLVQQARLQYQCKQCCRVLYSGNTVQQQQQQQRTVL
                     GVAFWRASLQRGQLTQLVKGSSRLKMSQSNPADVKDWRALTEEDWKARLTPMQFEVAR
                     RAGTERPFTGEYWNEKRTGIYRCVCCGTPLFSSETKFDSGTGWPSFYAPLSKEAVKER
                     RDLSHGMIRTEVLCAVCDAHLGHVFPDGPKPTGLRYCMNSYSLKFEPKESS"
     misc_feature    504141..505676
                     /note="possible transcribed region"
     gene            <506282..>508156
                     /locus_tag="CYME_CMP203C"
                     /db_xref="GeneID:16996150"
     mRNA            <506282..>508156
                     /locus_tag="CYME_CMP203C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537806.1"
                     /db_xref="GeneID:16996150"
     CDS             506282..508156
                     /locus_tag="CYME_CMP203C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537863.1"
                     /db_xref="GeneID:16996150"
                     /translation="MQDYEALRELRWCGAELHRVAGAQLVSQSTALERTSTLVRSLLE
                     KKDFMEENWKEVLHLQSQWFCCLQTLVQRSVQAEKPTSKPSCAVVGALEASLQRIAPV
                     VVRLGTEQDMALVFSIAGGLCALELLSWSQCWHVLVRQLLDSSIDDAARWQTVLVQGC
                     AAAFCDLRLHTLHAVAHLLRESSSVYSTPAPGAALDLAARAENAWRFVLKPIGRLLTK
                     DVAKQHQQLLSEVLRRVTTPSQRGDRQQRLLKASRKAFTDAMLALLSTGEHGIDLSAP
                     VLLDVFGELVDNLLPNHCIAEPLRLGDFLAETFREAIAGRSVYGIAALEPLLFLMRHD
                     GLEYEHIYEQVYSKLDVHTLLRLNACESATRGRVLRAVTQLLTSSHLPHALISAYTKR
                     LARIALQSWDATLTLWALRLTLELVHRHTSARLLLESWFKRQQPDREPVIESSCSDST
                     PRRRDQSEASFEASGTGVVRSTPTKRLAYGFVFWERSSGQRAGDECASSTPGLTNDPF
                     LADEPDPRRSNASASFLWEVGMLSEHFVSSVRQLAALFEDPEKAISRAGPLDAWCDAS
                     LRDLIELELRRSQHLVRNKPIAFEAPRDDDIVGDSGSKVEAQFTAHAANAKVIFGEYS
                     "
     gene            complement(<508893..>510275)
                     /locus_tag="CYME_CMP204C"
                     /db_xref="GeneID:16996151"
     mRNA            complement(<508893..>510275)
                     /locus_tag="CYME_CMP204C"
                     /product="similar to bestrophin"
                     /transcript_id="XM_005537807.1"
                     /db_xref="GeneID:16996151"
     CDS             complement(508893..510275)
                     /locus_tag="CYME_CMP204C"
                     /codon_start=1
                     /product="similar to bestrophin"
                     /protein_id="XP_005537864.1"
                     /db_xref="GeneID:16996151"
                     /translation="MTILYKDPVATFGKDYVLPLSWLRLFFYWHGSLMQRLLFEIILW
                     LALAALVIALKLYVATWTHAFLLVLAILANVLSPILTFMLGFYTSTIYSRWWDARVSM
                     CGTAQMAAYNIAMEMTQFIYSDKDPITAARLKQRIVRWCNLAFALVLREIITDGTHLY
                     NSFDSLEQLGMMTAEERQRIEHDVDRVRFTLPLMWAGHTFTRLRDHEPNYGVTHWVHL
                     QLSQQLASLRQGLGSMYVFVTVPVPLMYRQLVSAAVRIYILVVVLLAGNLQLLGATSS
                     GTDSANYSWTDMVYIVSVFFIYIGWLHVADELANPYRIAPDGLDFDDYLSSQRADHAT
                     MVDDNSIRLPTVDSINDEPLPGDPNWNCPFVWRDHAYEAVPGWNKYKEYIRTVKASRQ
                     DGHAKTYDFFQRVRQRLLSDEETFATDDTTAPTQTDWAQSIGLQGNTSLRGTTRCWTG
                     PPERIRYYGF"
     gene            <513764..>516910
                     /locus_tag="CYME_CMP205C"
                     /db_xref="GeneID:16996152"
     mRNA            <513764..>516910
                     /locus_tag="CYME_CMP205C"
                     /product="leucine--tRNA ligase"
                     /transcript_id="XM_005537808.1"
                     /db_xref="GeneID:16996152"
     CDS             513764..516910
                     /locus_tag="CYME_CMP205C"
                     /codon_start=1
                     /product="leucine--tRNA ligase"
                     /protein_id="XP_005537865.1"
                     /db_xref="GeneID:16996152"
                     /translation="MDRRCLSFTAGQNFFPWSSLRAASVARFWLRRLGEVPAEGGSFP
                     YRRSFLCPFTPGSNLYRGCAKSRERLGPWLWPTNEALPGKQHAGFWRWQASAASGSGT
                     DGSGTFADPTVTQVRNKDSILAPGTTETAHREPESIVPSPRADGAYDFLAVERRWQEF
                     WEREQIFRTPDEVDWNRPKYYILDMFPYPSGAGLHVGHPEGYTATDILARYKRMRGYN
                     VLHPMGWDAFGLPAEQFALDTGIHPAVATERNITRFRKQLKSLGFSYDWKREINTTSP
                     EYYRWTQWIFLQLYKRGLAYQAEIPVNWCPALGTVLANEEVIDGRSERGGHPVIRKPM
                     RQWVLRITAYAERLLKDLDLLDWPENVKEMQRNWIGRSEGVEVTFPTVSDASSASAKG
                     ALAEPPGITVFTTRPETISGATYLVVAPEYPILEELVTDAQREQVQRYVEQALRRSDR
                     ERTGTEVKLKSGVFTGRYAQNPVTGEHIPIWVADYVLGSYGTGAIMAVPGHDARDRAF
                     AETFALPIRIVIDETTNQMTDWNPDWLGGLEVAGTNVEAARVRITEALERLHIGERKV
                     NYKLRDWLFSRQRYWGEPFPIVFDAETGEPLPVDEQALPVELPTTESIRPSGDGRSPL
                     AKIVDWVEVRDPQTGQLRYLRETNTMPQWAGSCWYYLRFIDNSNAERLVDPVKERYWM
                     PVDLYVGGVEHAVLHLLYARFWHKVLYDLGVVSTPEPFLRLVNQGMILGEVEYTCRRE
                     RTAAEGRQLVANGHAAEAPLLEEVRVPADQVEKIGNDRYVLKADPRVVVTARAHKMSK
                     SRGNVVNPDDIVEQYGADALRCYLMFMGPLDQVKPWSTQGVNGMRRFLDRAWRLLFDK
                     NEVCNGDSRTEHQVQPTRAQLRQLHSLIKRVTEDTEALRFNTAIAAMIEFVNDAYKWE
                     VPWPKDILLGPFVLLLSPYAPHVAEEMWQEIRRRQQLRHGTERDSDAADAQVPRSLAY
                     EPWPDYDPQYLVQETVVYAVQVNGKLRGTLEIPSDADRDAVLAAARQVSSVASHLDGK
                     QVVREIFVPGKIANFVVR"
     gene            complement(<517869..>518483)
                     /locus_tag="CYME_CMP206C"
                     /db_xref="GeneID:16996148"
     mRNA            complement(<517869..>518483)
                     /locus_tag="CYME_CMP206C"
                     /product="similar to U6 snRNA-associated Sm-like protein
                     LSm7"
                     /transcript_id="XM_005537809.1"
                     /db_xref="GeneID:16996148"
     CDS             complement(517869..518483)
                     /locus_tag="CYME_CMP206C"
                     /codon_start=1
                     /product="similar to U6 snRNA-associated Sm-like protein
                     LSm7"
                     /protein_id="XP_005537866.1"
                     /db_xref="GeneID:16996148"
                     /translation="MDPKHPRDRSGQNRRRQAGTKATSARPATGGSGTRNRGWQSERG
                     RSSGARPQAREKRPVRASPAGPVSALEVSPWSGQTVQVLLVGGRCVIGKLVGWDTLAN
                     LVLEDAVEYFQDAREASSELVAAPIGSSSALGIGVQPREVSAIYTCAAEAWQASKSST
                     EQTLHVRALLPTKSPMSTHWQRKLGRVVLRGPSVATLGLPDADA"
     gene            <518632..>518958
                     /locus_tag="CYME_CMP207C"
                     /db_xref="GeneID:16996149"
     mRNA            <518632..>518958
                     /locus_tag="CYME_CMP207C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537810.1"
                     /db_xref="GeneID:16996149"
     CDS             518632..518958
                     /locus_tag="CYME_CMP207C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537867.1"
                     /db_xref="GeneID:16996149"
                     /translation="MSTTDSSDELFRNVHEQLKANETALKQKYARLRSQVEQQRTELA
                     QWRTQFEADVTTLLETLERVERNSKSRLERCLQVIEETKRTENEGGQDQEGETPEGPG
                     EAPGSS"
     gene            complement(<520029..>522053)
                     /locus_tag="CYME_CMP208C"
                     /db_xref="GeneID:16996156"
     mRNA            complement(<520029..>522053)
                     /locus_tag="CYME_CMP208C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537811.1"
                     /db_xref="GeneID:16996156"
     CDS             complement(520029..522053)
                     /locus_tag="CYME_CMP208C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537868.1"
                     /db_xref="GeneID:16996156"
                     /translation="MQVLILGGGIAGVTCLETLVAYANDFTTDTHITLVSATSALRRA
                     VPYGQRGRHIAAYRLEETCSDPWEALPWVDVLIGVVEQVRVAERCVYVRVGDGAPQGR
                     HSAGDVLQLRFDYLCICMGAVPRIPKVVHQACASSRVLNERILTLRDTDSADRFRKLL
                     QDLVARRQRRRGRPSEPRVMILGNGGIAMELAYVLPEVAHVDWVIRDAHIGHTFFDAA
                     LSNVLWSLPTARRPRRRQATAWLLAPTRSLAVESSPRRVLGAGLGPDWMQGGRRDQKQ
                     TVLEPAQIRVVHGHQHWDQTSSVPDADLPNTNSDAEQGSTKRLCLHQCCTVTSIAWDA
                     PGSTTSDDAAVDASSQASLTDACLRVTLSDGGVVFTDVLLCATGVRGAAVPSYFDAEG
                     QRLLRWVHLDPPLPFGTHCRRRCDGVDDANSASDPGEHGGSPGASGTVVAADTEDAED
                     TGIAVDEHLRTHARYIFAAGDCCVVQGASSLAGDETPRLWFQMRLWSQARMMGARAAR
                     SIVRDLLVSRPRTWARALKEQGPSEAGHPEAAVLAPPQPAPPASLSRDEVAQMEAAEP
                     LDMELFCHVTEFCGIKVVLMGRYRLECAQSNNPEVQVLESLRPGEDGNPTSLQYIRVI
                     LCKNRLMGAVLLGETDLEEVYEHLLLNQLDVGFLGSALVDGSLDLADYFD"
     gene            <522288..>522719
                     /locus_tag="CYME_CMP209C"
                     /db_xref="GeneID:16996157"
     mRNA            <522288..>522719
                     /locus_tag="CYME_CMP209C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537812.1"
                     /db_xref="GeneID:16996157"
     CDS             522288..522719
                     /locus_tag="CYME_CMP209C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537869.1"
                     /db_xref="GeneID:16996157"
                     /translation="MCLPRSTTHDIPKWLVLALESGLRPSSFAATGVLVGVRSLPFQA
                     STVTTYAQHVPEARRRVCLSMDHDFWVGLVNVRRCRSRCLQRSAPFALTLASWCLSME
                     AAVLQSWCVCGFGSISRYAQSSEFWAACTSTRNCCCLRYRR"
     gene            complement(<525213..>526181)
                     /locus_tag="CYME_CMP210C"
                     /db_xref="GeneID:16996158"
     mRNA            complement(<525213..>526181)
                     /locus_tag="CYME_CMP210C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537813.1"
                     /db_xref="GeneID:16996158"
     CDS             complement(525213..526181)
                     /locus_tag="CYME_CMP210C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537870.1"
                     /db_xref="GeneID:16996158"
                     /translation="MGDRVRRSWASREGRTILSLILLNGLVYLAWKSRPGGPPFMWRH
                     FACSLESLYAGRTHTLLTSSISHMGFLHLLGNMFLLANFGLDVCKVLGPSRFLTLYAG
                     GAFLSSAMSLLYKRLRLSGAVSIGASGSVMAVLVMFAMLFPRSSLYVMGIKMTAQEAC
                     LLWVLFDVIGVVGRFGYIDFAAHLGGAIFGYLYFVYIEEHLREELALRRRARRWGLGS
                     RTTEGPASGGGSLLSRLDAVLEWLQRRRDPTQRRTAERADEQSRRADSGWDSWFGRQF
                     WGTPTTAAQGERPQPQKTSTPEKEPGTVWERLRRFFFADSNDDKHK"
     misc_feature    526809..528100
                     /note="possible transcribed region"
     gene            complement(<527276..>528886)
                     /locus_tag="CYME_CMP212C"
                     /db_xref="GeneID:16996163"
     mRNA            complement(<527276..>528886)
                     /locus_tag="CYME_CMP212C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537814.1"
                     /db_xref="GeneID:16996163"
     CDS             complement(527276..528886)
                     /locus_tag="CYME_CMP212C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537871.1"
                     /db_xref="GeneID:16996163"
                     /translation="MGSRGAETLVGRYNSETLPVSLSMNQRGTNPALQSWSHAHSTAS
                     FGQHQRRSNSYAGPVLLDRDYYSLDEILAAETRFRCVFLERVRGMACLDTSGGASFAA
                     QAEVNAASLVHAHTETSGEGISQENERSSVSDRAEPVQDFERRLSRDALSKDRSDIMT
                     AAAAAAAALTHQAALQASGYGVTRASASGANPSSEQLLQRQEVAGGLDMLPDMACDLP
                     LWLAEMLAARMFVRIELPPSLRSRTLRELRADPCIANLNEKCPYFYAVVQRFRQYFRI
                     RNVASRNGLRGGNAVLAELGSVLLDAHQARCLEIADRAQSPFDGDPLEQLHRFESSER
                     AMFFAVQGAAQQYMRWKRGELRRLRPSKPLVPYCPRRDARLQVHPSHAAPQQANRLVS
                     DHAQHLRRIALSARNLDQEAEFNLYGQRSNHELAVDHPQRAMPMNAESNSSALNENVT
                     DADKENTHGVAPETIHSGKSLTCDTEPQVPENEEAARSEANSDCQALLEPSQASEMPS
                     KRMRRMLRAGESTAAQNLERQTHFPSGL"
     misc_feature    529163..531506
                     /note="possible transcribed region"
     gene            complement(<532861..>533787)
                     /locus_tag="CYME_CMP214C"
                     /db_xref="GeneID:16996168"
     mRNA            complement(<532861..>533787)
                     /locus_tag="CYME_CMP214C"
                     /product="thiamine-phosphate pyrophosphorylase"
                     /transcript_id="XM_005537815.1"
                     /db_xref="GeneID:16996168"
     CDS             complement(532861..533787)
                     /locus_tag="CYME_CMP214C"
                     /codon_start=1
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="XP_005537872.1"
                     /db_xref="GeneID:16996168"
                     /translation="MGTQSCLLGHCCGTTPAFTATGLSFIQRRAVGSGSWFARHRAAS
                     LDLHGEQRRCRRRGERYAVPLHAAGDRLTPFRSTRTDLSLYLIADVAYVSQLGSRQSL
                     EELTERALASGCVRAVQLRDKRSSLRKTLELAKRLRAVCAAAGVPFLMNDRLDLALAV
                     DADGLHVGQEDMPLEYVQKLVPADWIIGASAGSLSEVTALKQASTAERPIRLDYIGCG
                     PVFGTQTKLDAGAPIGIRGLAHIVEAVAPLPVLAVGGIGISNARQCISQGKAAGIACI
                     SAILGAEDPRRAAEDLDAEIRRGRDLRVHPGF"
     gene            complement(<535469..>539746)
                     /locus_tag="CYME_CMP215C"
                     /db_xref="GeneID:16996169"
     mRNA            complement(<535469..>539746)
                     /locus_tag="CYME_CMP215C"
                     /product="copper-transporting ATPase"
                     /transcript_id="XM_005537816.1"
                     /db_xref="GeneID:16996169"
     CDS             complement(535469..539746)
                     /locus_tag="CYME_CMP215C"
                     /codon_start=1
                     /product="copper-transporting ATPase"
                     /protein_id="XP_005537873.1"
                     /db_xref="GeneID:16996169"
                     /translation="MGGARLASPAAYPRARIARSIATACASHSCHTIRHRHRRSSLYG
                     RCRSGSLHGPGVVTSRLRLYTWHMNDKEQADGKDCVMFEVVVAKWPGSKDVAAVVERL
                     KSLPEVEAVFPECTGAEVKLRVRTSPTALYSKIIEFLQGELPAVQMTLRTRIFQIVHL
                     QVEGLRCDGCARKVTAALENVPGVVRAHVLLGLKRARVALDRQVPVSALIQATNAVGK
                     QVTLISKDVEMSCISDADDTSEALRYNCGCGEPSCVGALEPRLRGDAGVRVNREELDT
                     MGCLVNPVGILDLSQAACGCGKRASTRACCSSKSLKTMAVDESATTEKTLKKEALQDK
                     TNLVRTTFSVRGMSCATCVGAIETALRRLAGVQSASVTLLSQKATVTYDGNIVDAGRI
                     QAYIASIGYGAELQSNETLTDGSASHPNRSGTVAGSDRMPLVLCFTDRLKADEAVAAL
                     QRTAVAKTFNLVEQKSTGEMDANAALPWWQALYRQWLCMRKRPAPRYALHIWPRDEQS
                     ITNISKNMEVSPEASQLNPYARIVAVLQSAGLGGSFDIKDAPNAAKSQDPAETLAARL
                     HREALEWLGRFAFALVFTIPVLVISTVLMNLPMPPPSLRAQVGGSALQVGNLVALVLT
                     TPVQFIAGYPFYRGSYYALLKRRRANMDVLVALSTSIAYFYSLILVILNGANVRFGSG
                     PAFDTSALLITIIILGKWMETVAKRRAASGIESLYALQPQRAFLMARITQRSDDASCT
                     NEGLNEVPQEPCERKPAAERDTIPGHPPEPLTAGIHTAQAMESTSEPAVRTSDALPVS
                     TGKSGSLPVASDEQYRGIGDIDAKLLDVGDIIGIKPGERFPADAIVLEGSSTADESML
                     TGESMRVPKGPGAIVYSGTVNGSHPLIVQATAVGADATLSQIIRLVEEAQAQRAPVEA
                     IADGIAAVFVPGVLVIALVDFLVWMALAQSRVIPSSWYSGKGGPVPFALLFAISTLII
                     ACPCALGLATPTVIMVATSLGAHLGVLFKSGIALEALRSVRCILFDKTGTLTMGRPAV
                     TRHLLLQELEPSIEHGPSSSEREEALLLSIAAIEEHSEHLLARTLLDYIRQRIPDAVL
                     PLARALHVEPGLGIQGIVADHTVHIGSPTWILQVCRETPTDFADTQAVPLEHIEQKLR
                     AIEAGGATVVVAARNWVPQVAFAIEDPIRPESAAVITTLSKRLHISCWMVTGDQAAAA
                     QRVAERVGIPTTRVIAGALPWQKAQAVRACVEAAERGKLPKAAVGSEPAPPVPWMIEA
                     LQAESPTQDNSSKKKAWRHRYRVAFVGDGLNDAPALATADVGVAMAAGTQVAAEAGQV
                     VLMRDQLYDLLVAIDLSRAAFRRISLNYVWALGYNLAALPLAAGLFYPAWQQQVPPYI
                     AAIAMAASSVCVTVSSILLELYRPARWCRLSSTVHSPALRSSKHERT"
     gene            <541279..>543159
                     /locus_tag="CYME_CMP216C"
                     /db_xref="GeneID:16996170"
     mRNA            <541279..>543159
                     /locus_tag="CYME_CMP216C"
                     /product="CTP synthase"
                     /transcript_id="XM_005537817.1"
                     /db_xref="GeneID:16996170"
     CDS             541279..543159
                     /locus_tag="CYME_CMP216C"
                     /codon_start=1
                     /product="CTP synthase"
                     /protein_id="XP_005537874.1"
                     /db_xref="GeneID:16996170"
                     /translation="MSGGGCSSCSCNGTERYGSIDPKLKFVIVAGGVISGIGKGLTSS
                     SIGVLLKACGWRVSAIKIDPYINVDAGTMSPFEHGETFVLDDGSETDLDLGNYERFLS
                     VNLTRRHNITTGKVYSEVIQRERRGDYLGRTVQVVPHLTDLIQDQIMAAAMERVDDSG
                     LPPEVVIIELGGTVGDIESAPFVEALRQLRYRHGQENVCIAFVSLVPCLGVVGEQKTK
                     PTQAGCSTIASLGLPPQLIFCRSDRPLLPETRAKIALFAQVPVEAVVSLHDVSNTFRI
                     PLMMQEQGVTNALISALRLSWRLPVLLERWGRMAAAFDSYQGECRIAIVGKYTGLADT
                     YLSVIKALEHAGMALHRKVHIHWIAAESLENFVDASGDSRLLPNGSPTQRHMAYQNAW
                     RELSAADGILVPGGFGCRGIEGMLAAIRYAREHRVPYLGICLGMQLAAVELARSRLAD
                     GAKANSTEFDEHADPAIVVFMPEVDKTRMGGTMRLGARKTIFQPDGTNSIASLLYGRK
                     PFIMERHRHRYEVNPKYVDRLEKECGLRFVARDETGQRMEIAELNRAEHPFFLGSQFH
                     PELKSRPGAPSPPFVGFVAAAAGLPLDELAIEEMMLRVQSQDPWQPHSEESRGLDSSF
                     CL"
     gene            <547152..>548393
                     /locus_tag="CYME_CMP217C"
                     /db_xref="GeneID:16996179"
     mRNA            <547152..>548393
                     /locus_tag="CYME_CMP217C"
                     /product="probable NAD(P) dependent 3-beta-hydroxysteroid
                     dehydrogenase"
                     /transcript_id="XM_005537818.1"
                     /db_xref="GeneID:16996179"
     CDS             547152..548393
                     /locus_tag="CYME_CMP217C"
                     /codon_start=1
                     /product="probable NAD(P) dependent 3-beta-hydroxysteroid
                     dehydrogenase"
                     /protein_id="XP_005537875.1"
                     /db_xref="GeneID:16996179"
                     /translation="MPTNRKAAAGSGHARQNATGVVATKTPEPRTALITGGSGFLGRH
                     LVELLVERGYNVIVVDLKLFPFTEYSESELVKSLRSQVRDISVDIGNYDALWEALRSV
                     PRIDAVFHCATASPTAANAANRKLMEYVNIEGTKQVIRFCLERGIRYLVYTSSASVVF
                     AGLDLIDVDEESAPLAKKDIDFYTYTKRVAEQLVLQTASSSSTDPARRVLYAVALRPS
                     GIFGEYDPLFIPTLVSRARQGRMKYIIGSGRNAMDWTYVKNVAEAHYLAAEALQESDK
                     RAKQLTGKAYFITNGDPRSFWGFLGSILQGLGYPPPRHRLPFALVYSIAWLVVLIDAV
                     ARLLGRSLSTDFTPGRVLLATCERRVSCAAARRDLGYNPRFSIEDGLERTLRWFRSRG
                     LAAQTEAPMVQSVPKPVATTT"
     misc_feature    complement(549324..551507)
                     /note="possible transcribed region"
     gene            <553979..>557032
                     /locus_tag="CYME_CMP219C"
                     /db_xref="GeneID:16996002"
     mRNA            <553979..>557032
                     /locus_tag="CYME_CMP219C"
                     /product="alpha,alpha-Trehalose-phosphate synthase"
                     /transcript_id="XM_005537819.1"
                     /db_xref="GeneID:16996002"
     CDS             553979..557032
                     /locus_tag="CYME_CMP219C"
                     /codon_start=1
                     /product="alpha,alpha-Trehalose-phosphate synthase"
                     /protein_id="XP_005537876.1"
                     /db_xref="GeneID:16996002"
                     /translation="MVDRPAVQREKSSPGNLASLLSSPGGSRLQRGGQLCSSGDANPL
                     LRTERVGVDVDVDLNTVRDRKRLEREAYSQADITDSGLARNYSLQSLIRSPEEIESID
                     LNAPFVEEYLLNCIQQVQAELNEIREARTSLLRTEETSAQLTGGVDGAVKPRRLFIVS
                     HRLPVQVHFSPVQNKNKPKILLNSSGLFASLRHLRKEYTIRWIGQLMQIQQLSAEQQD
                     ITRRILLAEHGFIPLFIDAKLCRMHQIFCNSVLWRIFHYIPVGVEGERAFCSELWSAY
                     CRVNALYAEAISRESQPGDLIWVHDFQLMLVPQLLRSRQADARIGFFLHTPFPSSEIY
                     RMLPVRRPLLEGMLASDLIGFHTYDYARHFFSVCSRLLGLETRPNGIDNRGAEVHVGI
                     YPFSIDSTSFIAASRSRAVQERKRRLLEGPFAGKTVLLGVDRLDYIKGIPHKMLAFEQ
                     LLESHPEWIGRAVLLQVVVPSAPDLSLDAVDERASSDYLALRAEVEELAGRINGRFGT
                     VEDLPIMVRIMEPDLEDLVVLYSIADVAVITSLREGMGLMSYEFAVCQGEKRGVLVMS
                     EFCGAAHSLPGAVLCNPWSIDEVAETLHRAMALSKMERELRYQKLSKYVQMHTADRWA
                     ENIITDLVKTTETRRQYRRLDYEQLSASFRAARRRLLLLDYDGTLSAYHSHPELAKPE
                     ARVQRLLRQLVIQHPKTLVFVISGRERATLDRWLAATGCGLVAEQGYAFCWPDDAFAA
                     LDSGSGSGSGSGSAPERLDPRMRPAAVKAVAHDTAPALRSPVDKTALLEPRSGTGAVG
                     AYGPARATPLSRMWTQPLFDHDPEVLSRALHTAIDIMLRFEDHTPGSFTQIKESSATW
                     HYSEADPDFAYFQAQELRAHLEESLMHTPLEVLSGKNIVYVHPRGIHKGNAVRYILQQ
                     LKIEEPDWILCMGDDKSDERMFEACMEYVGVRETNPKTSPKLVDEPRAQRHVTLFTCT
                     IGRKNSLADAFVERVDDVLECLESLLDASAMDSMVTVAPSADSGK"
     gene            complement(<558742..>559335)
                     /locus_tag="CYME_CMP220C"
                     /db_xref="GeneID:16996003"
     mRNA            complement(<558742..>559335)
                     /locus_tag="CYME_CMP220C"
                     /product="similar to actin-binding protein, profilin."
                     /transcript_id="XM_005537820.1"
                     /db_xref="GeneID:16996003"
     CDS             complement(558742..559335)
                     /locus_tag="CYME_CMP220C"
                     /codon_start=1
                     /product="similar to actin-binding protein, profilin."
                     /protein_id="XP_005537877.1"
                     /db_xref="GeneID:16996003"
                     /translation="MVCGGQIHRHECPELFVKVRCTGADATLSACSEKLNISGPVAFK
                     TKTFLVSPSKKLFLSDSLNSRQEPIMSWQQYVDTYLIGSGKCAEGAIISAGGDGGIWA
                     RSPGLRVTPDEVSKLLRAFVDPGDAATSGIRVGGRKYMFLRSDGDAVYAKERDDGLVA
                     MRTRTALVLALYSKGTVPGECATAVGRVADYLRQHGY"
     misc_feature    559311..561744
                     /note="possible transcribed region"
     gene            complement(560799..560889)
                     /locus_tag="CYME_CMP360R"
                     /db_xref="GeneID:16995888"
     tRNA            complement(join(560799..560834,560842..560859,
                     560873..560889))
                     /locus_tag="CYME_CMP360R"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:16995888"
     gene            complement(<561421..>563064)
                     /locus_tag="CYME_CMP222C"
                     /db_xref="GeneID:16995945"
     mRNA            complement(<561421..>563064)
                     /locus_tag="CYME_CMP222C"
                     /product="probable ATP-dependent RNA helicase ROK1"
                     /transcript_id="XM_005537821.1"
                     /db_xref="GeneID:16995945"
     CDS             complement(561421..563064)
                     /locus_tag="CYME_CMP222C"
                     /codon_start=1
                     /product="probable ATP-dependent RNA helicase ROK1"
                     /protein_id="XP_005537878.1"
                     /db_xref="GeneID:16995945"
                     /translation="MSQGACQGSSHTSETTAEPLEHSEHFQQVQRFRHQHGIQVDRFL
                     TRRDGYKSVFESVPWDLIPDPIQAFVPDLFERYPQYSDVLEQVLGVLSEHFGATSPTA
                     VQCQAVPLLLEEAFDVLTCAPTGSGKTLAYLLPLFLKKQSGLVLVPTRELAEQVTRVA
                     AHFCGPRGVLTHEIRRLCQPSDVATWWQGSGESPASTNRKASSETATSVQRPASGPVL
                     VVATPLTAIHAHEYGAGQASGSARSPFPAPCETIILDEADRLLEPSLVPTVDRILRIV
                     LEGCQNEGASSKRPRIHFFSATMPPNADELARTVCVSPLRINIEAKGGMTRTVASVEQ
                     RLRFCGSGSDQGKLLALRQMVLDGYELQPPALIFVATQRACEAVAKELRFALLQHLMK
                     TTAGIPQIVRERQAMLLGTRVAALHAARDRETRRQILHQFLVGQIFYLVCTDLVARGI
                     DFKCVNTVVNYDIPADGVTYVHRIGRAGRNGRTGKAITLFCADEAAQARTCAHVMRLS
                     GQNESVPEWLLGLPKKPRNKSKSRGSKRKHLDRSEGMRG"
     gene            <563735..>565057
                     /locus_tag="CYME_CMP223C"
                     /db_xref="GeneID:16996024"
     mRNA            <563735..>565057
                     /locus_tag="CYME_CMP223C"
                     /product="mitochondrial ribosomal protein S18 precursor"
                     /transcript_id="XM_005537822.1"
                     /db_xref="GeneID:16996024"
     CDS             563735..565057
                     /locus_tag="CYME_CMP223C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein S18 precursor"
                     /protein_id="XP_005537879.1"
                     /db_xref="GeneID:16996024"
                     /translation="MNLAHKFIRNGPHELVVRSLRLSFVQRLVYRIESAAGHYGSCER
                     SRAFSAAAAGKTGSSGDGRKHSGNRVPPAGERDTDELKAGSQRGPELAENRVGREQLH
                     RRSGAPVHGRQLNWEEAQRRAVLELFGNPAWLAPYAAEIPVQELSRMLTTFQLVQEQP
                     RTLLADPVLPKFGRPKDSPVGVHVPESVIAAFRREYPPAVAGALELLDPGFVWDTEAG
                     GIPRPKSELPPSVYREDLETLWQRVDERTTGADELRQTARSSRTGVSRGPLAALAQST
                     TPSVLPRKQHRCPLCDLAGGKARELAIKRARRERKRQIKTFIDSFTSDVLERQQALRE
                     GSPQGTQLAAATPDQVVDAALMPLLEETVQRELEAASQREVVDFRDVDLLVRFVNEAG
                     RIQPRRRTHCCAKHQRWLARAIKHARNAALISPIRRIGFDLVGRPTEF"
     misc_feature    complement(564692..566316)
                     /note="possible transcribed region"
     gene            <566889..>568289
                     /locus_tag="CYME_CMP225C"
                     /db_xref="GeneID:16996044"
     mRNA            <566889..>568289
                     /locus_tag="CYME_CMP225C"
                     /product="probable arsenite translocating ATPase"
                     /transcript_id="XM_005537823.1"
                     /db_xref="GeneID:16996044"
     CDS             566889..568289
                     /locus_tag="CYME_CMP225C"
                     /codon_start=1
                     /product="probable arsenite translocating ATPase"
                     /protein_id="XP_005537880.1"
                     /db_xref="GeneID:16996044"
                     /translation="MQWLVMRPKNKVGSRAGVTATNVGATAPAPAAAPGASGLDAMAR
                     TGASSSSSVQRQSSWTPPATAQWSSAVDLVEQRTSRKITIIGGKGGVGKSTMAAATAV
                     RFADQGETTLIISTDPAHSLSDSFDQDVSGGAPVPVLAVDNLYAMEINPEQMKTSLRM
                     LPDSEKLQMMSGMDMGLEDFDSLFETLPPGFDEAIALVEIMKLIQGDPAFAKFDRIVI
                     DTAPTGHTLRLLSLPDFLDSFLGKILTMKNKLGNVMNQFKGMFSGGNDQQTLDSADID
                     ELKRSMNMVRALLRDPNQTEFIVATIPTMMSVAESERLVKDLSREKIPCRHIFVNMVQ
                     PPNDSCSFCKARRREHETNYKYIERVFRDFKVVPVKYFEREVRGAPALRAMASQLFAD
                     DSSSEPGTAASTEDTSRQTTETPTIAPRAATEAKGEQVGGRGNGAGAHHIAASGESAN
                     NNAPAANTATQRSSEQ"
     misc_feature    complement(568793..570787)
                     /note="repetitive element"
     gene            <571938..>572756
                     /locus_tag="CYME_CMP227C"
                     /db_xref="GeneID:16996045"
     mRNA            <571938..>572756
                     /locus_tag="CYME_CMP227C"
                     /product="probable ferritin, chloroplast precursor"
                     /transcript_id="XM_005537824.1"
                     /db_xref="GeneID:16996045"
     CDS             571938..572756
                     /locus_tag="CYME_CMP227C"
                     /codon_start=1
                     /product="probable ferritin, chloroplast precursor"
                     /protein_id="XP_005537881.1"
                     /db_xref="GeneID:16996045"
                     /translation="MAGIGSGFVPTYTLRSARGSFGETKSLSQPARTRGHQRLTFVSN
                     ARRRCQLVASAAEERPERSQTQSEIDFAKLQFSEGNELSGMVFKPDAELAKAGPDESR
                     ARLAYSNACEEAINSQINVEFTAFYVYYALHAYFDRDTVALPGFADYFRKQAEEERDH
                     AVKLMHYQNKRGGRVHLKPIAVPALHFHNEENSDAIYAMELALQLEKYVQMKLMEVWK
                     VADRERDANMTDFIEDFLDMQVESIKEISDYVAQLKRVGTGHGVYHFDRVLADK"
     gene            <575941..>578883
                     /locus_tag="CYME_CMP228C"
                     /db_xref="GeneID:16996053"
     mRNA            <575941..>578883
                     /locus_tag="CYME_CMP228C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537825.1"
                     /db_xref="GeneID:16996053"
     CDS             575941..578883
                     /locus_tag="CYME_CMP228C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537882.1"
                     /db_xref="GeneID:16996053"
                     /translation="MSSLPSQAGSGGSGGDPGERKPFPAFSFGAAKPEGGLMSANALG
                     ALSTAGSGASVSFGSGSGTSSQPLGAKFGFGAGTESKGAAAAPFPGTFGQAAQTPQSF
                     SFLNPASGSLQQQATAQNTASGVASSTPGTGLPGGFGFGARAEAPPAPAATASSNVPR
                     FEIGAGFMSSAPAAGQERPLSSFGAAGSAAAPGTSAAAAAARQPPQPSATPPAGSSGA
                     GNWFAAGTSSGSVPVGKGASDAQHPGTASGVAAPTAPFNIPSSAAPSSATGTSTSTST
                     APGNADRAGTGPNPSPPFSFLARSTQDNARESSTGTALFGSSSTLKSAPDNSQSAATG
                     HEGRQSETAGANRPAFSFGSSVQSGAQNQQNQGQAQPEQKQQPFSFGAASGVTTGGAQ
                     LRFAPPLDTKGAPAAAPTIPGSSQAAPGTALGASPNAAGGASGNAGGSTAPSSTSSLS
                     QEASGTASSSLQFGMQSRSDSSAQEKATAATSQPAAQARPLAASPFSLAGSGTTNQDS
                     TNTAQTKQQTESPWATSAPRASATGIVISNGSDAAAPSPAQDVSQKHTSAAASQALPK
                     ASEQASRAEQALPVGSANAAVAGHAAANRSLPFDSTRYGGFGSTQPNAAETGAGNTTP
                     ASLRTANEQQQQQQQQRESTDTQVKSESRDLKQAGPVNREPQVSLFTSPGAATGTTPS
                     ASVAGAGNGAFRSASQANASAGRPETKQPTQTAASAAATTQPTRAAQAAPNWGPVRMP
                     SAIEDKNVGEITVFFRDTISRLVEQFHRQAQQVARLDRQVIEQQERLVQLLQETEHTE
                     SLMQHMEKELDFILQQQSELHKALTTIEEQVRGTLSLASAGEQAWQAEFAASLAGAVE
                     QEREKYHRIAEQAKQELDQVYQVIGQCIRELNHVQGASSGELGASTSSVSNAAAGVFG
                     YPAAYTDDEQVPLLTILNVHLDTLELLSTQKNDLEHRITELEKVLHTITADPRFSLPA
                     ARPQAALR"
     gene            complement(<578876..>579856)
                     /locus_tag="CYME_CMP229C"
                     /db_xref="GeneID:16996054"
     mRNA            complement(<578876..>579856)
                     /locus_tag="CYME_CMP229C"
                     /product="probable alpha-soluble NSF attachment protein"
                     /transcript_id="XM_005537826.1"
                     /db_xref="GeneID:16996054"
     CDS             complement(578876..579856)
                     /locus_tag="CYME_CMP229C"
                     /codon_start=1
                     /product="probable alpha-soluble NSF attachment protein"
                     /protein_id="XP_005537883.1"
                     /db_xref="GeneID:16996054"
                     /translation="MGLFGSGDKKPVSSRERDPRIDEAYVLLNAGESTFAAAEAAARS
                     VARLFGLSSASAKYEEAASYFQRAGNYFKLAKKWTQAGEAYRRCADCYAHIKDHEHEA
                     ASAYVDAANCLKKPEADPAAAVTALESAMSIHTERGRFGMAARLAKERAEILESIANE
                     TTGGAAADERVAEAYQQAADLYLGEDARSHANSCLVKVAEYKALAGDYAQAIQAFEQV
                     AKLSLENALLKYHAKDTLMRAAMCHLCASDEVGARRALQNYLQWDPSLAGSREERFLQ
                     DLMDAVTSGDIEAFTQVVSEYDSISRLDPWKTSMLLRVKNQLRQAEEDLT"
     gene            complement(<581521..>582858)
                     /locus_tag="CYME_CMP230C"
                     /db_xref="GeneID:16996055"
     mRNA            complement(<581521..>582858)
                     /locus_tag="CYME_CMP230C"
                     /product="probable protein phosphatase methylesterase-1"
                     /transcript_id="XM_005537827.1"
                     /db_xref="GeneID:16996055"
     CDS             complement(581521..582858)
                     /locus_tag="CYME_CMP230C"
                     /codon_start=1
                     /product="probable protein phosphatase methylesterase-1"
                     /protein_id="XP_005537884.1"
                     /db_xref="GeneID:16996055"
                     /translation="MYPLTPVLESSESGSRTESASQGREASPSTEGDLLPAWDEGEDR
                     KADYSESFDTQPLPSTIQETSPGTMGPQTRPRTARSAGLNPSGPLNLWDRVRHKSARP
                     ATGVTCPLGSEYSPLTWDQFFDEKRFVGPGFCVYISGSTVDPSIPTLLLLHGGGHSAL
                     AWAAFVHFLRKQIPATELCVIAYDARGHGETFNVQPESDLSTATQVQDAMDVLEALFG
                     SRERIPALALVGHSMGGAIAVQLAASGRIPQLSGLIVIDVVEGSALQALPYMKSFLAS
                     RRKEFTSLEDAISYIFCGGHVRNLMSARCSVPAQLVPVEAGDGPTPTSTSTPNKHYRW
                     RTQLECTEIHWRDWFTGMSKRFVSVAAPKVLVLAGHDHLDRELMIAQMQGRFQVVILP
                     QAGHSVHEDLPEQVAETVAEFLRRYRLVQSASDHALGHMKIGPITQEKLRYSS"
     gene            <584662..>586296
                     /locus_tag="CYME_CMP231C"
                     /db_xref="GeneID:16996097"
     mRNA            <584662..>586296
                     /locus_tag="CYME_CMP231C"
                     /product="similar to tetracycline resistance protein"
                     /transcript_id="XM_005537828.1"
                     /db_xref="GeneID:16996097"
     CDS             584662..586296
                     /locus_tag="CYME_CMP231C"
                     /codon_start=1
                     /product="similar to tetracycline resistance protein"
                     /protein_id="XP_005537885.1"
                     /db_xref="GeneID:16996097"
                     /translation="MTLEVLPKAQDEKRVGTLGAVPEKVTSHTPLLSPRAMPPGHSEN
                     WASTLVIFYVMFVSEAARGLVLPSQWSYLAETLNGTETQLGALVSSFSLGRLLATIPL
                     GYLSDTWSSGSILLICCMLATIGSVGYATARSFTWLLLTRILTGVGSATVSVCRAHIA
                     RATSVQERTAYFSYLSAVQFIGFAVLPILGVALSALPQTRFGKVILDEFRYPGWVLAL
                     LNLSAIGALFAYYRDPPKHTRGTIMVPCTAERPDIERLESSEAAAEASPATRSDAETG
                     PTADNAMHNVSDAAQSAYCAAGPEVRSLNRAGAEHAMLHADRIKNVDECHEPAVASRR
                     SGSGYDTAAVSDRSDRAVLITCLLINICFRGVCAVVETIIAPNLVSGEGLSITKTSLS
                     IGVLGIIGLLAYLALRPLSAWYGDYPLVVGGLAMMTLGTLVLVAQSRYTLPLWIYFIA
                     LSTIWSIGYPIGQTATLSLFSKVLTNVPTGGFLGIFSAAGSVARLTFATLAGFLDDKA
                     GAGGPFVLSSLVCVTCLVLTILYRRKFIAALYPAHA"
     gene            complement(<588799..>589821)
                     /locus_tag="CYME_CMP232C"
                     /db_xref="GeneID:16996098"
     mRNA            complement(<588799..>589821)
                     /locus_tag="CYME_CMP232C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537829.1"
                     /db_xref="GeneID:16996098"
     CDS             complement(588799..589821)
                     /locus_tag="CYME_CMP232C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537886.1"
                     /db_xref="GeneID:16996098"
                     /translation="MLRRAHATRICGTVRAVLGYAVPSRARSHVTAASDSTAPTEAAI
                     DDIVAWLQKDLLPAVTETEEPSSYIEKETEPIQHLTNSQATDSSAHEKAGTEHPVPAA
                     SSESVSTAGAAGAPATAPLGALAALVNTTCPGFVRGDPKASLVPRTADALRPIAHAEE
                     VIRVNVRLTNRKTFRSILDWTLDDYVQAAKSIQTWDRRFLISVYSGLIPHTRIHGILM
                     RQRKYPEVLKVLDKVVTKTPASVQYSWIAALEQIFSLQRIVELPQSPPAEYLEQRRKC
                     AERKRAAMGTVPARPRRLWTVEENRLLLRIFRSIGPDWNKIAAALPGRSPYACRDRLH
                     RLLGSK"
     gene            <589964..>590638
                     /locus_tag="CYME_CMP233C"
                     /db_xref="GeneID:16996120"
     mRNA            <589964..>590638
                     /locus_tag="CYME_CMP233C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537830.1"
                     /db_xref="GeneID:16996120"
     CDS             589964..590638
                     /locus_tag="CYME_CMP233C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537887.1"
                     /db_xref="GeneID:16996120"
                     /translation="MMLFVSLPWPRNKSQAQTRALRRIFILKPRHNRLFCTVREPAWA
                     QTRRAFLRTLGTLSGGLLLSSLLSLRAPAAVEALQGVNRPDLLPSGPVQKLIDRERFL
                     VSGQRRRLQREIDALEEACGVKFRILTQRYPETPGLAIKDYWGVDANTVVMVVDYFGG
                     VGNVLKFNIGANVDKSISPRFWSRISSKYGNKFYLEENGIDQAILSAFEEAAEEIRST
                     CKDAMI"
     gene            <591759..>592598
                     /locus_tag="CYME_CMP234C"
                     /db_xref="GeneID:16996121"
     mRNA            <591759..>592598
                     /locus_tag="CYME_CMP234C"
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /transcript_id="XM_005537831.1"
                     /db_xref="GeneID:16996121"
     CDS             591759..592598
                     /locus_tag="CYME_CMP234C"
                     /codon_start=1
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="XP_005537888.1"
                     /db_xref="GeneID:16996121"
                     /translation="MRTLSAFCGPFVARRCWRCSKISLRSVNSGRNRQLWLSPGRGGH
                     SRASLLLCMNGEGAASAAPRATRTPPASSRTAQVHRVTRETDVRVWLNIDGTGECRVR
                     TGIPFLDHMLHQISAHGLIDLDIQASGDYEIDDHHTNEDVGIALGLALAQALGDKRGI
                     QRFGHFLAPLDEALVQVAMDFSGRGYLDYGLVMPTERVGTYDTQLVREFFMALASNAQ
                     MTLHIRQLAGLNSHHIIEASFKAFARALRMACEIDSRRQGEIPSSKGALTDQQALRNA
                     RGT"
     gene            complement(<593312..>595597)
                     /locus_tag="CYME_CMP235C"
                     /db_xref="GeneID:16996135"
     mRNA            complement(<593312..>595597)
                     /locus_tag="CYME_CMP235C"
                     /product="arsenite translocating ATPase"
                     /transcript_id="XM_005537832.1"
                     /db_xref="GeneID:16996135"
     CDS             complement(593312..595597)
                     /locus_tag="CYME_CMP235C"
                     /codon_start=1
                     /product="arsenite translocating ATPase"
                     /protein_id="XP_005537889.1"
                     /db_xref="GeneID:16996135"
                     /translation="MTFGEGLSNLLSSETLQWIAFTAKGGQGKTTCACATGIQAALRR
                     PNQRVLVISTDPAHNVSDAFGQRFARDPLPVRGYPNLYAMEIDPERDFAETDLGRALL
                     GNGFGGVAADGEEGARAALPGVEDDPFGLSSLVSELISSVPGIDEALSFGQMMKSVQE
                     MTFDLIIFDMAPTGHALKLLSFPAVLEKGLSRLLDLRSRLAPMLNMASSMLRMSGTPD
                     MGATANAFDEEIVGKIEELLSIVRRVDAQFRDPSKTAFVCVCMPEFLSLYETDRLLRE
                     LRRMRMTCSNLVINQVLWVADLPSHVPQMPPKYLPVCLPQEPCGWSALTLFQSRVEIQ
                     SKYLQQIEDLYAEDFHITRVPMLRNEVRGVDDLRAFGKRLLVDSGIRPLEPAQNSPFE
                     PTLRNVLEARSLELIIASGKGNVGKTTTTSALAIQLAEDTRRQRRVLLVSTDPAHSLS
                     DAFGQNFTVSLSNTQSLSVNDIDEVMRPVRVHGIGGPGILDVLEVDTAHFLQDIGNAV
                     QDTNLSDLAAGATNANDPRTALAAMMLGASPSDIIRDLLQAVPGLDDAIAFTRLMQRI
                     QGLDYDVIVLDTAPTGHTLRLLSFPALLQKGLQKLEEMRQRFAGALSMASSLAESSGL
                     GVGGGRRPDEEIAERLSNMQETILRVVKQFQDPERTTFICVCIAEFLSVYETERLIQD
                     LAEHDIDAHNIVVNQLFPPSATEAERIDMVCARIGMQQKYLREIDELYARDMRLVVLP
                     LEPQEVRGAEALRRFGQRLAS"
     gene            <598084..>600687
                     /locus_tag="CYME_CMP236C"
                     /db_xref="GeneID:16996136"
     mRNA            <598084..>600687
                     /locus_tag="CYME_CMP236C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537833.1"
                     /db_xref="GeneID:16996136"
     CDS             598084..600687
                     /locus_tag="CYME_CMP236C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537890.1"
                     /db_xref="GeneID:16996136"
                     /translation="MNDYRALLLRPLVEAAPHDDGNRREEVSVARPRGLRNIWASDVQ
                     QESNMFLVTYATSLEDIAGFYFYAAATKSKDEPGRKLLLVPNVNRAAYWQSLIAEIDA
                     REAQHPELTIVTPEGLSTPLIAHTSLLLVDGVHLVLGLHGDSSEHCAAGASARNLSET
                     VEFADAITRLLFYHPGKLRVFAQMAGPSSARAQTELVPLLAQWLRCSSVRHIIPQTTT
                     PEPSAALERGAHHWPYTIIPFAVPVEHQLDHVIDQRREYLYEVLEAHTGVFDGKEQAL
                     VLCPTKRSTERTLAALASRLAPQGAACTAPVPSLILSNVPEDSRIKLETLGSLLRNTE
                     AQRRALLGIGTLEPDAGDEESSAWSSASKPAAHSDRVLLQELFRSGALRIAAMAIRSV
                     RGRNDKPEGPDVAASAGRGARKSPSTSMQCADTAHAVQPFATIEYITRILDEMHRSKH
                     AVVVVLKTTHWSGYHGEPKSFQASVLRALSRCIFRVAVEPTGVLDRTRHSQAAIMHVT
                     CQALHRLMVFTSQRSAPWVYLHATGRLFTGDNLPVGERAAEHEVDTSAWWIQHVARTA
                     SQGLSFRLLREMNCCGTPLVDEAAAAEWMRYTLHAALMHRGQRTEQASRRGPDAHARA
                     LVRLLENAGCIQMSAPARTYALTMLGLAALKYQISPESILGFIRSAYGKPRCLGTFSS
                     DNAAEHRHCIGIAAPRPTARIVFDPHRHQPRCRAVIELLYYVCHAGAERELRDADMVL
                     HQIRDRGLRPEQAIPFTLHEMNPARLQKGEAVFLVVQLWMATAEPPHARTIFEAVLAM
                     VHCLCAAISERPALYRQSIIATLASWMEKFRNGAHHWVRAPSDTPRALLEQCLIAWTR
                     YTHAPKDADAR"
     gene            complement(<600824..>601885)
                     /locus_tag="CYME_CMP237C"
                     /db_xref="GeneID:16996137"
     mRNA            complement(<600824..>601885)
                     /locus_tag="CYME_CMP237C"
                     /product="similar to UDP N-acetylclucosamine transporter"
                     /transcript_id="XM_005537834.1"
                     /db_xref="GeneID:16996137"
     CDS             complement(600824..601885)
                     /locus_tag="CYME_CMP237C"
                     /codon_start=1
                     /product="similar to UDP N-acetylclucosamine transporter"
                     /protein_id="XP_005537891.1"
                     /db_xref="GeneID:16996137"
                     /translation="MNCDALHAAWWTLTSCSLNAYSYEIGVRYARDAGQLISFVQMLG
                     VALLTTPQAARELRTHWRQQQRYRLHSPRTWALFMGYFLTFYGTAFLINLSVELGVSI
                     QLVHVSRAGTLVATLILSVIFQRKRYTAVQYICVLLVSAGLVWAALALQATGTLSQSR
                     RDALRASASLWVGIFLLVVNCFLSPVMGILQQLLIAPRPGATGDTLTRSELLCMQHWV
                     AVLLFLIQAQEMEQASLVKNMKLLWRAPVPLSGAGGGTPGELLLMVNTMTQYLCMRSV
                     IQMQVTSRSILYVQLVTALRKLANFLLSAQLFGTKMHGFQWMSLLLVFGGTLGYALSQ
                     DDSPDVQRSHKIPRKNLAL"
     misc_feature    601746..603391
                     /note="possible transcribed region"
     gene            complement(<603151..>603936)
                     /locus_tag="CYME_CMP239C"
                     /db_xref="GeneID:16996139"
     mRNA            complement(<603151..>603936)
                     /locus_tag="CYME_CMP239C"
                     /product="14-3-3 protein"
                     /transcript_id="XM_005537835.1"
                     /db_xref="GeneID:16996139"
     CDS             complement(603151..603936)
                     /locus_tag="CYME_CMP239C"
                     /codon_start=1
                     /product="14-3-3 protein"
                     /protein_id="XP_005537892.1"
                     /db_xref="GeneID:16996139"
                     /translation="MDQAAREKAIYLAKLAEQAERYDEMVEQMRQVALQTNANTPELT
                     VEERNLLSVAYKNVIGARRASWRIISSIEQKEEAKGNTEHVAINREYRMKIEAELAEI
                     CKEILEILKNNLIPSAKTGESKVFYLKMEGDYHRYLAEFSSEQDRKISAEKSLEAYRA
                     ATDIAMTELAPTHPIRLGLALNFSVFYYEILNSPDRACKLAKDAFDEAISELDTLSEE
                     SYKDSTLIMQLLRDNLTLWTSDIGGDEEEARGNEGDGEGEAKA"
     misc_feature    complement(607059..608767)
                     /note="possible transcribed region"
     gene            <607160..>607534
                     /locus_tag="CYME_CMP240C"
                     /db_xref="GeneID:16996142"
     mRNA            <607160..>607534
                     /locus_tag="CYME_CMP240C"
                     /product="retroelement"
                     /transcript_id="XM_005537836.1"
                     /db_xref="GeneID:16996142"
     CDS             607160..607534
                     /locus_tag="CYME_CMP240C"
                     /codon_start=1
                     /product="retroelement"
                     /protein_id="XP_005537893.1"
                     /db_xref="GeneID:16996142"
                     /translation="MSHFLTLTEVAQRRFIRDRQPTYVCFIDFQKAFDTVPHEAPFLK
                     MERAGVSGKCLAFFSALYADSRMRIRLGDSSRTPSRRIHRGLRQGERASPLLFNIFIN
                     DPLKNCRQYGLEVPWIDCGDAR"
     misc_feature    609529..611755
                     /note="repetitive element"
     misc_feature    complement(610572..612800)
                     /note="possible transcribed region"
     gene            <611871..>613913
                     /locus_tag="CYME_CMP244C"
                     /db_xref="GeneID:16996181"
     mRNA            <611871..>613913
                     /locus_tag="CYME_CMP244C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537837.1"
                     /db_xref="GeneID:16996181"
     CDS             611871..613913
                     /locus_tag="CYME_CMP244C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537894.1"
                     /db_xref="GeneID:16996181"
                     /translation="MLMQSDTPVSKRRDVEACDTLTTAGEDADSNALQVVLQGRAAGY
                     TWSDRRTALDRLCESLKTTTALAWLSRFPELFAVEGAGRLGVALCQHAEELRPSIVAS
                     ACRLVHQIAASLQQCIETVDSGRRCHVEAWARTFHARVHQGVYSAVTAHVTSATAVAH
                     AALEALNELAVKVDEERCSVERDEHEQQQVQRADAGETSPQVEELQTDMTGASCSHAR
                     ATMLSGDRKKATSEETDASAKLSPQLELEADLEHWAAPLAANASSVLDYSLSVRKHIS
                     LVSRNERNASLDCPRTGSPVGSHENALSTTSAASADKENTEAGGTRDNGSRTALALRS
                     APPAVHRPETASNAPLNKTEADAALVEKNRELTAILQQYEATLETLIQSETESQACSV
                     RTKLLNLDTENNQLKADLLTCTEAFEQLRSRYRDLKEKLQVAQENERRATAIAQTASE
                     RMDEMERYLREFKHHAEQKLTQAFQLVSQSKNDVMTRDATITSLEKALEAKRTECAEK
                     DAAISEAMHMYRRAESSQEQLQARIVALENEMQALRSRAQTAESELEVLRSELAVSGP
                     SNLLGDASAPLGPQLEELRSALAAARSREETLQRELKRLNNENQSLKARTYDHLQTIE
                     SLRAELQRPKPVPTPALGIDAAEVERLRDENEELHQLCNTLLEKLEALEARTSAAH"
     misc_feature    complement(612987..614356)
                     /note="possible transcribed region"
     gene            <614309..>617662
                     /locus_tag="CYME_CMP246C"
                     /db_xref="GeneID:16996183"
     mRNA            <614309..>617662
                     /locus_tag="CYME_CMP246C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537838.1"
                     /db_xref="GeneID:16996183"
     CDS             614309..617662
                     /locus_tag="CYME_CMP246C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537895.1"
                     /db_xref="GeneID:16996183"
                     /translation="MVHSPLPGSYKTFSTADEKRRVPNQRPIRKHRGWRIRALSRNAF
                     RNLPASRLSTPMTDWKQWKVRELKQYLLEHDPSAMPAQQRPTKAELVEAVEQVHQRLQ
                     RRQKTKQNPPRALPKEEAREPRRPGPRPRQSALGDERKLPTTRAPRTPKKAERQQQDS
                     NRGVGKSEAPERPSSSESVTATSRKTRQKRSARKTEAVQGSSGVDGSSSGRKRVRRSP
                     LRGEEARRRLVGDDIPEDRSPDGGAWAESQHPLLWSVRPRSEAQLSPASLIQDLRRRP
                     FSANATSTRTSSPDRHRSASPRASSTWQDTTREFRPTKQGRSPSPTVSASNGAGPSTS
                     SGLGLREALRDVLSMVKSHDQLEPMEYVEYPEQVLPAEAESHARWHALTHQVSAVTPE
                     AGDGASRSSLHSSPVAGRDVPWLRQPRNAAAQTKEASRITLLRDTCDPLAQSQHMPPR
                     EDVVALSTGSPGELTSGGTLAGTRSTPTRAYTVQQDEAASGFMTGSMEGTRLASLHEQ
                     VSAVLERIRAEQANLVSGPEAATSTALSRNADSLATDALHQRLGDSGAAAPAVASLEN
                     RSPGGSAAALTRGTLTVAPEPPFAQSPLQAFRTLRQNRERMPVSSAATLTGSLRGRPV
                     HPLEQRSGDSAERSTSATTTDPTRSPGAFHASWSLPSTDAHSGDQPSISESQRYLARP
                     ETHAAVQETSAGTPGNASRVSRRDPALLGNRALEHRHWLRSHWRVLVALCLLLWFAVR
                     IYLVLPSIPFCDSSESGSGPVLGCRPCPEHGICVGGVLTCRDGYVVLGSTCAPDRDLN
                     RYAHIIQGQVHRLLGESAGRYRCGERAIRWKWTERELREALEQHPYMERLVRSSKWKA
                     AFRRALDTLDDPVVKQPRSAHDTVHRSPRSVDDANDTVPAEAFQRGGAAERPLLADDS
                     GTNSNSNSNISPNMASNESMQPDSDATQTGQLADDELLLYWSTDAQRPMWCRLWQLTE
                     AHLGSLIWLGSITAVTLMFATTLRRKRLRQRQIRSLQQAVHGRLQEQKRSYLVALQRG
                     RADVVTPFLIDVHLRDELLGDIANIYDRQRLWEGVSARARTDSRLQLRSETFTDGRRA
                     LVWEWTGPLGSAENAAPHLVLSGGTTSVE"
     gene            <623628..>625046
                     /locus_tag="CYME_CMP247C"
                     /db_xref="GeneID:16996184"
     mRNA            <623628..>625046
                     /locus_tag="CYME_CMP247C"
                     /product="methionyl aminopeptidase"
                     /transcript_id="XM_005537839.1"
                     /db_xref="GeneID:16996184"
     CDS             623628..625046
                     /locus_tag="CYME_CMP247C"
                     /codon_start=1
                     /product="methionyl aminopeptidase"
                     /protein_id="XP_005537896.1"
                     /db_xref="GeneID:16996184"
                     /translation="MTQESVVEAEARLEAGLAVSDKVMNFSLGKATAVPSSKHVHTAA
                     VSAQTVVDDDDEDADDVTATSTSEKGPKKPHKRRGKRGGRRKGASENGGGDSTVASSP
                     VPQPLPKATCSTELCGISRLFPEGVYPAGEVQDYVGDQAYRTTQAEVRERERLSFDMI
                     GKARKAAEVHRRVRTYIRPRIQPGIRLVDLCEELENATRTLVEEDGLEAGIAFPTGCS
                     LNHVAAHYTPNRGDDTRLQHTDVMKLDFGVHVDGIIMDCAFTIAFDERYEKLLEAVRE
                     ATNAGIRAAGIDVRLSEMGSIIQEVMESHEIELDGKVMPIRSIRNLNGHSIDRYRIHA
                     GKTVPIVKSSVPGKMEEGELYAIETFGSTGRAYVTESGECSHYMKVFDASHVPLRMPR
                     ARQLLSTINRHFGTLAFCRRYLDRLGEERYLMALKHLCDVGIVQPYPPLCDVPGSLTA
                     QFEHTILLRPTGKEVLTRGDDF"
     misc_feature    complement(625057..627976)
                     /note="repetitive element"
     gene            complement(<628033..>630414)
                     /locus_tag="CYME_CMP249C"
                     /db_xref="GeneID:16996171"
     mRNA            complement(<628033..>630414)
                     /locus_tag="CYME_CMP249C"
                     /product="probable endothelin converting enzyme-1"
                     /transcript_id="XM_005537840.1"
                     /db_xref="GeneID:16996171"
     CDS             complement(628033..630414)
                     /locus_tag="CYME_CMP249C"
                     /codon_start=1
                     /product="probable endothelin converting enzyme-1"
                     /protein_id="XP_005537897.1"
                     /db_xref="GeneID:16996171"
                     /translation="MSVPSERSPLFGRGTLDQEAGSRDVGSDGANMSAVARQAVTERG
                     RRVRRTLVLVAIGTALLLLLFISYSRESGNKSYAGPGGAGGTQGTNETQDRVLREIRA
                     FINPQEDPCEDFYAYACGGFLRSQPIPPNEARWGTSDLMEERCSDALLPMVQALRSGR
                     AVSRTASEQRVVDFFDACFAAGQPSAADIERSGEDGLANDASSELLNASGFGRILSQL
                     ETIADPTELFAILGEMHRSVVDPGGNLPRPFFSYEVLPDGMHPEVMVLTIEQGGLGLP
                     TRDYYLDEYYKDILDEYSNHIGRMLTLSGTDQAEAMQAAANIVEWETELAKASEAEAD
                     LGDDAWAVYNPTNLTALQHEMAPAIPWTNYLESLLAGTGKNASAIPLVVQWPPFLKRL
                     SDMVALSSISNETRKLSLYLRWHVLNAMAGAAGNSSLAAEHFRFFGQIVEGRRGLANL
                     SSQCLALADAHIGDDLGRLYVQRFFSPELRGKAVELIRSIEEEFAVILKRDDGAWLGR
                     SSLRAALEKLRLVQNNIGYPDRWPDYDTLHLNGSDLLGDVFLCRQFRNDAILKQIGGP
                     RNPSLWDMTPITVNAYYDPLSNSMNIPAANFAPNFYSALYPEAVNYGALGNVIGHELG
                     HAFDSGGRHYDAHGRLSNWMSPQAVQEYDRRAKCMTNLYDHFRVNGRPVNGRLTLQEN
                     LADLTGMKTAYAAYNRLVKEHLTEAARHREWNLTRRIRPDWTPEQLYFVAFAQTWCEN
                     ETPKYAMEGLVVDVHAPNRYRVNGILSQFPEFAEAFRCRSGSAMHPRKVCALW"
     misc_feature    complement(630451..633502)
                     /note="repetitive element"
     gene            <633810..>635087
                     /locus_tag="CYME_CMP251C"
                     /db_xref="GeneID:16996172"
     mRNA            <633810..>635087
                     /locus_tag="CYME_CMP251C"
                     /product="similar to Ras-related GTP-binding protein ragA"
                     /transcript_id="XM_005537841.1"
                     /db_xref="GeneID:16996172"
     CDS             633810..635087
                     /locus_tag="CYME_CMP251C"
                     /codon_start=1
                     /product="similar to Ras-related GTP-binding protein ragA"
                     /protein_id="XP_005537898.1"
                     /db_xref="GeneID:16996172"
                     /translation="MSLGSAGRPDSREKVSQIEGSAILLVGARGAGKRTIRSILLGAP
                     SASAVDSPVQSGQLSSLRLFGSVVLCLLDLELPISVETASQLRGFLRTGRVLSLVFIV
                     DVSSSEGASADRNWIRAVTELTVAKNLPALQRYIILHKTDMLPDGSAAAQLRRQARVC
                     CEAGYLDSSRCFRTSIWDSSLYHAWSTIARSLVPDIAQVQEALQALSRDPSVRRIVLL
                     ESTSLLVLGYAGAPLYGRPSLETEPKAASSPVSRWLAWFGSSETLPRGQPQAGSERPA
                     EELADPTQSTKQRSRWPWRKLERWSSAPLLDRSELVAISEPFRLKDAEAFEKMSLILK
                     RLKLACMRTGTMFQMLRVRKQHGDALLEAFTPHTLILVHLRASENREQEQKRILSAMR
                     ETLKPAYRSIAKLEHTAEDVPWSLSDSSRIGAF"
     gene            <636852..>638246
                     /locus_tag="CYME_CMP252C"
                     /db_xref="GeneID:16996173"
     mRNA            <636852..>638246
                     /locus_tag="CYME_CMP252C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537842.1"
                     /db_xref="GeneID:16996173"
     CDS             636852..638246
                     /locus_tag="CYME_CMP252C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537899.1"
                     /db_xref="GeneID:16996173"
                     /translation="MSLPRPWESTCALSGNGVSAYQNATWSLQHITLTLAAPSNNLIT
                     TQFDDGGEGGIPAGHSLAFTTALQGWRRGCGRARGAHSLETLFPECYRPQGRRVWHLY
                     RPLKRMQSAVAYSALTMLADLSGVSVLQRRARCTEAAQGFVSSTCASGLQYSSGLNGA
                     AEHSSTASHRGDEAPREIMSRFVSTVLKLKHHKTSHALLPIGNNGVTSASLTIVQPGN
                     FASNPFRTSARSLVVINRRKTTPSATGETASPLVASVRTSGTSSADALHSGGGVSTPI
                     SSAYHFRNVRSMAARRRWADPFYRHRVLEARRRTLSRKRRVAAALARAEANHDSSPTE
                     ASAQLGTNQTGSAHGKLVKQATSKCRRAGPVESITLVDENRARQLIAYAQSNAKRSEK
                     HRQMRADRIHWMNQRLAAGEKQRMRLFDPEFREALQRRRREMALLRHARQGSHGDDRE
                     RCVEHESTCPGDAC"
     gene            complement(<639072..>640316)
                     /locus_tag="CYME_CMP253C"
                     /db_xref="GeneID:16996174"
     mRNA            complement(<639072..>640316)
                     /locus_tag="CYME_CMP253C"
                     /product="similar to voltage-gated K+ channel protein"
                     /transcript_id="XM_005537843.1"
                     /db_xref="GeneID:16996174"
     CDS             complement(639072..640316)
                     /locus_tag="CYME_CMP253C"
                     /codon_start=1
                     /product="similar to voltage-gated K+ channel protein"
                     /protein_id="XP_005537900.1"
                     /db_xref="GeneID:16996174"
                     /translation="MSRRYFRWSGHTWTSDMRFRTADLNGSELVPRLAFVLSTVWRPG
                     CNSCYASERTALYSHVRRRLRLQRVSSSTLVIPPRTNFLRAYIVSKAEFERDEDGSRL
                     AFRLPFARDLDEALNSPAYELVLTGMVVTVSALYALETLPQLSLELRELFVRIEAVIS
                     GVFVIEYLLRFYSQGLDPRYLLRKAMLLDFISIFPFLIAQGLMNDAFELQFVRLLRVL
                     RILRLERLVEEDTFRRFFLGRADAAYAEYKLRIAQIVFTLASIIWVTSGLIYDAEHGA
                     NPQFQTYFDALYFSIVSLTTVGLGDLAPRTPLGKLTISLAILVGVAIIPFQLGQLGRA
                     LFATEGGSEHGPDDPAAFFGRNARPVECQRCGQKRHSWDARYCRICGERLPKTVSNGA
                     NGSVATSSNDKPDKSPDTIRES"
     gene            <640876..>642813
                     /locus_tag="CYME_CMP254C"
                     /db_xref="GeneID:16996175"
     mRNA            <640876..>642813
                     /locus_tag="CYME_CMP254C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005537844.1"
                     /db_xref="GeneID:16996175"
     CDS             640876..642813
                     /locus_tag="CYME_CMP254C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005537901.1"
                     /db_xref="GeneID:16996175"
                     /translation="MEAKDDCTVMNEADKVAASLEELAAHEPIGTLLLRRALAADEAV
                     SHLHEYAGGSVYLERLHARTMVVYLRDRFRLNPLFESSDQVLEVANVIHSSHPRSFEK
                     CQDLFQRFMLELLTQYVLMDAMERLQNRGTWQVDLEPLEELVQEDPSYASGLARVRLH
                     ELEAIFAKKHSPLSQKSSSKAKKSSASANKYLGLDQRQLATSLFPEDRLLPMATEYVE
                     ALLEWLGKPPLTAALEALAMLERHNAANPHGHEAASPSRLDSEALSETTARPQRTQTG
                     NENLSRSPGKRAEIRPAPVAVAVGEQAAQTTALATKKSASRSQTSTPPASAAVPPAPR
                     GTKHAESALDEAFAQHGRTGSSTRVQEASSTVDQQQTEHVKSRTRVPTPAADQDREPA
                     AKQVDPTDDAIAEALRYNAPDEKRQRGKAAPRLPAAKGARLFRHPSSLTTNEYVATQE
                     KVSEHKRRKRVHEPVAPAFESDAGGRQPARPTSQPQAPMTRPGSPQPTKPATRGGHEL
                     PLSNEGGIKLGPLVRYTPEEDEALLDGIRACGVGHWRLILNRIQDRLQEPHRSYQSVR
                     KRAEQLISQIGTLPEPPPPLNSFAKVHFTAEEDAELRKGIDLFGYGSWSRILKHGRFH
                     PKRTAESLKSRARVLKLNRLL"
     gene            complement(641127..643913)
                     /locus_tag="CYME_CMP255T"
                     /db_xref="GeneID:16996010"
     misc_RNA        complement(641127..643913)
                     /locus_tag="CYME_CMP255T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461528.1"
                     /db_xref="GeneID:16996010"
     gene            complement(<643897..>645378)
                     /locus_tag="CYME_CMP256C"
                     /db_xref="GeneID:16996011"
     mRNA            complement(<643897..>645378)
                     /locus_tag="CYME_CMP256C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537845.1"
                     /db_xref="GeneID:16996011"
     CDS             complement(643897..645378)
                     /locus_tag="CYME_CMP256C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537902.1"
                     /db_xref="GeneID:16996011"
                     /translation="MDAQAVCVHPLALLRVSETYTRSLERLCAGARGASSGTQATGRV
                     VTQGLVFGTRPDWPAETAVLHLQCAAAVSRSCCWRIMAVAECVPFTPHHIERVYQAAR
                     LMYREMTLLGWYAAGSASAKDESTALDASQLSVDAAIMHEFVEEAIWLDVKFATLTRE
                     EDGVVATAGAAASADPNVRVWLIAPRSENDGKEVAAGAAEVAWVPRTHTIKQWEEFLG
                     SLHIRQLSLLVEESEAERYVIQTLFWGSSSSHSNAGRIHAGTESDDKESLGADVSAPG
                     HDQPSRTRDATDTCATAARVFSERIIPTALRTESCPNVQGVKHAQAVSTADSTEDCVS
                     EPASDSWSQSEVLSMALSLALRSVQDSVSCSRLYAELCALEQSVCALEECVRGARSFV
                     QELQSHQTSAQTNVSLSEQDAQRWSRLRRILVALPPYEASAVAADRRTASQPILDGLH
                     RSLAIEALCSEVAGLGALYDRWQQLQQEQRPPTTAKTGNRTPT"
     gene            <646035..>647597
                     /locus_tag="CYME_CMP257C"
                     /db_xref="GeneID:16996159"
     mRNA            <646035..>647597
                     /locus_tag="CYME_CMP257C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537846.1"
                     /db_xref="GeneID:16996159"
     CDS             646035..647597
                     /locus_tag="CYME_CMP257C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537903.1"
                     /db_xref="GeneID:16996159"
                     /translation="MGDDSSDKGPDKEPKWDQAGQGWSLPRPTGSCSEPGCVEYGSTP
                     DLGANEPSAAGSTSLAAAEDWSNVAGVDDDFDNADDDDNDDNVEDLEFVHQGASEFAS
                     EGVDVDGTSTQTRSKGRQRPANQRSRISRRSRRYDPLPQQPDGVVVRRRKEPAKVENA
                     TQGNFGLFAHQETAAGDNTLEIEPAPEDAPSEGVPIRGQDPNELAPFDHAETLDLEQG
                     VTHEPVLFNAAVRPKRWTWKRLWRRLFRWRRPLDPTTSGSALTPQPYDALRREPGPSN
                     NPADVELDPEDEEGPEMLSAAIGDFLSAQYSWEIHAHRLVSQPDQSYAIAVNREALER
                     KEQLRTEEQRQAAEQSRLRMAAMQFRSLFIRDASHDEAMATGDPDAFDLSVAELEMHE
                     RRVRAFRILLLFDAIFFVLLSITWLDALIAHDVSNLQSTIIDGVVCGTNIVIDIIGLR
                     AVSVQSARWLGVFIALYWISLIGTIIAIPLLPLIPLLRFLLLPMAAAIKQFIEFQERQ
                     QQQLQNQAMIFV"
     misc_feature    complement(646697..648688)
                     /note="possible transcribed region"
     gene            648340..650209
                     /locus_tag="CYME_CMP259T"
                     /db_xref="GeneID:16996161"
     misc_RNA        648340..650209
                     /locus_tag="CYME_CMP259T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461529.1"
                     /db_xref="GeneID:16996161"
     gene            complement(<649000..>650526)
                     /locus_tag="CYME_CMP260C"
                     /db_xref="GeneID:16996104"
     mRNA            complement(<649000..>650526)
                     /locus_tag="CYME_CMP260C"
                     /product="pyruvate kinase I"
                     /transcript_id="XM_005537847.1"
                     /db_xref="GeneID:16996104"
     CDS             complement(649000..650526)
                     /locus_tag="CYME_CMP260C"
                     /codon_start=1
                     /product="pyruvate kinase I"
                     /protein_id="XP_005537904.1"
                     /db_xref="GeneID:16996104"
                     /translation="MTTIENNVRLTFRGAISKAPTRHGIVRTKVVCTLGPATRSKQTI
                     AALLSAGMNVVRLNFSHGTHDYHAGTISMLREVLAETKRTCAVMLDTRGPEIRTGLLS
                     EELHGEVALKAGQTFTLYSNLSDPQRQRGNAKGVFQSCRDLSSILSPGAQVLIDDGLI
                     ALTVEEVCADQVHCRVMNDGVLGERKGINLPGATYNLPALTEQDMQDILFGIAQGVDF
                     VAASFIRKRIDVEQIRSFLKEHGGSAIQIISKIENQEGLENFDDILEASDGIMVARGD
                     LGVEVRLELVASAQKHMISKCNVAGKPVITATQMLDSMIKNPRPTRAEVSDVANAVFD
                     GTDCVMLSGETAKGLYPVQAVQTMVNICMEAERALDHAAVFQAIRNFARSHELSVTEA
                     IASSAVKAAYDLKATMILCLSETGRTARLVCKYRPSCPCLVLTSNELTARQCLLSRDC
                     FPVVVGSMIGTESLIARGLQTARASGIVATGDLVILISGMREGVSGSTNLLRIITVEA
                     "
     gene            <651599..>654154
                     /locus_tag="CYME_CMP261C"
                     /db_xref="GeneID:16996105"
     mRNA            <651599..>654154
                     /locus_tag="CYME_CMP261C"
                     /product="similar to small conductance mechanosensitive
                     ion channel"
                     /transcript_id="XM_005537848.1"
                     /db_xref="GeneID:16996105"
     CDS             651599..654154
                     /locus_tag="CYME_CMP261C"
                     /codon_start=1
                     /product="similar to small conductance mechanosensitive
                     ion channel"
                     /protein_id="XP_005537905.1"
                     /db_xref="GeneID:16996105"
                     /translation="MEEPTVRQGRVRQQTSRCGFTLVALGAPTRKTTFIEEKPSSAWA
                     LPVRFGSFDARWRCVSGRKRLRVSAVNARRSVLSLSFVALPAWDAAFVEAVFLHANAG
                     SVRSYEEEYVARERIRSLEKADKALSGNPAEQSASGSATLPNLNLEEARSAPRRPIRL
                     RIPRWGMPRRSSLPVEPEQSTPGQLKATQQLREGTDPIRDQRSSWQDRGSILADKQMV
                     PPDLLPDADPEGANSDGSGSGVHELPDSLSPESTFEHPMRLHERIRALTAPVMGWLWY
                     MLFSRNWSAFLSRLSLVVALLILLRYGVNRSLRWLYKRFQSVDPKGTTLPFEDSVFES
                     MQRPLEIFAVTLLGTYMAEAVSRPLAATGIIKYLHPLRELGIIIATTMFVLRWVNKIR
                     LRFLRAPESQRRGIDQAQVDAVSRIVSVATVVVALLISLDTFGVNIQAVLAFGGIGGV
                     AIGFAGREVISNFFSGFMIYLTRPFTVGEWIRSINEDDPIDGFVEDIGWYLTRVRTWE
                     KRPLYIPNSKFSTLIIENPSRMTNRRIKKTLHLRIEDMHVVKTVVDEIRTMLMSHPDL
                     DPKQHRMVYVEGFTEFSCNIWLSCYTKQVFLESYMKTQQDIMLKIHEILRKHGARLAT
                     TLVRDLRDGTNPDIYGAGARLRPMDMEQEYRAGAAPVEYHLNRTGAPVPELGRDRPAP
                     PMEATGPSTWGEAATKNVSPGSTTTAGYTSGSGTSESGSESSVDRASSKKLRDIGQGG
                     NGSHGYVREPKSPAGALGGVAAPSTGGGGNTATGGSNGSGNGAGGVTAKRSEASTPPG
                     GEARPRSVTTTQQGMIIRGDTSTSAAYGNTNEEETARAGRRSEDVSDKPSKGS"
     gene            complement(654267..656092)
                     /locus_tag="CYME_CMP262T"
                     /db_xref="GeneID:16996106"
     misc_RNA        complement(654267..656092)
                     /locus_tag="CYME_CMP262T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461530.1"
                     /db_xref="GeneID:16996106"
     gene            complement(<656976..>657629)
                     /locus_tag="CYME_CMP263C"
                     /db_xref="GeneID:16995999"
     mRNA            complement(<656976..>657629)
                     /locus_tag="CYME_CMP263C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537849.1"
                     /db_xref="GeneID:16995999"
     CDS             complement(656976..657629)
                     /locus_tag="CYME_CMP263C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537906.1"
                     /db_xref="GeneID:16995999"
                     /translation="MPLMYTVSDSGDCETAIAARLEQRYDEFLQSAGQVLVLTQAGRG
                     VETSPDALARSLAALEQSAEHFARAAQALATDEDNLRCLALPTLEAQVKQLREQYAEE
                     KKALSVAESQLASERELRALCVEIERLPNCSELELEICERRAELESISSQRLEQQEQL
                     AELRATLNALQQSVATMGTVLGIMNEQKHEASAETPNAAFEAPNVGAGSVSSREAYH"
     misc_feature    complement(657602..660629)
                     /note="repetitive element"
     gene            <661051..>662034
                     /locus_tag="CYME_CMP265C"
                     /db_xref="GeneID:16996000"
     mRNA            <661051..>662034
                     /locus_tag="CYME_CMP265C"
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit F"
                     /transcript_id="XM_005537850.1"
                     /db_xref="GeneID:16996000"
     CDS             661051..662034
                     /locus_tag="CYME_CMP265C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit F"
                     /protein_id="XP_005537907.1"
                     /db_xref="GeneID:16996000"
                     /translation="MDLVPVAGVTGQTLQVHASPTVILEILEQFFLKKPDQERVIGAL
                     LGEVNVLDDEHSTSAGTDAAVRRQIEVWGSFYVPHSETDTEIALDIDYFGQMRALSLQ
                     DGSTGPTVDIIGWYTTGGIDKPTSIIIHEFFARQCNLPVDQVVCLLVRPDIRESNASK
                     RVVHPPLIQAYSGFASVLGRQNMSTDLEPVPLEVTASDAEQLMLNGVVQALAAQSNVH
                     SRFGRITRATALGGATHELVNLTRSLRKLVDALDTVLEYLRDVVSGEKAGDPAVLELL
                     NLVEAELNACGDEALMHALDTNLKDQLMTLYLSRLTSANLVLGERLLTLEK"
     misc_feature    complement(661304..662208)
                     /note="possible transcribed region"
     gene            complement(<662619..>665453)
                     /locus_tag="CYME_CMP267C"
                     /db_xref="GeneID:16996165"
     mRNA            complement(<662619..>665453)
                     /locus_tag="CYME_CMP267C"
                     /product="similar to phosphatidic acid-preferring
                     phospholipase A1"
                     /transcript_id="XM_005537851.1"
                     /db_xref="GeneID:16996165"
     CDS             complement(662619..665453)
                     /locus_tag="CYME_CMP267C"
                     /codon_start=1
                     /product="similar to phosphatidic acid-preferring
                     phospholipase A1"
                     /protein_id="XP_005537908.1"
                     /db_xref="GeneID:16996165"
                     /translation="MLKNMESENDDSGAAPDKWARITSESSLSALARWWYRSASQKNT
                     NHAERHVNELPGEQVGTSTATGWSSALVAPEPAARAAERARSSNAQGATGEPAVQQRS
                     PADSPPRKLVHAGVPATQTAASSSPNLKRRSVGQITIDASAVLLSPEMLHKLVKPDMA
                     GYLYYRWRMRWQRCWLSLDGSLLRFFEHDPRTGRRGRLIHTISLFYWDYIRTPSYSDP
                     RRPYILEVKDAKGVVHYFAADSEEDLICWKEAFFRARSVAPPAHAIPSMAEAASVVAK
                     TNIQKGQQTNDAVTHRRSIRGMLAEVTPPQHLICIVHGIGSDEQRLRENLKNFHDALD
                     EVMQNTLPDALTHFGIKTIYCHWRAALRKLDVYQRMLQLNPLGDQTPSRWRTLVNNKL
                     MDILFYLTPRIKRFIQCEVVAQLNEEYERFRQKYPEFRGDISILGHSLGSVISYELLV
                     QQVLSDPIMLEREGLRLRFPVHNLFLTGSPLGHVLNVDDHLRSTIGYWPFRLVNIINP
                     SDPAACRIEPILDPFFADIPPVEIPAMAGGASSWLSFQSTGRSGRARTANAKDGSADG
                     SGSGDFVSDHDSGTLSCAPVAASTAGKQLGSAAFKPRNGTSPVQRELPEESSTGDPAT
                     TQPLHWTRSPQPHGWFPQLETVRKLVCQFRIDYVMRPNFMEDLWGLSAHLNYWRSRDV
                     AYFIIQYILRQQLERQHQQSVATSPRIGKAHEHQSQSRAQGATPCPTVCPGPASPSPA
                     SGLVQPESEASNGHTTRAARAESNANIAASIRDDRAASISGTAEALDPALPYASYAPG
                     TALLDASEKRLPADNKVERSVVATPPHGNDDGQARDGMPTMLCGVSTAVPQQVGGDLT
                     KDDAERAQAAPERPAVVHQSVPPSNRLSAAYPTVRSAFMTRLDGLRAETPIGTAAAAD
                     SDPVGAMSDTMRTPESFYSSEDDDQRPASV"
     gene            complement(666530..668081)
                     /locus_tag="CYME_CMP268T"
                     /db_xref="GeneID:16996166"
     misc_RNA        complement(666530..668081)
                     /locus_tag="CYME_CMP268T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461531.1"
                     /db_xref="GeneID:16996166"
     gene            <668262..>670406
                     /locus_tag="CYME_CMP269C"
                     /db_xref="GeneID:16996167"
     mRNA            <668262..>670406
                     /locus_tag="CYME_CMP269C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537852.1"
                     /db_xref="GeneID:16996167"
     CDS             668262..670406
                     /locus_tag="CYME_CMP269C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537909.1"
                     /db_xref="GeneID:16996167"
                     /translation="MSTEESRVKRLELVLNGVEDERERERAHAVRTLQSLLPLQPLEV
                     LLIVKRIDAALRAERPPHWKYTTGALTVAAALLSAERGEALEQLTTTARVSRRNVAPG
                     VAERHCFQETPQRMALVQSVDHETLEALLELLTATLPVFLGRSEAALRVAAVEALRQV
                     VSHRSLAAWTYLVPTLLCLLEEQLVRSRSSESITLTQDKAKATISETFAVSDKPVTTA
                     QETFALESTLDAIAAGLSALAPLDLVPSLVLAHHAFLESNVLSRCLQHRNRFVRESLL
                     HLVCELIRRCQDLLDRCEGQVQDNRQLVRATALACAPLIARGLDDNWSQVRFAGMLAA
                     HRLYLVFEQLPLQLRFSVDRLLLPRLCLNRHYLAEGVREYARKTWLALFGAHGRELVA
                     TNLADVIPYVLKESQAENHAVREAACHLMAEIADRLDPCLVKPYVDALLTALIDCFHD
                     ESWPVRDCASSACAALAMVFDLHEQPPERVDELFTLWFRHCADNIPSVRQHAAEALAK
                     VSARLQGAYLERVFEYLGSALARATEQPPDLVAGESASTEVTETTFQSMKQVRDNDVR
                     LHSNQTMYSCGSLAPKMRARHQRVGCMDCAYLREPEPWEYTDGALYVWRHLSELGYGE
                     RCASSPYLELIVERLIQLPMFHRLPTLWATLWTQFALALPFLPPQRIAEMLPRIRAAM
                     GRVADCGQAHVLRALEEMRQALKPWETTDDSK"
     gene            <672347..>673153
                     /locus_tag="CYME_CMP270C"
                     /db_xref="GeneID:16996112"
     mRNA            <672347..>673153
                     /locus_tag="CYME_CMP270C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537853.1"
                     /db_xref="GeneID:16996112"
     CDS             672347..673153
                     /locus_tag="CYME_CMP270C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537910.1"
                     /db_xref="GeneID:16996112"
                     /translation="MEQQSQRPSDASAWERGTPQPETSPRADLASLRHAEGYAEDPLL
                     STEFIGEIDVDQLVAELESQAPQLLSQGGGFFAESSFGESTRGAPEAREVPGIQRGTV
                     APAYVERSVSGGVGNAAASTGARRYSSGSAASASTRAVGLETAEVSSFEVSSLGKRPS
                     ALGSPFLHRSRSLTASMAAAAAAAAAGVGSSAEFRQQFEERLRKLEQDYMELCRYVNE
                     IQANVAIERHVELHRLQRDNAELAALNRRLAEELARMQKRLQEGHGGAQS"
     gene            <674120..>675052
                     /locus_tag="CYME_CMP271C"
                     /db_xref="GeneID:16996113"
     mRNA            <674120..>675052
                     /locus_tag="CYME_CMP271C"
                     /product="similar to cyclophilin B"
                     /transcript_id="XM_005537854.1"
                     /db_xref="GeneID:16996113"
     CDS             674120..675052
                     /locus_tag="CYME_CMP271C"
                     /codon_start=1
                     /product="similar to cyclophilin B"
                     /protein_id="XP_005537911.1"
                     /db_xref="GeneID:16996113"
                     /translation="MFISYSVSSLWRVSDYDTSFVSSTGPRAPNNERQRRVSTRPFAQ
                     NLRLAEEPVWDRRQLMKQAGVLLELLAISSVASAKAAQVADNPPTQHTSCRAGTPFAK
                     VTDKARFVVQIGTTSGSERLPLVIGLFGTEAPEAVERFKQLVEQRLVHHGRQLGYSYT
                     TASRIIPNQRIELGRISQLEDLATADGVPLRPRMLLSPGTRDRNALRHRCAGTVSIPH
                     EPGRGFEFCILPVDVSDEHAFVQELDAENVVIGCVIQGMDTVRQLNEIPVSRPTPRDM
                     LRRVGQALGDVRARQDPTWRPLRKVRILECSLIP"
     misc_feature    complement(675270..676079)
                     /note="possible transcribed region"
     gene            <676329..>681521
                     /locus_tag="CYME_CMP273C"
                     /db_xref="GeneID:16996176"
     mRNA            <676329..>681521
                     /locus_tag="CYME_CMP273C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537855.1"
                     /db_xref="GeneID:16996176"
     CDS             676329..681521
                     /locus_tag="CYME_CMP273C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537912.1"
                     /db_xref="GeneID:16996176"
                     /translation="MTCSWGQVAPSGALASARTSSRCTRLPVFQWCAQEPAALSLETP
                     PKTLFRITGPYPAWERERIPLVWRTCSGSGKCLPQNTAAAVVASATHNLKAFKRSGSL
                     ARRLRLLRLCLLTQPLTENVLCLPLMSVEDVSDIVFEEEKLKFVQLGRLAEPSIRAEA
                     VQKPRGVLDLGKSLEAAAPTAPTDELSERHYLWQNHCVVAAPLNVLLLATEDRLVRLP
                     LAETLAAAQQYQKPELLRENPFPEWDETLPGKSGPASTVRSAPFDTNTFGAVCDLQVN
                     VDLAVVAVNTTRGRVLLYTLSDLRLARVLPDAFDRLWCWIPETPAGAVLTRRADRCAA
                     VVADIVEASTKAQVLDVPAVQTLVMVPGSNVVLCLVFKNHQWSCVRLRVRSQSVSDAT
                     NVTVDSLDTTVLQTAGKLQAICRMTPLNASEFIIAYTEQDSLLVSPDTIQFALVRLAG
                     VETSLRGTPEASQVTSFRAPHWITFGEVCPILLDDEEDRSRWFTFLVALPGWGLCVCA
                     LAPSDELELLGDSRFQESVPAWRILRPPDAYRAQLPAFENSEYVRILGMDVFYRKSSA
                     SGDTPSAEVFEPLLVVFTNNGLVHWFCLQGRERCAERPPREKTWARAPFSKRLLTLPP
                     ATTTTLELRESALDDVAASRRVPAAADVATSTGTATRAPRDVATATGTEGATTRTGTH
                     ATAAWNQAPPRMEMSLSESTSGALPEQGRHQIDPERSVLGSRQETEYLKHSAEHRTHF
                     SSEASRAEQHQLVKSILQLGVTDTEAVPVPDADIRHDDEQNILKQIREQQRFMLRQMW
                     ATVDQFARLVDLFSDQVEEQSSRMDASPQHAAQTASTRSLQSLSEQIHDILKQSNECL
                     DQCAASIGLVWKQVAPLERQVQLMQREATLSVASTDSDLALDSSTRRFLQHVHQIERQ
                     AERVQEMVDHLERLLRSRHGGASLSSHQRTLSSTGVTEAMGQLRYQYGERLRQLYETL
                     FRCSVATAQAEQAWEALAARAQRISELLQDERLPAARAALQRLLSQNDDQEQQFYSEL
                     FADKFLVPPGAPLLRNAPDTSSDSRASPTFPRAETTLPSSLRCSRSALQNRVRQALRH
                     QALKQGRDAIGLAGLQTIQHYARSWSVSSTPDPSPGASLSRSCRRSEPPSSQTRSPSQ
                     RLELRQTADAKTFPEGASVAHASAAAVTVTGTQARDPGMHPDRKADEISVRRTLSIER
                     PGAGEIGSEHPSASSSITVPWRLKTPSQASASQAPASNDAPATSNDAQRVRPQNGIAS
                     SREQAPEQLGHDLNPLAKEQHRGKAANAGFEDALQAVSSLEMSSKTESKTPRDTCQPS
                     ADIEAKPATGTGLQETAQRKSAGSPVQVSWTRTPQSSQPLEAYPSTSFRSTAAAAAAA
                     AGKFDANERSDTNLPVSRLPEETEPEQAKSETWASKHAEQTLASDTQTAAQRIETTTS
                     LMMQPGVASTKPEPRTKDITASASTEDDTNSRIDRASDSVALALSPSSAPSATQAPTP
                     VVPGKQSSETGAANLPALPASTPFEGIHASENVPQVPEGARAAIQFGLVHREPPERPA
                     AQHTTSTTGFFAGPSVFTNQAPKPVFGAPSTLGSGFGFNALTPGFPAASSSSSSSSSI
                     PSTASSVFAAPATTSPVTFGQSLGTGTGTPLSFGALAQAPQPPSNPFGAQPATPGAFG
                     AQGPTNPRPVGFGFATVGAPNDAVSTGSQPPRDNTSWFGGVSAAAGTNRRPLQSPAFT
                     QRRA"
     gene            complement(<682064..>683197)
                     /locus_tag="CYME_CMP274C"
                     /db_xref="GeneID:16996177"
     mRNA            complement(<682064..>683197)
                     /locus_tag="CYME_CMP274C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537856.1"
                     /db_xref="GeneID:16996177"
     CDS             complement(682064..683197)
                     /locus_tag="CYME_CMP274C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537913.1"
                     /db_xref="GeneID:16996177"
                     /translation="MRRLWTRLVDALSERQTNWRELQHQRDNMQLFLLAVSYEKGFEQ
                     ARALAQEIVSSAEQATRASSPLLMFRRALSVWKHSASLEMKTDSPQHILDDQGAQSRL
                     IERVNARQVHNLLAAAASMPTSASAATSGPAFTLSLRPSQSNVNAGYGVILNGHARMG
                     SVVAFYPGIAYRVRHWTSIPGYPYITAQNPYLFARYDRVIVDANPNLEVSRGLMNIPI
                     LDHALESVVRHTRQTESLHECWVGLNPYALGHRVNHPPRGREANVMPCAWNFDLQRLE
                     PSLLSFIPNRLFTKYRQLSSGILGPTSMLWSRFRHWFDSLGHQDNMSLTEIPGVVLIA
                     LRDLQDEELFLNYRYNPAALERLQAPSWYWQPDQEAAKRRWSS"
     gene            complement(<684422..>685669)
                     /locus_tag="CYME_CMP275C"
                     /db_xref="GeneID:16996178"
     mRNA            complement(<684422..>685669)
                     /locus_tag="CYME_CMP275C"
                     /product="probable 24-sterol C-methyltransferase"
                     /transcript_id="XM_005537857.1"
                     /db_xref="GeneID:16996178"
     CDS             complement(684422..685669)
                     /locus_tag="CYME_CMP275C"
                     /codon_start=1
                     /product="probable 24-sterol C-methyltransferase"
                     /protein_id="XP_005537914.1"
                     /db_xref="GeneID:16996178"
                     /translation="MTKRTKDSTPGARESIRKGTGARQSARNRRFTLLKVPIRKDGGL
                     WQLATAKSADAAANFWEFLFRFLPVVGRRGHTKTTGKSTEEELREYLTLFARGSGSAE
                     DIALRKRRYKELSNGMYDIATDFYEWGWGPSFHFAVYGPDETFREATRRYEYTIALRL
                     KLDPGAAVIDLGCGVGGPLRNIARFARCQIVGVNICDYQILRGLRYIEDDGLMDQCTI
                     IKADFNNLPFEENSKDGAYQIEATCHSPDKLKTYGEVFRVLKPGARFVGYEWALTDRF
                     DAAASEHQRLKFGIEIGNGIPDLMKTEEIVNAMRQVGFQIEDAYDATTLSIKPWYTPL
                     SGENAFHWSGFRHTRLGHYMTHALVSALETVRIAPRGSAKMSRTLMDGARDLIAAGKL
                     GIFTPSFFIVARKPLDKQANAQA"
     misc_feature    complement(686066..687773)
                     /note="possible transcribed region"
     gene            <687613..>689028
                     /locus_tag="CYME_CMP277C"
                     /db_xref="GeneID:16996062"
     mRNA            <687613..>689028
                     /locus_tag="CYME_CMP277C"
                     /product="mitochondrial ribosomal protein L2 precursor"
                     /transcript_id="XM_005537858.1"
                     /db_xref="GeneID:16996062"
     CDS             687613..689028
                     /locus_tag="CYME_CMP277C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L2 precursor"
                     /protein_id="XP_005537915.1"
                     /db_xref="GeneID:16996062"
                     /translation="MWWSALSRAAQQRSCSLWTPLAWHWRQRFDKKLDLSSRSASTDV
                     GAIIGNNESIQRKLAVDPTRPRVRKRKPTTPSNRATALIDFSVLYRGPPVKRLTGGLR
                     RSTGGRNNQGRTTVWHRGGGHRRLYRILDLHRRQYAGLPGCVERVEYDPNRSGLIALL
                     RYTLPEKDASSDTTTTTSSSSTTVFSDLYRNLANALQGATTPLPTSPSPEPRLVYLPY
                     EVAKSGAGTSVSETGTSAPATITANSSTNASTALPSSDAPVEPSRRPEPTVHMETIRS
                     NVRVLKRRSGSSPKTHLSYILCPQGIRIGDLLLSRTDGPVEPKPGNACPLRYLPIGTT
                     VHNIEMRPRSGGQLCRAAGTSAQLLEKDEKRKRALLRLQSREVRYIHLDCMATVGAVS
                     NPEHRNQSIGKAGRSRWLGRRPVTRGVAMNPVDHPHGGGEGKTSGGRPSVTPWGKPTK
                     GYRTVRKPRGANFIVRRRFKE"
     gene            complement(<689673..>689951)
                     /locus_tag="CYME_CMP278C"
                     /db_xref="GeneID:16996063"
     mRNA            complement(<689673..>689951)
                     /locus_tag="CYME_CMP278C"
                     /product="similar to acyl-coenzyme A-binding protein"
                     /transcript_id="XM_005537859.1"
                     /db_xref="GeneID:16996063"
     CDS             complement(689673..689951)
                     /locus_tag="CYME_CMP278C"
                     /codon_start=1
                     /product="similar to acyl-coenzyme A-binding protein"
                     /protein_id="XP_005537916.1"
                     /db_xref="GeneID:16996063"
                     /translation="MSNLKQVFDKAAEHVKTLSSVSQDDQKYLYGRFKQAKVGDCNTG
                     KPGILNPKERAKWEAWNSLKGMSADDAMRQYIAKVDSLAGSSFGSEVQ"
     misc_feature    690099..693230
                     /note="repetitive element"
     gene            complement(<693327..>694256)
                     /locus_tag="CYME_CMP280C"
                     /db_xref="GeneID:16996143"
     mRNA            complement(<693327..>694256)
                     /locus_tag="CYME_CMP280C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537860.1"
                     /db_xref="GeneID:16996143"
     CDS             complement(693327..694256)
                     /locus_tag="CYME_CMP280C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537917.1"
                     /db_xref="GeneID:16996143"
                     /translation="MTFNFVYSSFSRTVLLPSTHGSKTCCRQASRQFEMRALLRARNS
                     RCVQQRRQGRRRCNGGMERCWRLSLSPNSFKSSQNEDKVLGGPYAGAFGEWFLTEADV
                     REVRAYRAGMALVTLAAVTAVGAAWLTSGNGELPLDLAQFRSTAFVEALYWSGVAGLG
                     IALHYIHIYLKPLHRALQYLLGFGILTSALSEWMVWTNTHDLYVHWLIQHPVGVLTGA
                     GWVAAALTGVFFKEAFCFRRAEASVLAMLVPVLVGGHFLGWWSTASGNSGLALSTVVA
                     IFMTVFSLRKFVQNIRDDLGDKSVFIFQRHRRL"
     gene            <695373..>702533
                     /locus_tag="CYME_CMP281C"
                     /db_xref="GeneID:16996144"
     mRNA            <695373..>702533
                     /locus_tag="CYME_CMP281C"
                     /product="similar to guanine nucleotide exchange factor"
                     /transcript_id="XM_005537861.1"
                     /db_xref="GeneID:16996144"
     CDS             695373..702533
                     /locus_tag="CYME_CMP281C"
                     /codon_start=1
                     /product="similar to guanine nucleotide exchange factor"
                     /protein_id="XP_005537918.1"
                     /db_xref="GeneID:16996144"
                     /translation="MRLSERPWSPVTPFLGAFQCLRRSVDPEAASSRKTPVDGVRTTT
                     RSHSVTAVGIERASSLVSNVTEDELLDQSIRPELVRLLSKGEGALKSEKEPAAPVTVR
                     LQLKRWRRREASSVEHWNPAVTCHVRQGPDWETAYGSCPASVYLDELDSLWSICQRSA
                     LDSSNTEQPQRVALADRLWSLSLQLQSIVHTGRINWAKLAGACESGCLNASGPRHDTV
                     SDLGGSSTTRLMTDDGQNLLNHSSESPSCYQAPAQETHHDDSPSWVSSKTSQGSAELP
                     SVPLSPQIRPKAAFVSADMELVAIADDQGRAASYADGEHATAVCAKLVSWPSDDDDDD
                     DDSQVWDASADETMRRSRRKHVLRIPKAKQEYLVSVPASCPHWGIWWLPGTAILEPLL
                     EILESPTASIAVVTATLETLERLLRRGAARGLVLDEQRDVVVTVATSSVATDAGCTQG
                     SATASIESFRVLGRRWLDLYARERVLARLVVVALTRWYQQQVRVAGAESALLCFLHLV
                     QTIVDAGVPSLDGDAVASSTALNRDTGAASSCGALPVSALESLCLMCLHCAAGRHRLR
                     SPLLRRRGEEVLVKISELLFRRASGAAIRKWMLRLIAAMIDPTVADAALVICGEDAAS
                     ITAESSSPGETVNDDHVANPVSELRRILWEDKSTGRAATEWLGLGLLNSSVDANRRRK
                     ETQVLGLRMLHPVLDALIQAQTPISEQVLGVDATLRALVLGPLSLALLRCLAQSDDAL
                     CAEVHALAFPLALKLVECLGPEALTFFHTLLTVILPSALEGVREPAMRSNGSVAQELC
                     FPLLRQLLSRLDLLWSAYLAYDCSLQFADALGPLFQVIANASHPFAVPLMATLLESLQ
                     QRDWGPRPLRLKPCTAADWDTLYQQRAQKQRRQQVLDTLAGNGASQRDWNATDLWKSL
                     QKSQLLGEGTPPEPAATPSAASLLAQFLRATPELDKVLIGQVIGSPDPFSQQVLAAYA
                     QTFDLHQLPIDAALRLFLESFRLPGESQKIDRIMQAFATHYFNQNQGPSLPLASADAA
                     HVLSFAMIMLNTDQHHGQVKQRMTLADFTHNNRGINDGDDLPAAYLQGIYERIRQQEI
                     RLSDDHGVAALDRVHWEALLRNQQHALQVGSGHAEQLWTSPRRAAACLLGFIWPTLLE
                     AFGSRLVLLLFPPGVASAEAGATTAHSSSTTTSTLSSALTERPQSAEHRSMRRAGRLL
                     SQGTSSGSGSGSEHPAEPLLLPVLGAADPSWDQVEEDALPSGDESRVQLQERWLTRWD
                     HWRRTIVEDQGPWLVRYRTRAALREAVLRLFCRLGWTAHLLAMPTILGQVLELLTLLT
                     GVVDDRWPEPTPETASHRCSLPEAPCPCIQAPEQDEAVWVFLSHWKRSRRKTRSATWL
                     GRHRPAQQVLVAVLGLAARCLPGLDAAAWCALTALQLRLVEMRLTSPLLIEPEFVNWL
                     PALWAPDGTLLLPGRFAPPWASMLRDLALRECPELQLLRPSAADVASPQPEPTSLSGC
                     VAAGTPQSPQQRHMRKTRSAEERLERRTKHTAADADTQSLIASRGIGGDDGDDDEDHA
                     TASAAQHTVDAPRLGDRMQVLPQELVDMADDSSEANSYGASGSGLLATLLSGIGFGFS
                     GTETSTSTSADSAAAKGRPRHDKTQTGGDNDLERARSWRAVERLIADPEPDELSDLDA
                     YRSPTECAPSTRNADASLSQPATTTTTTAADTGAGKTTAPETEPWRRLVVEDSWDLVR
                     AVFPRYLRKPDMDAERRALTRRCLVYALQQANLFDPARWMTASAGLLEALGHAARWAY
                     QLPMPAATRPVALETLHPDSGNQQHEQHQQHQQKQQQPESALTSTWTVSACRWFPRRA
                     LWRYAHLSAADTATWRKAWLLEHVSLVVLSDVGRMLAHWGVLQELVHMEMATAVDDPT
                     LSLECAVFALVRLVLRVLAVAERNLSDRVCWTILAAVYKNLRLLMPLATSAFDALCLP
                     VLVALGTILERYPRWIPPEDGWETLCLVLERALRQSESTVQVAWQVLMLLLARLDQQM
                     EHGTLHETEEFSLQCLELLLTAIEQPYRPAATTAASTGTNAVSPYGCFQRLFAQRAAL
                     LTGAERCLPLLGRLARVVATHRSISVRYEALVTLERILMEPLWQNISESSRVELFTGV
                     LLPLAEALQWEVLSNESTLHTDPVLRERLLIRLVMVLNRFWLLQHMLLQQVPETTIND
                     WWMRLVRILGDLYAVAVRRSRAQRLAGVSDGRWASAPVPVAASETLAEHIHETLKNTL
                     LVMVTGGFLDPTLELAGAETTAVTENACSTAARRWSETFTLLAPLFPALEEDLLGLLA
                     QAPMHRSRAVQRDTDAAHTLAEQKISPTPVDVPQRPDDVTTHTLTETSAQTTDASTST
                     YESAAPSAVLCTDEHSCTELDK"
     gene            complement(<703578..>704555)
                     /locus_tag="CYME_CMP282C"
                     /db_xref="GeneID:16995997"
     mRNA            complement(<703578..>704555)
                     /locus_tag="CYME_CMP282C"
                     /product="similar to zinc transporter"
                     /transcript_id="XM_005537862.1"
                     /db_xref="GeneID:16995997"
     CDS             complement(703578..704555)
                     /locus_tag="CYME_CMP282C"
                     /codon_start=1
                     /product="similar to zinc transporter"
                     /protein_id="XP_005537919.1"
                     /db_xref="GeneID:16995997"
                     /translation="MLQVWRAFLESVAGALVSASATAAAALLCLPLGKRVVRRASPWS
                     MPLSDIGSGFAAGALLADVVFHLLPRCFAGAEVAAHHESVHHHAHDHVTAGGMLTGLV
                     TFFLLEKFVQWLHLSATPNATVEATADGKRPASSASKAPVAPVGWLNLIADGVHNFVD
                     GLAIAAAFLTQRRNGIITTVAVWLHELPQEISDYLVLVQAGFTPFRALYLNLVCSLSA
                     VAGALVVFCGYWMLGYRLGESLDASVPMMLASVQRRVAPFAAGGLLYLATTNLLSQMQ
                     QTVPFFAPVHQGATKTFASPRRKHMQRTLWQMTGLVSGILCVLATEHIC"
     gene            <706760..>707554
                     /locus_tag="CYME_CMP283C"
                     /db_xref="GeneID:16995998"
     mRNA            <706760..>707554
                     /locus_tag="CYME_CMP283C"
                     /product="unknown zinc finger protein"
                     /transcript_id="XM_005537863.1"
                     /db_xref="GeneID:16995998"
     CDS             706760..707554
                     /locus_tag="CYME_CMP283C"
                     /codon_start=1
                     /product="unknown zinc finger protein"
                     /protein_id="XP_005537920.1"
                     /db_xref="GeneID:16995998"
                     /translation="MLRFTSVQSLTARLAATVVGLPPTKPLVFPRETVSETSTGIGVD
                     SDELGPIAPVRVATTEHHRTWARPVVSSRDLAPNDTGPCLKKSQVCPRCGKALSGRGS
                     VHRHIRVVHLNRRDHICQVCCAQFSERNALRRHVRAVHEKRFEYICKVCNAQYRSAKG
                     LHVHYRSKHLGLRPFQCLFCEKRFVSAVHRETHVRAVHMNLREHGCPHCAYRTTTRVG
                     LLSHIRRMHDGVERQPCPECIREFRFSESLRKHLRQFHRWQDDDFW"
     gene            complement(<708263..>709732)
                     /locus_tag="CYME_CMP284C"
                     /db_xref="GeneID:16995893"
     mRNA            complement(<708263..>709732)
                     /locus_tag="CYME_CMP284C"
                     /product="similar to chloroplast outer membrane protein
                     Toc34"
                     /transcript_id="XM_005537864.1"
                     /db_xref="GeneID:16995893"
     CDS             complement(708263..709732)
                     /locus_tag="CYME_CMP284C"
                     /codon_start=1
                     /product="similar to chloroplast outer membrane protein
                     Toc34"
                     /protein_id="XP_005537921.1"
                     /db_xref="GeneID:16995893"
                     /translation="MDSETPTKNEAEQRASPDRTGQVTQRPVSLFRKNGTFAYPLEDS
                     DVYEEQVLALEDVPEPTAQAILRLALAAERQGVPRLRFLVVGAPGVGKSSLINTLLNE
                     NLCSVSAWERGTKNAQVCARQVDSVVIEFIDTPGIAPCRRSGLEASRRQVQRLRKLLD
                     ARGADEHPYLRSFHAILYVMRLDDTRPDLVDYHNWKVLMEFFGAEVLRHMMVVFTHGQ
                     SLPPDSLSYPEYVRGRRDYVYLLIERLTGPLKAVRFPVFVAENSSKCPVIEETGERKL
                     PDDTPWITQLYDGIRRFVFPLEADLFGMETGPEDTQVLVYIYDKRRSRADERYPRSPL
                     QALIRNPWFLRAVQFCGAMLLRSYMIRQEHERFNPKPHHPEPIIRDANNAFAVASRRA
                     NDHRLFTPSIDEDEESFFRMNGNDDFVSRLRNRPGEVDLDELDVERIESPDGRFVEYW
                     YTEKDNPEMVRMYRLEIRDDPNEERESRQDRIPISKDQH"
     gene            <711755..>713266
                     /locus_tag="CYME_CMP285C"
                     /db_xref="GeneID:16995894"
     mRNA            <711755..>713266
                     /locus_tag="CYME_CMP285C"
                     /product="glutamate-1-semialdehyde 2,1-aminomutase"
                     /transcript_id="XM_005537865.1"
                     /db_xref="GeneID:16995894"
     CDS             711755..713266
                     /locus_tag="CYME_CMP285C"
                     /codon_start=1
                     /product="glutamate-1-semialdehyde 2,1-aminomutase"
                     /protein_id="XP_005537922.1"
                     /db_xref="GeneID:16995894"
                     /translation="MTRSKFTPGPFPCGVMFVASNSIGTSLFVTGKTHVRHLQPLAKN
                     AGSCSAKNTRRKSRMQAGATTLKAVASERRLCTQRSEEIMRDAVNVMPGGVSSPVRAF
                     RSVGGNPIVFESTKGSKIVDVDGNEYIDYVLSFGPSVVGSANDEVIEAVSTQARKGLS
                     FGAPSYLENQLAHAIIDAVPSAEMVRFVSSGTEACISAARLMRAYTGREKIIKMTGCY
                     HGHGDSFLVSAGSGVATLGLSDSPGVLKSVASATIVVPYNNIEAIREVFRKHQGEIAG
                     VFLEPVVGNSGFIEPLPGYLAELREITKQNGALLLFDEVMTGFRISYGGAQSHFDVTP
                     DLTTLGKVIGGGYPVGAYAGPRHIMETVAPAGPMYQAGTLSGSPVGMAAGLKTLEILR
                     RPGTYEYLQRITQRLVEGLLDAARSNGHEACGGSLYSMFGMFFTKGPVHNFEDAKKSD
                     TEKFKKFHRGMLEEGVYLAPSQFEAGFTSLAHTEDDIERTIEAARRVLARIPA"
     gene            complement(<713947..>715560)
                     /locus_tag="CYME_CMP286C"
                     /db_xref="GeneID:16995895"
     mRNA            complement(<713947..>715560)
                     /locus_tag="CYME_CMP286C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537866.1"
                     /db_xref="GeneID:16995895"
     CDS             complement(713947..715560)
                     /locus_tag="CYME_CMP286C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537923.1"
                     /db_xref="GeneID:16995895"
                     /translation="MSAPSERTALLKQFASAIGSGTPETRLPPSQTSFQAGASGAPAA
                     GTLPTPNEIKLDLSQPAALGAGTTGPAHVSGLVAPSAAGGGVGNPSGAAPTPTMPLPR
                     KTGLRHRARLEREEPLREKAALGFVGRLSTYCTCTTYDLRALYAALQQITSKANLTVR
                     RLSRDLLLLQRRPSRRRIGAIRELLRSGEDARGSRLPCGNDRSGDEHTEMLPTTASPP
                     NDQQNRAGLARQRMNRTMDPSWRTMDAEEALDPSFALDDNQEVEDVVAGAAIFFFSYG
                     TLVCWGLSEAGEWGILDWLQAFENGQLSPAEMEKEFFTYTYSYEADKARIKNDNIMLP
                     GALVERSQLVGMRIAAPPAAILDPNAEAENEWTQLEEADLSDEELVQVQAGISHALAQ
                     SCKLGSFENSVDLLIERCGNVPLDLVRFGELRLGARDVMRMSGEVHLYRSYFNLQTDL
                     LGTPDWFWENEEVEPLYERTARWLDTEKRGQLLNQRLEILKDLFMLFRDEVHVRTEHR
                     LEWIIIILIVAEVLLQLLAMALGAAQSTA"
     gene            complement(<718834..>719694)
                     /locus_tag="CYME_CMP287C"
                     /db_xref="GeneID:16995886"
     mRNA            complement(<718834..>719694)
                     /locus_tag="CYME_CMP287C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537867.1"
                     /db_xref="GeneID:16995886"
     CDS             complement(718834..719694)
                     /locus_tag="CYME_CMP287C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537924.1"
                     /db_xref="GeneID:16995886"
                     /translation="MKPGPAAPHALSLWNFSLSPGWTGDEVHRLRLCLMVHGVGRWSQ
                     IVQSGYLVGKTISQLNLQTQKLLGQQSLAEFTGLQIDPAEVFLVNREKIKAGAKTKMG
                     LVINEGPNPSREVVVARLRENRERFALPETRVREAEFELRLLSREQQWQDVHTLLQSL
                     PEVQQQRLHQLLAGEWLQLQAATSPSTTRHWVQLESLGHIVLPGFAERRQMSAEDWRA
                     YQQQLECMCDAVQRVQHRITQDKENWLCADASTTEQGLEGSEAPEPKRKRTVGAKRAR
                     GAPVSQGEDV"
     gene            <720682..>722274
                     /locus_tag="CYME_CMP288C"
                     /db_xref="GeneID:16995887"
     mRNA            <720682..>722274
                     /locus_tag="CYME_CMP288C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537868.1"
                     /db_xref="GeneID:16995887"
     CDS             720682..722274
                     /locus_tag="CYME_CMP288C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537925.1"
                     /db_xref="GeneID:16995887"
                     /translation="MTKQVSASNAFDTVLTAARSAKKESPQTDSSALQEKHRRKPRAD
                     KRSIKQEHTPLDTVSSSDSAAPYCLESVPRNSSDGAPGLQPNGLCNVASWKNIQPLRT
                     YVHQGAVHCLVMSPSGSVLLSASTRGSLCLWDAQVGDHIQLRELRDTREHVFNRYIEE
                     YLTARFTPDERYVVAAGTRRDRHLWDFDESDCKVVPPAIKIFDVVSGEVLADLEGHLE
                     EVFCVQIYRELGDHGPWMMMSCSQDGTVILWRFAANGTAFNTATKERVISLEALDVEQ
                     LDPNYVSGISLSEPTARDAIQALARQVGVAPNELNGESYIATWCALLPATAARYALVS
                     VDTGLCVLDLKAGRVIAKFPALFTAICDSFLVLDDVDEAGTRYFSLAVHGVEALSGDG
                     RNAEQIRPDRCLLCRLYVPMKDGDQWRLITEQELSHSTKYVSNVWPSRISAAAGQWVA
                     AGTEHGTVCVWDLTNRGQHLLTLVGSHDNQSCVRDLIVHPTRPWLYSAADDGTIQVWA
                     VPSPADAGDPHAPTSNGMCGSI"
     gene            complement(<723576..>725222)
                     /locus_tag="CYME_CMP289C"
                     /db_xref="GeneID:16995916"
     mRNA            complement(<723576..>725222)
                     /locus_tag="CYME_CMP289C"
                     /product="similar to phytoene desaturase precursor"
                     /transcript_id="XM_005537869.1"
                     /db_xref="GeneID:16995916"
     CDS             complement(723576..725222)
                     /locus_tag="CYME_CMP289C"
                     /codon_start=1
                     /product="similar to phytoene desaturase precursor"
                     /protein_id="XP_005537926.1"
                     /db_xref="GeneID:16995916"
                     /translation="MFQSALPTRRQSRHCKNLSRQRCLRTCIASADPESRTRPLRVAI
                     VGGGWAGLGAAHALTSSPRNREAFHVTLIESRESIGGLAAGWVQRENRPVEVGVHGFW
                     KPYVNIFDLVYRQLRLAGDADPFTRFTRSAQYSPAGLEAESPLFSELPRLPSPLGTMI
                     YPRFYRLPWMDRLSAFALFDAVADFDNSPEAWRKYDQMTARELFTRYGCSERLITNAF
                     EPMLLVGLFAPSELCSASGALGMLYYFILAHQSDFDVKWVRGTTAERVFEPWLQVMTQ
                     QRGLDLRLGTRVVDVDLHPTRGHVDALMLQDGGNSPERLPVDAVIFAVGISGAQALVR
                     QSAALAKHSSQFRRFMHLGSVDVLAVRLYYDRRMRLHRPSNAFFGFDADIGGTFFDLN
                     ALHDESFGDAPGEVIEMDLYGASSLLVWDNDSIVEHCDRILRKCIASAMNEARVIDST
                     VVRAPRAVTHFRPGSYRHFPQVRATDAGLQNNVYFAGDWIDTRHGSFSQEKAYVTGLE
                     AANALIVDRARGQPFPVLPVEPDEPHVVLARRMRRLREML"
     gene            <727089..>728864
                     /locus_tag="CYME_CMP290C"
                     /db_xref="GeneID:16995917"
     mRNA            <727089..>728864
                     /locus_tag="CYME_CMP290C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537870.1"
                     /db_xref="GeneID:16995917"
     CDS             727089..728864
                     /locus_tag="CYME_CMP290C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537927.1"
                     /db_xref="GeneID:16995917"
                     /translation="MTETNHNSLGTGGRPDSPPPYVPQHIYSREDFLLVRTAAADTAV
                     SLAPSLPVASPRAKERWTLRLVHNDWGAAAALPSSGSHLERTGRAARPEASGRRQRRS
                     APGAPGAATSEHAVVPVQLPELVPVSEDWLKPHPLLDLTQDIPLEETGKETKDGDEFV
                     DGFLEHARKGEDLLVLDFEAQDQSQGSSLLPSVQPGKPRSTIGARSAPDDAELIAPLH
                     DMRLSGTVSGFSVDTAEPPKHHAQFADSETPGGKTGPWAGSQRPVAQSWHAAPSIGTA
                     TNVSNQRETFAGKPPAETTPANPHPASFGDIGMLESRLGRWTHRQADVAPTGPGDRSA
                     QEYIPDRGAPVAGGATRREQDPRAETLSPSVLAFFNQVRAQAAVSNPPSRVMETTSDQ
                     QYAAVTTHPRPESGTRFPADADPSLYALFGRYPVPPLSQLGPPPGFGFPPHLEQSGVM
                     DMQSNFEQQRQRPQHVARGLHIPQPQPQPQQPPQSQLPTLNVPYQEAFPVRGGPPSGS
                     TLGALVPNSELDPSRTGHIPQPVFIQTSSWISGPAQNGPFGPLDTFPNGPVPFDAQAP
                     YAQSTDPANRHFRDQKWPPNLSYQP"
     gene            complement(<731572..>732021)
                     /locus_tag="CYME_CMP291C"
                     /db_xref="GeneID:16995921"
     mRNA            complement(<731572..>732021)
                     /locus_tag="CYME_CMP291C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537871.1"
                     /db_xref="GeneID:16995921"
     CDS             complement(731572..732021)
                     /locus_tag="CYME_CMP291C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537928.1"
                     /db_xref="GeneID:16995921"
                     /translation="MSAETKLPPVSSEERDAAAREATQKSTARSERSQTERDIAQLTE
                     TGPEGDESADEAQVARLLRAASDDLPKLRLSDKTLRQLESQALRRKQLAAVRVSDADI
                     AELANAVYVSKAEAEQLLREANGDLNQALRTIIRWELPSGAGPKTAP"
     gene            <732743..>733783
                     /locus_tag="CYME_CMP292C"
                     /db_xref="GeneID:16995922"
     mRNA            <732743..>733783
                     /locus_tag="CYME_CMP292C"
                     /product="2-dehydro-3-deoxyphosphogluconate aldolase,
                     4-hydroxy-2-oxoglutarate aldolase"
                     /transcript_id="XM_005537872.1"
                     /db_xref="GeneID:16995922"
     CDS             732743..733783
                     /locus_tag="CYME_CMP292C"
                     /codon_start=1
                     /product="2-dehydro-3-deoxyphosphogluconate aldolase,
                     4-hydroxy-2-oxoglutarate aldolase"
                     /protein_id="XP_005537929.1"
                     /db_xref="GeneID:16995922"
                     /translation="MDGHEYSQLASKIPCFLTNMHGFLSIHDLPQQQLRFTRQRERQW
                     RLAAAACRTCTRLTWPPRYATQRTRTATLMATFDVPTRSFPVPEKTRTYLRRQPLIVC
                     IRLKSFILDQYAGARDALEAQRKRLLTLAAGHGVELTDQESQTAAMIIQIVETLQNAG
                     LHNFEITMDMPGVEWALRYLHETRGTSILLGAGTVLHASQLERAIACGCRFTMSPVFL
                     PGRSEQLIAYAREHNVLFIPGAATPSECVQASLALGEYQPVKVFPADVVGGLRFIRAL
                     AGPLSHIPLIPTSGVTFDVVEDYLSADNVYAVGVSQQILPTSRLLAGDWPQIHRLACV
                     WRKAVESAAPSP"
     gene            complement(<734427..>734933)
                     /locus_tag="CYME_CMP293C"
                     /db_xref="GeneID:16995923"
     mRNA            complement(<734427..>734933)
                     /locus_tag="CYME_CMP293C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537873.1"
                     /db_xref="GeneID:16995923"
     CDS             complement(734427..734933)
                     /locus_tag="CYME_CMP293C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537930.1"
                     /db_xref="GeneID:16995923"
                     /translation="MVRSAPWRSCGWIVPWTTHWLSPPKKCICSRRRNVFAGNLTMMS
                     QSTDPLVQYVVVRRDLLQAPFNWPTGAVIAQGVHAAVAAVWRFREQSPHVQLYCEEAQ
                     GTQMRTLVLEAPDEKAIQDIAQALEVDGIEHVVWTEQPEAVSTALATAPGPRSRLRGY
                     FPKLRLFR"
     gene            <735367..>736845
                     /locus_tag="CYME_CMP294C"
                     /db_xref="GeneID:16995931"
     mRNA            <735367..>736845
                     /locus_tag="CYME_CMP294C"
                     /product="26S proteasome ATP-dependent regulatory subunit"
                     /transcript_id="XM_005537874.1"
                     /db_xref="GeneID:16995931"
     CDS             735367..736845
                     /locus_tag="CYME_CMP294C"
                     /codon_start=1
                     /product="26S proteasome ATP-dependent regulatory subunit"
                     /protein_id="XP_005537931.1"
                     /db_xref="GeneID:16995931"
                     /translation="MERGIPEEILRESTDAIAQRARLIENEVRELRREEERLRREIQS
                     LNERVKENEEKIKLNAQLPFLVAHVVEVLTPAALKRAPPSLTGPGTQSAPHAETALAT
                     QPNGSVSETQGEARNQRLGSGARGGSDLINRSSGITSETQTPGAADHEDDLDDAEEDE
                     GAAQESDANQQSPAVVVKTSTRQTVFLPIPGLVDVSELRPGDLVGVNKDSYLILEKLP
                     EEYDARVKAFEVDERPTEDFADIGGLDKQIEEVIEAVVLPMTHKHLFERVGIKPPKGV
                     LMYGPPGTGKTLLARACAAQTKATFLKLAGTSLVQMFIGDGARLVRDAFALAKKKAPS
                     IIFIDELDAIGTKRFDSDRSGDRETQRTMLELLNQLDGFDQNDDVRVLAATNRPDILD
                     AALMRSGRLDRKIEFPHPDEAARARILRIHSRKMNVHPDVSYEELARSTDDFNAAMLK
                     AVCVEAGMAALRADRKVVIHEDFIDGIAAVQAKKKMSLNYYA"
     gene            <740679..>742472
                     /locus_tag="CYME_CMP295C"
                     /db_xref="GeneID:16995932"
     mRNA            <740679..>742472
                     /locus_tag="CYME_CMP295C"
                     /product="similar to iron-sulfur cluster scaffold protein"
                     /transcript_id="XM_005537875.1"
                     /db_xref="GeneID:16995932"
     CDS             740679..742472
                     /locus_tag="CYME_CMP295C"
                     /codon_start=1
                     /product="similar to iron-sulfur cluster scaffold protein"
                     /protein_id="XP_005537932.1"
                     /db_xref="GeneID:16995932"
                     /translation="MLSPTLADSLALFVGSKLPVCIGNSAGDQPSHHFCTAGVYRRQG
                     TSNSARWHSRRTSVRRPPRACEEFGPRKTGGSLRDSSKIDSSHIYNVGARDTARDLFE
                     LEPFMQNLREICEVFEGSIAATLERNLMLTPSIVLIRRLHHKAILNFSEPRVLVPTAV
                     AEQAAPSDFVQVPAVYAVLDGPSWRYGEPSYEEESLQDIPIDPSKIKRVPLEPNERRL
                     YPFADYVLQYGEKRVPVRSAPMGRIDQKRLRRNRVSVQYIGTSPNVALSVRHHLQRFG
                     PDTCQFVRVCVFPSMDVANMEALKQAWIAEIGYTPRGNRTQDPALATYVQQWQAAHEW
                     LNGVHQCSSEPTPPRSEPAAQQADETNDEAQAPTIPSRSNNVGTGTYPMPPAEASANT
                     NSLPSSAAEAAACSGTEDEQRVVSPFRNESVQAGVCNGPDTRLPLSVTTVEAALSEVR
                     PLLQKDGGDVQVVSVDPENATVRLQFLGACASCPALEDTVRFGVEIALRKYFGEERVR
                     NIELVPVTESTLWEQNNKKLLESCEVVLDELRPSLFAQEAVFELERVERGVLYLRYSS
                     SDDVLYQISRIISERVRGILRIDARPFDDHE"
     gene            complement(742164..743890)
                     /locus_tag="CYME_CMP296T"
                     /db_xref="GeneID:16995883"
     misc_RNA        complement(742164..743890)
                     /locus_tag="CYME_CMP296T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461532.1"
                     /db_xref="GeneID:16995883"
     gene            <743778..>745922
                     /locus_tag="CYME_CMP297C"
                     /db_xref="GeneID:16995884"
     mRNA            <743778..>745922
                     /locus_tag="CYME_CMP297C"
                     /product="probable carboxyl-terminal protease"
                     /transcript_id="XM_005537876.1"
                     /db_xref="GeneID:16995884"
     CDS             743778..745922
                     /locus_tag="CYME_CMP297C"
                     /codon_start=1
                     /product="probable carboxyl-terminal protease"
                     /protein_id="XP_005537933.1"
                     /db_xref="GeneID:16995884"
                     /translation="MGFAFSAKGEFFTPCEPQKTYVSGLSNQRCVQQRTPRFLFRRGG
                     CCRSCRRCCNVQPLQRRLVSRLEEKRPTEEKSDAHGPNPLKSGSPLSFGTFLKSRFQE
                     FRRFLAEPVRISVPKPLLIIVGVVGSIFVIAFVSYAPDWKTESKIREKVALFDFILTD
                     IVHGYVDPVDTDQLFEAGVDGMLGSLDPYTQFEGNIAAREMQLKTSGRYGGVGLGIAQ
                     SILQPEETVVLNAFEGYAFDRGVRAGDVIVEVDGTPVRGMPLDKVTELLRGEPGTLVR
                     VRLARETRAPDGSRRLFDVVLPRRLVTIHDVPLYGMIRSYDGVGYIRLQSFATNAGRE
                     LRAAIDNMVRTGRLKALVLDLRNNPGGLLDAAVETAEALVPKDSAIVSTKGRALGETV
                     FMSDREPSLPADVRLVVLTNEQTASAAEIVAGAVQDLDRGVIVGTRTFGKGLVQNVEP
                     LPYNTALKYTVGKYYTPSGRCIQSVNYKEGSALTAALPEAESGRPFLDPSGTLVPALP
                     PANGAARYLSTKVPESERKTFRTLHGRIVRDGGGIEPDMESTVTKPSELELQLLEGGK
                     FFFFANRYAAGISSLPEDFEVDDKLYKEFQRYVLEDASKWREHTRFEPGLKLFTSTFA
                     EAGYKNAEKELEHLRETIVTELKQDFERHADAIRQRLEDAIRQRFEPESRRLSAALRY
                     DKVLQDALRLLTEKQGEAYERLLQPAAETAQT"
     gene            complement(746322..748510)
                     /locus_tag="CYME_CMP298T"
                     /db_xref="GeneID:16995885"
     misc_RNA        complement(746322..748510)
                     /locus_tag="CYME_CMP298T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461533.1"
                     /db_xref="GeneID:16995885"
     gene            <748674..>754040
                     /locus_tag="CYME_CMP300C"
                     /db_xref="GeneID:16995896"
     mRNA            <748674..>754040
                     /locus_tag="CYME_CMP300C"
                     /product="probable pullulanase"
                     /transcript_id="XM_005537877.1"
                     /db_xref="GeneID:16995896"
     CDS             748674..754040
                     /locus_tag="CYME_CMP300C"
                     /codon_start=1
                     /product="probable pullulanase"
                     /protein_id="XP_005537934.1"
                     /db_xref="GeneID:16995896"
                     /translation="MEACTLLIYYHRPDSCYDDWKLWVWENAGPEASDALLPQLVQPA
                     FLNWTQQAASSLEERGMHFSRQPVPTALAVPGSKGAASNWAPRGSPVDHWYGRLFRVD
                     VPHTSRQQRVLGVLPVKAREPYQEFEAKDAGGDRLLHLSSAQVGDPSLPRIFYLHQDL
                     ADVADNPAVFGLSEDVAHIYVRRVPSQRRTCSLGLRLRWTSVQGNVTERVVSPDCGCS
                     PYGCLAPWSAAFGQRFTLPRFLFQYWMTAALSLELVTGNSTVMLTVGETEGSAGAGLT
                     WPSPLTTASECPRAYFAVEDSPGLFTSVESVTMLGEAGTPRFLRIGIHGLDAPFPVAI
                     FDDALTSFAEIPADAFRDGWSLYILDRQAYGRSRRLGLAVVDPLLDEPLPTPQFWLEP
                     EPAMECAVAFEYAEGSLRLSPASFWTLFSQRRSVDEHQSTRPGYARGATLACRENVLR
                     SLTDTLGLCSSEVHCFRGIEQTHWALCRLPTSPPMEQLSVGQASSMLAVLHSEQGASN
                     RGLHLFAPRWGAPYFFPAEQSVFYVWYRRYSRDHWLQWRLWILTNNVPRYSSPVISWE
                     HATDRALFVALVPPAIQGTAVALLLSRDDQLPPSIAEHLEASVEEVFDPSALNWDLQR
                     IWYPNAAEREVFLFQGREQVFHQADLVDVEPRWLQEQYLEVAYLRPRGDYEAWHLWLW
                     DADFAASTGREVASAARAPIDEQHPHVEALIFRIDRGWFGPAKRLGFLAKKRGEHGVW
                     ADRDGPDRFWTLSPQTTRVCFLQGREELALSIEDFVLEVTPFFEDDLLELCFPFPPWW
                     KHSASVTAAAERDGSALVTTPRLDAVARDAPRGDAPPEEHFLWHGRAPTREPRVYRRT
                     APGAPNRILGDDVDVNDDDDDIIEALELTLYWQALPNRPDGGHGASAVSHELCVRSTH
                     QASLLAITADDAAGVTSAVLSASECTASAMQKNPADPWRSDTTTGRSVSASASASIES
                     GTTQYALPHIVRMRSCSDPLKLQFQLDRTLDEDFPVEEVMVHLKGFSPSRGAWRRYEN
                     VDDYYYSGALGWHYTKSATTFRVFAPTADLVVLCLYREPVGTVGRQAFPMRRIPQGVW
                     KIVVHGDLQGLYYTYLAEGVNKRLFPGVEVIDPYSRCNTAHNGRGLIFGEDHTEVADR
                     PCIPPEHTIIYEVHLRDFTIDECSGVPEKLRGKYLGLAQQGTQLPEHWVRSRIVSSAG
                     RAALFLRDRATPDAFEEDVCPSTVEEDVYTAPVLTEVAAQVDWTDRSTCLDHVRFLGV
                     NALQIMPVQDFDNDESNPLEYRWGYMPVHFFSPDGWYASCTSDASRVRELKQLIDTLH
                     RAGLKVILDMVLNHTAEDPNEFNLEARFSFNGLAPRYYYRFWPDGSWGVSEACYANGS
                     GCGNEFRSESPMGRKFILDMLWYWATEYKVDGFRFDLMGLMDRETLRIAAAKLHALDP
                     NILVYGEPWSAGETPIIITGKGAQRHLGFGVFNDTFRNALRGSNQGIEENFLLDGGCI
                     EAVKQGILGSIDDFAASPLEVINYVECHDNRTLWDHLWYVIRERADANITYTAADVLR
                     VCKLAAVILLTSQGIPFLHSGQEMARSKFGVENSYQSGDDINRLRWERKIDFYGLVVY
                     VRGLVQLRRARPDIFSMSDAQQVRRCIAFYEALGLPVPERCLAYRIIADAGQSETNAI
                     EDDPWRCVALLFNPTPVAQVFPLPPEAKDELMTVIVNDLEAPRDAGASLGEYHIGWAS
                     VPGRSAMVLRLCTESERERALIETRLNAISEPYSSTTDLPGLYSSYATPGGSKTSSPA
                     PVAE"
     misc_feature    complement(749368..752652)
                     /note="possible transcribed region"
     gene            complement(<755302..>755622)
                     /locus_tag="CYME_CMP301C"
                     /db_xref="GeneID:16995897"
     mRNA            complement(<755302..>755622)
                     /locus_tag="CYME_CMP301C"
                     /product="mitochondrial ribosomal protein L36 precursor"
                     /transcript_id="XM_005537878.1"
                     /db_xref="GeneID:16995897"
     CDS             complement(755302..755622)
                     /locus_tag="CYME_CMP301C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L36 precursor"
                     /protein_id="XP_005537935.1"
                     /db_xref="GeneID:16995897"
                     /translation="MWSSVVSRVPAVWRRFATSTGIASGTTSTFRETNHTQLATVWQF
                     VRYFKVRSSVRRVCESCRIVRRGKRIYVLCDKEPRHKQRQGLGRTMPPRGSMHCQNPP
                     FAKT"
     gene            756059..757508
                     /locus_tag="CYME_CMP302T"
                     /db_xref="GeneID:16995900"
     misc_RNA        756059..757508
                     /locus_tag="CYME_CMP302T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461534.1"
                     /db_xref="GeneID:16995900"
     gene            <760008..>762002
                     /locus_tag="CYME_CMP303C"
                     /db_xref="GeneID:16995901"
     mRNA            <760008..>762002
                     /locus_tag="CYME_CMP303C"
                     /product="similar to cell division control protein cdc45"
                     /transcript_id="XM_005537879.1"
                     /db_xref="GeneID:16995901"
     CDS             760008..762002
                     /locus_tag="CYME_CMP303C"
                     /codon_start=1
                     /product="similar to cell division control protein cdc45"
                     /protein_id="XP_005537936.1"
                     /db_xref="GeneID:16995901"
                     /translation="MLLRLSQVDAVWPVVRSGRARALLDTVAQQDAIVDALLWPQQLS
                     ESTLQRRGKRTVAPAHPSDGLQAGRRQVSSQAAMCFLVAPSVDALAATRTLTLLLQAE
                     SIPYHIYPIHDYRELENLQCGGRSVLGSMDVQDTSPLRAIVCVNCGAGVDIAALLRLP
                     EDSDLPVLVIDSHRPYHLRNLQSAHVILLHDSDVFEVQLPPSGAEDALGQILPMDPEA
                     HVDDATSSDLDTDADTSPQDARNRRRRRRGFGSGIQRAVQRYYRRTERAASAAGVAYA
                     LAANLNRADLDTLWYWILAVTEQFFDRQASDTACYEQIVRCIREEWKRIISRLSTDDD
                     NGDGQKDALAPLEPSTEFSLELLRHWTLYDSLIHSTWLASRVQRWRQEAERSISEILA
                     LLGIPLRESKQRWTHLAAELKDRVRERLIPVLCTYFTRRESDAGRVRTNSRCRRSAIA
                     NTLCYESFVRRFGAHRGQTVSAADVVLAAGALLDRGHFWRAYALLQCRHIDDMVPAFE
                     LAKRSQRLLLEAAVSVLERRAYTRGRHAWCAMLDGPPLLAAKIERKLHLQRRLALALG
                     DWFYGTKRHPKPLWLIVDSPQSEHATVTLVTPQRSASEDAVSATCAECDLRAYAQTSA
                     TAATLLAPAFHGCEPVQASLGSGSVPDLKDLLTRGLSARR"
     gene            complement(<764549..>765916)
                     /locus_tag="CYME_CMP304C"
                     /db_xref="GeneID:16995902"
     mRNA            complement(<764549..>765916)
                     /locus_tag="CYME_CMP304C"
                     /product="eukaryotic translation initiation factor eIF-2
                     gamma subunit"
                     /transcript_id="XM_005537880.1"
                     /db_xref="GeneID:16995902"
     CDS             complement(764549..765916)
                     /locus_tag="CYME_CMP304C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-2
                     gamma subunit"
                     /protein_id="XP_005537937.1"
                     /db_xref="GeneID:16995902"
                     /translation="MSGLAVQDLSKLKVEELTPLTPEVISRQATVNIGTIGHVAHGKS
                     TLVRSISGVQTVRFRNELERNITIKLGYANAKLYRCERPECPRPYCYRAFPSDAPDSL
                     PCEVPGCGQRLRLERHVSFVDCPGHDILMATMLNGAAVMDAALLIIAGNESCPQPQTS
                     EHLAAVEVMQLRSIIVCQNKIDLVDESAARTQYEQIKNFIRGTVAEQAPIVPISAQLR
                     YNVDVVVEYLIKHVPVPRRDFVSPPRMIIIRSFDVNKPGEDVENLRGGVAGGSIMQGV
                     LRVGDLIEIRPGITIKDAEGNFKCQPIISKIVSMHAERNELQYAVPGGLIGVGTKIDP
                     TLTRGDRLVGQVLGAVGTLPPVFTEIEINFFLLRRLLGVKTEGADGARVSKLTKDEIL
                     MVNIGSTSTGGRVLATKRDLAKLRLTSPVCTEEGEKIALSRRIERHWRLIGWGVIRRG
                     TKLDL"
     gene            766075..767520
                     /locus_tag="CYME_CMP305T"
                     /db_xref="GeneID:16995909"
     misc_RNA        766075..767520
                     /locus_tag="CYME_CMP305T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461535.1"
                     /db_xref="GeneID:16995909"
     misc_feature    complement(767888..769420)
                     /note="possible transcribed region"
     gene            <769765..>771981
                     /locus_tag="CYME_CMP307C"
                     /db_xref="GeneID:16995911"
     mRNA            <769765..>771981
                     /locus_tag="CYME_CMP307C"
                     /product="similar to Reg receptor"
                     /transcript_id="XM_005537881.1"
                     /db_xref="GeneID:16995911"
     CDS             769765..771981
                     /locus_tag="CYME_CMP307C"
                     /codon_start=1
                     /product="similar to Reg receptor"
                     /protein_id="XP_005537938.1"
                     /db_xref="GeneID:16995911"
                     /translation="MRRGRRRRRCTSRSWAPASSMRPRRMVRQQALWRFWPPQPVSCG
                     NALRFTSMLYWIVVATLAIVNGCFAWYWTRAADGYTKSSTLQTPSTLRLVRQHWRSQP
                     APSNALSSLWHEYGALLSARCCCAFWTYIPDAETYLRAALGLLGSLLRHRQGVPVVVL
                     VGFNRSDQAFTRIAWDWNPDHHTPERGVYLKLISRAAAPAEQELVVRKLLHTPKCAGI
                     PRRLLRLDARAMLLEPITEVFLRPDWLQVLSWEQRLNCTHQSVQAPLRYRVRLAEQRL
                     ARRAALDQSQLLSWYRADWRMVHFEPGLEPGNLWRALLNPQVETGTGVLYPPASADVQ
                     LLEDFDLPLVYDWLRNAERWMRRVHKRPLWSPSPEMHFRNRFCHHALGHYRQRNRDAR
                     SRTIETFTVLVNAFSRQRIQAGLLEAILERYCRISSVASIVVLVYELDTLQIAEDLGK
                     RLGGCVPIRVLRLDGPGADSLNHRFLPLPSWIETAAVLHTDDDMLPVHDALIEFGFRQ
                     WRKRHAQQRGQPNLVGFVPRYADPQAHLYALRKPPVSRSKAQHIWDRRDAVQSYNIVL
                     TKLAFVPHIYHFLYTCILPYIPLVEPDAMDLLNMVDRVRNCEDIVMQGLASVVAGKQS
                     PLVVRGLSSADLADYGSTDDQHAISMGEHASLWVTSAGNPMTMTRLSGFDAHLWQRGQ
                     CVVAVQQTLGRGEYASSIFSEQTSVAAPFEAAPVPVQRDRMPVCSVVNTMNAVWVI"
     gene            <774728..>775216
                     /locus_tag="CYME_CMP308C"
                     /db_xref="GeneID:16995912"
     mRNA            <774728..>775216
                     /locus_tag="CYME_CMP308C"
                     /product="mitochondrial ribosomal protein L27 precursor"
                     /transcript_id="XM_005537882.1"
                     /db_xref="GeneID:16995912"
     CDS             774728..775216
                     /locus_tag="CYME_CMP308C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L27 precursor"
                     /protein_id="XP_005537939.1"
                     /db_xref="GeneID:16995912"
                     /translation="MRLYWSKLVQHLRSPGELCSFLSKNGGLPALVREPPSLADSEPC
                     TWRGAKKKAGGSSRNGRDSIAKRLGVKTGEGVHVRIGQVLVRQRGTRWLPGERVGVGR
                     DDTIYALATGQVRFSRRSRDGRTVVNVVPVADERDLAANSRFATSQTTVLGSPSTGTA
                     TQ"
     gene            complement(<778585..>781734)
                     /locus_tag="CYME_CMP309C"
                     /db_xref="GeneID:16995926"
     mRNA            complement(<778585..>781734)
                     /locus_tag="CYME_CMP309C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537883.1"
                     /db_xref="GeneID:16995926"
     CDS             complement(778585..781734)
                     /locus_tag="CYME_CMP309C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537940.1"
                     /db_xref="GeneID:16995926"
                     /translation="MDTDDNVPLAGSTASQLAGVRPAPVQRALGTQPRAATTEPRPPA
                     PATLEGSDLLRDAETLFERSLKEMISVFGTADAVEASTGNSDSPVLELKQRLANIASE
                     ASSFPFLRELTTTSDDHVTRFAVDQSSAIDNTALVADTVARSMREGSTLIDWQHVQEM
                     LASIDECIHRTLCQHRPELLKPLAGMQQKIGEIEARLDDLLNDFAEADCLYRQETAEW
                     HQLEALQGEIRDLTEAERVLRCTIFILGKLEHFEQTYLAVLDRLADSQQSATASTSHP
                     VLADHAASLSQAAALLSDLFELMRPELFETVPWMSAVIERGKSYSRRVYMLGFELLER
                     AASVRDFAAAQRLGSALALAEGFVSFLDALEAEAQTRAADLVSLLDPGHALAMTSGAS
                     RNTRNSDAAHGLESMQKAVDSRETNLLVDQELLENAALLNMLWMAAPADDIPAVPDAV
                     TPMTAHVGEHLIDQYRQNAKTFYIELTEYLDRLSFLEEVLSTSTHSTRFDCVQQASNA
                     SGFEKQSVPATRRAMPREVFFRDLTTRLVTLYERLNCVQDQHERVPGTSARSLVAICY
                     PLLGEALRTAARHCLLKNHYAPDTPVVEGEVTAHESFHQLDDFLERLGNAFSDLVEKA
                     WARRFARVSNLQGIEDESRESSPVRLGIIHTKYGVAKQLRQCLRLAWAYRNALPALER
                     LMRRVASTLLVRSKLLCERLHHYKQTQKLEVVSMLLSVLVCLWSLRESVCENLHGYDL
                     ALDLVSSESETSADVAADEPVHAWLRYRDQIDQCGRDATRTLLELVANQVEAQLHLAL
                     ARKQHQPEDVRKSGSQLWAGVTEASMLLRRFGVLLHSCLPTSSIWMDCLREALLEPLE
                     EALVYCVVLRPINTVKDLNELRRNLLPLWRLTLLGLASGGLPDQQRTCPEQLQTLTRF
                     EHLIELECEEADAGISDMQIGLPVHVLALFAISRSDERILQPHIRLQWSMERYRTWLK
                     CHIADERTIWGSIEPSIRLYGQQVQQSSDNAFIPQFRILQHLRHRLDSETMPEKNSPD
                     VCVEKSAPCSGQPRDTNDS"
     gene            <784368..>787643
                     /locus_tag="CYME_CMP310C"
                     /db_xref="GeneID:16995927"
     mRNA            <784368..>787643
                     /locus_tag="CYME_CMP310C"
                     /product="probable WD repeat domain protein"
                     /transcript_id="XM_005537884.1"
                     /db_xref="GeneID:16995927"
     CDS             784368..787643
                     /locus_tag="CYME_CMP310C"
                     /codon_start=1
                     /product="probable WD repeat domain protein"
                     /protein_id="XP_005537941.1"
                     /db_xref="GeneID:16995927"
                     /translation="MVIFTKPVWLRHAAGTGNGPLGVQRGFGTGEQTNSLSTSSDRRR
                     AGADNACVPIFSLDIQPCARDAPLDEVRLATCGQDGKIHLWRLGALWEDAKQQCARLL
                     GKPGAPHESTTPQQNGACENTLESALIGVVTPAHQGAANVVRWHPGGNVLASGGDDGT
                     VLLSSRVPAAAGAVTAVEPFARGTLLQAPLGAACKEHWSVCTILRAHDSDVLDVSFAP
                     HGEALASCSVDNTVCVWRIELSTKHGDDDQWITANGSLLARLRGHHGMVKGVSWDPAN
                     QFIATQSDDRSVLLWRTDHWGEIERRLSEEFEAATTEANLRSWFMRLAWSPSGAELVA
                     TNGYRNKCHVAPLYRRIQDFADPIEFVGHRAPVVSIRWSPCVYARSPHPPFEEKNRLY
                     FCVALGSKDHGLTIWRADHGKPFVSLVDLFDGDVLDLSWNTAGDILVACSTDGSVFFA
                     QFDPEELGYVVPEAVAKEAITKEMTLFTGGVNPLRAHPSNQLGDASCGMLDPVALALQ
                     RSKLAQQAPAFAKSGAETSTPVVEHSMPGDSRPPSSGKAGAKEPSPAAGVQLRLENQR
                     EERLKDGKRRIIPVPIGGQHATATPSLGVAAKQHAAHLASAGVEREPLDSADAVQAKK
                     RQRSLAMNGASTPEVLPKPPRNALRSDSGVRREQSLANNHTEMHGLATAAATPKATST
                     VAPVASSGTPRSTIPLSTGTDTRRRLWILEDASPNFCIESVGQPLNTSLVFGVRSGSP
                     LWKQVVRGAVTALTSTPGSNAIILGTSDAALHVLSGRSGLRLAPPFMLDAPAIWMARH
                     ERVILILTEKASFQVHHVTDLTDWRPEQTSRPLAWGSASFLLASENLEPVRLLPERFE
                     WDASRQVLLLFLRNGDVYMHQGAHATWIRLMEDTFLASPFSEATVSATGYDARKQQAL
                     PTLDCTDPCTEDRNFSFIDPERVGLREVADPEREASDTTAHLELLFVTAFRLQKEAEA
                     RFWLQRLVEWLVQIGDEARLVALCDQLGGFSTTVSSGECIDSQQRDGWKASNMALIRQ
                     IVLPLLASNPALETILNTYRELLIGVSQSQERLPAPALLEQVVSTTADAAEDKAGESS
                     PLA"
     gene            <788893..>789657
                     /locus_tag="CYME_CMP311C"
                     /db_xref="GeneID:16995866"
     mRNA            <788893..>789657
                     /locus_tag="CYME_CMP311C"
                     /product="TBP-1 interacting protein"
                     /transcript_id="XM_005537885.1"
                     /db_xref="GeneID:16995866"
     CDS             788893..789657
                     /locus_tag="CYME_CMP311C"
                     /codon_start=1
                     /product="TBP-1 interacting protein"
                     /protein_id="XP_005537942.1"
                     /db_xref="GeneID:16995866"
                     /translation="MPAKSPSTRKKRARTKDEDEENVDTGNQTTAPTFRDKNLQLVHD
                     FLASQNRPFSLQNILDSLANKGDMKKAALDKALTELVTSEYVTCKEYGKAKLYLIRQK
                     NIALPSAEETAALDSRLETLANELEELSAECQVLEAKISELSAQPRTEEAKERVALLE
                     TETATIDERIEKLQVHCAGYDSSRRQYIQQQHERALKALRLRRSRARQIILQMAEGME
                     RKPRELADEIGIESDSDDWLTASRSVVSNARSKAAV"
     gene            <791284..>793263
                     /locus_tag="CYME_CMP312C"
                     /db_xref="GeneID:16995867"
     mRNA            <791284..>793263
                     /locus_tag="CYME_CMP312C"
                     /product="DBF2-related serine/threonine kinase Orb6"
                     /transcript_id="XM_005537886.1"
                     /db_xref="GeneID:16995867"
     CDS             791284..793263
                     /locus_tag="CYME_CMP312C"
                     /codon_start=1
                     /product="DBF2-related serine/threonine kinase Orb6"
                     /protein_id="XP_005537943.1"
                     /db_xref="GeneID:16995867"
                     /translation="MMLQPAGAGASPHLVRMSRDQPGELHADSDSAKSSSSCPTTPFQ
                     SVTTVGSLEISKSPARVPPAGAPAASVEQTAVASSSVASSRQVNESQRRVLYAKRLIE
                     QYYRNFAHAFNESEARRQLLEERLERLRLSDADKQMLRREHFRREKEFAREMRSRITL
                     DDFEHIAIIGRGAFGEVSLVRSCESGELYAMKRLRKSEMLRKDQVAHVRAERDLLVLA
                     ESASYVCKLYCTFQDAEHLYLVMEYLPGGDLMQLLIQRDTLDEDSTRFYAAEIGTAIE
                     QVHRLGFTHRDIKPDNILIAKDGHIRLSDFGLAAAYELQVYGMAPLLEPGADLTYTGG
                     DRIAAMSEAERKGSWRRGLRRRMFSTVGTPDYIAPEVLMKRGYGKECDWWSLGVIIFE
                     MLYGYPAFYSENSVETCRKILNWRTTLQFPARPNVSPAAKDLIRSLLTDPENRLGARE
                     GLEDFKRHPFFHGFDWNRMREMRAPFVPELSHDADTRYFDHFEDDTHPKSQEAKATVP
                     PAGRTGTEPRSTAPANTLASPARPRPAVTLPPADQRKPQQVPRVVDIEGAQADASLTS
                     TNARSSTASRTPTTRAFPLNADPASRKQGELRGSRKIFREQLRMQPFLRYSYRDLHAL
                     GEGDASFLGFTYRRFGVRSQQRGSLRGAFDPKHPS"
     gene            complement(792120..794510)
                     /locus_tag="CYME_CMP313T"
                     /db_xref="GeneID:16995868"
     misc_RNA        complement(792120..794510)
                     /locus_tag="CYME_CMP313T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461536.1"
                     /db_xref="GeneID:16995868"
     gene            <795010..>795744
                     /locus_tag="CYME_CMP314C"
                     /db_xref="GeneID:16995869"
     mRNA            <795010..>795744
                     /locus_tag="CYME_CMP314C"
                     /product="similar to tyrosine phosphatase Oca1p"
                     /transcript_id="XM_005537887.1"
                     /db_xref="GeneID:16995869"
     CDS             795010..795744
                     /locus_tag="CYME_CMP314C"
                     /codon_start=1
                     /product="similar to tyrosine phosphatase Oca1p"
                     /protein_id="XP_005537944.1"
                     /db_xref="GeneID:16995869"
                     /translation="MSRSSATKAETLATLSPPESFGIVEQGVYRANLPHPLSFPFLKH
                     LNLKTVLMLSQESPTRVVTQFFEDNQVELVQLGMRVFKPTEASWKPCSEELVKEALET
                     VLCRAAHPLLICGASGVHAVGVVVGCLRKLQGWSLSSIVNEYRSYAGTKTRYVDEQFI
                     ELFDIDLVQVPADPERVYLPSWYHVYQQFAEEDRQRFRSASARGEITRDGILSHATLS
                     YWKYYFATCTAPLCSSELACDRSDSA"
     gene            complement(<797971..>799506)
                     /locus_tag="CYME_CMP315C"
                     /db_xref="GeneID:16995870"
     mRNA            complement(<797971..>799506)
                     /locus_tag="CYME_CMP315C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537888.1"
                     /db_xref="GeneID:16995870"
     CDS             complement(797971..799506)
                     /locus_tag="CYME_CMP315C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537945.1"
                     /db_xref="GeneID:16995870"
                     /translation="MSAAQLILGSGCLSVRQDEQCSQLRSVLSGIQLEAAEEETQRFS
                     DPLTPEERRTVNPCAQGRAVSPPEVPRLPHVHTASEVLEQLAQKPTACSLEWRVLHRP
                     LLPASYRNIYLRWSRPVRHILILFTVYSDSARSSAVKICQWLEAEYPELILYSETEHT
                     LPGTLHFPREQTQTPIDLVICLGGDGLVLHACASLFPKAAPPLMPFHLGSLGFLTPFP
                     FNNFPSCVREVMRGSDVTVTLRMRLDCAIYKDGDGQRPLIQKTVLNEVVVDRGPAPFL
                     SNLECYCDDFPVTRIQADGVILATPTGSTAYSLSSNGSMVHPSVPAILLTPICPHSLS
                     FRPVIFPDYVTLKIRVSRHARGSAWVSFDGRARTELQRGDYLRVQISPWPLATLNYND
                     QTQDWFRSVSRCLRWNERPMQRLLSLEGNAWEESPPAGASPRAPSDLTPPAGTGSLEP
                     APATPLDSFKEECGSPDLVEPEREASTFSRIANAFRSPPEWFFARSMENVHCPKGDSS
                     ASR"
     misc_feature    complement(799681..802721)
                     /note="repetitive element"
     gene            799697..802114
                     /locus_tag="CYME_CMP316T"
                     /db_xref="GeneID:16995871"
     misc_RNA        799697..802114
                     /locus_tag="CYME_CMP316T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461537.1"
                     /db_xref="GeneID:16995871"
     gene            <803091..>804284
                     /locus_tag="CYME_CMP318C"
                     /db_xref="GeneID:16995872"
     mRNA            <803091..>804284
                     /locus_tag="CYME_CMP318C"
                     /product="sphingolipid delta 4 desaturase protein DES-1"
                     /transcript_id="XM_005537889.1"
                     /db_xref="GeneID:16995872"
     CDS             803091..804284
                     /locus_tag="CYME_CMP318C"
                     /codon_start=1
                     /product="sphingolipid delta 4 desaturase protein DES-1"
                     /protein_id="XP_005537946.1"
                     /db_xref="GeneID:16995872"
                     /translation="MNSSRVFEENVTLEKQVGIWSRLGLSTENAELAASKQIRRKHPH
                     GSRRARLLREHPEVSKLYGTNKKSALYVVLLVALQLGVAVLLGTSGRTSWVSAAVLAY
                     VFGAVVDHAQWVLIHDATHNLILESVVLNRLVLCIANTIHVLPSGMMFRYYHILHHIE
                     LNRVQRDPDVPAAWEARLVGNSSWRKALWLALFFVFQSLRLVSYSHRIPNMREYVWFG
                     INTVVNLVAMVGVWLLGGWISIFYLTLSSIFSVGLHPLGARWIQEHYPTLPFQSTYSY
                     YGWANRVAFNIGFHNEHHDLPSVPWNKLPKLKKMAPEFYDTLFAYRSYRQLLKEFILD
                     PRWSLLRRWEADLAAAQKERLEQDAGDAGKEPATVPPSTEECECAADAPAKPPVDDWT
                     DMALR"
     misc_feature    complement(804746..805272)
                     /note="possible transcribed region"
     gene            <805663..>807111
                     /locus_tag="CYME_CMP320C"
                     /db_xref="GeneID:16995874"
     mRNA            <805663..>807111
                     /locus_tag="CYME_CMP320C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537890.1"
                     /db_xref="GeneID:16995874"
     CDS             805663..807111
                     /locus_tag="CYME_CMP320C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537947.1"
                     /db_xref="GeneID:16995874"
                     /translation="MFSSGERFFGSVQRKLRYSDASSSETSEAQQGGESPTLSCILRE
                     HTAELRKAQTKRLGVRQRAAARPALRDTTNTVKTVSGEAGVAATSAAPETGPGVEETK
                     NPVAPAPWVQKHSPAARAPSPTRDTLTAERQRVGSQGNSARGVPARTSADTAVARKPA
                     RCRNELRVQPENESSAPVAGAAQNQNAQLVLELAKRDALIASLQRRCAQLEMDLADDR
                     QMEQLLDGYREKLDTAAEENRTLEEALRIERQNQQALQEKLASYKERLAAWPEKLRAE
                     TRALEATHEYQSKEARLRIQRLEAEKHQLQDELQQSWDTVASLRAELASVREENAEAV
                     REETQRMRRDYEQKLLQALKELEEQFDAYRQEATEALGRWQRRCIEMEREHCEMSELL
                     RHYRQKSEALTRSRDALERQLQDQITFAATTIESKEAVIGQLDSEIEALQNRIGELQA
                     QIDDLELGDTPAGSDELAICAASAPRRTTLTR"
     gene            complement(<807344..>808519)
                     /locus_tag="CYME_CMP321C"
                     /db_xref="GeneID:16995875"
     mRNA            complement(<807344..>808519)
                     /locus_tag="CYME_CMP321C"
                     /product="similar to anaphase-promoting complex subunit
                     10"
                     /transcript_id="XM_005537891.1"
                     /db_xref="GeneID:16995875"
     CDS             complement(807344..808519)
                     /locus_tag="CYME_CMP321C"
                     /codon_start=1
                     /product="similar to anaphase-promoting complex subunit
                     10"
                     /protein_id="XP_005537948.1"
                     /db_xref="GeneID:16995875"
                     /translation="MERLRPSREFFEGTRAEEPPPRGRRRLLFPAPETTPASGGIDRL
                     AGSRSRPVHGTLPASLVSTPDSSPSGCSMPPHTERRRETSIASPPTRPGRLGLPRVLQ
                     QRYPDLLWDRRIPQLLRRLTNESDKSETQLEALRELGDEAVWSVSSAKQGNGIELMRD
                     GNVQTFFQTDGAQPHKISIQFRQKTKVSQIRMFLNYQLDESYTPNRIGVWTGTDFHDL
                     RETVFCQLHEPRGWITIPLPPPAAVLEFDESGLVVSTSPAASPAMQLVTAVDARVEPR
                     LRTEDSFEMPPPDEPMHTSVDLDRRDSTLPHSRTENSMNTSELSRTMMRKPPLESALE
                     VFHLQIVIYGNHQNGRDSHIRQIMIVGPREQGSDLRPSSEQGLFFTSKVFGCYAVLR"
     gene            complement(809206..809315)
                     /locus_tag="CYME_CMP322R"
                     /db_xref="GeneID:16996023"
     tRNA            complement(join(809206..809263,809302..809315))
                     /locus_tag="CYME_CMP322R"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:16996023"
     gene            <811403..>812437
                     /locus_tag="CYME_CMP323C"
                     /db_xref="GeneID:16995879"
     mRNA            <811403..>812437
                     /locus_tag="CYME_CMP323C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537892.1"
                     /db_xref="GeneID:16995879"
     CDS             811403..812437
                     /locus_tag="CYME_CMP323C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537949.1"
                     /db_xref="GeneID:16995879"
                     /translation="MALAGQGDPRWIVQDLGKQGKNVGNWHWTERDISVWAMERLRSL
                     LQEDPIGELRLADDTVQVQVTGSPSVHGDCALYNRKGKLRSVYDLKVQADWEARSLAT
                     NAVCGKGTIEAELFDTDPDVTITPTGTWEHSAQLVSFLTLDGKSWLHRVLERFQAEAL
                     QLGTGDTGSTVAGQSQAAEAVKNANKDHAGNTAATSGVQQPEQSTQSTWTSLHMEERF
                     RAPPSVVFRALTAVEELQRITQAPATSDTTSSNGTFSLYAGQVHGSYTKLQEPELIEQ
                     RWRMADWVPRDHYSRVQMRLKAVSDDETLLVLQQDQIPEEYLERTQVGWRERIFAQLR
                     LMYNLGSAYV"
     misc_feature    complement(812901..814648)
                     /note="possible transcribed region"
     gene            <814320..>817022
                     /locus_tag="CYME_CMP325C"
                     /db_xref="GeneID:16995860"
     mRNA            <814320..>817022
                     /locus_tag="CYME_CMP325C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537893.1"
                     /db_xref="GeneID:16995860"
     CDS             814320..817022
                     /locus_tag="CYME_CMP325C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537950.1"
                     /db_xref="GeneID:16995860"
                     /translation="MKLRDAPERGETMKTEDARWQTTFLELENAVRYVSGSEPTPAPC
                     NSTGVYADVELWLDRELFESLAEGRNAPQTQPSAAALSGNSTPSRQTQLRSVRPYPLL
                     DAFVSAGINHEPDGTLMHGSTSRRAGDQHVQSRNVAEGQLRPAMPEPSHPVHKRRRTA
                     VVFQSRHEISQYLEAALDELEREAEDGVTADADATGGNASSDVVADASHLESPRKVGR
                     GAVAGTREHKTLSSTRTRPESIEQALLRIYAELRQRVLAQKYETIEAFIADFSLLLSD
                     IARSSKPEHTTSRVATRRRTDLIRQRVDSLLQPAEMSRIMATSSSDRPASSEEPAILP
                     AQPDKISQGPLLPYWYWLREQLSLDFASRDALGPWSLALDAVAADPEHVIHPECTASA
                     QVPDLRGAVRPPLASVEGYTGSLAVQTATKDVITIPKVYEQWLHRIYRLREQKEDLQQ
                     RMNRFYQLEAMLHVAERDKAIGEQPNARCAEFVRSTLESSHVSEKNAVRSQQLEASQG
                     AANPGNASQEKPALQLHALRAADSEARPQTKAMSTSPNASVRLPRLAAAWSMPLFIET
                     DREPDEPMRSTAGLLGVPAASVTESVPTEAAPRLDQRPRGLVQVSLPLPLQGLQRAVA
                     AVLVLSGFTGAHRSALESLTDVVAELIEGLGRQFSWIRYQMKRPPADQQSSSAASAES
                     GAKAARVRERVDKVSRAWWQAPRDYLHQSRCALPGAAVADPLHYFVSIISQSGIQDGF
                     HGLMRYSQLELPALERGLAQAEALLSTKIAETEHALEHLAQRIPAFDAPAGHLEVEKK
                     TFLPPALQDGNATIRSDEELDPESNPLFRYFGIINESVTLDVLQLEYQRTDAVAVPYP
                     LAQRVVTELEKTPVQPVSAGHPARRITVVRAASRRQLRPHEAVS"
     gene            complement(<817429..>819231)
                     /locus_tag="CYME_CMP326C"
                     /db_xref="GeneID:16995861"
     mRNA            complement(<817429..>819231)
                     /locus_tag="CYME_CMP326C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537894.1"
                     /db_xref="GeneID:16995861"
     CDS             complement(817429..819231)
                     /locus_tag="CYME_CMP326C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537951.1"
                     /db_xref="GeneID:16995861"
                     /translation="MKRSKTGNQVAWNASRVPHRGTRWCTFAFGTRLPWLTPWQAFTQ
                     RGSHLGTARRCRRPTASRSQPAYSRTRTLVLQARGSEPESTAASGLSERTENTDALPE
                     KRVLVQQWSGTSRRRIETYCDYEGKLSVQRQISGPQVRHGLQFSTEPLQRLLASVFLP
                     TNYPHSVTASYAPYAFWHFLHNTLTACNSVLGTTALLVSAGVVADPSRAASTALTRDP
                     ALEHLPTAASASAVTSWILKDGVGHLVRLAFGSRYAHRFDGDLKRLRVLADVLWHLGT
                     GLELVSRSFPDSFIGLASGAYALKGMAHVVFNSTRSTIYRTVATRSNIGDVTAKGDAQ
                     SIAAELLGMSIGLSLYRGFAENNLFWTWAIFGIVVAGQMYSRIQSMRVLVLPLLNLQR
                     AVLLVDAYVASRLAAAATASEAIRPIRKQEYVSNVRENGTMKTLLVLSPEEVAQRERF
                     LHWQSHWSTVPQVVPDVRMHWFSESASDVGTLLRVFETEAFVVGRCRRQHPAQSKEQV
                     GFVMKTGAGAREALRALIAAIFLVRQPQATERDALLFSRLELTEDFFREAASRGWQLD
                     CVHGVGQRNRLLCNAVEPSDTVRHFIPFDEMPGH"
     misc_feature    819359..821045
                     /note="possible transcribed region"
     gene            complement(<820967..>822646)
                     /locus_tag="CYME_CMP328C"
                     /db_xref="GeneID:16995903"
     mRNA            complement(<820967..>822646)
                     /locus_tag="CYME_CMP328C"
                     /product="poly-A RNA export protein DBP5"
                     /transcript_id="XM_005537895.1"
                     /db_xref="GeneID:16995903"
     CDS             complement(820967..822646)
                     /locus_tag="CYME_CMP328C"
                     /codon_start=1
                     /product="poly-A RNA export protein DBP5"
                     /protein_id="XP_005537952.1"
                     /db_xref="GeneID:16995903"
                     /translation="MADRVVQMSSSDVTTRNGAAPAAASATAVKRTESPPGSSAEAAV
                     PAAAAETSSPSSQAESNEEASKQEDQVISQLERLPRLGRGHESTGASAARKTSAPTTA
                     ASEDACKTSSAHGAGNNNEDDKGNEDDDVDEPLPLRGLNEVEGADQVEVTLSDDRALY
                     TSAATFEELGLPVELLQGVYSMKFSKPSKVQAVSLPMILAAPPRNLIAQAHNGSGKTA
                     CFVLGMLSRVDTTKDVPQALCLVPTRELARQIRDVIMNLGKYTGCRVYLAVKQGEEER
                     SQPRVTSIRDHIIVGTPGRVMDLLRHRVFSGKTIRILVLDEADEMIDTQGMGDQTLRI
                     KKLLSPDVQTLLFSATYPDHVRDFALKVVPNANQITVKREQLSLDNVKQFYIDCGSSE
                     GRFQVLSDIYGSLRIGQSIIFVERRRDASELARRMRADGHSVALLHGGDMTPEERDRV
                     IDSFRAGTDRILISTSVLSRGVDVLATTVVMNYDLPRDRTGHADPETYLHRVGRTGRF
                     GRKGIAINFIYDHWSRQLLQEIEQYYGDRCHIQAVANVEELVSILEDEANF"
     gene            complement(<825920..>826909)
                     /locus_tag="CYME_CMP329C"
                     /db_xref="GeneID:16995904"
     mRNA            complement(<825920..>826909)
                     /locus_tag="CYME_CMP329C"
                     /product="putrescine aminopropyltransferase"
                     /transcript_id="XM_005537896.1"
                     /db_xref="GeneID:16995904"
     CDS             complement(825920..826909)
                     /locus_tag="CYME_CMP329C"
                     /codon_start=1
                     /product="putrescine aminopropyltransferase"
                     /protein_id="XP_005537953.1"
                     /db_xref="GeneID:16995904"
                     /translation="MNTQNPSPLNADRDSAATNGRELVECIQGGWFMERSPLWPGQAL
                     ALEVQRVLYQGRSRFQDILVFDSRAHGRVLVLDGAIQVTERDEFAYQEMITHLPMFAH
                     PRPERVLVVGGGDGGVLREVLRHDAVDKMLEKVVLCELDEDVIRVSRDYLPGVSGGAL
                     DGTNAKVSIAIMDGAAFMQQHQSQFDVIITDSSDPLGPAESLYQEPFFRSMYAALREG
                     GIACVQGESFWLHLDLIVSVVRILRNIFDVVEYASASVPTYPSGQIGFLLCGKGTVWR
                     NGGRPRHAARRPSEKLQRHLRYYSPEMHESAFVLPPFVEKAIAGALQHPLEAS"
     gene            826427..829689
                     /locus_tag="CYME_CMP330T"
                     /db_xref="GeneID:16995905"
     misc_RNA        826427..829689
                     /locus_tag="CYME_CMP330T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461538.1"
                     /db_xref="GeneID:16995905"
     gene            complement(<829769..>831823)
                     /locus_tag="CYME_CMP331C"
                     /db_xref="GeneID:16995946"
     mRNA            complement(<829769..>831823)
                     /locus_tag="CYME_CMP331C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537897.1"
                     /db_xref="GeneID:16995946"
     CDS             complement(829769..831823)
                     /locus_tag="CYME_CMP331C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537954.1"
                     /db_xref="GeneID:16995946"
                     /translation="MLAFSTPIVSGLVRSRSLAPDPEHGTWSFKSCSMCCIHLARFST
                     SNNNSWTCLVNTVSKPEFCAARELVRIEPEVSPETIRMSNTRVRSASSTRRKSTISLD
                     IVSGMSTFPESRSLTPLGKGSGLGNDSSEILKLSRALQECSQQRRLRQKRWACRWHRP
                     VPSGSPFLRGESPRARRFLQQCFLVAEEECWKRTESDTGVSAEGQTMDQVTPNATPEL
                     SQLIDCFFAEPVLLELIFTRQTGAEKELEEALPRAWALATLKACSFCNRHPSRDRARE
                     AVAESWRALSNAAVYEQGVLQTEAYFLWRLFNGGWCQNGGLQLVLRFYLQCRSLLREL
                     RALEDPAEELAIRDANPPTLEHLLDRARALVRSAFDTRLLLQERYHSFAWDAELDGAA
                     SHEAIKQLGQHAIARLECNQVFLRNLPLVLLNWLCKVDASGNTSSASGRLVAPWWRSM
                     VDLSYVTHCAMDALIERELADIAREIVEEQQYASQDWRGPVENLPADPVDLLLSDPQV
                     YLEAHRERLEGSRNASSALDLESTNSTAFARHRSGERDDFEYLMDESVRRTSSSTPFT
                     SDDSQSKTSARGIPLPQNRRLFTHLPTDTETTATSPRTEGYPSTPAVEREPPSALNPS
                     PVEASWQGSEVGAQLSDSLCRILYVDGQYYVCGGGIPCTMLSHRAQQAPHMAAGRRIE
                     HG"
     gene            complement(<832702..>833391)
                     /locus_tag="CYME_CMP332C"
                     /db_xref="GeneID:16995947"
     mRNA            complement(<832702..>833391)
                     /locus_tag="CYME_CMP332C"
                     /product="similar to fibrillin"
                     /transcript_id="XM_005537898.1"
                     /db_xref="GeneID:16995947"
     CDS             complement(832702..833391)
                     /locus_tag="CYME_CMP332C"
                     /codon_start=1
                     /product="similar to fibrillin"
                     /protein_id="XP_005537955.1"
                     /db_xref="GeneID:16995947"
                     /translation="MFAFASHAFAGNAHLPKTSLCALTRQREALSVRARGARLRLWTQ
                     PGCSLIMGVFLNTPTLEQAKADLIERVKDLDMGRIGYSDAFAKELDEKYIKPLEAMNP
                     TRTPVESPLLDGRWRLIYTNSKNVLGLDRPNIARPLRNSIYQTIYVERGQVVNEERVL
                     FGLLTNRVQAVFTPEPPRRVRVQFKQFQFGLLRVPAPARARGWLDITYLDEDMRISRG
                     NLANVFVLLRD"
     gene            complement(<835123..>837024)
                     /locus_tag="CYME_CMP333C"
                     /db_xref="GeneID:16995948"
     mRNA            complement(<835123..>837024)
                     /locus_tag="CYME_CMP333C"
                     /product="similar to ubiquitin carboxyl-terminal hydrolase
                     10"
                     /transcript_id="XM_005537899.1"
                     /db_xref="GeneID:16995948"
     CDS             complement(835123..837024)
                     /locus_tag="CYME_CMP333C"
                     /codon_start=1
                     /product="similar to ubiquitin carboxyl-terminal hydrolase
                     10"
                     /protein_id="XP_005537956.1"
                     /db_xref="GeneID:16995948"
                     /translation="MERKGVNWTQFSHVYLGQLTAREWSSLIIRSEAVLSQSTSEQEP
                     ELNQAPGTVKVRSGSASSTPTLAVSPSQVAVALPQTETPSLSPLKKDAPAEVVHSSNS
                     NSPVVPLRSSESPKSTPRAAPEPVSAGTPRLRWASVVSGEARADAPGASHESNQSSVT
                     TESKLLKRIDEADQATGSDRRGRLFTGLPAQMSERLLQLLEYGCPVSNDRTPSPSVAA
                     SSIAIDPHWRRPGFVNTGNSCYLNAVLQALLAIDEFRLTWTALGALLPTQRDLLEKCN
                     CHLVAGWLRLIDEWQALCQQTRLQRGRFGAAAPMLRPTYFWENERLASTVGSGHQEDA
                     QELLMIMLDGLHSELLELRSLLGEKSKLASLERAASPSLTDSDATSDTEWETVDRRGR
                     SAIVRTHQVRKTFITSIFGGALRSEVRKAGAKRSAVREPFLMLSLDIEDQRIRTLDDA
                     FRYFMEPEFLEAPDERDSSARTRTRVAANLDPLRKHVTLDTPLPQALIIHLKRFSVAS
                     DGTGQGKKLHKELSFPPQFVLNASWFSAAVPKAQLGEACSRRYRLVAVITHLGTDLAN
                     GHYIADVLASGTNSTWSLSKSRNAPRGLTRSVDADAIWWQCDDQDVQMVSASTVLSRA
                     AYVLVYRNA"
     gene            <837299..>837640
                     /locus_tag="CYME_CMP334C"
                     /db_xref="GeneID:16995951"
     mRNA            <837299..>837640
                     /locus_tag="CYME_CMP334C"
                     /product="DnaJ homolog, subfamily D"
                     /transcript_id="XM_005537900.1"
                     /db_xref="GeneID:16995951"
     CDS             837299..837640
                     /locus_tag="CYME_CMP334C"
                     /codon_start=1
                     /product="DnaJ homolog, subfamily D"
                     /protein_id="XP_005537957.1"
                     /db_xref="GeneID:16995951"
                     /translation="MATPLLAGIAVAGAALAGRAAIRAWQVLKTAPARPKFPRSFLQG
                     GFEPTMSRTEALHILGLREGVPREKVREAHRRLMRINHPDTGGSAYLAAKVNEAKEVL
                     LGTGRRPTAGV"
     gene            complement(<838548..>838985)
                     /locus_tag="CYME_CMP335C"
                     /db_xref="GeneID:16995952"
     mRNA            complement(<838548..>838985)
                     /locus_tag="CYME_CMP335C"
                     /product="box C/D snoRNP and U4 snRNP component Snu13p"
                     /transcript_id="XM_005537901.1"
                     /db_xref="GeneID:16995952"
     CDS             complement(838548..838985)
                     /locus_tag="CYME_CMP335C"
                     /codon_start=1
                     /product="box C/D snoRNP and U4 snRNP component Snu13p"
                     /protein_id="XP_005537958.1"
                     /db_xref="GeneID:16995952"
                     /translation="MEPLSSTEAPSRPMDVVTAPNQADPRAYPFAPADLVVEILDLVQ
                     QASHYKQIKKGLNEVLKSMNRGLAEFVVLAADTQPLEILLSAPLVAEDKAVPYVFVPS
                     KAALGRACGVSRPVIACAVLRADMSQLRNQITALRTKIEQLLL"
     misc_feature    complement(841668..843131)
                     /note="possible transcribed region"
     gene            <841790..>846013
                     /locus_tag="CYME_CMP337C"
                     /db_xref="GeneID:16995939"
     mRNA            <841790..>846013
                     /locus_tag="CYME_CMP337C"
                     /product="similar to desmoplakin"
                     /transcript_id="XM_005537902.1"
                     /db_xref="GeneID:16995939"
     CDS             841790..846013
                     /locus_tag="CYME_CMP337C"
                     /codon_start=1
                     /product="similar to desmoplakin"
                     /protein_id="XP_005537959.1"
                     /db_xref="GeneID:16995939"
                     /translation="MYAALHRVTATIEAVDLSPLHFEAHVSSPASMSRRMTALLHWGP
                     SPVLFASPFYQAGARNQRANATKITRWSIRCRKYARSEGLGFLAITQPKTSLVRTASH
                     AAYNANLWAARRSGRVSPRMTTGSSPVLSTRRAELVCSRYVVFSDLHVDANRLETCLQ
                     VLERVHELATARDAGIIFLGDFWHLRGSIPVICLNRVLETVQQFTVPCLMLPGNHDQV
                     SICGREHALVPVAAAMQPGLALVFDEPVVMFDALWLPYRKRPLQLVEALREHGPHVKA
                     VFCHAEIQGAWLNNQMRYGGPGGIAPELFPPSPVPTYAGHFHRPHTVTGYPHIQYVGS
                     PYQVTRAEEGQEKHLLVVRSTDWLTEEIVPLAIGPRFFRVSLKQARQQLSASIPASAA
                     EATTSATTGFRPGDRVTLLCTASELQQQRTAGAKDMDHDLEYVYNELRRRGIHASMRL
                     WDAPAENEKVSSSSAQRTFVEPQLRMPNAERLDAADVLRLFARQHPQQLDGTTLALGL
                     SILEQIQKSNAKIARGESFSRLRAVHVLFDSVRLHNFGCFHTEPDSNQVDQLSMDVAG
                     STRHQMSVTSASEESHQDLESNGGVVKRGRVAAATATADGAWRTIPAKPGIWYPLRNR
                     GIVQVSGRNLDEDGCNSNGTGKTTLAMAALWALTGSLEPRPHLRRNVSQLRILHEDAT
                     EGFVELRASVNGKPLLVRRKVRRSGKQRERYNQELFVEYDSRDLTRLSIEETQQRLNE
                     IIDLSLLPHVVFFGQNYLHGLLSTTDKEFKEILESALPLQVWNEAYAHVTARQRALRE
                     ERQQLAQKIQSCSQALERERERIEELARTERETRLQLDLQEQELKQSLEQWQQGAAEA
                     SASDTIDSGSDNTSLEALRERIRHLKASIDADVTTLAELQRKEAKLHAELAQAQRLWD
                     QWAALHAQLQGDAGITVCQGSLEQRRTALHEQVKDLKRVLQELQLQEQSTVASIRHLD
                     RMLHSEQPPVASSAADCDGAAKPQQTHSKTFCALCLQPVDAASYADRLQALQTDRQRL
                     ASALDDLRAQRHDKDAEIQIMERELRDTEAAFMERHALEQRLDAVVALRPTPEHLHEL
                     SQASDRCSMEAALVMRTLDTNRQLLAEYEQHLLQQQELRLHQEQQRARYDRALRALDW
                     TQQQRQRLLQPIAAAILEATAHVASLQSTLNEAVAHERTLVDTADRLEFLARAFHRGG
                     IPSQLLDQSLQVIETLCGHYLRHLSDDTLLLRIRRRRQAQRPRERELTKATTRAENAL
                     EVLVWQVYCRDARTGTFRERELGLLSGGQLRRVSIALSLAFAEYICHQLGYRSNLLVL
                     DEALQQLDQEGARRLASLLPQLQRETVLVIAHENASFLVDIADAHDVVERASGRSTVH
                     CDTGFLETELAGDSFSGRSELVPQAQVRR"
     gene            complement(846748..848394)
                     /locus_tag="CYME_CMP338T"
                     /db_xref="GeneID:16995940"
     misc_RNA        complement(846748..848394)
                     /locus_tag="CYME_CMP338T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461539.1"
                     /db_xref="GeneID:16995940"
     gene            <848515..>849009
                     /locus_tag="CYME_CMP339C"
                     /db_xref="GeneID:16995935"
     mRNA            <848515..>849009
                     /locus_tag="CYME_CMP339C"
                     /product="similar to Golgi vesicular membrane trafficking
                     protein Bet1p"
                     /transcript_id="XM_005537903.1"
                     /db_xref="GeneID:16995935"
     CDS             848515..849009
                     /locus_tag="CYME_CMP339C"
                     /codon_start=1
                     /product="similar to Golgi vesicular membrane trafficking
                     protein Bet1p"
                     /protein_id="XP_005537960.1"
                     /db_xref="GeneID:16995935"
                     /translation="MHRASRPLSESRCPSPAMARSTSDRSAHTAGSAAFPSTVTSTPA
                     STSTSMSWSGHSSQVANRADLSGVAYADLLEQQNQDRIQALSGKVGAMKELAIQINEE
                     VITQNRFLDQDLSDSMGRTVEQLRNSMRKLEQLVRSGSSYALCYGVLGIVGVLFLLHW
                     LFPR"
     gene            complement(<849241..>852027)
                     /locus_tag="CYME_CMP340C"
                     /db_xref="GeneID:16995936"
     mRNA            complement(<849241..>852027)
                     /locus_tag="CYME_CMP340C"
                     /product="26S proteasome regulatory subunit RPN1"
                     /transcript_id="XM_005537904.1"
                     /db_xref="GeneID:16995936"
     CDS             complement(849241..852027)
                     /locus_tag="CYME_CMP340C"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN1"
                     /protein_id="XP_005537961.1"
                     /db_xref="GeneID:16995936"
                     /translation="MNGTTDETLDLSPEDAELKDRLDLLVDRVLDTTTRPAALSALGD
                     IIRTATSSLTSVPKPLKFLRPHYGRLKKQAQDEPNGSFFYNLLSVLAMTMAEAGTFEC
                     LLFRLRGDSSLPVGYWGQEYVRSLVGEIGEALEAGKVERKELNPLISEILTYLVEKRA
                     EVDACDFCLEIGELDRLGQLTLNDRLSEDRVCQYLTSCAVYLPEPENENALRWALNLY
                     LRANRFSNAYRVAKMLGDPSLVPVDRVPPGPMRTQIELMQTPRDWSKHYRAVAQDLEI
                     LEAKTPEDIYKSHLVESGRRLSTLIGTVHVDSARENLAAAFVNGFVNAGFGSDKFLTN
                     PSDDERRNWIFRNRAQGMLSATASLGMIFLYDVDGGLAEIDKYLYSPEEFVRAGALLA
                     IGLLSGGRVPDECDAALALLAEHIESENNNERLAAILGLGFAYAGTQRVDLMELLAPI
                     LVDVSSPVDVAAVTALAVGLIFVSSANADLASTLIQAIQDRCVDVPRESNTTDAAGPE
                     PRTTELDAPERMELVGPVSDPNNDTVPGAAAEHSASNPEASQETATSTSTNQEAEAPS
                     NATNGGPAASAPSSGGTGNDAQNEAIFRHSLNRLFPLALGLLYLHRRGLAMQPVLDAL
                     HAMGVQAPFVSQLLECCAFYGTGDVLALQRFLSWENELMPLAAAANASGERLMQQMLL
                     RLFDRMLQLGSDTQRRVVPLALGLAFVSDPRLEVVDILSKLSHDGDSEIAAGAILAMG
                     FTAAGTNQARVAGLLRELSAFYAEDPSMLFMVRLAQGLTHAGRGLLTFAPFSADATVV
                     DAVAAAGLLTVLVLCLGAGSLRETLLGRHHWFLYALALAARPRFLVTLDADTQQPVPV
                     LVRVGQAVDTVGQAGRPRGITGFQTHTTPVLIGVGERAELASDEWACYAPVLEGLVLV
                     HRRDRVTGSAQKAL"
     gene            complement(<854169..>855788)
                     /locus_tag="CYME_CMP341C"
                     /db_xref="GeneID:16995937"
     mRNA            complement(<854169..>855788)
                     /locus_tag="CYME_CMP341C"
                     /product="similar to phytoene dehydrogenase"
                     /transcript_id="XM_005537905.1"
                     /db_xref="GeneID:16995937"
     CDS             complement(854169..855788)
                     /locus_tag="CYME_CMP341C"
                     /codon_start=1
                     /product="similar to phytoene dehydrogenase"
                     /protein_id="XP_005537962.1"
                     /db_xref="GeneID:16995937"
                     /translation="MQRAQRVRRRNGGVWAFQWADYVIVGGGLAGLATGALLADQGHS
                     VCLLEAHERVGGAAHGFSKGPYYFDTGPSLFAGGSLSGRDSSDPLAQLLRLLGIKLPV
                     ARYNTWGVLVPEGRFNSAVGAKDFSHTLRELRGRDAAAQFAELQRFMKPLAEAAVSIP
                     PVALRRDLGIWRTVTPHLPRALRHAAHFRLMSAPFSRVLDQVGVRDAFLRGWMDLLCF
                     LLSGLPSDGTPTAEMAFMFRSFYGEDAYLEYPLGGVAALAQALKDALEKRGGKVYTSS
                     PVQSFWTENASQRVVGVTLVDGRRIKASRRVVSCISLWDTARLLQDGSFQANAEPLPS
                     FLHAHLVFKALDPESASTHFTDYIRGSQPPEHDGYNCHYIVVDNWERLTEPQNVVAIS
                     IPSVLDPSLSRSGEHTLHAYTPATEPYELWENLDRERYRAQKLARGQVLLDAIARAVP
                     GCADPDSIRMKLIGTPLTHEQYLRRYRGTYGAKPLLPWIRHDLPAGLALAGENSFPGI
                     GVPAVITSALLTALGEMPATLHARYLQRLFE"
     misc_feature    complement(857036..858673)
                     /note="possible transcribed region"
     gene            <857303..>859099
                     /locus_tag="CYME_CMP343C"
                     /db_xref="GeneID:16995919"
     mRNA            <857303..>859099
                     /locus_tag="CYME_CMP343C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537906.1"
                     /db_xref="GeneID:16995919"
     CDS             857303..859099
                     /locus_tag="CYME_CMP343C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537963.1"
                     /db_xref="GeneID:16995919"
                     /translation="MWCFVTGRCAPLWGVNTNSTSVTARSRWRTAVCGGQQQRCTRRT
                     KLASRRPCRASASDPNFWRDVARSVSEQGELATSRAPVRRERPPPQWVAPPPGFELDT
                     SGESSSTWASWRAAAEAAQAEQEAVQERLERGEPVRDMTAERNFWRSAAAELGAPLDP
                     GRTAAELRTAAGGLAERPSEHNRSEEIGSIDSNIPESDEEWDPDTSWMQMYASDAVEF
                     VSGTESADDNLQGTLWGAALGSEQAARERSSTSLQSLSAEWDTKERIPDSGAEAADEE
                     ETLEPRDPKKETAFWRGAAQELLGASTGATSDAFATRSTTSHSADGSATQDSEEETWE
                     PRDPKKETAFWRGAAQELLGASTGATSDAFATRSTTSHSADGSATQDSEEETWEPRDP
                     KKETAFWRGAAQELLGASTGATSDAFATRSTTSHSADGSATQDSEEETWEPRDPKKET
                     AFWRGAAQDIIESLPTQIELGVDAQSSASTPAVPDAHAGTGDPDVTAEEPVGPAEAWA
                     AWRAARASSKNVSALPAPVAETHPEPLSETEIWIQWREQQRKTWAGALNDLNRNRPRE
                     QQVARPEKSTVDRWRHVAAELSQDSPQSEENS"
     misc_feature    859399..860725
                     /note="possible transcribed region"
     gene            complement(<859418..>862714)
                     /locus_tag="CYME_CMP345C"
                     /db_xref="GeneID:16995913"
     mRNA            complement(<859418..>862714)
                     /locus_tag="CYME_CMP345C"
                     /product="valine--tRNA ligase, cytoplasmic"
                     /transcript_id="XM_005537907.1"
                     /db_xref="GeneID:16995913"
     CDS             complement(859418..862714)
                     /locus_tag="CYME_CMP345C"
                     /codon_start=1
                     /product="valine--tRNA ligase, cytoplasmic"
                     /protein_id="XP_005537964.1"
                     /db_xref="GeneID:16995913"
                     /translation="MTLDATGESAAATGQDVTLEQYRAMTAEERALLPKAKQKKLAKL
                     LEKAEQKALKAQARSVIAEANLGAASATQAATGARANKSSASTTNDNDDTGSSSKQLP
                     PEYIDHTPKGAYKTLLKKPMSPAYYPRSVEAAWYDWWEAQGFFTAQTEQALSEPDPSR
                     RFVMVMPPPNVTGTLHLGHTLMCAIQDCLTRWHRMRGHVALWVPGTDHAGIATQTVVE
                     RKLMRERNLTRHDLGRDDFVRYVWAYKEEYGGRICDQLRRLGVSVDWSREQFTMNEQL
                     SKAVVEAFVRLYERGLIYRGTRLVNWCCRLRTALSDIEVEYVDIPGRELLRVPGHDGE
                     VEVGVLTRFAYPLKEPVPGGIHELVVATTRLETMLGDVAVAVHPEDPRYRDLVGAQLV
                     HPFLPDRELRVIADAQLVDMSFGTGCVKVTPAHDPNDYECGLRHGLPFIVIFDDEGHL
                     NEHAGAFSGLMRYEARVQVERALAERGYLRGKESHAMRLALCSRTHDIIEPMLKPQWW
                     VKCDHMAREAVRAADEGQLTILPEFHRATWNRWLENIHDWCVSRQLWWGHRIPAWRYT
                     NVDTGAEEWIVARNVEEARQRAPPAYRESLEQDEDVLDTWFSSGLFPFSVFGWPDTSP
                     VNREMHAFYPTTLLETGHDILFFWVARMVMLGLELTGKLPFSTVYLHALVRDKYGRKM
                     SKSLGNVIDPLEVIEGATLEQLHAKLLSGNLDPREVEKARKMQRLEYGEQGIPECGTD
                     ALRFGLLAYTLQGRDINLDVARVVAYRHFCNKLWNAVRFALGLLHVADKDMAGQPAHR
                     QLPNASDDSGAEALVYKDAALALEDRWILSRLAHCAMQCHQALSSYEFAEAVQALHHF
                     WLYELCDVYLEAIKPRVYGAEDAPADATATSDASVARRVLLECLDQGLRLLHPMMPFV
                     TEELYQRLPLPKRAPSIMTASYPEGGSRDEAAEELVQQAMLIVRGIRSLRTLYQVKKT
                     ARPQVWIVGGDAVCAPLVRTLALCGTVNVQADPPSEVKQCGVQLVTPQICIYLHLAGL
                     VDVQVEKAKAQAKLAEAERSAQRFREQLQNYDERVPESVRERTVQNLNRYEQEIAQLT
                     EALERFSQWS"
     gene            <866781..>867602
                     /locus_tag="CYME_CMP346C"
                     /db_xref="GeneID:16995914"
     mRNA            <866781..>867602
                     /locus_tag="CYME_CMP346C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537908.1"
                     /db_xref="GeneID:16995914"
     CDS             866781..867602
                     /locus_tag="CYME_CMP346C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537965.1"
                     /db_xref="GeneID:16995914"
                     /translation="MVFVNVNAASLQTGRFLGRALHRRRFCEARSRSPLGTLMVMPPV
                     SRRAFLAAFAAGVTGIVLARASPSWADGAVSRATRERARGQYGPRVLATQAIIDRIEQ
                     AANAGNLELVAALTANPKKISKKERKELESLDGFGALYAERNAFLLLKGAVRGDRVRE
                     PEMDRVVDRLFATADEIYQAARIGNRDKVIRSARNLPLYLNSVITVAEVNPRGPDAAP
                     GQAFSSDFDWRRGRVAMHLEESAAKGSSEMAAQPVVSKPSAPAPAPAPEVSAVGS"
     gene            complement(<868257..>868559)
                     /locus_tag="CYME_CMP347C"
                     /db_xref="GeneID:16995915"
     mRNA            complement(<868257..>868559)
                     /locus_tag="CYME_CMP347C"
                     /product="similar to lipoic acid synthase"
                     /transcript_id="XM_005537909.1"
                     /db_xref="GeneID:16995915"
     CDS             complement(868257..868559)
                     /locus_tag="CYME_CMP347C"
                     /codon_start=1
                     /product="similar to lipoic acid synthase"
                     /protein_id="XP_005537966.1"
                     /db_xref="GeneID:16995915"
                     /translation="MNVAAEVASWDIDDVVLTSVDRDDLPDGGAADFARTVQYLKQLR
                     PQSTRVSSDQDAQQMPPTNRPLFVECLVSDFAGQRLLPLLQHSGAHSATEALAYVR"
     misc_feature    870042..872845
                     /note="repetitive element"
     gene            <872903..>874783
                     /locus_tag="CYME_CMP349C"
                     /db_xref="GeneID:16995933"
     mRNA            <872903..>874783
                     /locus_tag="CYME_CMP349C"
                     /product="similar to RNA methyltransferase"
                     /transcript_id="XM_005537910.1"
                     /db_xref="GeneID:16995933"
     CDS             872903..874783
                     /locus_tag="CYME_CMP349C"
                     /codon_start=1
                     /product="similar to RNA methyltransferase"
                     /protein_id="XP_005537967.1"
                     /db_xref="GeneID:16995933"
                     /translation="MGFAATPVARVLSVKKPSSTTARPRSVWTPSFRTRKKRLAPLVA
                     TNSRKTSAGTGIPPASGPRPRQVWEALSAREAAFLAVECSLTQGHDVAEDVDGSDALD
                     GRPSQGSGGVGGALSNRYLLTQLALWSEKHKPSRVEYALAKIIAFNAVRQRALFDYVL
                     QTNIVRDRSAIDQEPHRIKSEGMHLSIAQRALLHTALAQYAFMERVPVYTIVFSTVEI
                     AKTYFGQRFAAFANAILRNLVRYGEKYAADLESRRPASYIVRPLPFPADALDVRYSYP
                     AVFASRVFGQLLNRKRLVAFLEAGNMTPQTFLRVPRQHAQHEDLKMAIERRLLVPWSD
                     QDSTETVSRPWIIYRVDLQCAGEDPGAALPLTLPSANGTGWADDPANVLTRSLFQRLL
                     QHFIAQNVTQAEHTFLLCEQLRQRWDKERRIARVLDLCTAPGGKLTAVFEYLQYSDLG
                     DAQTEYIGIDLSDQRIHMVHENVDKTPGMRESRVFVGVARGESFVDCRAGNILRSEDE
                     RAVSPCFDLVIADVPCTNSGVLNRRPEARWRLDEQHFASSVPRLVSLQASLLNRACLL
                     SRSAVFYMTCSVLHAEGRDLVRSVLENHRDFELVWDHLTYTDAAGRDGGYAAMLWRRP
                     SH"
     gene            complement(<875839..>876393)
                     /locus_tag="CYME_CMP350C"
                     /db_xref="GeneID:16995934"
     mRNA            complement(<875839..>876393)
                     /locus_tag="CYME_CMP350C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537911.1"
                     /db_xref="GeneID:16995934"
     CDS             complement(875839..876393)
                     /locus_tag="CYME_CMP350C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537968.1"
                     /db_xref="GeneID:16995934"
                     /translation="MSTQELFVYHPNMEPSPRLGSTFRCSVVLQFMEPVCTCLQSRYC
                     STAGRMQRSRLQGACGVRFSRARPLLRMQAAKGFGRDASKEPGYLSPEEVREAIRFLV
                     NSAADPAAATLRQRLRRQLRKQYGPVIQCGACHGKRRSVCLMCNGSCKMKGFLGDEVP
                     CYPCQGTGLGRPCRECNGMGFFSL"
     gene            <878358..>879455
                     /locus_tag="CYME_CMP351C"
                     /db_xref="GeneID:16995953"
     mRNA            <878358..>879455
                     /locus_tag="CYME_CMP351C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537912.1"
                     /db_xref="GeneID:16995953"
     CDS             878358..879455
                     /locus_tag="CYME_CMP351C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537969.1"
                     /db_xref="GeneID:16995953"
                     /translation="MSFIRLTTRGSGAQPAERLGAGVTMAATVHWPVTRLGLHRCQRD
                     NHAVYDVALPLGTVTALVEDEPGLHARTFLSVFIAEGLAHEHSLGLVPGALVEGVPAS
                     PVAGPSSSAAASASSAAPEADLRIAWRYANKVGSASKRRAERARLDLSLQVNPRELLR
                     SSAALRLYQSLEGALEFAAAPASQQCRRLALQSPHHWVCSQMIGGLSEETALSRLWRF
                     LYILRQRCRKSMTVAVMTLSRQWALNPSLLHLLDAVIDVNTFGGKGVAELGLGAFDGL
                     IHPLKMAVVPSSLKPMTPFIVDDQEKSPLEVDLLVFRRTRRELVVEPAHEAPDLSIPG
                     TRPSHSKAKQIDGVADTLKQMQDADAFATDW"
     gene            complement(<880708..>883530)
                     /locus_tag="CYME_CMP352C"
                     /db_xref="GeneID:16995954"
     mRNA            complement(<880708..>883530)
                     /locus_tag="CYME_CMP352C"
                     /product="4-alpha-glucanotransferase"
                     /transcript_id="XM_005537913.1"
                     /db_xref="GeneID:16995954"
     CDS             complement(880708..883530)
                     /locus_tag="CYME_CMP352C"
                     /codon_start=1
                     /product="4-alpha-glucanotransferase"
                     /protein_id="XP_005537970.1"
                     /db_xref="GeneID:16995954"
                     /translation="MKLIFRVQFASVPGQDVFISGSGDQLGNHRADGSKKLRYTPTAW
                     EIELDDFAMGTTLQYRYFVKDGTTGKISWERGKPRTLILPKDVQVLVCDDGPFRQEPN
                     VEEEVFHTTAFRDVIYGRHVAAASQNDATDGKSKRGPAPGSGRDLLLFQTLQVRVCPS
                     EEVYIRFFVDRSDAATAAASNIRKIVEDGTEKSIEQRLSADRFPLWSLVMPLDELLPD
                     RNQEQMLKYELFVRNSANGSTTASSKDDQRHLRIPPKDVSVHYTDYRAIDDPEKSARF
                     AGFAIPVFSILSENSCGVGELLDLEQMIDLAVQMKMSLIQLLPLNDTSVTGTWRDSYP
                     YSCLSVHALHPLYLNLDELNPPSEISREIKEARTRLNQLEAIDYEAVMNTKMAILRRM
                     YANDKQRILRDPAFLKFFNENQEWLVPYAASRFLAKVNGTANFDQWGARRRVTVADLE
                     GLASPDTFFFDELALHYYIQFHLYRQLARVGAYAAKHRVILKGDLPIGVHRFSVDAWM
                     NQDQFYLDRQTGAPPDQFAEFGQNWGFPTYNWERMALDGYRWWRGRLRSMEKVFHAYR
                     IDHILGFFRIWEIPGEAMSGLSGRFRPVNPIRRSELESRGIWDIERLCEPYISETQLR
                     RVFGDQKWSFVRDFFFEPWYNRYRFRPKYSTEARLEAFFAKEEEVSKFCAQSGIDAEY
                     LKLELFRFVNNVILLRDLDEPDDAFHPRIEFWRAPTYWELNGDWQHKLRQLYDDYFFR
                     RQEVLWRDKAMEKLPMLKAASDMLVCGEDLGMLPSCVFEVLGSLCIIGLRVQRMPENA
                     EFGDCSKYPYLTVATPGSHDTSTLRGWWEEIPSEKRQRFWKNVMKREDEAPSECTPET
                     VEWMIRDHLHAPSILAIFPLQDLLGMDAKLRRPVASEEQINVPANPNHYWRFRLHLST
                     GKLAQSQKWLQKIASMVTESNRQRPQ"
     misc_feature    884717..885775
                     /note="possible transcribed region"
     gene            complement(<886997..>888805)
                     /locus_tag="CYME_CMP354C"
                     /db_xref="GeneID:16995976"
     mRNA            complement(<886997..>888805)
                     /locus_tag="CYME_CMP354C"
                     /product="probable Na+-dependent inorganic phosphate
                     cotransporter"
                     /transcript_id="XM_005537914.1"
                     /db_xref="GeneID:16995976"
     CDS             complement(886997..888805)
                     /locus_tag="CYME_CMP354C"
                     /codon_start=1
                     /product="probable Na+-dependent inorganic phosphate
                     cotransporter"
                     /protein_id="XP_005537971.1"
                     /db_xref="GeneID:16995976"
                     /translation="MLRQSRLEAGFASSTTVSGRATFPGKSYCWRGQKLVPLAKCTAL
                     FRSQTQHLQSSARLLQGSGLHCRRSGFFGDARLRFWDKSGGHPGGTHLIDRRQRSPSY
                     APSSRYWRASGFRRFRSRVSMHREAESDQDISVEIDSASGDNAGNNHVGQHAPEQEAS
                     ANSMASWLQFVQKRRFPERLRIVVLCFLAFLINNIDRINLSVAILPMRHEFGWSSTTV
                     GIIQSAFFWGYLLTQLPGGYLADRYGGRSVLAFGVVSWSLMTFVTPMAARSSLPILLG
                     ARALLGVGEGVAMPAMNNLVSRWVPNQERSRALSLIYSGMYMGSVIGLLLCPLLMRNL
                     GWQSVFYVFGALGFVWYFLWERFTSGSSPKESKIIDPQELEYLRKQLGRRRNKETVPT
                     TVPARARVPWKLLLSHPATWAIMIGHFCCTWGYFLLLAWLPTYFNQALGFDLNASAFF
                     SILPWLTMFVGANVSGWIADYLLSTRKFTTTAVRKMMQTIGFLGPASFLALVSSTQDP
                     YSAVIYMAAALGLASFSQSGIYSNHGDIGPQYAGILLGMSNTLATVPGIVGVALTGWI
                     LDVTAGTWSIVFYTAIFFYLLGTVVYNAFGTGERVF"
     gene            <889460..>890899
                     /locus_tag="CYME_CMP355C"
                     /db_xref="GeneID:16995977"
     mRNA            <889460..>890899
                     /locus_tag="CYME_CMP355C"
                     /product="similar to J-type co-chaperone HSC20"
                     /transcript_id="XM_005537915.1"
                     /db_xref="GeneID:16995977"
     CDS             889460..890899
                     /locus_tag="CYME_CMP355C"
                     /codon_start=1
                     /product="similar to J-type co-chaperone HSC20"
                     /protein_id="XP_005537972.1"
                     /db_xref="GeneID:16995977"
                     /translation="MHSCIQRMMPRYDFTEAAAGLPRWLLLPHRARRSAGKALGARTS
                     KYACTRRSLESVFDSAHAPDAAMGDAGGDSATSASNCYASAPGMRRVRASCFVLDKID
                     TLRPRSAVAIAALLCPMRMFAGAVSRNAGRIAGGNGCTPARGLESAAFEGLPQEGSNA
                     AHDVSLDGHTCSSQISGRNANGRARLERVGRTPRGGILDLLRSETVRLHDWKAWTLPC
                     KQRQYGPRPLSRLARAMTSHGGSSQPEIRTGAVEANTCWSCNAPRTLPGESDPASVPM
                     KAFFCEHCGRIQPKPPVDVDFFTLFGLPRRFFLDEQLLESRFREWQRRLHPDRFNAEL
                     RRQQGFHSSAADPQAHYAEQASALVNAAHDTLKSPPARALYLLAEHGINFESDSEDAS
                     DQRDMDPEFLEEMLALREELDRAEQGHYDFEALRARIEGSQTRLCQELDEAFASSARN
                     EEGALRRCRDLTARLQFYHRIARALQERL"
     gene            <895610..>898519
                     /locus_tag="CYME_CMP356C"
                     /db_xref="GeneID:16995978"
     mRNA            <895610..>898519
                     /locus_tag="CYME_CMP356C"
                     /product="DNA replication licensing factor MCM4"
                     /transcript_id="XM_005537916.1"
                     /db_xref="GeneID:16995978"
     CDS             895610..898519
                     /locus_tag="CYME_CMP356C"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM4"
                     /protein_id="XP_005537973.1"
                     /db_xref="GeneID:16995978"
                     /translation="MAHSTDSFASSSPRDDRGEDPAGDNVPLSSVPATPAGATPRPPF
                     AERGMFSPPSSRGALSPDPSEQTGVSQFGQARYGRAVGGSASFAAEGEPGIGARSGSS
                     CPPTSPHFQRFSTVGRRELSRSFLGLPLTPRSSATGSPNIDRGLGSQTVGGGADPTRT
                     TSTDSIPVRVLWGTDLSVEEVYAKLLSFLKGFHPLRLSDENSLSRGDDSSTTATPAPL
                     YLKLLEELHETDSHTLNVSMKHVQEYDAVLHEKLVRYPSDMISLFDMAANQIYQQMFM
                     SDSSGVIGHIQVRVYDIGSAQSVRQLEPCHLDSLVAIRGMVVRTSSLIPDLADAFYRC
                     MNCLHTTVVPIRHGRVQEPSACSRCGLKSSYQLIHNRCCFTDKQVIRLQESPESVPQG
                     ETPASISLVLYEDMVDTMKPGDRVEVTGIYRAMPVRVHPRMRNVRSVFRTYLDVVHVK
                     HTDARRVMDVPEPGDVDALPLAEEVAGTTSTAMVPLIDLGGAGSAQMPAEPREVAADA
                     LEPAPLSDAPLRGMRDWEPRIRELARDPRVYERLAASIAPSIWGMDDVKKGVLCQLLG
                     GTRKDFVAAGGTRFRSEINVLIVGDPGVSKSQLLSFVHRISPRGIYTSGRGSSAVGLT
                     AYVTKDPETHDTVLESGALVLSDRGICCIDEFDKMSEQSRTILHEAMEQQTISIAKAG
                     IIATLNARTSVLAAANPIDSCYNPRLSVIENIQMPPTLLSRFDLVYLVLDKPSADDDR
                     RLARHIVSLFSEHEESAAGNAFHASEDLPLVELPLLAAYISYARENVHPVLSDDASDT
                     LISGYMEMRRMGAAYAAHGIPKTITATPRQLESLIRLSEAHAKVRLSPVVERADVEEA
                     LRLVRIATQQAATDPLTGRIDLDLLQTGHSAAWRQRVNELARAIWNILQERESSIVLR
                     KQAILHLLRQQAAQVGTTSADETVREDEFEEALHLLQNEQKIRLVQHGSAVARCF"
     misc_feature    complement(898613..901586)
                     /note="repetitive element"
     gene            <902164..>904479
                     /locus_tag="CYME_CMP358C"
                     /db_xref="GeneID:16995979"
     mRNA            <902164..>904479
                     /locus_tag="CYME_CMP358C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005537917.1"
                     /db_xref="GeneID:16995979"
     CDS             902164..904479
                     /locus_tag="CYME_CMP358C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005537974.1"
                     /db_xref="GeneID:16995979"
                     /translation="MKGGLRRSSLRRVLWLRVLVVCLWFSARIRVLVGAGAPAYPVRW
                     SWIGGETSVNNYGKYGTLNVASSNNVPGGRHYSSTWVGSPGVLYLFGGFGYANSSGGY
                     LNDLWRLNVTSLEWAWIGGSLDIYVPGNYGTLGVGSALNIPGAREASAFWRADEEHFW
                     LFGGYGLDGNGNIGCLNDMWQYDTVSGNWTWVDGNDTINALPTYGPMGSYDPSYNPGA
                     RLKAAFWLGADGNFWLFGGENCYSYLFSDLWCFNRSLSLWAYMGGSQSVNQPGNYSEP
                     DIANRSNAPGARQGAITWTDSKANLWMFGGFGYGNGSESYPGFLNDLWFYNISTSIWT
                     FVAGNTTISIPGSYIIFGNTDAASYPGSRESGVGFIDASGNLQLFGGEGYGNSSSESG
                     DLNDLWLFNVEQRQWAWINGSAVINAPADYGMFRTFSPSVVPGARYGSALWNTTESGM
                     ILFGGFGYSNTSEGKGELNDIFMLSESMITPSPTPTPTPTPTPTPTSTSTPTATPTAS
                     ATPSLSATPSTTANVTKIPINGGTTICFPEDATVLIDRLGSIRPMSELRSGMSVIGAD
                     RSGQLLEDTILGWLHKEPGATAEVLLIKTLSGKQLRLTRQHLVYRMHASMRVRGFGMI
                     PFSDLLRHQQTRRQRPELESLALEAVFAEHIRIGDALLDAAAHRADPVVAIDTYVTRE
                     GVYAPLTRSGRLVVDGLLVSCYGTYASHEVAHAVLWPARVDVLRTMWGSALGSDSTAS
                     IMPYAERLYRIYASAAQILGKARVIVVGAAC"
CONTIG      join(AP006498.2:1..908485)
//
DBGET integrated database retrieval system