GenomeNet

Database: RefSeq
Entry: NC_010143
LinkDB: NC_010143
Original site: NC_010143 
LOCUS       NC_010143            1232258 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 17, complete
            genome.
ACCESSION   NC_010143
VERSION     NC_010143.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 1232258)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1232258)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006499.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1232258
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="17"
     misc_feature    1100..3383
                     /note="repetitive element"
     gene            <3848..>5545
                     /locus_tag="CYME_CMQ001C"
                     /db_xref="GeneID:16996627"
     mRNA            <3848..>5545
                     /locus_tag="CYME_CMQ001C"
                     /product="similar to dolichyl-phosphate-mannose:protein
                     mannosyltransferase"
                     /transcript_id="XM_005537918.1"
                     /db_xref="GeneID:16996627"
     CDS             3848..5545
                     /locus_tag="CYME_CMQ001C"
                     /codon_start=1
                     /product="similar to dolichyl-phosphate-mannose:protein
                     mannosyltransferase"
                     /protein_id="XP_005537975.1"
                     /db_xref="GeneID:16996627"
                     /translation="MAPAVKRRAADATAASLPASSPSTERVQAADLDVMHQGRTKVDT
                     PQHEHQGAHPQKQQASPLERLVLRSTAHVRANPDAWLTGALVLLGLWTRLYRIRWPPE
                     CVFDEVHFASFAHHYLNRTYFFDIHPPLAKLTLAAVAKLAGDVPNRDWYVDKVYPPDS
                     RYYAMRACAGVFGALLPPLGFRIARGMGMSRIAATSVGVFLLFDMLNLIEARHILTDS
                     QLIFYSALCIDAFVRLWRTPPASRARRWAAVRAGLASGAALSVKWTTLVVPGLFGLES
                     VAGAALAAEPLEWSTCAIVAATALLLYVALWYPHFRILIYNGPGGDFMSAEFQRTLIG
                     RDGYDPQARKPPFLKLVWQLNKEMLLANARILDEHQWQARWHTWPYVGRGLLYWNRWQ
                     EGTLDADGRPLRPHHAMQIYLIGNPLLFWMCLAAVLGTVAAMPFLLRLIRQRKKRGTS
                     TDAWERYLRLATFLLLGYALGILPYMPIQRSTFIYHYLPSLLFAELLFAHAVLDLPAL
                     PSVLQLPLAGIVWIVVFWCFWYFRAWVYGHIALTADDHEAMRWIKYTSSVGDNKGWH"
     gene            complement(<7042..>7557)
                     /locus_tag="CYME_CMQ002C"
                     /db_xref="GeneID:16996358"
     mRNA            complement(<7042..>7557)
                     /locus_tag="CYME_CMQ002C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537919.1"
                     /db_xref="GeneID:16996358"
     CDS             complement(7042..7557)
                     /locus_tag="CYME_CMQ002C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537976.1"
                     /db_xref="GeneID:16996358"
                     /translation="MAAPTSCSAGKGREASASCCLEVLPVDVAFVQLHAFSVVGERLA
                     SGAERTPLSQVLPRRWTPLHPASLQDRKQAWVLGQVLQRHRSSSALQGSRVGRPQAAI
                     VQLRASLDRSALAGMSLAQAGFLVIGAREPVLLDVGPLHQVDVTMLLTGVATVGGVLV
                     GLLIAFIISRQ"
     gene            complement(<8921..>9874)
                     /locus_tag="CYME_CMQ003C"
                     /db_xref="GeneID:16996339"
     mRNA            complement(<8921..>9874)
                     /locus_tag="CYME_CMQ003C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537920.1"
                     /db_xref="GeneID:16996339"
     CDS             complement(8921..9874)
                     /locus_tag="CYME_CMQ003C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537977.1"
                     /db_xref="GeneID:16996339"
                     /translation="MDELPEQVLVEFRAGRAYLDSGLVHSDGRKGCVRVVRAADGLVH
                     FQWLDRATRAIEEDLIVFPGDANWRRVHACRTGRMFVLGFASSDLQLFFWLQEPRCDA
                     DVRLAQRLRNALECRPLDDPAGLDHADEVRLSDAESRPGPGLSSQVPDGATRPSSAAL
                     GQSLVDALQRLGASAASDAVHAADDASRQPQARADDTPDLGALLRWGPALERLLREPG
                     LGPASAALCREYLPSSIDLESVLQSAAFRQQLEALSTALRRSRGDAGPLFAAFGIEPP
                     PAGDWRHDLEALLEALRLRAEESARSRSEGPAPESRHGGGR"
     gene            <11589..>12884
                     /locus_tag="CYME_CMQ004C"
                     /db_xref="GeneID:16996340"
     mRNA            <11589..>12884
                     /locus_tag="CYME_CMQ004C"
                     /product="similar to high-affinity iron permease"
                     /transcript_id="XM_005537921.1"
                     /db_xref="GeneID:16996340"
     CDS             11589..12884
                     /locus_tag="CYME_CMQ004C"
                     /codon_start=1
                     /product="similar to high-affinity iron permease"
                     /protein_id="XP_005537978.1"
                     /db_xref="GeneID:16996340"
                     /translation="MIFWMLSTAAHMRRDLEGGIARALSRRGRWGVALLVFTSVLREG
                     VELIVFLFGITGGVSWSSIPIAAAVGVAVALVVAWAIYRGALAFDLRLFFALSSLLLI
                     AFAAGFLSTAFLDLQKANLFGAFTRNGNEDESIPSTQRPWWNAALWSTEACCADDGNE
                     FFNLLHELFGYVDAPTFVSTVVYFGYWTLAGVLWIIVERRTLERKLCQMHTGYLVSTA
                     FLAVAAVVGLVVAARSPTWNGILVTCLTLVLAIIGVGAASAPHAALPPRARFALQGSC
                     WIGLVLVACLALALQVAQAICSPQIGASQYCSISDFYYWFVIFSPDWIAKTRDDNSFH
                     ALAVLTVSICFTMLFCLGQGLVGFYEWKRSALAMQRAGQAPAALAKEANTSSDLEGGK
                     STPLDDSSIDELTWEALDSTQPPQHASQIEISARRVLAD"
     gene            <13549..>14463
                     /locus_tag="CYME_CMQ005C"
                     /db_xref="GeneID:16996341"
     mRNA            <13549..>14463
                     /locus_tag="CYME_CMQ005C"
                     /product="similar to dTDP-4-dehydrorhamnose reductase"
                     /transcript_id="XM_005537922.1"
                     /db_xref="GeneID:16996341"
     CDS             13549..14463
                     /locus_tag="CYME_CMQ005C"
                     /codon_start=1
                     /product="similar to dTDP-4-dehydrorhamnose reductase"
                     /protein_id="XP_005537979.1"
                     /db_xref="GeneID:16996341"
                     /translation="MPDESAQVRFLIVGRTGWIANMVAELLEQRGERYAFASFRLEQR
                     EACELELDALRPQRVLNCAGVTGRPNVDWCEDHRRETVRSNVLGVLNLADCCASRGIH
                     LTNFATGCLYHYDDGEHRPTAEGGRPFTEDDPPNFFGSYYSRTKAMVEELLRSAFDNV
                     LILRLRMPVSDDLSPRSFVAKIARYEKVVNIPNSMTVLTELLPVALDMSERGLTGVYN
                     FTNPGSISHNEVLELYRKYIDPKFQWKNFTLEEQAKILKAGRSNCELDVRKLLRDNPG
                     AQIREVHAAMEEVFRRMQAKGVKPLAAP"
     gene            complement(14279..18380)
                     /locus_tag="CYME_CMQ007T"
                     /db_xref="GeneID:16996354"
     misc_RNA        complement(14279..18380)
                     /locus_tag="CYME_CMQ007T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461540.1"
                     /db_xref="GeneID:16996354"
     gene            <15674..>16804
                     /locus_tag="CYME_CMQ006C"
                     /db_xref="GeneID:16996381"
     mRNA            <15674..>16804
                     /locus_tag="CYME_CMQ006C"
                     /product="dTDP-glucose 4,6-dehydratase"
                     /transcript_id="XM_005537923.1"
                     /db_xref="GeneID:16996381"
     CDS             15674..16804
                     /locus_tag="CYME_CMQ006C"
                     /codon_start=1
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="XP_005537980.1"
                     /db_xref="GeneID:16996381"
                     /translation="MSSQSTALSNGAKSVTGGQPDGNSDARVVYGDRLRFVPRNILVT
                     GGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIRGDIRSHD
                     LVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGKVRRFI
                     HVSTDEVYGGESNMETESSILAPTNPYACSKAAAEFICRGYVKSFGLPVIITRGNNVY
                     GPHQFPDKLIPKSICLLAQRRPCFVHGSGEHARNFLYVEDAASAFDTILHCGETDEVY
                     NVGSEIEKRNIDVVHDIIDLFGLSAEANRHIEFVKDRTLNDMRYRIDSSKLHALGWRP
                     QVSWEEGLRRTKTWYCDPNNLKRWPNYLSGLVPHPSLTEEKH"
     gene            <17302..>17946
                     /locus_tag="CYME_CMQ008C"
                     /db_xref="GeneID:16996355"
     mRNA            <17302..>17946
                     /locus_tag="CYME_CMQ008C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537924.1"
                     /db_xref="GeneID:16996355"
     CDS             17302..17946
                     /locus_tag="CYME_CMQ008C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537981.1"
                     /db_xref="GeneID:16996355"
                     /translation="MPRGLQRYAFVEFASGSALLRVRRVKRSASRTSRTPARCAVSEP
                     SPASPSSGDQPTQTVRVRPDERPLRLNALQRWLLGRLRRSLERLSPGNVPNLLRSAVA
                     RARGAPADPPPLDDDYLDSVLLPESDERPFISPALRRVLRDAPAQPAKGVYTSDPSRT
                     FWEQLILWAGVVLVALAVLRVLWLFISAILGISLSLIVIAVVTVFVFVAFTILG"
     gene            complement(<17961..>20957)
                     /locus_tag="CYME_CMQ009C"
                     /db_xref="GeneID:16996382"
     mRNA            complement(<17961..>20957)
                     /locus_tag="CYME_CMQ009C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537925.1"
                     /db_xref="GeneID:16996382"
     CDS             complement(17961..20957)
                     /locus_tag="CYME_CMQ009C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537982.1"
                     /db_xref="GeneID:16996382"
                     /translation="MPQACLREPEAPRTWAAVAKATQTQPAHKRRCRMRKRGEQAAST
                     RVLSLDAIWAPKLLEKWPSSAHTDPAGPGIVLASGLRSAAEVSGSPEQSGPVGETRQH
                     GAQPRPRGTVRTATRLGSYKRHRLVAAGSLDSQAKRHSGYTSTESEAQRCFDNETGNS
                     FEKSAPSERHCGVSCSGTTENDTCRSESLLRHIPKDTNDERCSIIEKAGSGMIVQPAR
                     KQPMCGHSGRISRHQCADDNRNGIGRNEYLKSAAQTLPSTPFSSANDSLDAGNVKSAL
                     NTNAASLCASCTGSLLFRQYAVSDGYASSAESLSLSSEEHTRVAGDVQVPEHTQCRDK
                     HRTRQAADEPAETSCLQHNLSSSMAETTNEHELSWADPYHRLDHGTSERRVSSTIREL
                     GNPRVHCQSPVEDVESPGALPHRDGKLLDSSWGRSGLATCTRTDAFREQCIELQRRVE
                     SPMQPDLATASDRHVSRVALSGTDMRCKTKHAPASSEVWSADVPHWTAATPTAICEPR
                     IQRDKRHSDERVSPVSIRSQGQHTSTKATDVSIAFRARRAGLASSLRILVARSAHADA
                     RIVPAALRRCVPITADRARRFDPCARLEDRCDSGGVEVVTATACPLCVLNIAAQQMCD
                     TPRDQHMRAMGALHVTLRRLGCMALARSPLGLLGWCDVCALDEPVHSKRASSSRVSTQ
                     CPAYRHAHRLKRVLTLPGAFVHQLLETAAAAVTTQNPAAEPALTQTRSTLEPFWHLLK
                     RNLRAAAWNDEQLLAFIDDVLAIYTCQAAMARHWRTQLAEVIGIAADRVSADAAIACW
                     CRCVRDDVPHCRLCGHDHLTRCWLPALVALIWVIPPRGRSRWLQKCLCARLLESWVSR
                     RTELQVEAQESAVARIDDGASEADAGHASVMLLARVAGALCLPRYEAGRTSGRASDAS
                     DLEWMVDAMHLLLLDWNVVPDIAAAIHSMRRHVLQQLRTVLAAWTQVARTVPEPRGYR
                     LRTQLHLLRRQLCDEPVDVFGSGTVP"
     gene            complement(<21360..>22085)
                     /locus_tag="CYME_CMQ010C"
                     /db_xref="GeneID:16996383"
     mRNA            complement(<21360..>22085)
                     /locus_tag="CYME_CMQ010C"
                     /product="probable V-type ATPase V1 subunit E"
                     /transcript_id="XM_005537926.1"
                     /db_xref="GeneID:16996383"
     CDS             complement(21360..22085)
                     /locus_tag="CYME_CMQ010C"
                     /codon_start=1
                     /product="probable V-type ATPase V1 subunit E"
                     /protein_id="XP_005537983.1"
                     /db_xref="GeneID:16996383"
                     /translation="MNDAQVQQQVQQMVAFIRQEADEKVNELRTKAEEEFHLRKLSLF
                     EEQRERIRAEFERKYKQLQASRRIALASALNAARLQVLRAREATLRELYECSRERLAA
                     FGTEAGPDYQELLERLIEQGMKMVQPEPRVSLILRSRDRALVENSLAGLQARYRQLLE
                     NSEATTPASEQASCVSISNTEQLDNSSPGGVIVTSADGRIRCDNTLERRLEIAYQQNL
                     ATLRDLLYGDSGTLSAFEEDLSL"
     gene            <22786..>25266
                     /locus_tag="CYME_CMQ011C"
                     /db_xref="GeneID:16996384"
     mRNA            <22786..>25266
                     /locus_tag="CYME_CMQ011C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537927.1"
                     /db_xref="GeneID:16996384"
     CDS             22786..25266
                     /locus_tag="CYME_CMQ011C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537984.1"
                     /db_xref="GeneID:16996384"
                     /translation="MTTLDTVLGGQWEPLEKTLSRLETAIQRAASLDWQQVRSELASA
                     VARAGEQSIPDALRLRVWRLALEWPQSHGTALVQPAEDLTHEASAAETPAATLIEAQE
                     SIEERFAPSDVNTLSIALLGETAGNGADLIDSPTDAHRFDTLWTDTVVAGESRPKASE
                     TPATRKNDAPYAAVDESESTARGASSDTAREAAPGKGPVSAGMPSTLENDVYDVLEQD
                     VLRTRRGTTVFERAAARTLLTQWLCTFCETHGVPYMQGMNEVAAVFVYLHETQHSPVA
                     DCTCYALYERFEERFVPLTADLGPDPFRCLKLAFELLTALLWFHDPELAVRLERYQLT
                     PDMFSTSWLVTVFARNLSLDAVLALWDALVLAGDPLLTIFVALVCLESNRQSLLMASE
                     ASLPEQLLSIPLQSRQDIEAAWQWARKLESRTPAEALRRSRNVMFGPSPVPAEGTAFR
                     EVTIVVAFEPHEVIASLEKPCNDGTRAPLPALLLDCRPSDERQYGYLPEAIPLDLDEL
                     RDAVVHGWEPCLDRFREDVFAQRIVQHVLERFGASHDGKIWICLVGSGPPTYFDVDEN
                     AFDVLPLKRILEYQGVHYVASLRHGFAACEALAKRGSLALAHYDAAALAQARQAKCAR
                     LAGVRPPGPVAPPHVTSRIAPPGSHPEECLDRQVSQTLGMVSLQAIDSTLLGTSALHG
                     WLDGTQLMLAKHTPLDIGSPALLRRLTLYPCLKLQRKSGVFVNRYLGITRCRFFVLAP
                     DRARNTLMYVKSSRHLLLLKRILFRKESRELVIFEFRAPDSQLIDKRITCHLADGLSD
                     CVESIRRRLRQLRLESRLGSRAARDTAT"
     gene            complement(<26270..>27241)
                     /locus_tag="CYME_CMQ012C"
                     /db_xref="GeneID:16996362"
     mRNA            complement(<26270..>27241)
                     /locus_tag="CYME_CMQ012C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537928.1"
                     /db_xref="GeneID:16996362"
     CDS             complement(26270..27241)
                     /locus_tag="CYME_CMQ012C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537985.1"
                     /db_xref="GeneID:16996362"
                     /translation="MNMKLFWILGANPDIVPNGSRVPWARRARSSSEHQVPSGRLRRS
                     VRSQTAVHPLDRRIARTGGVLSLHMGRRYAKIMARKQASELARVKLFARYGKRIVQTA
                     KAGGDVDAIVREAIERGVPKENVARALTKASASEQANFESAIYELFGPHGVGILVEAL
                     TDNLNRTAAEVRLVARKAGLQMASAGAVQHLFERKGCIRAFVSEEDAESSQFDPDSLL
                     LIVADAGADDLQHLAMDDTPMGRSEFLVWTPPGALAQVAQALTTAGVKLSTSELVMVP
                     KLIPPPVSEADRDLIHAGVEALQAIDDVDQVYTTLDPRPCDADTSSS"
     gene            <27449..>29323
                     /locus_tag="CYME_CMQ013C"
                     /db_xref="GeneID:16996363"
     mRNA            <27449..>29323
                     /locus_tag="CYME_CMQ013C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537929.1"
                     /db_xref="GeneID:16996363"
     CDS             27449..29323
                     /locus_tag="CYME_CMQ013C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537986.1"
                     /db_xref="GeneID:16996363"
                     /translation="MFCITSTFTSPVHSSRAGGSVYACKLRRKSLRKHVLTQPWPQTL
                     RLCAAGSVGDDSASESGVEPGMPPEKAQVTSSATDPELERLRLAVERAKLEAERARLQ
                     AEKARLEAEKAKIEAEKQRLAKEKEKEKAALAAKGTAAVASGIAQPAANTDATAGAQQ
                     SGTRSPTNDAGGKQPERGSAPLNNTDPALRRAIESGMLDERSMALLSQMGSFVLGGGI
                     SDDDLKLLQEKVLTFDTFMANQITRTPIGVVIRGRLRVQNPSEAYQRLEMALANTGLN
                     QRLRLFLMEDPRSPFLTDDELLVDSADESARLRSPPIIVVMPITSEPAGIGIWQYLLA
                     SVLGVTALFTTFGYGVGVFGLSPDFAQQIARGNIDVVSETLPVSIGAVGILVAHELGH
                     RIAGAVRGVKQGLSFVIPSLQIGYYGCVTPLKSFPRNRSSLFDVAVAGPVAGLVSSVV
                     ALLAGLVLTVQQGSTPLDWFPQIPSALFDASLFIGTLGKAILPQSALSQPTIAVHPLF
                     VVGYTGLLSQALQLLPIGRTDGGRMVQAAFGRRIAGRVSGITLLLQALASVLGNSPLL
                     LFYGLVVIFLQREQELPCLDEVSEPDNARRVTTFVLLLITMLILLPFPSQFGDITGQF
                     "
     gene            complement(<30971..>32056)
                     /locus_tag="CYME_CMQ014C"
                     /db_xref="GeneID:16996364"
     mRNA            complement(<30971..>32056)
                     /locus_tag="CYME_CMQ014C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537930.1"
                     /db_xref="GeneID:16996364"
     CDS             complement(30971..32056)
                     /locus_tag="CYME_CMQ014C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537987.1"
                     /db_xref="GeneID:16996364"
                     /translation="MIRASSEDVAVSLEDLRLRFFCFLRTRGYEPRAAALVADVFVFC
                     CIDGNSELVYRSLEALQVSRICDETPESDRLHSLECELRELANCIADPPSALPPTPSL
                     RFVRAHKLVASLEGRGTDMTLVLSVATRTCLDRVAAHGIALVSAFGTSCAALGSLGYF
                     ARWIALNGYVAVLVCGSSALQGRYSRMRVIWGVPRAPAGSEPLIWDCYWDDHCVNLES
                     LSSMTVDVGLGIWPFMEFLIGPLVGTGPSTLKSAEQDRESSMLTPWGALIVALDRRLL
                     LPLNFASSVGSQGAGGTDELMHIFERGGTMDPRANVMRKAMERAETRAHCLEASSASL
                     PSYLWSFLTDAADEAAASSTSGPDEGG"
     misc_feature    32575..35536
                     /note="repetitive element"
     gene            <35535..>37271
                     /locus_tag="CYME_CMQ016C"
                     /db_xref="GeneID:16996365"
     mRNA            <35535..>37271
                     /locus_tag="CYME_CMQ016C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537931.1"
                     /db_xref="GeneID:16996365"
     CDS             35535..37271
                     /locus_tag="CYME_CMQ016C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537988.1"
                     /db_xref="GeneID:16996365"
                     /translation="MRRTLRQFSLTMTQVVKRSDAETESSLGAYERERLARMERNRML
                     MEKLGVTSLSNRLETITTVREQALKPIGYSKRTPKAEKRARNSENEVDRGELEPRRRS
                     LRVRGIAPAGAGTSAEEPKNSQLQLKEEETSRGPFLEDQTFAEVALENYGATSESSMV
                     NDDYDRSDVDDVDGNKDDGDQKSLCTRRARLFQRAWCGAMACTSLSTSEHLAKDPSRF
                     HRWVLDEASGFFKLVPARIYSATMHPRLDAWTMMVGDKAGHVGLAVVPRERVAEHAVQ
                     VLCMRVHRDTTAGMAPRAGSANSQQLLTVSYDGSARLLDIEKQTIQTVLVDERERIFK
                     SIALSTENDNVFWTTASHRSLGGFLVRHDLRQSQKSFDAFGISDSRVYSVSLQHQGAA
                     GAVPGHDGLLAVTTARDGVLIFDQRRIETGATRRSTSKPLFALPHERATTAATWSPSA
                     TRLLTTCYDDLLRIWHYDGSECSLEHRFVHNNHTGRWVTPFEACWDPATDHKIFACGS
                     MNHNPVHGVDLFHVELNKRSVWNRLTGEPMTAIAAVLAWHPAGHALIGGTASGRVYLW
                     GEAHGSEGVLAA"
     gene            complement(<38966..>40357)
                     /locus_tag="CYME_CMQ017C"
                     /db_xref="GeneID:16996366"
     mRNA            complement(<38966..>40357)
                     /locus_tag="CYME_CMQ017C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537932.1"
                     /db_xref="GeneID:16996366"
     CDS             complement(38966..40357)
                     /locus_tag="CYME_CMQ017C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537989.1"
                     /db_xref="GeneID:16996366"
                     /translation="MWVVIPRGNCQKCSLAQACNKIGSRCRLRALHALRVSRCGLWGD
                     LESRATLPAAALALSDLKQKQIFPGVLKKGRSFGSCGLTEVEKDSSTTSAWSECSAGE
                     SCEAAARLEALLRVPFVALGLDISTQNTGYAYVSSASQINHLIALGQVSTTRTTGTYA
                     KVAQICDQVSAAAPVAAAHERLQQEDTAGCPFVIGVEAYMRCYTPGRFRTNSLFRLAE
                     LNTLIAYEMSRRLGCVHEPLSIHPSEARGWFGLTGRALYSDAASDEHSVKAVVLERVR
                     PWLERSSRPLSPGVALPDAQAAGHDTRGSVELTSDSIGYDESDAFVIAHYTMVLEQER
                     RALADPALYFAFVSEYGPLILARAKAPEVIADVHLLAKEWRRREQEYAAATGSPGVDP
                     GPLSPTRKRGRLTSKAPLTLPEFSRWIARSRLRRTYGARFMERIEKARRTWIRDTIRM
                     HWGLQSVVSELPT"
     gene            complement(<41089..>43365)
                     /locus_tag="CYME_CMQ018C"
                     /db_xref="GeneID:16996367"
     mRNA            complement(<41089..>43365)
                     /locus_tag="CYME_CMQ018C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537933.1"
                     /db_xref="GeneID:16996367"
     CDS             complement(41089..43365)
                     /locus_tag="CYME_CMQ018C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005537990.1"
                     /db_xref="GeneID:16996367"
                     /translation="MTAWVAVVQPCITANPQQVVVWVASLPCIENGVSARLALHYVVV
                     HLSTTDERDERFDRAVLNRQQKEADGVALEESALLSFSEATANGSASSAPCAHAVGVH
                     CLLSAGWVRWCGLYRHGVQVSTDEGQTCWILLPFTDDDAFEGEHLQRTTYVAASKVSP
                     LWRVQATTSDSLLVSSCIQVIRTPATGAKSWNYRVVVEGALFVAHAGIVGSGTKRSLQ
                     QPQQQQRTRAAHLEPGVHESGDADVDAHERGLAPSEAAAALETPARRAASQENGSGAG
                     VFLQQLQHRLEAEIEAWIDSKRSLMLKEAVARRAAAWVATMDRREMERMRAALDIDSS
                     STLDSTATMPDGHAPGQCDSIPETAQMIPMCPASELDMFHETRVIDASSASMNAEQSD
                     VTDIMLDSERAPCTVSGTASMAKRPRASPRTLTEEAAESRDGERPGATSPRYRKIPCV
                     DILRQKLLWSLDWWHALLVVRDWRDAREPLTALANSRRLRLVLSTPQRNLDAFVRCYT
                     PAVGPASVDHLFSVAAPAHQVSGHLIICGLVSDVPTVRCHSVQSIRVPETMLDHDKTH
                     SDGASHSDRFAPPDTVFEMVVVYPPGARYAERNLCHWWRRLRDDGRVVHSEHVAVEAI
                     VEPDLALLVLRPRIHPPESGLTLPGTQRTFGALLREVAARIRNSLPAGGHVLAQGQVT
                     TCLQLLDALELQIQMHVRNALQSQASSTEPKTDACIAGFEERDFACSGSQKMIDIDRL
                     IALLEETLARTRLSADRA"
     gene            <43633..>44610
                     /locus_tag="CYME_CMQ019C"
                     /db_xref="GeneID:16996368"
     mRNA            <43633..>44610
                     /locus_tag="CYME_CMQ019C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537934.1"
                     /db_xref="GeneID:16996368"
     CDS             43633..44610
                     /locus_tag="CYME_CMQ019C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537991.1"
                     /db_xref="GeneID:16996368"
                     /translation="MLPPASPDECRVLDEFERLLVETRPSGSSTLAEAEAEQSPDAEQ
                     RTAPCPDDDWEHTIEAVLGQLQQTGVAEKLPLGVGDEDVHRPADSSARAESTEQREDE
                     RADAELDAALTQFVTELGAVPGPTAAGTGGKASTSNGTGASEANYAAGNEVESLISNL
                     VQTILSKDVLYAPMLEIRGLYEYYLNKEECTAGTDGEAHLAQADLERYQAQYTCVNEI
                     ITCLEDESLSPGKQTEMLMDLIARMESMGDPPPGVLETMNVARERQSHEAALDQSRTD
                     NNADPEQVMAILEKLLQEVAESPSDASAMAKLQRALQDAPPTSSDCRQQ"
     gene            complement(<45533..>46009)
                     /locus_tag="CYME_CMQ020C"
                     /db_xref="GeneID:16996369"
     mRNA            complement(<45533..>46009)
                     /locus_tag="CYME_CMQ020C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537935.1"
                     /db_xref="GeneID:16996369"
     CDS             complement(45533..46009)
                     /locus_tag="CYME_CMQ020C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005537992.1"
                     /db_xref="GeneID:16996369"
                     /translation="MQSGHGETRFDVGVEWLRAKGSWTFYIMLLASFRIFFGLGLSLS
                     PMESWTIMNVVHAGVTFIVFHWIKGNPFHTPWVDMMGKGEKQTWWEQIDGSVQNTPSR
                     KFLICVVVFLYLAAVHSTPFERQFFFVHAVNLIAFLVVFVAKLPFMHGVRIFGINR"
     gene            <47257..>48996
                     /locus_tag="CYME_CMQ021C"
                     /db_xref="GeneID:16996370"
     mRNA            <47257..>48996
                     /locus_tag="CYME_CMQ021C"
                     /product="glutamate 5-kinase"
                     /transcript_id="XM_005537936.1"
                     /db_xref="GeneID:16996370"
     CDS             47257..48996
                     /locus_tag="CYME_CMQ021C"
                     /codon_start=1
                     /product="glutamate 5-kinase"
                     /protein_id="XP_005537993.1"
                     /db_xref="GeneID:16996370"
                     /translation="MEYSSAHSERGTTVTHVHSSAKPVTSTGSVQRGTPSRSTPLTTP
                     VPPAAVAAHQQTLTGVTSGLGSSTLSHPGTQPTAAVTVQGVSPGSHLGATQRVAAAVQ
                     VGSPVVHVGSVGSTSTGKSPITGEKLVAASLDALSDLGRDVAPHATPTVPAGGDLDAP
                     CVVIKIGTSTIMRYDSEGEAGELALSTLGKLVDSIVALRRLNHNVVLVTSGAVGVGCR
                     ELGLRKRPDSLRTKQAMAAIGQCKLMRVYDDLFRFSGQTIAQILLTRENLSQKHQYFN
                     ARNTMRELLRLGVVPIVNENDTVATEELRFGDNDRLSSLVAGMVEAKWLFLLTDVDKL
                     YTADPRQHPGAEPIDIVHDMEQLHVRLSANEDAVSSEQEQRAESDTHAAHGPKSQLQG
                     GQVPRGGTQWGSGGMATKIVAAQLATAAGVHVCIMHGRRPEGILERVLDKKGSSRIGT
                     VFLASREPIRGGRKRWIAHGLAPKGKLYVDDGACRAVARHNSLFAAGIREVDGDFEAD
                     TAVSIVRQSDGLEVGRGLTNYSSDEIRRIIGLHSKEIRRVLGYPGPDEVIHRDNLVDL
                     LGTISSSDADETD"
     gene            <50878..>51696
                     /locus_tag="CYME_CMQ022C"
                     /db_xref="GeneID:16996371"
     mRNA            <50878..>51696
                     /locus_tag="CYME_CMQ022C"
                     /product="probable peptidyl-tRNA hydrolase"
                     /transcript_id="XM_005537937.1"
                     /db_xref="GeneID:16996371"
     CDS             50878..51696
                     /locus_tag="CYME_CMQ022C"
                     /codon_start=1
                     /product="probable peptidyl-tRNA hydrolase"
                     /protein_id="XP_005537994.1"
                     /db_xref="GeneID:16996371"
                     /translation="MFLVLAVAFIGRKRWPLARQEVRFRPVRARHRNWSSAAPRTTPQ
                     VACTATASTNGSAPNEHRDRLVLVGLGNPGPKYEKTRHNAGFLAADAVARAYRAPAFR
                     LNESWQALHTHIDIGRQVHILKPITYMNLSGQALRSFLRDTFGTGFERETEWSTRLLV
                     LVDDTALPFGKLRLRLRGSDGGHNGLKSIAQALRSERYSRLRIGIGGDHRAGNGSAVD
                     YVLSDFSRAEWRTMEEQVLIDCVQVARHWIEHDDLAKVVQFCNAARSTMHMPPA"
     gene            complement(<52195..>53535)
                     /locus_tag="CYME_CMQ023C"
                     /db_xref="GeneID:16996385"
     mRNA            complement(<52195..>53535)
                     /locus_tag="CYME_CMQ023C"
                     /product="similar to lipoate-protein ligase A"
                     /transcript_id="XM_005537938.1"
                     /db_xref="GeneID:16996385"
     CDS             complement(52195..53535)
                     /locus_tag="CYME_CMQ023C"
                     /codon_start=1
                     /product="similar to lipoate-protein ligase A"
                     /protein_id="XP_005537995.1"
                     /db_xref="GeneID:16996385"
                     /translation="MTLRRAAAVLCSERTCVFENLALEEWLLRHALEKHHVSHVLLLY
                     RNSPSVVIGRNQNPWTESNLWLLAQLEAADGSISSGSTNALVQPFLARRFSGGGAVVH
                     DLGNLNFSFISPKSDFNRRGNVEWLANTLRGAFRDLHLEINQRNDILCDGFKVSGSAY
                     RLTGDVALHHGTLLIRSDLGRLRGLLTPTTRSESSGIAAAHRRHAVAKLAAETGQVGP
                     STRWYSPMSAGLRTTFADVRGTPSVRARVGNLIDMVPSMDVDRVAQLCVRQFRMDFDA
                     KVLSVAQVDWDAVREIADRLADPQWILGETPAFRVKVEGVSLCPDLHVEVELRARRKG
                     GWIDDIALSTAGSVRAAQTTLDAVQAALQEMLAAHCRLDGWAIRTSLRRWLRDHARDQ
                     SRPHRDYLRAIGEALADCLPPVQSWLENQRARARAAIACNHDAPSTSCARTDSL"
     gene            complement(<53967..>55439)
                     /locus_tag="CYME_CMQ024C"
                     /db_xref="GeneID:16996386"
     mRNA            complement(<53967..>55439)
                     /locus_tag="CYME_CMQ024C"
                     /product="glutamate-5-semialdehyde dehydrogenase"
                     /transcript_id="XM_005537939.1"
                     /db_xref="GeneID:16996386"
     CDS             complement(53967..55439)
                     /locus_tag="CYME_CMQ024C"
                     /codon_start=1
                     /product="glutamate-5-semialdehyde dehydrogenase"
                     /protein_id="XP_005537996.1"
                     /db_xref="GeneID:16996386"
                     /translation="MTTETESILQVAQQARQAALVCQTLSSQQKDRTLLAVREALAEQ
                     RAEILAANQSDLRQAEALCEQGKLDKVLLKRLDLSGSGKFDTLLAGIDQLRTLPDPVG
                     RVTLATELAADGLELYRVTCPIGVICVIFESRPDALVQIGTLGLKSANAVVLKGGREA
                     TATNQALTAAMRLGVERTLGARYANALQLVTTRAEIAELLKLDQYLDLVVPRGSQSLV
                     RYIKANTTVPVLGHADGLCACYIDKDADPDKAVRIVVDSKTQYPAACNALETLICHRL
                     AMERGVLEQVAQALWKQNVEIRADEDAFAHLQKVLVSTRNQDTKQKLLRRATAEDWDT
                     EFLDYILAVKIVESMDEAISHINEHGSHHTDCIITEDVNTAECFLAAVDAAGVYHNAS
                     TRFADGFRYGFGSEVGISTNRIHARGPVGLEGLVTYKYRLYGAGHTVAEFAAGSRQFT
                     HRAIPARWRPEWFALNQQQQQQQLQQQQQQQHASASDGKS"
     misc_feature    complement(55491..58732)
                     /note="repetitive element"
     gene            <59053..>59757
                     /locus_tag="CYME_CMQ026C"
                     /db_xref="GeneID:16996406"
     mRNA            <59053..>59757
                     /locus_tag="CYME_CMQ026C"
                     /product="ubiquitin carboxy-terminal hydrolase L3"
                     /transcript_id="XM_005537940.1"
                     /db_xref="GeneID:16996406"
     CDS             59053..59757
                     /locus_tag="CYME_CMQ026C"
                     /codon_start=1
                     /product="ubiquitin carboxy-terminal hydrolase L3"
                     /protein_id="XP_005537997.1"
                     /db_xref="GeneID:16996406"
                     /translation="MARVLGSVAAQPKWVPLESNPDLWNEYMYHLGVEGGRPAFVDVL
                     SLTEAVAQLPQPVHALVVCFPLGAREASSPVRTVGSDVCYYFCAQTVQNACGTMALLH
                     AVLNNCERASIQLRPSSVLEKLQAHARDFPNATPLERAEFLEGDEALAAAHDAYAAAG
                     QTTAPAPDTDTDLHFICLIRDRSGRRLLELDGRKHGPVDHGETNAETFVEDACRLIQN
                     KFVQRGPYLTVMALCG"
     misc_feature    complement(62605..64063)
                     /note="possible transcribed region"
     gene            <66220..>68844
                     /locus_tag="CYME_CMQ028C"
                     /db_xref="GeneID:16996408"
     mRNA            <66220..>68844
                     /locus_tag="CYME_CMQ028C"
                     /product="adaptor-related protein complex 3, delta
                     subunit"
                     /transcript_id="XM_005537941.1"
                     /db_xref="GeneID:16996408"
     CDS             66220..68844
                     /locus_tag="CYME_CMQ028C"
                     /codon_start=1
                     /product="adaptor-related protein complex 3, delta
                     subunit"
                     /protein_id="XP_005537998.1"
                     /db_xref="GeneID:16996408"
                     /translation="MNLFADPPLTAFVKALRSHQHEELSFVQKQLELLRSECEDRDPE
                     KKAWALLKLTHLNQHLLAGDLSFTAFPIVETATRSVLWQKQVGLLAASLLFHSQTPET
                     LLLANQLRKDLHSGNRNEQALALTGFAGFASADLAEALWPDVAALFTSARPYLRKRAV
                     VAFHRSVRQCPEVLPACWPRFVNLLQDADPSVVCASVTVALEEVHTYPELFIQVIPRF
                     YEIASQGGSNWLLIKVLMVLDALCAHEPRLPKKLASLVTSMIEATQAKSLVFECCRVA
                     CRRLADDGHLLCVAIARLIAFVEGTDQNLRYLALKVLRNVVEYRPSIISQKQLQGVLN
                     ELQNNDILVRLAALELLSSRVHTADDLRCLAQSMERMSLLEPAPGRAPNRDTSEELRF
                     RSMLFSELWRCIRRVFPDGSTDLAEADAAWLLVSIVRPALVRASQLDEKNVERFAVLL
                     WKLVQLHESLRGSAAAVCRQVLDRCLSESHDWIRYYGAIRVCVWILGTSLEGVNDSSR
                     AANDLERLTGLFQLFECVRTGDEELDSFAALQTTVLRTLRFCCEHLQADFSLQVRERL
                     QRIVLLSPSAFEEHWRLLGIQRDVQRRAGEITRRSAPHPGALQALLRSLPALSSHELS
                     ECWADPHDLPPPTPTPAIRRPRKHSESQGASRSGNNAEAALLLLDTVDANDVVRAPLT
                     ALPYRSAAPASATNESRGERDASSAHPLQASASAGFTTASDVWAAHRFASAPDDTSTD
                     ATGMEAAGASARSTTELEHLAFYLRDAPSAHAHARHAHAPAASVPSNQQAADALSIGA
                     SLQGNACTRHDAMQGARIAGTSDAPDDALLIDFCAPYAAIDGGDAPAGDDAPSTTGAD
                     NLGPGRCVATPEHTQAAV"
     gene            <69826..>71433
                     /locus_tag="CYME_CMQ029C"
                     /db_xref="GeneID:16996396"
     mRNA            <69826..>71433
                     /locus_tag="CYME_CMQ029C"
                     /product="arginine decarboxylase"
                     /transcript_id="XM_005537942.1"
                     /db_xref="GeneID:16996396"
     CDS             69826..71433
                     /locus_tag="CYME_CMQ029C"
                     /codon_start=1
                     /product="arginine decarboxylase"
                     /protein_id="XP_005537999.1"
                     /db_xref="GeneID:16996396"
                     /translation="MFLGAGLRVGHVSNKVIGRDRRQPYGFLRSVQGVVCACADNAGF
                     LRALQKCRTRIRASFCCPGHHGQPEKLWPPLREVLDRERHALVTLDLAEQPELDNLQQ
                     PTGILRAVQERAAAVFDTVHTFFLVNGSTSGILAALLAVCSQLGQDPSRFYALVPRNA
                     HQSVFHALALTGLHPVYLTPEVVDSRYDILGPVSESTIEAALVAFAPQVAVVLLTSPT
                     YHGFVANVRSIAARCRRYGAWLVVDEAHGAHLGFSPELPQSARQMGADLVVQSTHKTL
                     MALTQAAMLHVPCGSRLAVEDVAEAVRMVSSTSPNAWVVASLDATVAALADTPWCQAW
                     FERACTLGQAIRRRLPTLPNDDATRCCLLLPDDIDGFLFDAHLLDHYGVYMELAGRAT
                     STGIVTGANDASHVAILEEAFTALTTDSRLRGTRESRVHTLRPMDSLQGVFRAASCTL
                     RVSLHQRRRWCPLQHAANQVASATISVYPPGIPVVLPGERIDPPLVSYLLDASRCGCA
                     ISGVHGPEQHVAVVDDEPPATRCHQAP"
     gene            complement(<72559..>73638)
                     /locus_tag="CYME_CMQ030C"
                     /db_xref="GeneID:16996397"
     mRNA            complement(<72559..>73638)
                     /locus_tag="CYME_CMQ030C"
                     /product="galactose-1-phosphate uridylyltransferase"
                     /transcript_id="XM_005537943.1"
                     /db_xref="GeneID:16996397"
     CDS             complement(72559..73638)
                     /locus_tag="CYME_CMQ030C"
                     /codon_start=1
                     /product="galactose-1-phosphate uridylyltransferase"
                     /protein_id="XP_005538000.1"
                     /db_xref="GeneID:16996397"
                     /translation="MASFDFTEHPHRRFNPLKGEWVLCSPHRAKRPWQGAQETVGGEE
                     RPRYDPECYLCPGNTRAGGAHRNPQYDATFVFTNDFPALLLDGPSDSADAEASRASHA
                     TLFQARPVSGTCRVVCFSPRHDLTLAEMSRSEIRRVVDAWQEQYAELATMPQIRHVQI
                     FENKGSAMGCSNPHPHGQIWASSFIPNEIATELRLQSAYYADTGRELLLDYLKAELQR
                     PNERIVCQNPHFVALVPFWAVWPFEVMVLPTGSCQSLLDIDASQKDDLADILQRVTVR
                     YDNLFKTSFPYSMGLHQAPVANGAATAEPGLLFHIHFYPPLLRSATVRKFMVGFEMLA
                     ESQRDLTAEQAAERLRSLPEKHYRA"
     gene            <74740..>75213
                     /locus_tag="CYME_CMQ031C"
                     /db_xref="GeneID:16996398"
     mRNA            <74740..>75213
                     /locus_tag="CYME_CMQ031C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537944.1"
                     /db_xref="GeneID:16996398"
     CDS             74740..75213
                     /locus_tag="CYME_CMQ031C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538001.1"
                     /db_xref="GeneID:16996398"
                     /translation="MAFVLCAAKYGNRSSRRRCMRRSLNALHTRLAVAAHLKKLRWSE
                     FEDRAAYQPLPATWRGEFDSVSPLDEMSGGQVKPVKTQVFGQVYEEPVPLELRAEDDD
                     AFRRFQALMLADRAAELEALQQRRAAYGDDAGVMSNMRIETIYAQPCVEYWRGRS"
     gene            <76843..>77403
                     /locus_tag="CYME_CMQ032C"
                     /db_xref="GeneID:16996409"
     mRNA            <76843..>77403
                     /locus_tag="CYME_CMQ032C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537945.1"
                     /db_xref="GeneID:16996409"
     CDS             76843..77403
                     /locus_tag="CYME_CMQ032C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538002.1"
                     /db_xref="GeneID:16996409"
                     /translation="MKHFSCVWSFMFMVACWASICFAGGAAEPSLRSARVTNAFTLPV
                     EVRVTYGRYSASAQNASRQLTSATVVFPGDSAVFGEVFVQLREPAVVGALTGTGSSSC
                     VQVTLPIDSVLACAFPSNDTNIPYTYPDSCASASAPYGAENQKRGNFLVLPATAGGSS
                     GSAPVSVAYAGGEPAASALISETCSV"
     gene            complement(<78102..>79550)
                     /locus_tag="CYME_CMQ033C"
                     /db_xref="GeneID:16996410"
     mRNA            complement(<78102..>79550)
                     /locus_tag="CYME_CMQ033C"
                     /product="folylpolyglutamate synthase / dihydrofolate
                     synthase"
                     /transcript_id="XM_005537946.1"
                     /db_xref="GeneID:16996410"
     CDS             complement(78102..79550)
                     /locus_tag="CYME_CMQ033C"
                     /codon_start=1
                     /product="folylpolyglutamate synthase / dihydrofolate
                     synthase"
                     /protein_id="XP_005538003.1"
                     /db_xref="GeneID:16996410"
                     /translation="MAWRTASGVFTRGVDGTVSQRLRQLLTRLDELVNWERLQRANTG
                     QRQREMRVDVKPAKRLLDALGSPQHCYRAVHIAGTKGKGTLAAMLTAYLVKQKGFRVG
                     TYTSPHVERIQERVRLQGACIEDEALADALESALAAADPFLQDGVPVVERPTWFDVMT
                     AAGFLAMKTAGVEYAVIECGMGGAKDSTNVLGAEVCLLTSVALEHAEIIGPGLADIAR
                     EKAGIAWRPSCILISGVHQPELRQVIRETVEQLSPPAPRSVVFVDAASWEERNQLMAE
                     RAIKELAARYGWLQCEPPDWSLLQPQMKQMLPGRMEWFALHRGTLSVNVLVDGAHIPE
                     TVQRLPCGAWIVLAMGRDKRVEEFTEALMRFAPRAIICTRVGDDPSYMPADELHERAH
                     RVVANHAAAVSQTPVFKVALPEEALRRAVELAATAAGPEKPHSVVCIGSLHLAGIIRR
                     TLLRDWNTGSIPDSRTSAAEPPAGKPQAHIAL"
     misc_feature    79284..80727
                     /note="possible transcribed region"
     gene            complement(<79700..>81259)
                     /locus_tag="CYME_CMQ035C"
                     /db_xref="GeneID:16996387"
     mRNA            complement(<79700..>81259)
                     /locus_tag="CYME_CMQ035C"
                     /product="similar to exosome complex exonuclease RRP45"
                     /transcript_id="XM_005537947.1"
                     /db_xref="GeneID:16996387"
     CDS             complement(79700..81259)
                     /locus_tag="CYME_CMQ035C"
                     /codon_start=1
                     /product="similar to exosome complex exonuclease RRP45"
                     /protein_id="XP_005538004.1"
                     /db_xref="GeneID:16996387"
                     /translation="MRDEPYSSNELLFVLQSLPLRVDGRRPEEARRLRFQLVGESGVL
                     VFAGSSAITFATTTCRVVAPPPHRPTEGWIRVVYGISPGASERTLLEQSDAVSFSEEA
                     VFLERILRESRCIDPESLCIVAGKYAFQVTVQVCVESLDGSGLFYASLAALGSLQRFR
                     RPDFTIERHGYGDERVRLFSPRERPPVPLQLQVYPVILEYALFFDEHRGSQETCCVLD
                     PTQAEENACHARLRVVYDVKNERLLALRQLAGGMYTAVTTLSKLHHWVLRACDDARVA
                     WQMLSTRLRLNAQQQRPIEPPSWSVSDETPYGTGVKSARSSVDADLASGPTAAQGQLG
                     IPGRPKQPPYGERGHPGLCEGQERTEVDGEFAAEHLSSGKHTQQPLSPEVASPRHRSA
                     VLTPRVSPDIAPATITEQGSSSLMDLARTDPELSRFTSPLPWTDKRKSDTEACNVPVD
                     RDGILVESSAQVRASSASDMEYSISSAASEDNSTDEDRMQDLTQAARVPVLPPPPPPS
                     SRRPYHPKSSR"
     misc_feature    complement(85732..88529)
                     /note="repetitive element"
     gene            complement(88280..90394)
                     /locus_tag="CYME_CMQ037T"
                     /db_xref="GeneID:16996388"
     misc_RNA        complement(88280..90394)
                     /locus_tag="CYME_CMQ037T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461541.1"
                     /db_xref="GeneID:16996388"
     gene            <89942..>90568
                     /locus_tag="CYME_CMQ038C"
                     /db_xref="GeneID:16996389"
     mRNA            <89942..>90568
                     /locus_tag="CYME_CMQ038C"
                     /product="similar to ubiquitin conjugating enzyme E2"
                     /transcript_id="XM_005537948.1"
                     /db_xref="GeneID:16996389"
     CDS             89942..90568
                     /locus_tag="CYME_CMQ038C"
                     /codon_start=1
                     /product="similar to ubiquitin conjugating enzyme E2"
                     /protein_id="XP_005538005.1"
                     /db_xref="GeneID:16996389"
                     /translation="METRSAVSGKETTQITPSGRGATRAPEGRHASVGAAAARDATLV
                     FPEAPKRMSPMATRRLHKELSDWHLSGRTAESNPQPAIFLETPVTRLDEWFVSLRGVE
                     STLYAGEVYRLRFRFPSDYPIEAPEVVFLGNPPVHEHVYSNGHLCLSILYDNWSPALT
                     VNSVALSIQSMLSSATQKRRPPDNDAYVRNCRGRSPKHTRWLFHDDGV"
     gene            complement(<93717..>95228)
                     /locus_tag="CYME_CMQ039C"
                     /db_xref="GeneID:16996390"
     mRNA            complement(<93717..>95228)
                     /locus_tag="CYME_CMQ039C"
                     /product="MAP kinase"
                     /transcript_id="XM_005537949.1"
                     /db_xref="GeneID:16996390"
     CDS             complement(93717..95228)
                     /locus_tag="CYME_CMQ039C"
                     /codon_start=1
                     /product="MAP kinase"
                     /protein_id="XP_005538006.1"
                     /db_xref="GeneID:16996390"
                     /translation="MSQQRTPPPQGARTETTTVPNAAALGVAALSSQRYTFQCLVGRG
                     AYGEVYRARDTLSGRDVAIKHIRNVFEHPPEAIRVLRELKLLRLLRGHPNIVQILDVL
                     MPRDTLRFDDVFIILEYLPATLRRANAILYTNSQLTTAYRNRLVKKLLYDLLCGLQYM
                     HAAGIYHRDLKPDNLLVTNMPNTVRLCICDFGLARAAKLREPENLVLWTGYVETRWYR
                     APELLLCNYTHYSTAIDIWSAGCIFAEMLSGGRPLFIGKDGLDQLDLITRLLGKPDAH
                     SVREFRSPQVREYLRRMPERPPVDLGSLFPTAEPHAVDLLRQMLCVNPRLRLTAAEAL
                     SHPYFDDVDGGRAPSYTVPVWDAGDFGFENTRLDAERLRDLFRAEIRMHYHPGPSPQR
                     TAPLPTAETNTNAKCMESVSADQTTGDNTAYEWPSELDTALEQVQAKRIGFELRPFRS
                     LPKEKILQTASRIVQENKMEDEMCACVRTMSQRGLSRLGCEAAAGASRQAPTL"
     gene            <96519..>98690
                     /locus_tag="CYME_CMQ040C"
                     /db_xref="GeneID:16996404"
     mRNA            <96519..>98690
                     /locus_tag="CYME_CMQ040C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537950.1"
                     /db_xref="GeneID:16996404"
     CDS             96519..98690
                     /locus_tag="CYME_CMQ040C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538007.1"
                     /db_xref="GeneID:16996404"
                     /translation="MASEEAVLAGNCSSEQDASGTAVVACAESAASFDEQAAAAQQNQ
                     LLTAAAATDGSSARDEKHSTETEEALRASVASAPFQQCSSAGAMFPSAADELVERALH
                     DDRSLAALLNADGPVRWPSSEVVLHQVACSLERRYLLHPGTMYISKRYLCFQLTSSGS
                     SSFLEAAGASASSFLSFGYRSSPAANSGSAALAQAERRSVPEADGDAVCSARDCASSV
                     ASPRSASGNGTTVSPGSLAQQRASDSGSTTLWLIPFEAVTSVRKSSYLYLESALEVST
                     TFGLCNHTRHGGVFWTKPQEAVSGIKLLRFAAFSEPNRDVVYQYVMKAWMARLSLLAL
                     EGRLPLTMQTPSTQHALDNAGKPATQPGSENNMFIAGVSEVKNEPRTTKTNTAVTGGL
                     ALSNAVASQETLKTPDTSANGSVVESLSREDGAAVAVETPYDIDAGQVVLEIPAHITS
                     AQTADKVPEALLFELFFADTATLPKQLNEALGHTELQMSTWQLIEPASDAAVHAASAF
                     PSRHRTISYQVTVRRGILSFTGHCTESQSFRLTPPALRDAGYPYGALYEMSVITRDMP
                     SSDTFLVRQRIFFDMQQIDKVWRVRVRAVLGIQWLGRTVWRPFIERSVAAQSRHAFEQ
                     YSKLMDAEISKFRAREGAAQIQHHPHASKPEPIIAVMWVVLASRVRSLVQRTARAVEQ
                     ALVRLPPPLLARLFLTQTVLLMLCSGLCGYLLGQLSSRSLP"
     gene            complement(<99547..>100821)
                     /locus_tag="CYME_CMQ041C"
                     /db_xref="GeneID:16996405"
     mRNA            complement(<99547..>100821)
                     /locus_tag="CYME_CMQ041C"
                     /product="pseudouridylate synthase I"
                     /transcript_id="XM_005537951.1"
                     /db_xref="GeneID:16996405"
     CDS             complement(99547..100821)
                     /locus_tag="CYME_CMQ041C"
                     /codon_start=1
                     /product="pseudouridylate synthase I"
                     /protein_id="XP_005538008.1"
                     /db_xref="GeneID:16996405"
                     /translation="MKLQFHSASSDSKQVRFPAALGDLKKRPAWVTSVTRPQLQKKRL
                     LLVVHASRLGQFWRCLRERRCWLPGGSHLSPVACLAGEQPTRNAGSAPSTENLVRYRA
                     VVAYDGTDFHGFQRQAKSRATPTIQGRLEAALQQRLGGYPWHCQVVGAGRTDAGVHAR
                     GQVIHFDIPEQKAATSAFEPSRLEHALNRLLPRTIQVRAMEVSPPPAWYLVPSTRTYQ
                     LLPWHAIYRAQGKRYVYRLSAGAWIDPLYHRYAYTDYRQMQHWAVAQQMLQTFVGTHD
                     FGAFASSPPGKADRHQIQRSTVRTIRRISVEPSPVDSIVPVWKFEFELDGALYRMIRN
                     IMGTFLAVARGELDDALVVDALQQGSRGRALIAPRVKPAPAHGLCLERVYYADGYPVR
                     QDVTADAAHECTHTVSSGNRGAPLPPGADVLV"
     gene            complement(<103000..>104301)
                     /locus_tag="CYME_CMQ042C"
                     /db_xref="GeneID:16996425"
     mRNA            complement(<103000..>104301)
                     /locus_tag="CYME_CMQ042C"
                     /product="UDP-GlcNAc:dolichol phosphate
                     N-acetylglucosamine-1-phosphate transferase"
                     /transcript_id="XM_005537952.1"
                     /db_xref="GeneID:16996425"
     CDS             complement(103000..104301)
                     /locus_tag="CYME_CMQ042C"
                     /codon_start=1
                     /product="UDP-GlcNAc:dolichol phosphate
                     N-acetylglucosamine-1-phosphate transferase"
                     /protein_id="XP_005538009.1"
                     /db_xref="GeneID:16996425"
                     /translation="MSSTIKHPRCLRARIWNARYALALILAALGAVYVQLDAEARAHI
                     ALNWWSSAGVFLATLVLIPRFSPLFIKAGLYGRDLNKPPTKQEGADATQEQPLVPEAL
                     GLVAAAVYLCGLCFFHLFRGPEATPFYNAALASVTFMILLGFADDVLDLRWRDKMILP
                     SVAALPLLAAYTGSTTVIVPQPVRQWFGWLLTKVASFSYGKEWAKLWKLPVVVPRLVD
                     LGWIYKLYMLLLAVFCSNAINIHAGINGLEVGQAIVIGCAVALHNAAHLRGWFALPVA
                     DPERLRANHLFSLDLIVPFLATSAALFVHNWYPSAVFVGDTYCYFAGMCLAMAAILGH
                     YSETLLLFFVPQVFNFLYSLPQLLGIIRCPRHRLPRLNPKTRKLEGVPSHMNLLNLVL
                     LLCGPMTERQLCLVLMILQALCCALAYGLRMYVLRSVAWFA"
     misc_feature    103602..105062
                     /note="possible transcribed region"
     gene            <106471..>107832
                     /locus_tag="CYME_CMQ044C"
                     /db_xref="GeneID:16996427"
     mRNA            <106471..>107832
                     /locus_tag="CYME_CMQ044C"
                     /product="aurora kinase"
                     /transcript_id="XM_005537953.1"
                     /db_xref="GeneID:16996427"
     CDS             106471..107832
                     /locus_tag="CYME_CMQ044C"
                     /codon_start=1
                     /product="aurora kinase"
                     /protein_id="XP_005538010.1"
                     /db_xref="GeneID:16996427"
                     /translation="MQATPGLAVQAGTTPEVRKWKADNSRQLYSDAKASPEKLLERAW
                     LRLGRRDADALRETSTRATANASASAAELATRAPLSPVLSRVDSKDAKLHYTLQRSTS
                     KAVIYASEDPHRNSKNKAISKRQLVTEWTPDKRIAMQVPDERPRGTVTAATGPVSTAV
                     LRTPTASTPERRPWTLGDFEIGRPLGRGKFGNVYLAREKRTRYIVALKVLFKAQLQKA
                     GVEHQLRREIEIQSHLRHPNILRLFGYFHDDTRVFLILEYAGRGELYRELQRCGRFSE
                     RRTATYIAQLAHALEYCHRKHVIHRDIKPENLLLGIFGELKIADFGWSVHAPQSRRNT
                     LCGTLDYLPPEMVEGAPHDARVDIWSLGVLTYEFLVGNPPFEAQSHEETYRRIARVDL
                     RFPPSVSAGARDLIRKLLVRDPAERLPLDALLKHPWIQANAEFVPRIGELSLPPRMHA
                     AEQ"
     gene            complement(<108257..>109048)
                     /locus_tag="CYME_CMQ045C"
                     /db_xref="GeneID:16996428"
     mRNA            complement(<108257..>109048)
                     /locus_tag="CYME_CMQ045C"
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /transcript_id="XM_005537954.1"
                     /db_xref="GeneID:16996428"
     CDS             complement(108257..109048)
                     /locus_tag="CYME_CMQ045C"
                     /codon_start=1
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="XP_005538011.1"
                     /db_xref="GeneID:16996428"
                     /translation="MWCLAAQVRILPSAQTFSRLGARARFYSWFRPGIPNRTGPGFDA
                     GPTTAGADAAQAQLVPIVLEQTPRGERVYDIYSRLLRERIIVLNGPITDTVASLVVAQ
                     LLYLESVAPAKALSMYIHSPGGIISAGMAIYDTMQYISAPVHTVCLGQASSMASLLLC
                     AGEPGERRCLPNARVMIHQPSGQAGGQASDIAIHANEILFLRERLHELYAKHTGQNKH
                     VIADKMERDHFMSAEAAKAFGLIDEVIYKRDALKEDKREARSDER"
     gene            complement(109007..109139)
                     /locus_tag="CYME_CMQ046R"
                     /db_xref="GeneID:16996296"
     tRNA            complement(join(109007..109051,109103..109139))
                     /locus_tag="CYME_CMQ046R"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:16996296"
     gene            109262..111152
                     /locus_tag="CYME_CMQ047T"
                     /db_xref="GeneID:16996430"
     misc_RNA        109262..111152
                     /locus_tag="CYME_CMQ047T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461542.1"
                     /db_xref="GeneID:16996430"
     gene            complement(<109576..>111582)
                     /locus_tag="CYME_CMQ048C"
                     /db_xref="GeneID:16996231"
     mRNA            complement(<109576..>111582)
                     /locus_tag="CYME_CMQ048C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537955.1"
                     /db_xref="GeneID:16996231"
     CDS             complement(109576..111582)
                     /locus_tag="CYME_CMQ048C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538012.1"
                     /db_xref="GeneID:16996231"
                     /translation="MDNVCVAASTVAPDAERSCSSAFPEAWYRACRRVYIGMVIGSGA
                     ALAHWVAAERRGESIRALAHQTLLREYPEYGRIFGQGEAAATPGHALLRIKHWTKALV
                     SHWPTAPPRECWGQHARPVGAMVAAVLLALGGLAHWRWRATMGIWWRAILRRAVYVWC
                     KLRLIIVACWRFLELRTRALVHVAANSRASFWRHRCTEDSCAPRPAEDADPDTEAICE
                     GQRGSQSDSVLGLAGRPGSVCVRFADDSQAAPGHRGLPSGKSPEPDTRRSYALLRGSR
                     DVAQIGCRNLEMPSSKSEDVGSGKTITADAEPDAKASTAESRPAASASQITGEPVPRP
                     YEEQAEQVDHDSRRSASPSLSIETSGPRPANQRTATLRHEDCCRSSNKHQKQRDPIDT
                     SDEGAFQHKANTDSMEWDPPYARDFTNASSSSLDQLCASHSEVFGALASRLRSLLGDC
                     TDSDHARLLNEAASLLQRHASACGDASGEHTKLVASAFARVPPIDVIENLVTTLEGMM
                     LANAALRVEAAAVRREIAAGLVPSTGDDSASEDPSPCALAEHVHSAGESPAHEHPSPA
                     DTLLRSPVSADPEHSSRWRSPSESSSTLSDIENDMRCAERVTQKLEQQVALLTSANRS
                     RIATQHRESPLNKSSDSSALPAILVTVNGSLHALPRVTGRYVRD"
     gene            111912..115350
                     /locus_tag="CYME_CMQ049T"
                     /db_xref="GeneID:16996435"
     misc_RNA        111912..115350
                     /locus_tag="CYME_CMQ049T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461543.1"
                     /db_xref="GeneID:16996435"
     gene            complement(<114205..>115275)
                     /locus_tag="CYME_CMQ050C"
                     /db_xref="GeneID:16996436"
     mRNA            complement(<114205..>115275)
                     /locus_tag="CYME_CMQ050C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537956.1"
                     /db_xref="GeneID:16996436"
     CDS             complement(114205..115275)
                     /locus_tag="CYME_CMQ050C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538013.1"
                     /db_xref="GeneID:16996436"
                     /translation="MEPRVFTSQQRDLPIVRLNNRAMQSLRKTKVFKNVHQEQVCTLD
                     FSVDGEIVAAGGDDGLISVYSAVQGRLLTTIPVKRYGCGVIRFGNHKSAVLCASKPVL
                     DPGSGSLQARAPDNAPLSWDDHIRYLSLTESKYIRYFRGHRARVVSIAVTPNDDSFMS
                     AALDGTMRLWDIRYPHCAGVLQVRGRPAVAVDPSGLVAAVAFSDLLKLVIKLYDLRKW
                     DEGPFIDFESNVTTSEPTVLKFSGDGRSLLVGAAEPNPRIQILDAFNGCLQTLCRGHA
                     NDQAYELDACFSPDSQYVLSGSEDASIHIWERATGNPCHVLHGHSMYSRALGFNPQYA
                     LLVSACQNVVFWQPDPATLDYV"
     gene            <116030..>116344
                     /locus_tag="CYME_CMQ051C"
                     /db_xref="GeneID:16996437"
     mRNA            <116030..>116344
                     /locus_tag="CYME_CMQ051C"
                     /product="40S ribosomal protein S21"
                     /transcript_id="XM_005537957.1"
                     /db_xref="GeneID:16996437"
     CDS             116030..116344
                     /locus_tag="CYME_CMQ051C"
                     /codon_start=1
                     /product="40S ribosomal protein S21"
                     /protein_id="XP_005538014.1"
                     /db_xref="GeneID:16996437"
                     /translation="MQNASGRIVDLYVPRKCSVTNRLISAKDHASVQLNIAKVDPDTG
                     RMVPGEHLTVALTGSIRRLGLSDQAVFRLAKEKGALDDLRGGGAVGVGSGASGGAEER
                     TD"
     gene            complement(116234..118699)
                     /locus_tag="CYME_CMQ052T"
                     /db_xref="GeneID:16996438"
     misc_RNA        complement(116234..118699)
                     /locus_tag="CYME_CMQ052T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461544.1"
                     /db_xref="GeneID:16996438"
     gene            <117663..>118436
                     /locus_tag="CYME_CMQ053C"
                     /db_xref="GeneID:16996421"
     mRNA            <117663..>118436
                     /locus_tag="CYME_CMQ053C"
                     /product="5-amino-6-(5-phosphoribosylamino)uracil
                     reductase"
                     /transcript_id="XM_005537958.1"
                     /db_xref="GeneID:16996421"
     CDS             117663..118436
                     /locus_tag="CYME_CMQ053C"
                     /codon_start=1
                     /product="5-amino-6-(5-phosphoribosylamino)uracil
                     reductase"
                     /protein_id="XP_005538015.1"
                     /db_xref="GeneID:16996421"
                     /translation="MGVLGDASARWPWLVQLGTEPEDTILRVVYEHQKVAAEEERPWF
                     VTLSFAQSLDGRIDFRETTGAAPLRLSSPRAQRLTHALRAMHHAVAVGWNTLVSDDPL
                     LTVRCGIPGTHTPPGWTQPRPVVLLPHDGTRESTGLKQSRLWCQRRHELLLVPREADW
                     RAEVSAPSLFVEGGRRVISSLLQATTTDDALGRRCNLVIITIANCFIGNDVRSVPAFT
                     RGSSSAHTCRLGHLRSWMLEDELILLGIPAGADTERTPS"
     gene            complement(<119993..>121909)
                     /locus_tag="CYME_CMQ054C"
                     /db_xref="GeneID:16996422"
     mRNA            complement(<119993..>121909)
                     /locus_tag="CYME_CMQ054C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537959.1"
                     /db_xref="GeneID:16996422"
     CDS             complement(119993..121909)
                     /locus_tag="CYME_CMQ054C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538016.1"
                     /db_xref="GeneID:16996422"
                     /translation="MASAGVASGATAPLHMISTQGELNPALGDWISLNVRPLDAELTA
                     NNVAGNEAGFLGQRELAVVTSLGPRGSGKSALLNDLFGTRFATGRTFARHARGTRGCF
                     CSVAGPQAPWLLLLDSEGIDGRETEETAELEDAEAEALLVEAESRARLTGRRGDSANA
                     ADHAGAGARERALQLTVPRAIRVAMLATTISDVMLVNVWYADIGRAEASGYVPLIRTI
                     FSEHLKLFTKESPARSKILFIVHDHDDGSPLEAIAAIIERDLEAVWATQVEKPVEYRD
                     ARIGDHFDIEVISLPHRRYRAEAYNKAIDALRSRFLTGRGATGAVLWPQSSSSADAAE
                     IYQNLLAPRYSKELPVEGFATYVDMVWRELIEPKEGGLPDYAELVAAHRCGVVYDRLL
                     RSALEQISKWYNQVDSGKLVDGFGSKAQELLTTTGEKYDSETSALTSSSASLVRNRKR
                     HELVSTLQNHIRALFNRQIQLLQNQTMTRFRDQMLALIADRSGMVSEFECQFLVRRMD
                     EFFNRKAEELLVPSMRLSYRSSRTDLQNTLLEAANKYRDSPTAQLQAMTRMEKRAMAP
                     PSKQRGVVIGFGLNTALRPRGYGNFQLIASTSRGPHTFNASICNDADLAEQEGHGKVP
                     LFRWQPTVHFDIDL"
     misc_feature    122409..123578
                     /note="possible transcribed region"
     gene            complement(<123308..>123610)
                     /locus_tag="CYME_CMQ056C"
                     /db_xref="GeneID:16996424"
     mRNA            complement(<123308..>123610)
                     /locus_tag="CYME_CMQ056C"
                     /product="RNA polymerase I, II, III common subunit"
                     /transcript_id="XM_005537960.1"
                     /db_xref="GeneID:16996424"
     CDS             complement(123308..123610)
                     /locus_tag="CYME_CMQ056C"
                     /codon_start=1
                     /product="RNA polymerase I, II, III common subunit"
                     /protein_id="XP_005538017.1"
                     /db_xref="GeneID:16996424"
                     /translation="MIIPVRCFTCGKVIGDKWEPYLQLLREKTEAEALDALGLKRYCC
                     RRMLLTHVDLIEKSLRYAWNDKRHEGFEDELPGQGTMPGGMGPGLAGPTSTLPPRP"
     gene            complement(<125960..>126955)
                     /locus_tag="CYME_CMQ057C"
                     /db_xref="GeneID:16996458"
     mRNA            complement(<125960..>126955)
                     /locus_tag="CYME_CMQ057C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537961.1"
                     /db_xref="GeneID:16996458"
     CDS             complement(125960..126955)
                     /locus_tag="CYME_CMQ057C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538018.1"
                     /db_xref="GeneID:16996458"
                     /translation="MSSTTKPRTRAGKRALQKREPKLEENPKRLLVLRASKTSQVAIG
                     ALRSLARLKAPLVTVLRKRNEVRPFELGGEGPLEFLLQRNDCSLFAIATHAKKRPHGL
                     VLGRSFDGRVLDMIEVGVESLKTPEQDTEAPKRAGSIGSKPCLCFLGDAWAKVPHGER
                     LRNLFLDFFRAYDLEEVNLAGIDQVIVLVAQSPPRSVLETVESDGCGDLRILFRHYLV
                     RLKKRAEGDVRLPLVRLEPAMPWMDWRVRRTRFASDALMRQTMPTQEQLRAAAGSTLP
                     RREKNVKYDPARLSKVGKVYLPRQSLETLELAPSARPRKRIRTGTSSATSPAGTE"
     gene            <129019..>130254
                     /locus_tag="CYME_CMQ058C"
                     /db_xref="GeneID:16996459"
     mRNA            <129019..>130254
                     /locus_tag="CYME_CMQ058C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537962.1"
                     /db_xref="GeneID:16996459"
     CDS             129019..130254
                     /locus_tag="CYME_CMQ058C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538019.1"
                     /db_xref="GeneID:16996459"
                     /translation="MSQEALFRDLQLIQRLNHMTPLWILEDPSTFTYAGFVPIKTASR
                     ENRACFLRVQCPKGPADLCDASYALESWAENLISYYGLDGALRKRLERAHDLAEFVAE
                     VQDLLERCADGRAAVPRTPVPPPAPTVAGSTLLATLPDPFFYRRLCTDLKHIGWSCLR
                     HLAMDFESVTLQAIDTGGRLHELQILDLMREQPTCIAALPWRPTAICRPASEDGRLFI
                     SIYETYRRFRSMLDELEPYFRVLDDFDAHTWVLEPEHPTYAVSSRRLNLAPQCSLVVE
                     IDPADPCRLPNVRFFGSEQRIEAMRNRFFERRALWDSSARTPRENLQVVLMMALPPRP
                     ADMMQNAKDNECGICYTYELEGEGIPDWACDAASCGRPYHRSCLRTWLASIPETRQLF
                     QMYHGSCPYCGEPIQVSKI"
     misc_feature    131698..133078
                     /note="possible transcribed region"
     gene            complement(<131785..>132768)
                     /locus_tag="CYME_CMQ059C"
                     /db_xref="GeneID:16996443"
     mRNA            complement(<131785..>132768)
                     /locus_tag="CYME_CMQ059C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537963.1"
                     /db_xref="GeneID:16996443"
     CDS             complement(131785..132768)
                     /locus_tag="CYME_CMQ059C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538020.1"
                     /db_xref="GeneID:16996443"
                     /translation="MASQQQHAHDAAFTLRGHPKPLQFSIVTFNLLAPCYAVRPPALC
                     ERSQNSGCSGGSPEWSQPQRWQQRAERTCTFLADGTCTVQQREDGIREQPKLIGDIIC
                     LQEYLFEPAYEEIFQTRFPAETFRWIKAKRPGSKRDGLAVFFRRTDFHVEKWRCFTLT
                     PLGDRIGLLVHLRPTWAPHMHLLVLNVHLTYPHHIWDNALRKHQVRTVHHMTAQAREE
                     IPPCHRVVVLCGDWNTLGAEDPVLRYLESNMYVRCRLPQRSVTHLTHDGKQICCDHVF
                     LDWASEKIFQSAQLLPPELEADQWPDIERYDLSDHRPVRVLLRLETERSAL"
     gene            complement(133073..134125)
                     /locus_tag="CYME_CMQ061T"
                     /db_xref="GeneID:16996445"
     misc_RNA        complement(133073..134125)
                     /locus_tag="CYME_CMQ061T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461545.1"
                     /db_xref="GeneID:16996445"
     gene            <135746..>136492
                     /locus_tag="CYME_CMQ062C"
                     /db_xref="GeneID:16996444"
     mRNA            <135746..>136492
                     /locus_tag="CYME_CMQ062C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537964.1"
                     /db_xref="GeneID:16996444"
     CDS             135746..136492
                     /locus_tag="CYME_CMQ062C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538021.1"
                     /db_xref="GeneID:16996444"
                     /translation="MNSQKTIDEEELRIPRDDPSEWISSGSVERSTVLFIWSSAPAET
                     LAASRSVYRALQAQRQLQPELRLLCFDLHEQRSKLSKVLETYKVGAVPTVLAFPAHAH
                     QPSDRVEGVYPARVGALVEQLVHNSAAADTKTVRQRVEKMISEHPILLFMKGTPERPR
                     CGFSQQIVQLLVGDLKLPRASLATFDVLTDEQVRQEVKAYSQWPTFPQLYVRGELIGG
                     LDVCREMAQSGELAALLASATRDEHGTTGP"
     gene            complement(<139932..>140852)
                     /locus_tag="CYME_CMQ063C"
                     /db_xref="GeneID:16996478"
     mRNA            complement(<139932..>140852)
                     /locus_tag="CYME_CMQ063C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537965.1"
                     /db_xref="GeneID:16996478"
     CDS             complement(139932..140852)
                     /locus_tag="CYME_CMQ063C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538022.1"
                     /db_xref="GeneID:16996478"
                     /translation="MCGRFALYYSREQLERVAGTTRWADAKDQEKRYHYQPRYNVAPQ
                     QTVPLLRTVSGERVLQPMRWAFPIRGRTFGKGESPPIVINVRAETALEKASFRSALDA
                     GQRAVVIANGFYEWSAADAPGEQQDVGKIKTMTKASRIPYFIYHGVTKRESKDHLAPR
                     NAHDMIDRPLFMAALFVEETEMNRFAIFTVAASDKIQWMHNRMPALLETEDQLQAWLD
                     VEQVPARVAVHRCLQPTEQIVWHPVSNTVSSVKNEGPSLIEPRRDEPGKKPGLDIRSA
                     FARGLKRSPSAQDLQAPETKQMRHTYQANR"
     gene            <141166..>142638
                     /locus_tag="CYME_CMQ064C"
                     /db_xref="GeneID:16996479"
     mRNA            <141166..>142638
                     /locus_tag="CYME_CMQ064C"
                     /product="acetylornithine transaminase"
                     /transcript_id="XM_005537966.1"
                     /db_xref="GeneID:16996479"
     CDS             141166..142638
                     /locus_tag="CYME_CMQ064C"
                     /codon_start=1
                     /product="acetylornithine transaminase"
                     /protein_id="XP_005538023.1"
                     /db_xref="GeneID:16996479"
                     /translation="MRTIHERKDGTFMTPAFISSSHVFLSDPCFWSSGRVSGRRHRNA
                     VYSKPQSGTVRLPTRLVLEDAPSREKTTQFDRAEFDRYVQNTYARYPLTLVSGRGSKV
                     VDDNGRTYIDCVAGIATCSLGHADPRLVSAVSDQIRRLHHVSNLYYTVEQASLAKWLV
                     EHSCGDRVFFCNSGAEANEAALKLVRKYAHTQLGLDVPVVVTAMNSFHGRTLATITAT
                     GQPKYQRGFEPLMPGFRYVPYNDVAALERVVNELEQMRNSWWRRIQGAPRTGLAAIML
                     EALQGEGGVMPGDRAFFAAAQRICERTGALLVLDEVQVGMGRTGKLFGFENLSIQPDI
                     FTLAKGLGGGIPIGAMICNARLRDILQPGEHASTFGGNPLACRAGLVVTRALVEDNVL
                     ENVRARGAQLRNTLESLARAYPSVVRETRGWGLIQGLEFHEPCSPQFVQAAMREGVLL
                     VPAGPRVVRFVPPLTITESELEEAIQATRRAFRNLFGSES"
     gene            complement(<144733..>145476)
                     /locus_tag="CYME_CMQ065C"
                     /db_xref="GeneID:16996480"
     mRNA            complement(<144733..>145476)
                     /locus_tag="CYME_CMQ065C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537967.1"
                     /db_xref="GeneID:16996480"
     CDS             complement(144733..145476)
                     /locus_tag="CYME_CMQ065C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538024.1"
                     /db_xref="GeneID:16996480"
                     /translation="MFLVCQYTSLPKDTASLHRQVQNALSKATETKTRSPALYEVSFP
                     AVRDTTAALSRILDANTSHAREIIKPFAASFRKRLHLVFPDVAEAKIAEKVYGSSEHT
                     FTLSALPLYERPAFLQQVEAPALVFVVQPGFNIDEWLQLERPALLYPDASIVVLNGNM
                     DRLRSNYYPPLFYPRLTALRKRYLEQFEPIYYLKPLPNGLLFRVFPEPWQTFFCASPG
                     EATRIAVDDERPTFPQTTQRLMELSREQR"
     gene            <145980..>147536
                     /locus_tag="CYME_CMQ066C"
                     /db_xref="GeneID:16996481"
     mRNA            <145980..>147536
                     /locus_tag="CYME_CMQ066C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537968.1"
                     /db_xref="GeneID:16996481"
     CDS             145980..147536
                     /locus_tag="CYME_CMQ066C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538025.1"
                     /db_xref="GeneID:16996481"
                     /translation="MSRMDRAAPQLVGAPTEQSQGGDGDWKKNLSGKLQEAGPCYARL
                     LGSSERCLWHYELLGTPGAAATVVLLPDHLNGAAGLRALASVVARCGYRVLLLDWPEH
                     VHTVEAFIKSLEKLLEVLAAADAVCRSAHFLGVGLGALLALSFAQHCPDLVASLMLAG
                     VLWRRQTLSRLLSPWSLAGRVCAANSLLPRCIFEEPLLESGLLTFASTTERLQMQLLI
                     RERIRQSTRGSLCTRLCLMRSGKDPGTIRLPESRISLITCLPRSWDAVYFASSSGLGR
                     SQNLRWPFTDTKLQHRVLQSPWVQSYEETTPVDGTHAGGLLRRAFCAYWRSWRLGSGD
                     RDSAAHPGHGPDTAAFLLLFPRARRAYLKGAFTNYPFLWSADAFILHVLVHLRRQLDP
                     PQQLLLLQRYRSLPLGHLNTIPEKTDAAPMRPLMHQQTSVSNANAEPNHDTRSSDWNH
                     EDFIRIVSPASATTSWATVYASAGSTTLTDVTQDIWSEDANETEVSSSCESTCSTTSR
                     DVRIMRDALA"
     gene            <148974..>151211
                     /locus_tag="CYME_CMQ067C"
                     /db_xref="GeneID:16996517"
     mRNA            <148974..>151211
                     /locus_tag="CYME_CMQ067C"
                     /product="phosphomannomutase"
                     /transcript_id="XM_005537969.1"
                     /db_xref="GeneID:16996517"
     CDS             148974..151211
                     /locus_tag="CYME_CMQ067C"
                     /codon_start=1
                     /product="phosphomannomutase"
                     /protein_id="XP_005538026.1"
                     /db_xref="GeneID:16996517"
                     /translation="MSTLLIPAFAIAVAGLAALRWNTAKQVPHQVGRRPNGALRLPLG
                     ETNNGEANDRSGSPVLSRQDALQQARAEASAYAAQEPVQAFARKVRSLRPEDLLDRFG
                     PSASLHFGTAGLREPMGPGYNLLNTVVVVRATRAVLGHLADTLGWEALRTRGILIGYD
                     ARQHSETFAQAAAVVCASHQVAFALLDRVVPTPLVAFGVVQQQRCAGIMITASHNPKE
                     YNGYKLYMENGLQISAAVAKQIEARMRSEASSPRERQAELLFATKELASLPRQSVETL
                     WQAYEQRIRHELYAPMRFDSARLQIVHTALHGVADDYLRRLFAAFALPTYTPTAAQQS
                     PDGDFPTVPVPNPEEGAAVLRLAMQTAEQLLRSNKTNAVVVLANDPDADRLAVAELAP
                     QTNPRWHIFHGDEVGILFAWWMLQQVEKLGKQRASTEMVFINSVVSSQMLGALAEHQH
                     KLRCRWIQHYPGFKWLMEVAVAQTRPQQQVLLVYEEALGYALGGLRSGTLPVNDKDGI
                     AAAIVAAQLAYFCHQNRTYGSLQGLLESLYRQYGLYLQHSGYLRCRDFRTLTPLFERI
                     RQRLASGELVLFTADDGCGGGKPLPPRRYQIQSVYDWTRGYYCAYGCEPVPLSLPPQP
                     KTHFMTFCIRESDEHRLSLQRQRRQQPRQTPSGDRSRTPSSPSTPMKPASPSLPADAD
                     LRITLRNSGTERKLKFYSELHVTRYSRLEDRDELRKALDRAVRAFIEAFLQPGLHGLE
                     YGTDR"
     gene            complement(<153375..>154823)
                     /locus_tag="CYME_CMQ068C"
                     /db_xref="GeneID:16996518"
     mRNA            complement(<153375..>154823)
                     /locus_tag="CYME_CMQ068C"
                     /product="probable ubiquinone biosynthesis monooxgenase
                     COQ6"
                     /transcript_id="XM_005537970.1"
                     /db_xref="GeneID:16996518"
     CDS             complement(153375..154823)
                     /locus_tag="CYME_CMQ068C"
                     /codon_start=1
                     /product="probable ubiquinone biosynthesis monooxgenase
                     COQ6"
                     /protein_id="XP_005538027.1"
                     /db_xref="GeneID:16996518"
                     /translation="MPETGSPTASADVAIVGAGVVGSTLALALHRHLIEPGARILLVD
                     PRRAPAWQPINDTAAGLRTVAITPASQKFLASLGVWERLPQGAITAFPTLFAYGRSAQ
                     EKITFDAADCVGRLSTEPPALGYIVEETALLETLHRCLERVAGEKEPTGNASGRDGTS
                     SVSGSICWSRACFDTLTWPASHPWAQLHLSEAEHPPFAVAASLVIAADGARSRVRHQT
                     ELTWIGRSYHQRAVVAIVENREPNLVAIQRFLPRGPLAILPMGQHGMYSNIVWSTNES
                     EADWLETEASASQFLDATHAALHRVNVDGGQHAPYRRFLSQSSYPIDRRSFPVVPSFQ
                     RLIPSRTDGRDRWSFPLHFGSATGYDANRVVLVGDAAHVVHPLAGQGVNLGLADAQTL
                     ARVLKQAWQTGRDIGDPSVLAVYTRERLPLNTAMLVTLSALRRVFAFPTRTRGLGSTL
                     ASSFRGLGMQFIERVAPLRSSVVRIATGEPWL"
     misc_feature    complement(154937..157901)
                     /note="repetitive element"
     gene            <158744..>160345
                     /locus_tag="CYME_CMQ070C"
                     /db_xref="GeneID:16996510"
     mRNA            <158744..>160345
                     /locus_tag="CYME_CMQ070C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537971.1"
                     /db_xref="GeneID:16996510"
     CDS             158744..160345
                     /locus_tag="CYME_CMQ070C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538028.1"
                     /db_xref="GeneID:16996510"
                     /translation="MESLEENDSDFENDGRDRMPSRPELASWQPPALETVAVLARQFD
                     TAFQSANASALEACERALVERVPLQLLQQTWLEKIFDRRADASHEWTYADIRFALHLA
                     SAAGHLEQRMLRTLFVSVLAETASGEAPASVGRTSVTTNIPRRVETRAFAALYRHVAE
                     ALSKPSMDTEGSWLTLVQLIPHIDGVSGSVTSMHVDALALCVAHDAWNQALEVVLARI
                     TPFWYKPPSPFMVSLSDLERFLFSAATTHFKTGNYRASWRLLHEFLALQCTRPMSRRN
                     EAADPDTKHPSQRIAPLDTAVTLCRWHEPVMLDSSHICETTAAMRIRAAQRYVCLELI
                     VYGTTEEALQSSLPMGSVERSPSTTGRFLARYRALAQTFDACSAAGCIAPFDAFVHLH
                     LDSFRADTHEEWILQTRRALARVLMLSTASVYKTLPLRTLSERTGLSRSEIAQVIQDL
                     RSGRCWSQSAGALWTRWFTTLVTLDANGERVSFRRHADTRTESAGAVAVPGSCGIYLS
                     RAMLVDAGVHAACAADFSRKCAWFP"
     gene            complement(<160653..>161687)
                     /locus_tag="CYME_CMQ071C"
                     /db_xref="GeneID:16996511"
     mRNA            complement(<160653..>161687)
                     /locus_tag="CYME_CMQ071C"
                     /product="probable U3 snoRNP component Imp4p"
                     /transcript_id="XM_005537972.1"
                     /db_xref="GeneID:16996511"
     CDS             complement(160653..161687)
                     /locus_tag="CYME_CMQ071C"
                     /codon_start=1
                     /product="probable U3 snoRNP component Imp4p"
                     /protein_id="XP_005538029.1"
                     /db_xref="GeneID:16996511"
                     /translation="MISLKRQARLRREYLYRRALEIAAAGAETSRQRGPPGLARPGGA
                     SSTPSARRDTSDADEKVQITEEALRHPIRMLATTRLMLDDEYATAGVADPKIVITTSR
                     NPSSRLCQFAKEVRFLFPNAQRLNRGNLILKDLIELGRAQQLTDLVLLHETRGEPDAL
                     IVCHLPLGPTAYFALSNVVMRHDVAEMLRHEHQNSPDAALPPLSEAYPHVIFEGSFQS
                     RLGMRVKNMLRFLFPVPKPDSKRIVAFIDKGYDGILSFRHYIVERRRTAAADDSSDDE
                     EAGTATASSSAGRIQGHQQHQALIELGPRFDLGLFRIRLGTLEQQDADDEWRLAPYTR
                     SARKRRRLFG"
     gene            <162151..>164103
                     /locus_tag="CYME_CMQ072C"
                     /db_xref="GeneID:16996512"
     mRNA            <162151..>164103
                     /locus_tag="CYME_CMQ072C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537973.1"
                     /db_xref="GeneID:16996512"
     CDS             162151..164103
                     /locus_tag="CYME_CMQ072C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538030.1"
                     /db_xref="GeneID:16996512"
                     /translation="MANSLGLPAVPLEPRLVPDAATWLSERFSNDDEEEVTRLEEAVC
                     LQLAALRALRAPLPQGIAVYRCRAPGSPSRSADASSSRGTRSVRRTVQLRQRTRSAYR
                     QASGTTAANTGLRTNLDTSIGAVDEHINDELIDSQELEEASTGETEPRPAHRATTVAH
                     RVFIPPRYVLPHHALIYEHTDWYRERVRLAMETNSGQYASAEASSGRAPAPRALTVFP
                     APAGRDRETDSSPRRPRERRFRTRFSGQREGILEDALATILFRDERTGAGTPPAAEMP
                     LDRQLDRGPGLPDSAERLPAPLLGYREEVRSHQRRAYAQREAFGSPPTSMVLSDWLES
                     RRRDVADPGSVSPADAMSLWSAPRAPQRHIPGRGDAALGVYREPRTGQRSLQRRSTEV
                     LSTSVDTGRIRGPITANESAPELLHSPPFRAGSIGDDSFDAGSLRLTARGPSRARLSG
                     HVASRTRGLPVDHISPADASLPLDESLQTDETSGRVHGRAALHRMRRSGRELDVSSVA
                     DTFHSTSAGSASHHAWTRAPMDTARSTSTAFASPLTLEHRDSAGSSPGDFVVNDWMSA
                     GDRSSRTDQSRGGFRTGTGSAGDTTTIEALGGRRHRGPRDLVVRIEETLRTRAWERST
                     SADASARASGTARAQVRNERRHLDSS"
     gene            <167019..>168806
                     /locus_tag="CYME_CMQ073C"
                     /db_xref="GeneID:16996508"
     mRNA            <167019..>168806
                     /locus_tag="CYME_CMQ073C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537974.1"
                     /db_xref="GeneID:16996508"
     CDS             167019..168806
                     /locus_tag="CYME_CMQ073C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538031.1"
                     /db_xref="GeneID:16996508"
                     /translation="MNSGNEYARVSPGATSAPDAQSGLGVTTAGSEVTIKAWKQTAGE
                     RCAVGNALVAAHEPHCPVCPEPTNKIVPRRKMVPSSMAVQPQPFPHQVGGHGALALHG
                     AGLVKKPLVERELAFYEYVWGDLVDIFERLDDTSEDGLNLRRKLVAPHSPRKLERLLS
                     SETRGRALANLRDRLQYRRMKAERRCALCRQNAPVGCGSSAGTNKLCTMQFSDLVVQT
                     LREFTARYYGIVSLYRVRGEWRYTRELPSSSAIELEANDSSDSAITGLPDAAERRSPA
                     SSEDTSSGLVELWHAENGKALDVNPWARVCFERSFASYASHRGTRSPRVGTTPGADAN
                     HMDPDRGVVVETGVTSSDPDDAVQHDFLVLEDLTFPFRYPSVLDVKVGTRDYDDEATE
                     EKRRRHIEKCRMTTSARYGVRLTGMQVFQPERRTYLCHDKYHGRRLKDEEQLQEELQQ
                     YLDNGQRSRVAALRAVQVANAFRQRLEILRDFVARQEEWRFYSSSLLFIYEGDSVEAQ
                     DAPVQPASDANAATASEVASACAARNGSKSGNATSVCLKMIDFAHTQRSNCDDGPNDD
                     GYLLGIETMIRLFFNAAQRFAERGNQWHP"
     gene            complement(<169363..>169908)
                     /locus_tag="CYME_CMQ074C"
                     /db_xref="GeneID:16996509"
     mRNA            complement(<169363..>169908)
                     /locus_tag="CYME_CMQ074C"
                     /product="small GTP-binding protein Arf1"
                     /transcript_id="XM_005537975.1"
                     /db_xref="GeneID:16996509"
     CDS             complement(169363..169908)
                     /locus_tag="CYME_CMQ074C"
                     /codon_start=1
                     /product="small GTP-binding protein Arf1"
                     /protein_id="XP_005538032.1"
                     /db_xref="GeneID:16996509"
                     /translation="MGLTLSRLFARLFGKREMRILMVGLDAAGKTTILYKLKLGEIVT
                     TIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRERLPE
                     AREELHKMLAEEELRDAHLLVFANKQDLPNAYSASEITERLALHTLRQRNWYVQSCCA
                     TTGDGLFEGLEWLSQQLDDKY"
     gene            complement(<174764..>175528)
                     /locus_tag="CYME_CMQ075C"
                     /db_xref="GeneID:16996490"
     mRNA            complement(<174764..>175528)
                     /locus_tag="CYME_CMQ075C"
                     /product="similar to thiamine biosynthesis lipoprotein
                     apbE"
                     /transcript_id="XM_005537976.1"
                     /db_xref="GeneID:16996490"
     CDS             complement(174764..175528)
                     /locus_tag="CYME_CMQ075C"
                     /codon_start=1
                     /product="similar to thiamine biosynthesis lipoprotein
                     apbE"
                     /protein_id="XP_005538033.1"
                     /db_xref="GeneID:16996490"
                     /translation="MGCLFSVPEGGYLEVNEERSAGAYDSLSTASGIDDLHDERQPKA
                     AYSMEDSSADLVAEDGAAVHQEVLNAHDDAWCRFDATSDATNEGAAAGGIGAPPSPLD
                     LSLDSVVQQAYQDRVLVVFSGKAFGIALQLQMHWAALGASSAAPECVMDACVPESLLR
                     AVHACLRAHMHACERIANRWNPDSELSAACSSAHPKKAVEVGTILYALLAEAHRLHRV
                     TGGRFDPTCGALWRGFRATLRSSALQRPPQGRAFST"
     gene            175955..177881
                     /locus_tag="CYME_CMQ076T"
                     /db_xref="GeneID:16996491"
     misc_RNA        175955..177881
                     /locus_tag="CYME_CMQ076T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461546.1"
                     /db_xref="GeneID:16996491"
     gene            complement(<177267..>179921)
                     /locus_tag="CYME_CMQ077C"
                     /db_xref="GeneID:16996492"
     mRNA            complement(<177267..>179921)
                     /locus_tag="CYME_CMQ077C"
                     /product="cleavage and polyadenylation specific factor 2,
                     100kD subunit"
                     /transcript_id="XM_005537977.1"
                     /db_xref="GeneID:16996492"
     CDS             complement(177267..179921)
                     /locus_tag="CYME_CMQ077C"
                     /codon_start=1
                     /product="cleavage and polyadenylation specific factor 2,
                     100kD subunit"
                     /protein_id="XP_005538034.1"
                     /db_xref="GeneID:16996492"
                     /translation="MASSIRVTPLYGAHTSAPPLCTVLEIDDGVFLLDCGWNDRFDVA
                     LLEPLRPVITRGIDAVFLTHPDLAHLGALPYLVGKLGLPASVPIYATTPVQILGQMFL
                     YDAHQHRYYGEDFETFTLDDVDEAFERMRPVKYQQVIELAQNVFATAYPAGHLLGGAI
                     WKFQKESEEIVYCVDVNHRRERLLNGCASTPQLITKPSHLIVGASGVLTAPSQKKETD
                     LWEAVVETLRGGGDVLMPVDSAGRCLELLVAADEFWTAHPDVAALYPVVFAQHVGIHT
                     IEFAKSLIEWMSDAVVSAFDSRRENPFRLRHVQVVHGLDQADALPSPKVVMAPLPSLD
                     YGFSRVLFLQRIAADPRAMVLMSDRLESGTFAFRLAVEKEKLRVREPLTYAERVPLQG
                     EELERWQREQEKARFVGAEVALESAEMPMVAPTAVAEKLRGGRVVSSGPLGEALVAGD
                     AAQLHEALGPDFPGVAEDEEEDDVNQRYQALVQAGLLLPHVEPEPPPHDAYGEVIDPA
                     RYMIGEDPGDRTIDGDAFEGLAKSADNAFSRHAPDQGEPMDLEPHKTDNIDGFHDERM
                     ATAPSPSVSPSVRPERTSADAPGSYHRRDRFRSSAHDNDAAVADSTTSRALETLPTKL
                     VRYVVNDLTIRCAVRNFDMAGLADGRSLRQLIVSMAPQRVIIIHGSERETAALTEYLG
                     KKNFTRLYAPRAREMVDVSSDTSVYRIKLDDSLLRRCFWRRMQDYELAWFDGYIQTDP
                     DGQLRLVSVERQTEQEQQLPEGTESGVDAAWLAAKTTDAASAATALVDGDRTANTTTF
                     ALVTERTQVGHLNVFVGDLRLSDLKEIMTKSLMPAEFAGGALCVENDRPPSIVLVRKR
                     QHDLVIEGSLSAEYFDVRDLVYSQYMIL"
     gene            complement(<181666..>182361)
                     /locus_tag="CYME_CMQ078C"
                     /db_xref="GeneID:16996475"
     mRNA            complement(<181666..>182361)
                     /locus_tag="CYME_CMQ078C"
                     /product="60S ribosomal protein L6"
                     /transcript_id="XM_005537978.1"
                     /db_xref="GeneID:16996475"
     CDS             complement(181666..182361)
                     /locus_tag="CYME_CMQ078C"
                     /codon_start=1
                     /product="60S ribosomal protein L6"
                     /protein_id="XP_005538035.1"
                     /db_xref="GeneID:16996475"
                     /translation="MSVFTKGSSERAERDAALQAAIKEQAAIISGTGNVIELKPSERA
                     PKRKPSFYPVDARVRRLHTSAKKRSQKQRTRLRNSIQPGTVLIMLAGRFRGKRVVFLR
                     QLEHSGLLLVTGPFALNGVPLRRVNQVYVIATKTRVDISGIDTSSVDDTWFTKGARKA
                     REERKKARLRGADGSGGESTVKQCLPEEKKNLQKQIDGQVMKAVEGIPLLREYLSSRF
                     TLTKGQYPHRMTF"
     gene            <184031..>187072
                     /locus_tag="CYME_CMQ079C"
                     /db_xref="GeneID:16996476"
     mRNA            <184031..>187072
                     /locus_tag="CYME_CMQ079C"
                     /product="unknown zinc-finger protein Mpe1p"
                     /transcript_id="XM_005537979.1"
                     /db_xref="GeneID:16996476"
     CDS             184031..187072
                     /locus_tag="CYME_CMQ079C"
                     /codon_start=1
                     /product="unknown zinc-finger protein Mpe1p"
                     /protein_id="XP_005538036.1"
                     /db_xref="GeneID:16996476"
                     /translation="MSAAVHYKFRSAKHFGRVQFEGDFIQLAELKVAIVEQEKLQFGE
                     DFDLQVVDAQTQEEYYDEETLIPKNTSVIVKRVPAGQKQGILSQIALARKNERFAEIL
                     DRSTGGTGATAGAIAAAARQVLAGNLGPSTTANTGMTGSEPVRLRRGDEDTRLASVAL
                     AAGAGDSGPNPRNIQRPGGRVTASGAMDGPPPGAQPPPGYICHRCGEPGHYIQHCTAN
                     LEGDVNIIRVKRPTGIPRSMLKTIDAPVDGGTELQLPGGKFVTLATDDREFSKEPLAV
                     RMARLAEARAGAREDNTIASDVTTIQGSETKQPVPMDKKESETTRRQVAASDAPSESA
                     ASSPRGSTPTDSVENAQLLPADIRPDLPYFPLPGMDQKEHFFGTGELPTAREFQEVIW
                     GIILMNRDQHPELGHDMETGTQRDVTRDSAAALQPEPRSMESAEAPSTTNERAVSAQP
                     RPRMTASAEGESYQERRPQAHERKTPTHVQDVSKRSPTSEAQNVPERGDRDPDKSAPR
                     SGSVANARPIPSSFKSTETANHHLDAERPRPGRRSSALQVTSMEPSGAPFGEIEYSRV
                     STKNQRLLPPDRKATESAQATAPNYGNSLPRKQAAFARSGKMTGNTTRPGLPLAPLQT
                     QQQQQHQQQQQHQQRQTHVQRFQAANQHGNEAASVDKQHPLDRGQHAMQRTEPARERR
                     QPTVAAADRNAVSRGVPTSRATSSGVTATGSTAPVRTKMPPRMPHQRPDEDTLGHRHH
                     AASDTEQKPAQLNANLSQPQPLSVSRARERSGLGKSARHSPAPVAPALHGTTRKHPRA
                     SDSSPGTETRDSRPIPVFARLGTRAEAAASTRAPASVPQRSTTGSIGSAERRTVPPAH
                     PPPADASQLKGKNSSPMNQQGEYLHRASVRAPPKVPEKRPAATAAVGDDKRSRNTPSS
                     AERAAANVFERLGPAIPVPPRLAGRISSGKVSDGERGANASTGASGVVANDASKTKTN
                     LRAVHAKQSVPMTQQKTPVPTYSSSETGSSRARNRAANLPW"
     gene            complement(184093..187078)
                     /locus_tag="CYME_CMQ080T"
                     /db_xref="GeneID:16996477"
     misc_RNA        complement(184093..187078)
                     /locus_tag="CYME_CMQ080T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461547.1"
                     /db_xref="GeneID:16996477"
     gene            <188762..>189646
                     /locus_tag="CYME_CMQ081C"
                     /db_xref="GeneID:16996486"
     mRNA            <188762..>189646
                     /locus_tag="CYME_CMQ081C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537980.1"
                     /db_xref="GeneID:16996486"
     CDS             188762..189646
                     /locus_tag="CYME_CMQ081C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538037.1"
                     /db_xref="GeneID:16996486"
                     /translation="MAHEPLEPTVIQEDHTVSVPVAEQVTLRVLPEWEQIFPPPTLRS
                     AKESDALSALASIRLCVSLDSTISDLEEQVRRAYLPRCCACLSLPEERIHEALESAHI
                     RYTASVLDPQCTLRALRLASGTTLRWLRIHDPESPEASAAAVQLQTSAPQQRRRRTTV
                     QRLEPNTGLTSGGARVLVFGEHFPPVARVRFGRVVVSANRISAQCLSCIAPAHEPGVV
                     CVEVSTRATTASEQDAWTHDRVTYTYVGYERLSMILAVHAAERRAATALTETQSPCRS
                     SSEPLSWLRRDPDDEDRR"
     gene            complement(<191498..>192919)
                     /locus_tag="CYME_CMQ082C"
                     /db_xref="GeneID:16996487"
     mRNA            complement(<191498..>192919)
                     /locus_tag="CYME_CMQ082C"
                     /product="histidinol dehydrogenase"
                     /transcript_id="XM_005537981.1"
                     /db_xref="GeneID:16996487"
     CDS             complement(191498..192919)
                     /locus_tag="CYME_CMQ082C"
                     /codon_start=1
                     /product="histidinol dehydrogenase"
                     /protein_id="XP_005538038.1"
                     /db_xref="GeneID:16996487"
                     /translation="MVPVPIYTAEEALGSILQRKPLDLNQVSALQQERILKIFGEALS
                     PREAVQRILESVRTQGDIALLDWTARLDGVVVDSPKALEVPAAELDHALCSLEKTEPS
                     LYEALHIAARRIAAFHEEQPVNSWFTTKLGGQVGQLVRPLQAVGFYVPGGNAALPSTA
                     LMTMIPAIVAGCRRFVVTSPPSRESNDISPVTLAACALCKQMLEERHRHALTKRDEAL
                     SFQVFRLGGAQAIGAMAYGTQTLPRVDKIVGPGNLYVTLAKREVYGICDIDGIYGPTE
                     AIVVADAFANAELVAADLLAQAEHDEAAIPILLTPTRTFAEKVREALHRQLASLPTAA
                     ARQRAQHAIQRQGGLVVCDDLEACAKLCSDFAAEHVSLSVNQPWDLVSRIHHAGGIFV
                     GESSGEVLGDYVAGPSHVMPTGGSARYASPINVWDFVKITSVIALDKSTAREVAAAAE
                     KIAAAERLDAHASAAKQRLQKDS"
     gene            complement(<194900..>195895)
                     /locus_tag="CYME_CMQ083C"
                     /db_xref="GeneID:16996488"
     mRNA            complement(<194900..>195895)
                     /locus_tag="CYME_CMQ083C"
                     /product="retroelement"
                     /transcript_id="XM_005537982.1"
                     /db_xref="GeneID:16996488"
     CDS             complement(194900..195895)
                     /locus_tag="CYME_CMQ083C"
                     /codon_start=1
                     /product="retroelement"
                     /protein_id="XP_005538039.1"
                     /db_xref="GeneID:16996488"
                     /translation="MKLTTPKDGTTGTPSIPDEPDTSLGKRLVELIQGMFEETYIPDV
                     WRTAEVVPILKKDSHTDMNNYRTMRLIPSIIKLLCAIPTNRTQRGLEQRKFFAPGQAG
                     FRSREEYMSHALTLIEVAQRRFIRDRQPTYVCFTDFQKVFDTVPHEVLFLKMERAVVS
                     GKCLAFFRALYADSWMRIRLGDSSRTPCIRIRRGLQKGDPASPLLFNIFINDPLNNCR
                     QYGLEVPWIDCGEPGKEPSHRNRLAGLLFADDVVLLAPAPETLAGSMEQVSAWVDRWK
                     MNVGASKCGVMVIHGDSQSIRNRSWRLQNQESPIGEKYRYLQGLSHADARRKGTR"
     misc_feature    196064..198202
                     /note="possible transcribed region"
     gene            198596..200816
                     /locus_tag="CYME_CMQ085T"
                     /db_xref="GeneID:16996472"
     misc_RNA        198596..200816
                     /locus_tag="CYME_CMQ085T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461548.1"
                     /db_xref="GeneID:16996472"
     gene            complement(<200179..>201168)
                     /locus_tag="CYME_CMQ086C"
                     /db_xref="GeneID:16996473"
     mRNA            complement(<200179..>201168)
                     /locus_tag="CYME_CMQ086C"
                     /product="retromer component VPS26"
                     /transcript_id="XM_005537983.1"
                     /db_xref="GeneID:16996473"
     CDS             complement(200179..201168)
                     /locus_tag="CYME_CMQ086C"
                     /codon_start=1
                     /product="retromer component VPS26"
                     /protein_id="XP_005538040.1"
                     /db_xref="GeneID:16996473"
                     /translation="MRGGTADTSAYATLASARGVSALEAATMSLFRHLRYRWALQNRV
                     DLQISLDEGSFRSRDPKNRAIYTTGDQITGCAVVRSRVTFPLPCTLLTVKLVALVSVG
                     YGISQRDWEVFSRTLSFKPESVKLEPHAAVSLPFAFRCAELVHDTYESTRVRCVYRVV
                     LSFHGYSGLSSRSTGVEVVVRLSQRAPRFFPAIHFNAGLEDILNLELQLDRRAYSIED
                     VIVGSLTFLDNHIAIRRADIEIRRQESGFSLPMQSVLVGSFQVLAGSPKPACKLPIRI
                     FLRQFDDLTPTYEDVCGLFSVHYMLRVVVTDIGDRRFWKEQPIAFWRAPPCNA"
     gene            <201830..>202924
                     /locus_tag="CYME_CMQ087C"
                     /db_xref="GeneID:16996474"
     mRNA            <201830..>202924
                     /locus_tag="CYME_CMQ087C"
                     /product="chloroplast F-type ATPase CF1 subunit gamma,
                     precursor"
                     /transcript_id="XM_005537984.1"
                     /db_xref="GeneID:16996474"
     CDS             201830..202924
                     /locus_tag="CYME_CMQ087C"
                     /codon_start=1
                     /product="chloroplast F-type ATPase CF1 subunit gamma,
                     precursor"
                     /protein_id="XP_005538041.1"
                     /db_xref="GeneID:16996474"
                     /translation="MQAFVGTFTAARGGFVSARRDAFLCGAGQVRPAAPVVQAAPQTL
                     VMSGKTTALRGRIRTIKNTQKITEAMRLVAAAKVRRAQDAVLRTRPFSDTLQKVLGGL
                     LSRLNSTEYFDLPLLKQRETKKVLLVAISGDRGLCGSYNSSILRKLQLRINELKAQSL
                     EVELVTVGSKVTQWARRRNYKIRRSFLCTQQPTSSQATEIADVLLAAYLGDDVQRVEL
                     LYTRFVSLISSKPSIRTMLPLTPVGLEMEGDEIFQLTTEEGKFAVKRSFQKPSPEAIE
                     ITPDMIFEQDPLQLLNALLPLYFNGQLLRTLQESVAGELAARMSAMSSASDNAKELAR
                     KLNIEFNRARQSAITSELAEIVGGAAALEG"
     gene            <204026..>204898
                     /locus_tag="CYME_CMQ088C"
                     /db_xref="GeneID:16996499"
     mRNA            <204026..>204898
                     /locus_tag="CYME_CMQ088C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537985.1"
                     /db_xref="GeneID:16996499"
     CDS             204026..204898
                     /locus_tag="CYME_CMQ088C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538042.1"
                     /db_xref="GeneID:16996499"
                     /translation="MLTASSPAKTQTERIKIIRPSGMTLGQLHTLIEYEPTIRTPLET
                     VASDFAEVLGEQVVLTRGAEVVEKAPPVKRDVLGEWLTSSGGGGGGGGILTQLPASQR
                     FTTAPDAAPLVLLSGSFNPLHEGHRQLLEAARKMVAWDARGGFEISVLNADKGAISEG
                     ELHQRLRQFAGYRPVTLTRAPLFTDKAKILPGRVFVIGVDTMLRLVDARYYGGNETKM
                     REALEEIERCGCRFLVAGRKDPRAPNQNDAPFLTRDDVSIPLGLESLFGSIPERLFRV
                     DLRSTDLREAFTRS"
     gene            complement(<204918..>208070)
                     /locus_tag="CYME_CMQ089C"
                     /db_xref="GeneID:16996500"
     mRNA            complement(<204918..>208070)
                     /locus_tag="CYME_CMQ089C"
                     /product="probable protease"
                     /transcript_id="XM_005537986.1"
                     /db_xref="GeneID:16996500"
     CDS             complement(204918..208070)
                     /locus_tag="CYME_CMQ089C"
                     /codon_start=1
                     /product="probable protease"
                     /protein_id="XP_005538043.1"
                     /db_xref="GeneID:16996500"
                     /translation="MQRQEVSTRRKALMFAHFIPCKHLLSKAARSLPYRLFRGAQYAR
                     KGFQSPQGGSCCSCCCRGRARETSRHISACAGDHTPRTSASDTSGAVENAHQVTSTGA
                     SALPTNEGHPAFRFVQQVAGISEYQLDANGLRVLLRRDAAAPVATVMITYLVGSRNEA
                     AGITGSTHLLEHLMFKGSRHYNKETGRPIWTVLQNIGANVNASTWFDRTNYYAVLPSE
                     FIEEAIAIEADRMRHALLREEDLLAEKTVVRNEYERGENDNFQALDKEIWATAYQAHP
                     YHHPTIGWRDDIEHATAAALRRFYDTFYHPNNATLSIIGDIPDTCTVLGWVAQYFGPL
                     PASTHSIQEKQVVPQEDVQRGPRRLIVKRSGRQHIIGIAFKAPPGLHEDAPALAVLSV
                     ALSGGKTGRLYRRIVDAGLATRVYAWESSFRDPGLFQIYCFLTPQADSPTVERILWEE
                     IEQIKKEGIELAELERAKSQVNAYLKFSRDGTFGIADGLNESLAMGDWTAFCRNRIEP
                     VRLEDVQRAAQRYFREDASTTGWFVPLRSEDDDVQEDPAFIDHEDAAAAPAGRIVEDA
                     ESSMDAQRREATRVAPTALPLTTQKRRSTTAGAEASGSPAPAVPRSRIAARTHREMLF
                     EGGLTQFTLRTAAEEVVTLVGSLAGGTDHGDREPFGSLMVAEMVSDMFDQGSRHRDKF
                     AISELLENVGARVSFGVTRNRLRFRGRCLRKDLPLVASLLMEQLTEPRLDMNDFEMAK
                     LRFLGDLEASKESTGRRADELFSAALFPRGHPNFVYPLEELIESLRALKVDDVERFAR
                     MYGFGSDARFIAVGDVDPQETRSLLEATCPSGWRRSGFPATLPLELRALDRVTVANAS
                     TKHPSSVSSWRTYRVPDKDSVDVQIGQSLGMDSNHPEYYALAMGVFILGGNFSSRLMQ
                     VVRDELGLTYGIGAGVEGAELGTDGLWRIGATFGSTNVERGVAATLEQVERWYHDGVT
                     QAELDAKKATVYGSYQVGLATTRGLAGAIMSTLDEGRPLTWVDDYVDRIGSLTVDEVN
                     TAIRRWVDPDALVIAAAGNL"
     gene            208163..210033
                     /locus_tag="CYME_CMQ090T"
                     /db_xref="GeneID:16996532"
     misc_RNA        208163..210033
                     /locus_tag="CYME_CMQ090T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461549.1"
                     /db_xref="GeneID:16996532"
     gene            complement(<209152..>209940)
                     /locus_tag="CYME_CMQ091C"
                     /db_xref="GeneID:16996533"
     mRNA            complement(<209152..>209940)
                     /locus_tag="CYME_CMQ091C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537987.1"
                     /db_xref="GeneID:16996533"
     CDS             complement(209152..209940)
                     /locus_tag="CYME_CMQ091C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538044.1"
                     /db_xref="GeneID:16996533"
                     /translation="MSRAASLRAELTSLANAFEEERISSAERLDADLVRQAVEQAKPE
                     NLEQWKQVVHDATAKLQQFWEDSEQALIRETYALATSYLRESDDEVHRLQMTKKALEE
                     QLETERRRSTRIEEQLAALQSRLLDSAAPAATTPADDARTQQEVLRSELQGFMQELVR
                     NQRESLRVLQEELQRVREEASVREENLLRQIAHLKTELAVARTDNEVSSRQLRQLETS
                     AGREEVQDELGPGTIWPPHLTPRRGHRRFQRHNRLEDAPAPPEF"
     misc_feature    complement(209956..213155)
                     /note="repetitive element"
     gene            complement(<214439..>214963)
                     /locus_tag="CYME_CMQ093C"
                     /db_xref="GeneID:16996534"
     mRNA            complement(<214439..>214963)
                     /locus_tag="CYME_CMQ093C"
                     /product="thioredoxin"
                     /transcript_id="XM_005537988.1"
                     /db_xref="GeneID:16996534"
     CDS             complement(214439..214963)
                     /locus_tag="CYME_CMQ093C"
                     /codon_start=1
                     /product="thioredoxin"
                     /protein_id="XP_005538045.1"
                     /db_xref="GeneID:16996534"
                     /translation="MFVIGNAPSSPSGRNAGTRAVCSRPMSSHCPVVRNQSQRQRWAS
                     RRVPAFEKRRVAGSARTLVCKAPTLTDDMFESEVLQADVPVLVDFYAEWCGPCKLIAP
                     LIDWAANEFSGKMKVYKLDTDTNPKFLTRYGISGLPTLILMKKGDVVARHEGAIGKPA
                     LTQFLTENLPELVP"
     gene            215144..217595
                     /locus_tag="CYME_CMQ094T"
                     /db_xref="GeneID:16996489"
     misc_RNA        215144..217595
                     /locus_tag="CYME_CMQ094T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461550.1"
                     /db_xref="GeneID:16996489"
     gene            complement(<216650..>218488)
                     /locus_tag="CYME_CMQ095C"
                     /db_xref="GeneID:16996523"
     mRNA            complement(<216650..>218488)
                     /locus_tag="CYME_CMQ095C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537989.1"
                     /db_xref="GeneID:16996523"
     CDS             complement(216650..218488)
                     /locus_tag="CYME_CMQ095C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538046.1"
                     /db_xref="GeneID:16996523"
                     /translation="MGAWKRLEVSTSNPVRSSDVRKLRQELLLQEAHWITEEEVDQIL
                     PHSKSKNIILVKCSTPKASVYVVEQDPVLFQPARSSLYYPTVYTLWKVRRWPALETIS
                     QVSKFLLGGADLMLPGVFRDDPALTWRATQVIAVRVRGNPCALAVGTTLIGSDSADKN
                     TKGKVLAVEHFFGDALWEYGSKAVPNRGFILGEVVEAVPGDDDDDDDNDRNAGGEEAG
                     LETSTMKAGEAPPPSRNDNAATTSASSTVDANHAIDEVAQDLEAQHIIDTAETENERA
                     LDVEPDQLLIQSFLQALKIHPSLALPIDASKFYTEFVVPSRPAGTALDLKATSYKKLG
                     AFLKAMVKRKLIKTKEQRGAILIVEVDRNHELLQSFESHNSAAFSASETRESQSLAET
                     ERVIHVEEWFKAKPHQRAFLEALAAGMPSVMDAVADTSQGAEFFQSDQLFKLLEHYVR
                     AHGLERPRNIVEMNEDLCSFLQCAPTGSPRQLPFRELFDRMLESMEIWHRIGRDGKLQ
                     RGRVKPIQVIVEDRQGGRKHITRIQRMRVYGIDDQQFAADAQRRFAAAATVSEIAGSA
                     KKGGIPDTEVTLQGSFADEVVELLTGTYHVPAHLAEIVDKRKKRGK"
     gene            complement(<220383..>221285)
                     /locus_tag="CYME_CMQ096C"
                     /db_xref="GeneID:16996524"
     mRNA            complement(<220383..>221285)
                     /locus_tag="CYME_CMQ096C"
                     /product="phosphopantothenatecysteine ligase"
                     /transcript_id="XM_005537990.1"
                     /db_xref="GeneID:16996524"
     CDS             complement(220383..221285)
                     /locus_tag="CYME_CMQ096C"
                     /codon_start=1
                     /product="phosphopantothenatecysteine ligase"
                     /protein_id="XP_005538047.1"
                     /db_xref="GeneID:16996524"
                     /translation="MDPSFTAYYVAELPLQSSIRNFLERQRRFQRNLAVVSSGGTTVP
                     LEKHTVRFLDNFSTGRRGAASAEYFLESEYAVVFLYREGSLRPLQRRLAKLVTDPVTV
                     LVSEGHIKEGVASFRVTADAQAALVQYERALKEERVLEVPFCTVYEYAQYLELIASAS
                     AVFERNAILYMAAAVSDFYLRFEDFKSHKRTSDSALVLKLSCTPKLLDLLRELWAPQA
                     FVVAFKLETSMETLHERAQLTASRSGAHIMVANLLHERHHRVWILENGRMEEIECPES
                     DTEIEKRIVEAVIASHRCYLDADR"
     gene            <221722..>224457
                     /locus_tag="CYME_CMQ097C"
                     /db_xref="GeneID:16996525"
     mRNA            <221722..>224457
                     /locus_tag="CYME_CMQ097C"
                     /product="probable ATP-dependent protease Lon"
                     /transcript_id="XM_005537991.1"
                     /db_xref="GeneID:16996525"
     CDS             221722..224457
                     /locus_tag="CYME_CMQ097C"
                     /codon_start=1
                     /product="probable ATP-dependent protease Lon"
                     /protein_id="XP_005538048.1"
                     /db_xref="GeneID:16996525"
                     /translation="MILQRVLRSARPERYAGSLERLTRLTQRRQWTLPLRQSRGFSSE
                     SDAAAAENKEPPSQPSEHSASDAVAQPPSIVQRVPFRELVLPCIPLYRRPLFPGIVAP
                     ILVQDSAACEAFLAMKDGGNRFAGLFLHKSAGQGRQQGGGEAPGGITALPADGLLRGA
                     PDPDQLFKVGVIGELLRMAPRPKGLELTYMCHHRIRATGVARREALLFLHTEPVQEEK
                     VEQTTSIRAYSLAVVETLRELLSAGSLYKEQLELLLESVDVNNPYHLADLGACLASTA
                     DAAALQEILEEPRLEERLSKTLGLLKSELETIRVQRKISRQIEENVSNAQRKFFLNEQ
                     LKYIRKELGLEKDERESVKSKLLARLEQKQVPKQAASVIDEEMQKLSALDPASSEYNV
                     TRNYLDWLTIIPWGVYSQDNLDIQNVRAVLDEDHYGMDDVKKRIQEFIAIGKLKGTVE
                     GKILLLSGPPGVGKTTIGKSIARALGRKCYRFSVGGMSDVAEIKGHRRTYVGAMPGKF
                     IQALKVAQTQNPLILIDEIDKLGRGWQGDPSSALLEALDPEQNNAFLDHYLDVPVDLS
                     KTLFICTANVIDSIPSPLLDRMENISLPGYILEEKVAIARRHLVPQARKAAGLTARQL
                     VIREGALRALARDYCREAGVRSLQKQIERICRKVALQIVNQDIGQMVVNSESLPELVG
                     KPPYASELAYRRMPSGVARGLAWTPLGGAVLYVESIDTGHQGSGGAFTGGPRLHTTGQ
                     IGSVMKESSDIALSFARRFLQAKDPANRFFERAYIHMHVPEGATPKDGPSAGCTMVTS
                     LLSLALNRPVPSDLAMTGEMTLTGRILPVGGIREKVVAAKRAGLKRVLLPQQNIRDWE
                     ELPDYIRRGLEVSFVSSYDDVYRIAFASAGAGASAGASGPADANADDARETTAVA"
     gene            complement(<224867..>231538)
                     /locus_tag="CYME_CMQ098C"
                     /db_xref="GeneID:16996549"
     mRNA            complement(<224867..>231538)
                     /locus_tag="CYME_CMQ098C"
                     /product="DNA polymerase epsilon, catalytic subunit"
                     /transcript_id="XM_005537992.1"
                     /db_xref="GeneID:16996549"
     CDS             complement(224867..231538)
                     /locus_tag="CYME_CMQ098C"
                     /codon_start=1
                     /product="DNA polymerase epsilon, catalytic subunit"
                     /protein_id="XP_005538049.1"
                     /db_xref="GeneID:16996549"
                     /translation="MALDGYLDPDEEQLSSGAEDEDAEVDVRTLPAHDTQVERDSRAA
                     LDARDRMAGFFPLPPVLDGFRAPERIGWLLNVAVAAVHDPASGRQVSALDCYFLSGDE
                     GGGDFRVTLCYRPYFYVGCTPGKETDVESALKRDFSDVLSGIHRAELEDLDMLNHLAT
                     RARRLFLRVETFTTDDLVRIRSHLLSYANGKQNPSLIPGDLSTDASASLSSAAQRIRR
                     TDPYENIVELREYDVPYVTRVCIDCDIRCGYWYRVEHSLSSGGAAPKLHLLSELVERA
                     NPTVLAYDIECTKAPLKFPDPYADDEIMMISWMLDGRGYLGVNRQIIAEDIHGFTYAP
                     KPEFESSFVVFNEPDEASLLRRFFAEARAAQPRVYVTYNGDAFDWFFVHVRASRLGIN
                     ILDKIGMSFSAARGLCRGRAAVHMDCIHWVNRDSYLPQGSRGLKAVTRALLGYEPHEL
                     DPEEMLTAARTRPQELAAYSVSDAVATYQLYMKYVQPFIFSLCNILPFGPDDVLRKGS
                     GTLCESLLMCEAHRRNIVAPNKFKNNATERTFQSRLLANETYIGGHVEALQSGIYRAD
                     LPIPFRIDTAAVRELQENLDQFLQFAIEREQDLHLEEITDYENVRADLAERLKRLAEQ
                     PLLQERPLILHLDVGAMYPNIILTNRLQPHACVTRETCAACDFNGTSDCRRKMHWVWR
                     GECYPATIGEVQSIRASVLTTVRARRRQGEKVSDDDAEAMYRKRLREYCMKVHKRVLE
                     PTVQTREAWICQRENPFYVDTVRAFRDRRYEYKRLLKQWRKALAESGGASIEARNMCI
                     VYDSMQLAHKCILNSFYGYVMRRAARWYSMEMAGVVTQTGASIIRLAREWIERVGLPL
                     ELDTDGIWCAIPATFPNDITLHTRSGREISISLLCTVLNTKVAAQYTNHQYQEWSPDE
                     GTYKQRSEFSIFFEIDGPYRAMVLPASREEGKSIKKRYAVFQRDGSLAEIKGFELKRR
                     GELKLIKVLQSEIFGRFLEGSTLAECYAAVGETANLWLDVLDSNGGLLSDAELLELVA
                     EQTHMSKPLAAYIQAGQKSSAITCAKRIQEFLGKDMVRDKGLACRYVIARYPLGTQVT
                     ERAIPVQIFSADLEQRQALLRKWLREPVYNFREILDWDYYRGRLANTVQRIISIPAAC
                     QGVPNPVPRIEHPDWLRRRLRDLACAQKQTTLKSFFRADQKATPDLEDIVVVKTGPLP
                     RRQPCSDARGIANTSLLNAAVAAGAAGAAGATSSVDLARTVLETVSTSLKWTAAGTSV
                     GFAHSAQEQVTERDASGSRLAPFRAGVQQVVQPGRCRPHSDAAARGEPPSLRPISYQQ
                     WLEAVAKPQWRLWVRQRRARRSAAAHPAGLRCRLSGLVLEHADLVEPLLVLGIRETGT
                     FQTCRVWFQTSRGRVLSLPVHVPHELWLLYRRLPPDALGQPIETSRNRAWCSDELAVH
                     TLTVRDASVSEAQLTTMARDALCLHAGYLVGLYGVQVSPLLLAVASLGIVCVLKPDAA
                     KQTLRALQLQGIALTDLDSVEKRKPADFASPSWIIVCGSHAKDRSGRGIWVIFSPDRI
                     ILILVGSFRSDAETRSTLMRLRHESSVHGDGSLQTLGNALNQTEIIHAQDWKRGLRLL
                     GLTLANRFPGGARPPLLFLQTAVPVALMRRRVPALNNYPLAVVPHVAADCSYQPTGWE
                     APAMQRTLQRVTALCAQLPLRFQLSDLYGVPIGNLSGDLVAETLDVAVARALLQRGWP
                     LDWLHRGDSLALDVDTTSDAETWPQVSVPGAYSGICIDLEIQDLPLVAILEADTLYAM
                     DRSQAPSGSLLVQVLRPLVQTWVGLEANGDQSAALLTSHLHRWIVRGLAGRTSRMLCA
                     ELLHLIRKTFHHLMETLAEMNASVIHATPFRLMLCTHRRQLSEAKAYCRFLLESCRTR
                     PVLRRLIFAPVLRYIRAAFWHDSDHYWAWTMETTPVQTEAEAPTTTTTTTTTTTTTEA
                     GAIPNGTANGNVALSYRLEYSWRDAEHWSAPARKQFAALAQGLLQHLALAGQEGQGRA
                     PHVTAAGTVGARAAPAALTPLAADQIFFLVKQWSLDREPQAAAQDAHWLFRLLLLYRP
                     WQEALLGVEHAVFRFLKCSPFAYKAKSLDASHRVIVLDPIVCSRCFAVNVAQLASSQT
                     TEALSTRSCRICACPLSEAQLRYRVAGRLSALLQTYLVQDGLCDRCGTAQGRLLSDQC
                     ECSGSCTTSRWETCTTSRALQSLFAFWNPTPCT"
     gene            228204..230555
                     /locus_tag="CYME_CMQ099T"
                     /db_xref="GeneID:16996550"
     misc_RNA        228204..230555
                     /locus_tag="CYME_CMQ099T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461551.1"
                     /db_xref="GeneID:16996550"
     gene            <234603..>235457
                     /locus_tag="CYME_CMQ100C"
                     /db_xref="GeneID:16996551"
     mRNA            <234603..>235457
                     /locus_tag="CYME_CMQ100C"
                     /product="similar to DNA repair and recombination protein
                     Trad"
                     /transcript_id="XM_005537993.1"
                     /db_xref="GeneID:16996551"
     CDS             234603..235457
                     /locus_tag="CYME_CMQ100C"
                     /codon_start=1
                     /product="similar to DNA repair and recombination protein
                     Trad"
                     /protein_id="XP_005538050.1"
                     /db_xref="GeneID:16996551"
                     /translation="MSAAPPYVRASGRRTSDSVVDASRADTASTVSANRRLQTLLDHW
                     IRRGCVTEVSGPRGVGKTHLALACACRAIRDNAEVIILDTEGGMTSDRLQRIEPSVAS
                     RMHRIQCFRPSSMTEVLALAYCMDAGVIDTSQVALVIVDTLASVVRSEFVPDRSLARL
                     GLLLQRLAHQTNAIVLVLNHVSFRILEAEGPREVPCVERIWASLCTVRIQLIGRDQYI
                     VWKGHQLDHGGVVSERSQGDGSVVGYSQPHRSGNDTQPFDASGAENPASQPSAQSDTS
                     CKEPSGSN"
     gene            complement(<236813..>238978)
                     /locus_tag="CYME_CMQ101C"
                     /db_xref="GeneID:16996540"
     mRNA            complement(<236813..>238978)
                     /locus_tag="CYME_CMQ101C"
                     /product="gamma-glutamyltransferase"
                     /transcript_id="XM_005537994.1"
                     /db_xref="GeneID:16996540"
     CDS             complement(236813..238978)
                     /locus_tag="CYME_CMQ101C"
                     /codon_start=1
                     /product="gamma-glutamyltransferase"
                     /protein_id="XP_005538051.1"
                     /db_xref="GeneID:16996540"
                     /translation="MTDQITVLSPRKQIDRRTTFLDVESQQQREPFLVRSGLELPSWW
                     EGERDPRELRKYALLFFFLVLFAAAVLSIPIFLPPSDERAGTSTPSQAADSTHDSKGG
                     PVAGGSDAHKGARGDDTTAASLVENFAPFGKSILARGERYGAVAADNPVCSKLGLQVL
                     SELGGNAVDAAVTSALCQGVLSPFASGIGGGCFALVRLQNGSTDFIDARETAPMNLTH
                     QLLRERGPESTRHGGLSIAVPGELRGLELMHALYGKLSWRDVVLPVIPLARNATVGTM
                     LAYRLAQNAPTILKSPTLCEVFCDPSGSRVLAENETLVQTALAELLTQIALHGADYLY
                     NHSASTLAKEIQEAGGLMTAEDISGYQPKRRQPLQSFYRGFEILGSSLPSSGGPAIAM
                     ALNILEGYNMPSRGHSNESLQLVTEALKYAFASRSQLGDPDFVPEAAVHVSDYMVNKA
                     AAARLRETLDTLQTHPADYYFDAERIHSTIGGVDDHGTTHLSVLDAQGNAVALTSTIN
                     TEFGSMIRSRSTGIVFNNEIDDFSVAGHPNAFDISPSEPNFPVPGKRPLSSMSPTIVV
                     RNGRTVLVVGGSGGPRIISSTLQVLINVLDFADGLVEAISMPRVHHQLLPNVLWMEAV
                     GQKCELGGVRSAQEKNSGIWTQMCQYMRRVGHEIEGSQDHESIAPEMVGCVQAVVRPH
                     AGLPLFALHSNEPVQRGTVQDGIMYAASDPRKRGQAAAA"
     gene            complement(<243101..>244084)
                     /locus_tag="CYME_CMQ102C"
                     /db_xref="GeneID:16996541"
     mRNA            complement(<243101..>244084)
                     /locus_tag="CYME_CMQ102C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537995.1"
                     /db_xref="GeneID:16996541"
     CDS             complement(243101..244084)
                     /locus_tag="CYME_CMQ102C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538052.1"
                     /db_xref="GeneID:16996541"
                     /translation="MEEWCKITVPSCPDAVATRCLERGACLAFGAYELHENRRIGGVG
                     LIKFSPEDKPLLAWKALDFGVLDLHWFNENSLVVASADGGIRALQVQDGASGWTVQQH
                     LDGPAIALSVCLGAGASEGKIVTSFADGAIALATLDSPSWLWERTQAHAHEAWFACFG
                     AQEYLIMSGGDDGYLRLWDSRLRPQEDPCVSSYQAHEALGVTRACFLDEHVFVSGGFD
                     EKLRFWDTRMLGRSWQTLQMPGGPWRIEVRGTSLLVACMQGHAAIVDLLGPLPRLQVH
                     LGQHMDHSLVYAASWLPGLGHNLKCVTASFYERILYVWRSAPADSVDRKSL"
     gene            <245265..>246893
                     /locus_tag="CYME_CMQ103C"
                     /db_xref="GeneID:16996542"
     mRNA            <245265..>246893
                     /locus_tag="CYME_CMQ103C"
                     /product="probable pantothenate kinase"
                     /transcript_id="XM_005537996.1"
                     /db_xref="GeneID:16996542"
     CDS             245265..246893
                     /locus_tag="CYME_CMQ103C"
                     /codon_start=1
                     /product="probable pantothenate kinase"
                     /protein_id="XP_005538053.1"
                     /db_xref="GeneID:16996542"
                     /translation="MRVRRETRGKAEGDPDDALDGFVPPSLVCKGTALAVLKRVNVLA
                     ESNALALDIGGSLAKILYFQPNTRGTAERQLCIDFLEPVAAAHRSALSVAVQELGGTF
                     HFFAFETRNIEECVQFIKEHWMPTNTEKPYVIRSTGGGAYKYRELFRAIGVELSTQDE
                     MACTVAGLNFLLTHFEHEVYSVTVAPDTQIGSPNPIIQRNYLDARPDPYPYLLCHIGS
                     GVSFIKVQGPRSFRRVSGTSLGGGTFWGLCRILTNCKTFDEVIELTKKGDNSRVDMLV
                     GDIYGGAYEKLGLDANLIAASFGKVTMRKEPSPTFENFRRELRRFIVGTMSLFVQLLI
                     ALPFLGQIFRWLGLERRAHATLSNVYFSRHFHAEDVALSALRMVSYNVAQLAYLNAVI
                     ENVPRIYFGGSFVREHPFTVSAISYAVEFWSKKNMQALFLVHDGYLGALGSYLGVDWT
                     ESEQFADEQIPTNAISQMHSHVAMNRVIFNPAANGSSRKNKRQRRKQSLASAPSSAAA
                     PMHFSKARSQQRSALGDEHGPEFEGTGTETSRLD"
     gene            complement(<248184..>248498)
                     /locus_tag="CYME_CMQ104C"
                     /db_xref="GeneID:16996543"
     mRNA            complement(<248184..>248498)
                     /locus_tag="CYME_CMQ104C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537997.1"
                     /db_xref="GeneID:16996543"
     CDS             complement(248184..248498)
                     /locus_tag="CYME_CMQ104C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538054.1"
                     /db_xref="GeneID:16996543"
                     /translation="MDTSPCTGKNTKKCGSRKSAQLENAGPCKRFVNETNKQNKFPQH
                     RFVKAIPIKTTTNLKPRMNSYAHIAAVRYSMLYMETMSENIDSREPSEHVSLPFSTDT
                     DN"
     gene            complement(<251743..>252144)
                     /locus_tag="CYME_CMQ105C"
                     /db_xref="GeneID:16996544"
     mRNA            complement(<251743..>252144)
                     /locus_tag="CYME_CMQ105C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005537998.1"
                     /db_xref="GeneID:16996544"
     CDS             complement(251743..252144)
                     /locus_tag="CYME_CMQ105C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538055.1"
                     /db_xref="GeneID:16996544"
                     /translation="MFVPQSVPLGCQRSRPVLVSTCSQSRVLLRAELSSDDEDFASAP
                     PAIRRLLTKHKQSARTLFGRAQSGADEHANLWWLSGEDYVNPDGIMELAERTSDDAAP
                     GTAEAFWTAFLNSGLADAEDVPGEAKKPTEL"
     gene            <252259..>252948
                     /locus_tag="CYME_CMQ106C"
                     /db_xref="GeneID:16996545"
     mRNA            <252259..>252948
                     /locus_tag="CYME_CMQ106C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005537999.1"
                     /db_xref="GeneID:16996545"
     CDS             252259..252948
                     /locus_tag="CYME_CMQ106C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538056.1"
                     /db_xref="GeneID:16996545"
                     /translation="MSDATNNAVLVRNLSPEVTKQTLLDFFSFCGEISAVKIRPSVGE
                     GGSSSSGSPTEAMEALVIFENQSAKKTALVLDSATLKKRKISVMDATEELVSSFKDVR
                     EVDLARDSTDVPETATARQERLQGLREEFDRAIKRASDKLSDFNEKHRITEKVQEFGD
                     LTKRKTQEINEQYRLTERAREGWQTVREKTRELDERLHLSESARDGWRSLKASVSKIM
                     QKDRGGEVDKA"
     gene            complement(<255438..>255905)
                     /locus_tag="CYME_CMQ107C"
                     /db_xref="GeneID:16996552"
     mRNA            complement(<255438..>255905)
                     /locus_tag="CYME_CMQ107C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538000.1"
                     /db_xref="GeneID:16996552"
     CDS             complement(255438..255905)
                     /locus_tag="CYME_CMQ107C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538057.1"
                     /db_xref="GeneID:16996552"
                     /translation="MASLSFGALGLVSCSQIAVQVFVRGAADLQDLLNNEPLAWSDVL
                     ARQGNSKPRSPSAERTIARARAGGIGGRATPRDGSESYLDRVPKQRKPWDLQGQWKDK
                     LSGAGPKSNPFGTTATLEDVLSKVPSRKTGVGGSWARLAPRRPAGFDNRQFGD"
     misc_feature    complement(256009..258865)
                     /note="repetitive element"
     misc_feature    259059..260264
                     /note="repetitive element"
     gene            <262067..>263902
                     /locus_tag="CYME_CMQ110C"
                     /db_xref="GeneID:16996553"
     mRNA            <262067..>263902
                     /locus_tag="CYME_CMQ110C"
                     /product="similar to nuclear LIM interactor-interacting
                     factor"
                     /transcript_id="XM_005538001.1"
                     /db_xref="GeneID:16996553"
     CDS             262067..263902
                     /locus_tag="CYME_CMQ110C"
                     /codon_start=1
                     /product="similar to nuclear LIM interactor-interacting
                     factor"
                     /protein_id="XP_005538058.1"
                     /db_xref="GeneID:16996553"
                     /translation="MVALELPAAMSKVEVVGLVESNTGRQAVLVSGEQEAGQPDRNWF
                     TSQTAADLCTQSRPRTRQMGPVYCPILGREPTTKNRARSDQNSLYVREACEGTVYASN
                     RYETRTSELSREAPRDEAGDGRAQVQTTPTLISAEKRLEETNSLPCVLEGSSSHMPRV
                     LNSTVEVPICKSRNISAADEQPEVLRERSLEKNVKHWSSIHFLLSAALRPQYSTTVKE
                     DDCSRRARRRVHTRSRSAGYGALRVVPEKYLLDRTHASVLGASNQRVLRWLAPHTGES
                     GVQLSSSSSSAAAAAAPRSVTGTGALVSRPREGGSEHAAPKCSSTSFTARKRGRNISC
                     TLNSNVNKCSSRDTDSDGSSAVTEMIPDTEHILIHQAGVSSLAVEVDGEIDPWLIIAT
                     LPPREYAAPAPQIRLPKPDPAVRDRPTLVLDLDETLVHCSTEFMSDADFNFSVHFEGT
                     NYTVYVKRRPFLQALLQYAARYFEVVVFTASQKAYADRLLNILDPDHTLIHHRLFRDA
                     CINVAGNYLKDLTVLSRDLRRTIIVDNSPQAFGYHLGNGVPILTWTDDENDRELIQLI
                     HLLEDMRDELEHGSGDVRFLVERRFRNKNRVEFYRAFLASIDSAQ"
     gene            complement(<265067..>266368)
                     /locus_tag="CYME_CMQ111C"
                     /db_xref="GeneID:16996586"
     mRNA            complement(<265067..>266368)
                     /locus_tag="CYME_CMQ111C"
                     /product="DNA topoisomerase VI subunit A"
                     /transcript_id="XM_005538002.1"
                     /db_xref="GeneID:16996586"
     CDS             complement(265067..266368)
                     /locus_tag="CYME_CMQ111C"
                     /codon_start=1
                     /product="DNA topoisomerase VI subunit A"
                     /protein_id="XP_005538059.1"
                     /db_xref="GeneID:16996586"
                     /translation="MVAKRKKTATEPRLSTASRKWKQAAESGAVSSGTAAVDAESFLN
                     RVRELKREIESREAAKQRFILQQSSDASSAARIEVRELDCDQVLAELERVILSAAKSI
                     LEGRGLSYKVPRRSAGNQEYVEELERIVLKDGVAIRNFASVASVRKTTIMTRVLQLVH
                     ELCTRRIHTTKRDLFYTDVKLFRQQTESDDVLNDVACLIGCTRNSLNVVASEKGIVVG
                     RVTFQEDGDLIDCTRMGVGGKAIPPYTDRITNITSDAEFILLVEKDAAFMRLAEDRFY
                     NRVKCIIVTAKGQPDVGTRLFLRRLKRELHLPILGLVDSDPYGLKILSVYMSGSKGMS
                     YDSANLATPDIKWLGIRPTDLDRYGIPEQCRLAMTENDLKTGKDMLEEDFIKKNPAWH
                     RELSLMVKRKEKAEIQALSNFGFQYLTEVYLPEKIRHGDWI"
     misc_feature    complement(266875..268662)
                     /note="possible transcribed region"
     gene            <269025..>269534
                     /locus_tag="CYME_CMQ113C"
                     /db_xref="GeneID:16996588"
     mRNA            <269025..>269534
                     /locus_tag="CYME_CMQ113C"
                     /product="similar to translationally controlled tumor
                     protein p23"
                     /transcript_id="XM_005538003.1"
                     /db_xref="GeneID:16996588"
     CDS             269025..269534
                     /locus_tag="CYME_CMQ113C"
                     /codon_start=1
                     /product="similar to translationally controlled tumor
                     protein p23"
                     /protein_id="XP_005538060.1"
                     /db_xref="GeneID:16996588"
                     /translation="MIVWKDVFTKDELLSDGMKNVRELENGLLLACDSYNVTLGGGDY
                     GIANNDEEAMGAGGDTAGAESVNVVVDAFKLQNIQLPRKDFQVYIKKYSKRLKEYLEN
                     ENPSRVAAFMEGMKEWVPKMLKEFDEYEFYMGPSCDPDALLVLAKYEGESHYPTFLYL
                     KDGLAEEKF"
     gene            complement(<269630..>270622)
                     /locus_tag="CYME_CMQ114C"
                     /db_xref="GeneID:16996576"
     mRNA            complement(<269630..>270622)
                     /locus_tag="CYME_CMQ114C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538004.1"
                     /db_xref="GeneID:16996576"
     CDS             complement(269630..270622)
                     /locus_tag="CYME_CMQ114C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538061.1"
                     /db_xref="GeneID:16996576"
                     /translation="MLHRVKLSLKSSKDAVLRRGPASAPETRYEAAMDVLDSLERRAQ
                     RVRAVLAANENAWKSLLANMSDATGSIQTMFEATHPFYSTATDTANVVSALEQHMCKI
                     GLLRPPPTGYRQNESKPTPEGVQSVLAQVDEFLEKCKEMRKRAHVYEERLREVNYYLT
                     KVEKLEAAQKQDSDARLERNRLKLLESRQSAEDACNSLQLGVEMLERNKDVVFSRALI
                     VYISNQLAALKFEPLIEQDRELQDIMTEHGSLTSQKIDWTESSQVNTSGERTSQRMQS
                     PTSKTPSRFSADASPLSDSVDHSVAGGASPPPEFDPHEFAEHREQEPEPEGNLA"
     misc_feature    270850..272711
                     /note="possible transcribed region"
     gene            complement(<274153..>275274)
                     /locus_tag="CYME_CMQ116C"
                     /db_xref="GeneID:16996578"
     mRNA            complement(<274153..>275274)
                     /locus_tag="CYME_CMQ116C"
                     /product="similar to phytoene synthase"
                     /transcript_id="XM_005538005.1"
                     /db_xref="GeneID:16996578"
     CDS             complement(274153..275274)
                     /locus_tag="CYME_CMQ116C"
                     /codon_start=1
                     /product="similar to phytoene synthase"
                     /protein_id="XP_005538062.1"
                     /db_xref="GeneID:16996578"
                     /translation="MDQWRTPGGYRNLQDFEARQPSSLEKGETGCRTGSTTETHAFTA
                     GRMSVHTFPTSWEPKFPTVLEAQRQDYEYCLQQLRQMEYGAYLINVLHAEQRARCAHA
                     ALFAFNLQLARIKDSVSNEDMGRLRLSFFRNAVHGIYDGSSAETGVRTSISSPTLRAL
                     CETIQRFALPVEPFEALFAAREQDLKYPQPHTIQDLVEYTQASHGSCIALHARILHAV
                     GANGEPPKRETAQLLDRVAMDVGTAAGLATLLRGAPYHAARLQTYVPRDVMEAWKISA
                     KELVNLQVQSSVDRRGAFQSIALVAEEYLERARSDKETWKRIPRSCRLAFLPAVLAAD
                     YLRKLRASGYDAFDRRLQLPMTPGIQLRLLLSRLIGRLL"
     gene            <275462..>276189
                     /locus_tag="CYME_CMQ117C"
                     /db_xref="GeneID:16996535"
     mRNA            join(<275462..275561,275819..>276189)
                     /locus_tag="CYME_CMQ117C"
                     /product="eukaryotic translation initiation factor eIF-1A"
                     /transcript_id="XM_005538006.1"
                     /db_xref="GeneID:16996535"
     CDS             join(275462..275561,275819..276189)
                     /locus_tag="CYME_CMQ117C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-1A"
                     /protein_id="XP_005538063.1"
                     /db_xref="GeneID:16996535"
                     /translation="MPKNKGKGGKNRRRGKSDNDSIKREIVFKEDGQEYGQVLRMLGN
                     GRCEIHCFDGQKRLGHIRGKMRKKVWVNAGDIVLVGLRDFQDDKCDIILKYSADESRA
                     LQRKGELPDNIVLNEATDTGDGAEVEFEVDFDEEEEVAKQPARGAMPELDIDDI"
     gene            <277185..>277340
                     /locus_tag="CYME_CMQ118C"
                     /db_xref="GeneID:16996584"
     mRNA            <277185..>277340
                     /locus_tag="CYME_CMQ118C"
                     /product="60S ribosomal protein L39"
                     /transcript_id="XM_005538007.1"
                     /db_xref="GeneID:16996584"
     CDS             277185..277340
                     /locus_tag="CYME_CMQ118C"
                     /codon_start=1
                     /product="60S ribosomal protein L39"
                     /protein_id="XP_005538064.1"
                     /db_xref="GeneID:16996584"
                     /translation="MPSHKTFKIKIKLAKKAKQNRPVPVWFRYKKDTKIRYNNKRRHW
                     RRTKLNF"
     gene            complement(<277644..>278510)
                     /locus_tag="CYME_CMQ477C"
                     /db_xref="GeneID:16996585"
     mRNA            complement(<277644..>278510)
                     /locus_tag="CYME_CMQ477C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538008.1"
                     /db_xref="GeneID:16996585"
     CDS             complement(277644..278510)
                     /locus_tag="CYME_CMQ477C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538065.1"
                     /db_xref="GeneID:16996585"
                     /translation="MNQERGAPPEAWNLLFSELLAATATLREKLDYLRQLSVTLESQQ
                     TLREWAAEYAPSVLSAAQASIASAQFMIETLSTGAPTHQGTLENETVQVGSTPETLSE
                     NIELGKLSAKRALAASPVGFREVQEASSYGVEQREARTYNGHAAARSGSRETGVPVNS
                     KAHRLRFTEAEDAIFSEVYHELAPRIRSKVQIAKEVQARLPNGQERKWNVVYKHLLLL
                     KEKYDWPSYSKNEKHAPSGADDDSQVYLNDAVIGVREAPNRQTPLSARGPTMPRGASS
                     PKESKLDTPWEL"
     gene            278691..280432
                     /locus_tag="CYME_CMQ119T"
                     /db_xref="GeneID:16996621"
     misc_RNA        278691..280432
                     /locus_tag="CYME_CMQ119T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461552.1"
                     /db_xref="GeneID:16996621"
     gene            <280936..>282447
                     /locus_tag="CYME_CMQ120C"
                     /db_xref="GeneID:16996554"
     mRNA            <280936..>282447
                     /locus_tag="CYME_CMQ120C"
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /transcript_id="XM_005538009.1"
                     /db_xref="GeneID:16996554"
     CDS             280936..282447
                     /locus_tag="CYME_CMQ120C"
                     /codon_start=1
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /protein_id="XP_005538066.1"
                     /db_xref="GeneID:16996554"
                     /translation="MAVCFVLPHNGLAAVAGRRAQSGWKPSGALFRETRMVISAKPDS
                     KKNTGGRVWRPSSWREMPVKQVPTYPDEARLQDVEARLHKALPLVYTGECEHLKKLIA
                     KASRGEAFVLQGGDCAESFEEFEKYGGDNIRDTFLLLIQMSIVLMYALGLPVVKIGRM
                     AGQFAKPRTSPMEREKNKKLELPSYRGDMINGPEFEARARVPDPERMLRAYHQSTATI
                     NLVRALAYGGFVDLHRIHEINLEFVNGTPQGKRFFEYAARITDALRFMSSCGIQANSP
                     MIKQAEFFVSHEALLLPYEEALVRQDRETGKYYATSGHMIWCGDRTRQPDGGHVEFLR
                     GIANPIGIKCGPSLTEAELIELLDILNPDNEPGRITLISRVGAGRVREHLPRFIECVQ
                     REGRIVTWSCDPMHGNTVTTASGVKTRRFDDILSEVKEFFEVHREMGSIPGGIHLEMT
                     GQNVTECIGGMYELSDADLATRFESRCDPRLNASQSLELAFLLSEYMSGKRTD"
     gene            complement(<282540..>283106)
                     /locus_tag="CYME_CMQ121C"
                     /db_xref="GeneID:16996555"
     mRNA            complement(<282540..>283106)
                     /locus_tag="CYME_CMQ121C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538010.1"
                     /db_xref="GeneID:16996555"
     CDS             complement(282540..283106)
                     /locus_tag="CYME_CMQ121C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538067.1"
                     /db_xref="GeneID:16996555"
                     /translation="MQQPVWGRKLLTVAQDVLEDTRRDGRRLFSHTERNICWRNAQVV
                     PGRHPRRWRFDRVGNLVCRALHGCNGPLCYEYDHRAPWGKGGRSDSTNCDVLQTSANR
                     WKSDQPESRVTEKLLRAHSRVLSRSLSQEELDTIEYVIYGDILRPDGTRLLELPVLQK
                     PAAHRNDTPNTSRAWARLNADRSLCSIM"
     gene            <284595..>285230
                     /locus_tag="CYME_CMQ122C"
                     /db_xref="GeneID:16996556"
     mRNA            <284595..>285230
                     /locus_tag="CYME_CMQ122C"
                     /product="small GTP-binding protein of Rab family, Rab6"
                     /transcript_id="XM_005538011.1"
                     /db_xref="GeneID:16996556"
     CDS             284595..285230
                     /locus_tag="CYME_CMQ122C"
                     /codon_start=1
                     /product="small GTP-binding protein of Rab family, Rab6"
                     /protein_id="XP_005538068.1"
                     /db_xref="GeneID:16996556"
                     /translation="MSTQAGATAAALSKYKLVFLGDQAVGKTSIITRFMYDKFDNNYQ
                     ATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVTSRRSF
                     LNTAKWIEEVRNERGNEVIIVLVGNKSDQNDKRQVSVEEGEAKAKELDVLFIETSAKT
                     GANVKALFRKIAAALPGSSSTTSRGSQLIDVKLTPQEPAASPSQQSSSCLC"
     gene            complement(<285407..>286024)
                     /locus_tag="CYME_CMQ123C"
                     /db_xref="GeneID:16996579"
     mRNA            complement(<285407..>286024)
                     /locus_tag="CYME_CMQ123C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538012.1"
                     /db_xref="GeneID:16996579"
     CDS             complement(285407..286024)
                     /locus_tag="CYME_CMQ123C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538069.1"
                     /db_xref="GeneID:16996579"
                     /translation="MQCQAFALSALQSFGTLGSIGVIGFCAHALHETSWRSSISAQNS
                     RPLLVLRADRVWGGDGWILTRGGKLGKKRLPMPGADSARSRIRNGQLPAFERKQTTGV
                     VPRVPTDAGSTAGSSSSAAEKPPKTASAQSVQTHDRASTGNGAASTTSATASAKASVT
                     EPEAGASTKKAVGAGTAPSPFSLFRNHRPTRLPGPPRSFDRNAFP"
     gene            <287735..>288955
                     /locus_tag="CYME_CMQ124C"
                     /db_xref="GeneID:16996563"
     mRNA            <287735..>288955
                     /locus_tag="CYME_CMQ124C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538013.1"
                     /db_xref="GeneID:16996563"
     CDS             287735..288955
                     /locus_tag="CYME_CMQ124C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538070.1"
                     /db_xref="GeneID:16996563"
                     /translation="MNTESRWRRQFGRGAMLSSNTLAGFVNVFGPVAGQAGSTRAALR
                     SATVRLSRVCTDAVSRRNRKQATCMRPRSRARLFMGTDTNPDGEDNETRSGSQGGQNS
                     SDVEKHKEASASSGQSGRSDMGTRDIEFNLGPKGESLTASATEKPNPFLEYIRSLSPP
                     ETLKRFAESAPKEVQAAMKQMVVNMLGNLPPFAYAVTITTLGQRLADLLYSTAMTGYM
                     LRNAEYRLSLTRSLGYWSPNDNQSNERLRQEIERIAPDSVIRLRNSDGTTTEVPAAKF
                     LGELCEEVRALKSELAQYEAGSNRILSYIRSLKPENLEQLTKSAGTEAVDAMKRTVKT
                     LLEQSGVKGELPVTLPAAELSSLLFWLMVLGYDIREKEVKMDFERQFHRGYLSSSNEQ
                     KPEDEGSGPDAPQP"
     gene            complement(<289068..>293723)
                     /locus_tag="CYME_CMQ125C"
                     /db_xref="GeneID:16996564"
     mRNA            complement(<289068..>293723)
                     /locus_tag="CYME_CMQ125C"
                     /product="probable transcriptional regulator, SIN3"
                     /transcript_id="XM_005538014.1"
                     /db_xref="GeneID:16996564"
     CDS             complement(289068..293723)
                     /locus_tag="CYME_CMQ125C"
                     /codon_start=1
                     /product="probable transcriptional regulator, SIN3"
                     /protein_id="XP_005538071.1"
                     /db_xref="GeneID:16996564"
                     /translation="MEESEDRLLERISGEASLVPPETQTVPLRVEAEPQRPQGSAGLG
                     SSEEAGMILQSTDDRSERAEALRSETENVPRDVTADTMPREGARTIEDELATLVEGAH
                     SHVRETATQPISPTSSQHKTHLEFTEKQVTQNLEPTVSGKNSSSKRESDSTERAGAAR
                     TVLKLDPQSEETSAAADRMNQPAETEEGSQARALRVEDALAYLEQVKAQFEDRPRIYA
                     KFLDIMKEFKAQTIDTPGVIEQVTRLFRGYPNLVLGFNTFLPAGYKIELSDCLDAAPV
                     HAETPGPANERDDAKITVAAEDTRARAPYPGAITRPSQHAVPDAYRVAEMSSAMGNAH
                     IRAGPEAFRAFQPSQEPKQLHVPQRVADTVADSAAVVNAQAVGVPPSLSTFNNEEFDH
                     AIQYVNKVKQRFQNQPAIYQRFLNILQAYQRDGEDKFSVLDEVSQIFRGHPDLLEEFK
                     SFLPDSVEDEIESARQITWAKRAASNLGATGGPTKRTKRSRRSETAQGVSLDGRDAPL
                     QAALVPQHLEQTIATAPHASSTAATALSGLSPISYGARAELLFFEKLRERMEAHQFHE
                     FIKCLSLYNQEIIGRTELMSLADELFGHRHILSEAFRTFLDACAPARRSKHPTDAESA
                     MSGVEAALAILEGRAPPSATAPPVDGLWRYKSLSEAAAESRERCDTSYKRIPSEFQSM
                     PCSGRGELEKQVLNDIWVSVPTGSEEGSFKHMRRNQFEDNLFRCEDDRYELDMVIETN
                     AATIHKLEPLAMVIAHMSDEEKAKHMLAEHALSAVHYRAIERVYGAHGPEMVMHVKMQ
                     PSVAVPIVLNRLKQKDEEWRRARVEMNKLWREICERNYFKSLDHRSFYFRQSDKRTIS
                     VRGLLQDIHDIAEVRTLMEAITVAVFAANIMAGSCDCVAFGCGFGHPALSREFENSWR
                     ARQVALQCVHGGTFECAHASLSAACGDSAAAPERDPFAVVSALEPPCLRFRLRLKKAH
                     QDLYALVSFLSHLEYGPMECAHLLQFYAELFGRFFGINLHDPGVRAVETPGECTAPVV
                     REETDSELADVSGLLRNELARAADERSAGDSPAASDSVSRKSSPDENFCAEMDTRDGG
                     NGLDPVILSLSEEVPSVRPGEAPAIKAETGSTSVPGPKRNARVERMRYRNDSVLFADE
                     SLYILMRLYEIAFQRLAAARQMAQSQYERQRSARMNEQRQPEAAMDLKSISDSLYNPE
                     GEARAEATLRAPSDIYREYMDMLRRYLSNAIDSQEYEDYCRRVLGPESYVLFTLDKVL
                     FKLVKQAYNTAQSRLVALYFAQEQDLVRGLVPDGDGVTDAEAQALCIAEVSYCIKALQ
                     ILRDERGGNLYRFQVQDAPGPVGSGASDLEPKEDRATLASTPAILTVTLLTSDEGIPR
                     RRDTAAAAEAAASYLGFFAWQGQHQHQHTLDMLPMAVDARKLYAFERSVVNVPLERSF
                     ASWCRRLGHATSSDPDRISLYETWKRQLMLQVLISNGLESKMSLNTNRLVHIGETCDE
                     LLRRKQDSFSGESSHMEAAASHQRHASERARRRRLRRWHQLYRQWDAAQKQSTIPVL"
     misc_feature    complement(295617..297122)
                     /note="possible transcribed region"
     gene            <301222..>301935
                     /locus_tag="CYME_CMQ127C"
                     /db_xref="GeneID:16996547"
     mRNA            <301222..>301935
                     /locus_tag="CYME_CMQ127C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538015.1"
                     /db_xref="GeneID:16996547"
     CDS             301222..301935
                     /locus_tag="CYME_CMQ127C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538072.1"
                     /db_xref="GeneID:16996547"
                     /translation="MIERCGSSFCTAYIALSVLFDVYLVRFFLDAVKVALGLPKSAGE
                     KLFSARLYKALQSTKKRSIPLFVRVISSSCDGTIWFFFPLLVGLVANSPFAWPLLLHC
                     FLVPALAELVVKSIFRRPRPSHNTRHVFLAPGERFSFPSGHSTRAAAIACFWTRWLCC
                     ALSPRNVCLALCVHFWAISISLSRVTLGRHYPSDVIAGHLVGTLATIISQEVLLLDAR
                     LPPPWQLLHSNLLSRRFAN"
     gene            complement(<301841..>303169)
                     /locus_tag="CYME_CMQ128C"
                     /db_xref="GeneID:16996548"
     mRNA            complement(<301841..>303169)
                     /locus_tag="CYME_CMQ128C"
                     /transcript_id="XM_005538016.1"
                     /db_xref="GeneID:16996548"
     CDS             complement(301841..303169)
                     /locus_tag="CYME_CMQ128C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_005538073.1"
                     /db_xref="GeneID:16996548"
                     /translation="MIFDVVIVGGGPAGFFAAIHCAQCALALSGTQPRVLIFEAGSQV
                     LGKVRISGGGRCNVTHAAFDLQTFSGRYPRGSRELLGPLSRFGPRETFDWFERRGVKL
                     KVESDRRVFPVSNKSQSIVDALVSEADRLGVQVETNCKVTDVAHEREGDQPLFRVDVA
                     KRGHFSSRRLMLATGASQRALDWAQMLGDHRVVPLVPSLFSFTVCPERHAWLLELAGI
                     AIPEAEVSFAEPSAQPASRATLNGPALKETGPLLISHSGITGPAVLALSAFGARVFCE
                     RKYRFTAQLNFIPSFGPFTEVMESWRKSSGRRLGILTRNPFMLPRRLWAALVTKVARI
                     HSTQNYANLSAAEMKRLGDALTRCELHIVGRSPFKEEFVMAGGVDLRDVNMASCESKR
                     VPGLYFGGEVLDVDGVTGGFNLQNAWTTGYCAGVAMGAAIAHPREAPLAK"
     gene            complement(<304122..>304988)
                     /locus_tag="CYME_CMQ129C"
                     /db_xref="GeneID:16996557"
     mRNA            complement(<304122..>304988)
                     /locus_tag="CYME_CMQ129C"
                     /product="unknown metyltransferase"
                     /transcript_id="XM_005538017.1"
                     /db_xref="GeneID:16996557"
     CDS             complement(304122..304988)
                     /locus_tag="CYME_CMQ129C"
                     /codon_start=1
                     /product="unknown metyltransferase"
                     /protein_id="XP_005538074.1"
                     /db_xref="GeneID:16996557"
                     /translation="MLLRRLLFASLFCFPRSAFGQFAVENATRPGACSVQRSLLLCLS
                     RRCLVCAHASQNAPDNSFDLKGMVPNVGDSGSDRAKRPRVRQHVNPLSEHLRTLVELP
                     PEWPVGVYNDRRAPLHIDIGCATGTFLLELSQEDPSYNYVGLEIRRPLVEFANIRAER
                     AHVADRVFFVCCNANAAMEKIISTYTLGMVRRISLNFPDPYFKRRQHKRRVVQPELVH
                     CLSEGLAPGAEVVCQTDVAEVHEYIREVFVSSGKFTAENLSDSPYPVRSEREMRCILN
                     GRQIFRIRFVRC"
     gene            305917..307502
                     /locus_tag="CYME_CMQ130T"
                     /db_xref="GeneID:16996560"
     misc_RNA        305917..307502
                     /locus_tag="CYME_CMQ130T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461553.1"
                     /db_xref="GeneID:16996560"
     gene            <308209..>308547
                     /locus_tag="CYME_CMQ131C"
                     /db_xref="GeneID:16996561"
     mRNA            <308209..>308547
                     /locus_tag="CYME_CMQ131C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538018.1"
                     /db_xref="GeneID:16996561"
     CDS             308209..308547
                     /locus_tag="CYME_CMQ131C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538075.1"
                     /db_xref="GeneID:16996561"
                     /translation="MDTEQPQDISPDETRLRPGEVERRIIQVESQLTMARRARLVAEA
                     ALEALGTVAPERQVARAVGKCFVLSTHSRVEDQLRAELVRSEESIARLSELKSLFEKK
                     LAPRTVRSEH"
     gene            <310097..>311164
                     /locus_tag="CYME_CMQ132C"
                     /db_xref="GeneID:16996562"
     mRNA            <310097..>311164
                     /locus_tag="CYME_CMQ132C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538019.1"
                     /db_xref="GeneID:16996562"
     CDS             310097..311164
                     /locus_tag="CYME_CMQ132C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538076.1"
                     /db_xref="GeneID:16996562"
                     /translation="MPKWSPSRFHRYRARLFSLLFAYTLALVAFAAALRALSLRGFSK
                     TPFPAQKAPVSLLIIVLGYNRPLALRRLLESLAKVNWLQTRIDLRVWIDAGDIAASYD
                     VAKGFHWDHGQKIVRQRLRHHGLCGSWLNAWPAWDTHEYALILEDDLEVHPQIFEVFQ
                     YLIAKGVRANASGFILEKLAEVPCGSLVHYASSWAPVFSRRLFQDFARWYDSRRKCAP
                     DFRPFIRGHDETYNLWIREHRDVWSPWLRRFLFERGIALTYLGSLDLVHNHQERGSSR
                     KGASPFFIRTVDWRHIELDLIDTCVVREPPVYECFLKASKHFCTRLDGNRSSLVDRGW
                     IEFLTDKLWICSPSAPSVKAK"
     gene            complement(<311768..>313915)
                     /locus_tag="CYME_CMQ133C"
                     /db_xref="GeneID:16996573"
     mRNA            complement(<311768..>313915)
                     /locus_tag="CYME_CMQ133C"
                     /product="probable CLC-type chloride channel"
                     /transcript_id="XM_005538020.1"
                     /db_xref="GeneID:16996573"
     CDS             complement(311768..313915)
                     /locus_tag="CYME_CMQ133C"
                     /codon_start=1
                     /product="probable CLC-type chloride channel"
                     /protein_id="XP_005538077.1"
                     /db_xref="GeneID:16996573"
                     /translation="MSSKITGTLEVDYGLLDSMGNLARHPTPVGTRASESSQQISLEE
                     TESGLRLAPYDTGFDANERSYGSVSPRDAYRCWNALGSCTPRGSLMYLLRLVCFLTLL
                     GVTAALFIFAVDLAVHGLEELRMKISRLAGRFAGYILYVVSGVALCLLSTFWCAVLST
                     EAEGSGLPQMKSILSGFYDKMRSALELRVLFAKALGLICAIGGGLPVGWEGPNVHIAC
                     IIAHQFYRLGVFKELCTDRALRLQTLAAACAVGLASSFGAPLGGVLYSIETIASFYLV
                     QAFWKGVLSALSGAIVYELLYTTPLVEAFEGTNFDASDVSRTQTLLYAILGALMGVLG
                     ALFIRCVRSIYELRMRHYPGTNRYFLVGVVALFASALQYPFRLFALDPRATINDLFKA
                     VPLYQTDHFGWTELILMPIIKFILVALSIGLPLPAGVFVPSFLIGAGFGRLYGELMRV
                     VFGNAIVPGSYAVVGAAAFTAGVTRALSCAVIIFEVTGQIRHLVPVLISVLLAVIVGN
                     AFNRSLYETLVLMKHLPYMPILRRDRSPEMTAREIMHPIEGEPHLFPDSEPQHIKGIL
                     EKFPNRLVFPVIDANGYLLGAISRKEIVDRLQHVLEDVPEPIAGHRTLVLLDAADLSE
                     NIEGLVDETPSGEHSSKGKRTATVLEPTSSLVVPCDVSPIVVTSYSLVRQLHFLFVML
                     MPSMIYVTERGKLVGIVEREDVAYGYREPEQTS"
     gene            <314170..>314880
                     /locus_tag="CYME_CMQ134C"
                     /db_xref="GeneID:16996574"
     mRNA            <314170..>314880
                     /locus_tag="CYME_CMQ134C"
                     /product="similar to ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /transcript_id="XM_005538021.1"
                     /db_xref="GeneID:16996574"
     CDS             314170..314880
                     /locus_tag="CYME_CMQ134C"
                     /codon_start=1
                     /product="similar to ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /protein_id="XP_005538078.1"
                     /db_xref="GeneID:16996574"
                     /translation="MGQAMSRWYETTLFDGAMELFESNTQRKLRQRLFQYMDCDEPTN
                     TTSVLEIGAGAGLNLPHYPVWVKELHASSLSPDLPPKAKKRARKRNIKVYYKQGKPIG
                     LPYPENSFDYVVATLILCSLPDREGFVKEIYRVLKPGGKYLFMDHAWQSAEAQTHLSR
                     MLAPLHRRLALGCSLKSVWADSVFTSAGFKREDLHVEEEIPKGFSWLVGKIFLGYATK
                     RPEASDFKMDDRHGQRAC"
     misc_feature    317563..319844
                     /note="repetitive element"
     gene            <319974..>322391
                     /locus_tag="CYME_CMQ136C"
                     /db_xref="GeneID:16996575"
     mRNA            <319974..>322391
                     /locus_tag="CYME_CMQ136C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538022.1"
                     /db_xref="GeneID:16996575"
     CDS             319974..322391
                     /locus_tag="CYME_CMQ136C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538079.1"
                     /db_xref="GeneID:16996575"
                     /translation="MRESKICKPRAVCFLTPSTASATPARGKPTRTAQCETRPQQDLG
                     TTEFADEQEISVGGLVDSTSSRAQRTCDSSGAVCIEPVSEFSERLVVSTETNPRTEGN
                     WYFELPWPDGGLCSQDQGGACRKAPDVRLPRGAAQGGAAATSVLLKHSASLSRDSSSA
                     RRQTKPGPSQTVASFLFSAQKVVDAPRNFFVSSCGYVANEPDSAKNLSNCWQVPLEGA
                     SDKPAVWRQDVQETSHGYEYSLATERVAFETASDVLADEEQKLFNQQESSHPTVRDNM
                     SPSFSTSGDSTNEDPERNEITRFTPPRAPASKTSYERRLAESRNLFPVSNLNVADADL
                     RSPLHRSASQHRSDGSLAPQVREIRSTRQLNKILSALYKSGRAADALSLCRIVEREGH
                     IEIDVASYSILISCLGKCGASAQAIEMFHKMIRNGVAPNAFTFSALFGALTDGAFFDQ
                     AMRLFQMIRASYPNELNVVVYNAVLKYVGRAGRIDAALDLLGQMEQNRNVQPDIVTYG
                     TILDICAKKQDVSLAYAVLDRMRKRGMRPNNFCYASLIDACARAGLPDQAESLFRQLR
                     AEGLEYDLFICNALLGAFARAKMVERAFQAFEEMRSAGVRGDRITFNTLITAAARARE
                     FDKAWKAFETMKKSNISADATTYNALIDACSKSGMTELAFALFNEMRQAHLQPTIFTF
                     NALIGACTKLQDMRRATQVLMLMHGFGVYPDTFTLNILLTACARNEDFDYAISLVREF
                     ETNYRVRLDRLGSSIVTNLCIKACDSQSRDRCLRLLEAAVLEGYETLREVRDRARSAF
                     ANPMTGS"
     gene            complement(<324619..>326538)
                     /locus_tag="CYME_CMQ137C"
                     /db_xref="GeneID:16996568"
     mRNA            complement(<324619..>326538)
                     /locus_tag="CYME_CMQ137C"
                     /product="similar to chloroplast outer membrane protein
                     Toc34"
                     /transcript_id="XM_005538023.1"
                     /db_xref="GeneID:16996568"
     CDS             complement(324619..326538)
                     /locus_tag="CYME_CMQ137C"
                     /codon_start=1
                     /product="similar to chloroplast outer membrane protein
                     Toc34"
                     /protein_id="XP_005538080.1"
                     /db_xref="GeneID:16996568"
                     /translation="MTESFTSPQTREQVRLDFAERVEPRGDDAAERRDVSGRRTADSD
                     KTTRGSRPSTGRTRSRRRQLFRRNLLPGVLSQSRKGTESEGHGAENAADGEFFISDER
                     HLYNMGIHVKQELNLSRLAALVVTSPAPYSKDLKESGSSWQQGPSPTLSDKPSLSEVC
                     GEQPWGAIPDATEKALERLCLLWIARKTGASESSSNGLRAVLSDPNVFLHIAGIDAPC
                     SGDARNLDSMRRCIQLFLDSARNAGLDANALFEPEDVIEGKNLHLACKVLCAYAEKTD
                     SEAFTACMKQVGLQRRNYEEIIRGFGNDSRPGCATVNQLVDVVRAHSPFRDATILFAG
                     TIGAGKSATINRILGSPVARTNHTMALILSDDEILERDPEHGLEVIEERSYEREREQR
                     AHPNRKTEFVPSPNENVLIYPVEKEGMSLRLIEIPSSEKYFYDEAGEDSKKWSRAGTC
                     ESVAAALRGLEIDIVCIIERLDSYRSHCFRLVLEELKSLFDGGVWERCILVFTHGYAL
                     PPEGLTFEENLARRMHLAQEEVHRVSGRRDIFIPVCVVENSESCPRDSAGNLILPNGI
                     SFLDRFVTIGENVFLRNRDRPRLKVRSLVPSHVRVRHIGFILSSVLILQMLRNGPQDG
                     RANPLARDKAFLPAF"
     gene            <327276..>327509
                     /locus_tag="CYME_CMQ138C"
                     /db_xref="GeneID:16996569"
     mRNA            <327276..>327509
                     /locus_tag="CYME_CMQ138C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538024.1"
                     /db_xref="GeneID:16996569"
     CDS             327276..327509
                     /locus_tag="CYME_CMQ138C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538081.1"
                     /db_xref="GeneID:16996569"
                     /translation="MLGRTLSLLKSKVARSAPFLHAKHGPQNYYKGNRCRRLGRHTRK
                     GGYVVDHANKVPDFRIPQIPEDFPLKPYVAVGS"
     gene            complement(<330254..>332677)
                     /locus_tag="CYME_CMQ139C"
                     /db_xref="GeneID:16996570"
     mRNA            complement(<330254..>332677)
                     /locus_tag="CYME_CMQ139C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538025.1"
                     /db_xref="GeneID:16996570"
     CDS             complement(330254..332677)
                     /locus_tag="CYME_CMQ139C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538082.1"
                     /db_xref="GeneID:16996570"
                     /translation="MPRKSGRFGDTKADDYVKPIFQRRQDEELQKSRAKPLQKAVENR
                     TVQVEGSDSRDSRSKRQTGNRGNQRKRPREGTLKVANQKLAKSNTGQVSASSSLVQSG
                     SSEPKERDQIFTTAGTEKLHECAPGEECRGSIVFLVLCVRHYIRDQAYWFTVNGTKDE
                     IPEMDADAYDITVCNPVEQTKTRFCLHPHLNSIVQSGDLDRGSILEIRKWSVRFNELR
                     GLYPPRVIVVYDCLVLRRPHEDFWIDVPLTCAWTTSSTPLETAANVPLASSRKSYLGP
                     GAFDALPVDSRLRDPSNVERVEDPASIKSVTSAAVRIARALMGDVKRPIIGRVLRKTS
                     LMPWPKKSDMRQSVPFKFEFEIGDGADSATVVVWNSLCSKYFYHIQLGDILIIENYRV
                     RRGEIHLNASSPQGIIRKLSDNYEELLDFGPIAKLGGGRTGELYHPCILTSALDAWDD
                     RSYFSLACIVTHVSPLYRERGTYRSAERTSAPQILSASDDYYIFRKYRIILARDGSEA
                     RDVCIRLYETSQRDAFDAICVPGAAILLTSLEKRELYNAPFDGVSIMEVHSTRWTSMY
                     LLDGVREQQKRTEGTSLPENIPKVILQDRLVRRILALARWIQSSEGKKSVKIRQTFAL
                     GRIQHSTFRYTDTLEQLAALYGGQEKIENLCIEFERLRAVQSEIFLRERREVLVYGYL
                     SCFRSTSKPEKAQLEEAKALGLAGSSFATVYFDEIHIGHLRALNDNNSWIPVVITPGR
                     TVFGSGIAKTYNKRTAFLGRFGASLRGSLREKGLAAIRNKPMACLLALYRAAPGCDFA
                     LLEVAYEFP"
     misc_feature    333466..336420
                     /note="possible transcribed region"
     gene            <335859..>337118
                     /locus_tag="CYME_CMQ141C"
                     /db_xref="GeneID:16996606"
     mRNA            <335859..>337118
                     /locus_tag="CYME_CMQ141C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538026.1"
                     /db_xref="GeneID:16996606"
     CDS             335859..337118
                     /locus_tag="CYME_CMQ141C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538083.1"
                     /db_xref="GeneID:16996606"
                     /translation="MPQYGAQNCFLLRELFNHVGDGGSFWQRQALVLVFVCLAAFLNS
                     ITVILHFVGQNWMARCLQFHLAKQVVRAQRRAAQDRAFRLGSTVGHTGTGGTPEFLCA
                     CKGCRKLSSVLNPQQRQALEASRVVRVRKLLGQQGLHAEAANSSQWCSDLTIMRYLDS
                     YGSCPALAAKYLAATIKWRIQNSVHELTVTEFTEELRKGVVSFGGFDSQSRPVFIVRF
                     VPGFSLRLLIFMLEVGESIIRNSMEPDVLRKDAPSASATPGVWQRIYRSMFRGMKRVE
                     SDRKVQNRDRWVWIVEWGSVQRECTREACTQCTPSEDSPVPTKYAGGVSASELIGAFR
                     ICNEHYPNRLHAAYVLGAPEPIVSLFRILAKKSTKRKVRFVRLRDGCDRGSLSEYGPI
                     WRRPWAATDFIQLINYIDGSLAVQKSK"
     gene            complement(<337675..>338319)
                     /locus_tag="CYME_CMQ142C"
                     /db_xref="GeneID:16996607"
     mRNA            complement(<337675..>338319)
                     /locus_tag="CYME_CMQ142C"
                     /product="similar to light harvesting protein"
                     /transcript_id="XM_005538027.1"
                     /db_xref="GeneID:16996607"
     CDS             complement(337675..338319)
                     /locus_tag="CYME_CMQ142C"
                     /codon_start=1
                     /product="similar to light harvesting protein"
                     /protein_id="XP_005538084.1"
                     /db_xref="GeneID:16996607"
                     /translation="MYAFVSFAPLVQRANTVSKATGTSAIRSRHASGYATLKMEQSPA
                     LPFLSKPPNLSPDMPGYRGFDPLRFSDAFDVNWLQEGEIKNGRVAMLACLHFFVTEFY
                     QFPFFAGAPKLAGPAHDYFVKSGAMIQILAFIGFLEFLLHRGKVLYSDMEWKGRKPGE
                     LGFNPLNLPNDKAMRDREVNNGRLAMLGFAGIIHGEFLNGKMPFEQITNFQPLQ"
     gene            complement(338359..340015)
                     /locus_tag="CYME_CMQ143T"
                     /db_xref="GeneID:16996598"
     misc_RNA        complement(338359..340015)
                     /locus_tag="CYME_CMQ143T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461554.1"
                     /db_xref="GeneID:16996598"
     gene            complement(<340156..>341922)
                     /locus_tag="CYME_CMQ144C"
                     /db_xref="GeneID:16996599"
     mRNA            complement(<340156..>341922)
                     /locus_tag="CYME_CMQ144C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538028.1"
                     /db_xref="GeneID:16996599"
     CDS             complement(340156..341922)
                     /locus_tag="CYME_CMQ144C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538085.1"
                     /db_xref="GeneID:16996599"
                     /translation="MDEELSLQSRLKRKIEGFDRKFSRKRKSRGSPYAFPQTDLKTWE
                     AAEFLSNDVDSLGVIIGPLLKSNNQKVKSMKSGAETSLSADAVDEDVAPQEGTATKLS
                     SAREKGKTWTQNEIDSLVSQLSSILNRVSDTNLDLTCSKLYKYFSEIRHDPLGFVHLR
                     DIFCTVLCSARMGRTFENSVAMENPKGQHEGVSTFNCAALCAVLIYLHCTVDASFVNC
                     FFVKVTERLQNVGASGRLDLQNLLDALTPLCHLFLGGMIEWEVVFELAKSSVLNSGNA
                     VGLVGMLHVTKLCGLHLRNSFPEKFAAFEAQLRSICRNMHETTSCGCERSSHFREFHE
                     GCTVYMIETVIADVVRESRSQELSAQSALEPVPEALLWVHAKLGSSFVYEKRIRANAT
                     ISKRPEVCDDASKESLVTDGGILWENSSLTRRASSKGTSGATELLESKDRISSLLDRN
                     RIWSATGRSVVEILASSVNFIEAASRIYKLLSRSSRSASLYQALEAILQCYLNEKKTN
                     EFYGHLLIELCSFYGRKALSPLRQVLRNTCPTAERSVDTSVVAEPTKIEKRVRLLVTF
                     LNSHGLSDEKLFRDPKPMNSRK"
     misc_feature    complement(345638..347435)
                     /note="possible transcribed region"
     gene            <346887..>347912
                     /locus_tag="CYME_CMQ146C"
                     /db_xref="GeneID:16996601"
     mRNA            <346887..>347912
                     /locus_tag="CYME_CMQ146C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538029.1"
                     /db_xref="GeneID:16996601"
     CDS             346887..347912
                     /locus_tag="CYME_CMQ146C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538086.1"
                     /db_xref="GeneID:16996601"
                     /translation="MVFVRVLAKPITFRYLSLILILYGSLSASIVAEKNCVVLAANVF
                     NNVGTVDLFHTLLSDLEGMLQAAGFSTGLCIYEDNSRDGTDVRVSQWNQSRRGTPFTR
                     ILADKTPPTATERVSRIAVVRSRLLNLIHEVLAEMQNCSGRYILFFNDVVFEPSDVHK
                     MVLDGIRQNFDMLCAVDVYRGFYDRWVTRDASGLIPSRWASVFFTGKTGSRIRNKDAT
                     EWRTDFWPSRACWNGAVLVNAESAPRSFRSARNDECYASECKLFVDDLLKERGGQARV
                     AVRLDTLVAYDVIHLLLHKFVIRTYASHIAAFQSLGELIVKAKHRYQAERVLQSDPCP
                     KLPMLCC"
     gene            complement(<349093..>349455)
                     /locus_tag="CYME_CMQ147C"
                     /db_xref="GeneID:16996602"
     mRNA            complement(<349093..>349455)
                     /locus_tag="CYME_CMQ147C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538030.1"
                     /db_xref="GeneID:16996602"
     CDS             complement(349093..349455)
                     /locus_tag="CYME_CMQ147C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538087.1"
                     /db_xref="GeneID:16996602"
                     /translation="MEAKEHIEEEEVSIDSIEYMKRTTQISPETSETLMNRWGNEKRT
                     TLKRDATGREQIETERSHKVEEAWCPRSRPMAWQHPPLSVVSALHASRPHQSSNAPLL
                     RTGNTATMSSKLYRCVAS"
     gene            complement(<351798..>352988)
                     /locus_tag="CYME_CMQ148C"
                     /db_xref="GeneID:16996603"
     mRNA            complement(<351798..>352988)
                     /locus_tag="CYME_CMQ148C"
                     /product="trehalose-phosphatase"
                     /transcript_id="XM_005538031.1"
                     /db_xref="GeneID:16996603"
     CDS             complement(351798..352988)
                     /locus_tag="CYME_CMQ148C"
                     /codon_start=1
                     /product="trehalose-phosphatase"
                     /protein_id="XP_005538088.1"
                     /db_xref="GeneID:16996603"
                     /translation="MEPTRSFDRGRPSPRISRRAESLPSALDHMDSLLKRADTFAFLL
                     DYDGTLTAIVEDPNGAVLGERVRGILQELARLYPVAIVTGRSREKIIQLVGIKGVYYA
                     GSHGFDIEVPLRKSRPSNGSSLENGEISALADAMQTKDPEDAYFRYHIAEEVIPVLRE
                     AARHLRSIFGLEEPASDLPEPERRVDGQETVTANVQAPKQMACSNIDDCGAPGSMLLP
                     PLPIQPEPSSPPVFDPSFLSQVDRLLTERYAVRGIGIEDNLLSISIHYRRCDPAHVPT
                     IEKIVDSIAYKYGLRKTRGKCVFELRPAVKWDKGRAAKWLLEMIQCREKREYVPVYVG
                     DDVTDEDALRFVTNFGGVGIIVTEDDSRETAATWRLRDPDEVAEFLEHFVRARPGGVS
                     PSSS"
     gene            <359070..>364646
                     /locus_tag="CYME_CMQ149C"
                     /db_xref="GeneID:16996604"
     mRNA            <359070..>364646
                     /locus_tag="CYME_CMQ149C"
                     /product="RNA helicase"
                     /transcript_id="XM_005538032.1"
                     /db_xref="GeneID:16996604"
     CDS             359070..364646
                     /locus_tag="CYME_CMQ149C"
                     /codon_start=1
                     /product="RNA helicase"
                     /protein_id="XP_005538089.1"
                     /db_xref="GeneID:16996604"
                     /translation="MSDPFRNKPNARATVEQDDLKAVNAFFRTLGHVSCDPSAIVDIG
                     HSLLSLLESSLTDVDLESDLFDLIGNPEVAAELLKLRPSVQRHSSSIRAELTGSYGRE
                     RTKKTKQQSPEKFLPSSSLSGLQYSSPFEAKGRTRTDSATHGGAFRQRAPFLSGSVTS
                     TTSATADSIQELSPDFPGSDNPFVAKPTYPAPKSSNIEFRSEELYKEIFVPPPQPCSA
                     AQQRLKVAECLDPPLRRIFEHTEHFNPVQSTVFSAVYHTSENLLICAPTGAGKTNIAL
                     LAIGREILHRMHERAWRCVYIAPMRALASEIVRKLANSLRSLSVEVLEYTGDTNPTLP
                     SLRRSQVLVTTPEKWDVLSRNSAHWQSGLAASIRLLVIDEIHLLHDNRGPVLEAVVAR
                     TLRLAEIQQTRVRIVGLSATLPNYVDISAFLRVTPEKGLFYFDASYRPVPLGQRLIGM
                     RKRRDRGSESALIEVCYEKARSFVTCGHQVIIFVHSRKKTKLLAEDLLKMARERNEAS
                     LFVQSERSQDQLPRTIRSADLRMLLMHGVGIHHAGLARSDRIATETHFRDGSITLLVS
                     TATLAWGVNLPARAVIIYGTKIYDASRGGFVDIGVLDILQIFGRAGRPEYDSYGEGII
                     LTEEQRLPFFYRLLSVQMPIESQMLNGFALVDHLNAEIATGHVTSEHEALAWLACLYL
                     SVRLAKNPLHYGIAWEDVQRDPTLSAFKYQLLKKSIDALVIAGLVSVDSELSQLEPTD
                     WGIVASRFYVSHQTMQIFKENLRQDASASQVIRCISSSSEFENLALREEEIPELETLY
                     ADACPYEYPRHANIAIRSKLEDESEYFLNGYTGKVYILLQSYISRATVHDFALLSDMR
                     YIEESATRLFGAVFEIALRQGWPELARNASELARAVERRLWPFEHPLTQMQNVQASVV
                     DLIKNRNIPHDIQILRRLSNEQWTDLLGSPSHVQIMAEIVSEFPYLEVSGHLSALAEQ
                     LFRIQISCTPCWKWGSRLHSTRTSEAARYTLMINDVDAGVMVYSQSVTFSKKQVQERE
                     TSFFEIYLSHGGQWPQTFEAVFLSEEWLGADQKYVLQTDAPGPPQSQLIRTPLLNLRL
                     LGREALGFGLGAACDTLFPGLSHLNPIQTQICHSVLHSDASLFIGMPPNAGKDLVLLL
                     CILRQLRAKRSAHCRVLYLSLASNNMDDMDACLRRWLSVLDVRLLDLSDGCKAGIHDP
                     MVVCCVTPKQLLDWLLDKTESAIAFFDSVDLVLVDNMHHLNEDNGVLAESALVAVRAV
                     TRRSTRLVAFGNLIGNAMDLASWLSTSRMYNFALEHSPTPIAFSVIPFRERNIAERFA
                     RMDQTIRKIVQHHNAEQVIVLVQSDRECIETARRLLHVAAADGTSHRAGIEGHLLDVS
                     VLNADIGQFLAFGIGVLVGEMNNVLQSLMQDLFSARKLSWLAVAFPLLDELRCSAPVV
                     VVKGTEWHLTAGGTWKHLSPSVLLKILQRCGCQEIQRGSFYLLASESRKAYFQKLLEC
                     EVPVEAGIRTEEDLGLFLCQMVAGDLVSEPEESFQLTRETYLSRRLAQNPSWYPWVTA
                     NDNEMRTVVETSLLRMASIGLLRIQASSSAVLTLEPTTLGKLACFFSLRPIFFERINN
                     LLSEMNQEKREQKAHDLAHEDHACMPDSCKVEDSIPDAAKESDNGPATQVIPYNVVRF
                     ETAARELLYIGLREIAPHCSSMELAVAAAVVAAEKGFDPAVSPLLRFAKVERKEHRRS
                     SHARPTPRIALNVSSVERVQLNWIQVSLCFRKIELEGINRTQPERIYASALPASCPVT
                     KLVCFAFSAVTEELLGYGISEETVLHVDLELRRHIPAGGKLKLKLFCFPVELTHEIGV
                     SLSDEQMSASSSTRKQ"
     gene            complement(<365284..>366084)
                     /locus_tag="CYME_CMQ150C"
                     /db_xref="GeneID:16996589"
     mRNA            complement(<365284..>366084)
                     /locus_tag="CYME_CMQ150C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538033.1"
                     /db_xref="GeneID:16996589"
     CDS             complement(365284..366084)
                     /locus_tag="CYME_CMQ150C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538090.1"
                     /db_xref="GeneID:16996589"
                     /translation="MGSFGSGSIYRPLGRLLLFQKSVKGSVEVAQESESLKGDYVSAV
                     TLRNRLVSELSILREGRASYAQGATSDDFEPRVEGLLTCVTSASTRIEEPETSTEERS
                     QPVEAVEFVAAAQLALSVSSADQDATITDSEGSTSVIDSWSSDSEVEQVCSPDDVAAT
                     LLDGVHRGPIDTNTSSGANIPGLSTSSRNPLRPQDELVWLKLAEILHVPDEDRKYFAL
                     IAEKRDQWLHGGDDQWPDASFPPDIHCFMDSPADCHGHDRKAGARSSV"
     gene            <366346..>366831
                     /locus_tag="CYME_CMQ151C"
                     /db_xref="GeneID:16996590"
     mRNA            <366346..>366831
                     /locus_tag="CYME_CMQ151C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538034.1"
                     /db_xref="GeneID:16996590"
     CDS             366346..366831
                     /locus_tag="CYME_CMQ151C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538091.1"
                     /db_xref="GeneID:16996590"
                     /translation="MTLEKKEYGAPGFWPGSMIGRVHAFETPAPLTRAQLDRLRDEFF
                     ETRTEGHLEIWTAIRAASHAQEAGDDELAYAIITAVGILPAEVGPAGEGLGERIPFAE
                     QPLDRLLGMICGCCFPAFTRYRTLERVYDQRGFLYETPKECIATPSNVLPDESTEASA
                     R"
     gene            complement(<370457..>371302)
                     /locus_tag="CYME_CMQ152C"
                     /db_xref="GeneID:16996591"
     mRNA            complement(<370457..>371302)
                     /locus_tag="CYME_CMQ152C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538035.1"
                     /db_xref="GeneID:16996591"
     CDS             complement(370457..371302)
                     /locus_tag="CYME_CMQ152C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538092.1"
                     /db_xref="GeneID:16996591"
                     /translation="MWLASVNLSHTRISSRLKCGVKCELTPPQSQREQNETGTRKRKP
                     RGYWKDAANLEKEVREFLRLNGWDNLNQLPSEQQFISASFPRPDLLYPIRLHGGWQAV
                     AAKLNLKPACVSQPRSLYVTFAVDLRRGRMMPHNYWKDFDNLAKELQSFIAEHLEAKD
                     TMPTAGQLAAHHRSDLIRAIRKHGGFPKVAEQLGLKAHRRPNGYWNDKRRTLVELKTF
                     IAAHRLPPDRAPTYRTMKRFGASTLAAAVGRLGGTAHFSRLLRRKTPMALPAKESHPN
                     VSKTP"
     gene            complement(<372811..>374379)
                     /locus_tag="CYME_CMQ153C"
                     /db_xref="GeneID:16996596"
     mRNA            complement(<372811..>374379)
                     /locus_tag="CYME_CMQ153C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538036.1"
                     /db_xref="GeneID:16996596"
     CDS             complement(372811..374379)
                     /locus_tag="CYME_CMQ153C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538093.1"
                     /db_xref="GeneID:16996596"
                     /translation="MWLCLVPGGHDRTTVRTCTRCVTVLGRCTESASVARGLRRLCAP
                     GELVLNRVRRPERRSVSFPVAAGAAASAHALRCVYEQSEESKSFGLNAVDDRVLGAVE
                     SLGGRVTVADVAARTGLGLPTAQRCLVALANVAGGHLEVSRDGELVYAFPSNVRRVLL
                     QESIIFALRNRWEKISPFLNYLVRISFGILLIASIFIIYTSIVAISSSVQSREDDRRS
                     SYNRSYGGGSLYVWMGPSPFDLIFYANHGYSGRRREGGMSFLESIFSFLFGDGNPNAD
                     LETYRWRRIGETIRRLGGAVTAEQIAPLLDVPEPPESRGAVYVDESFMLPVLERFGGR
                     PEVTDDGDIVYVFPDLLNTVSGSGSTSGSASSEQSHYDKGYIEEQEYVFSKASSGQIL
                     GAAGLGVLNLLGAVTLGEYMAQLRAVPLPFLKWLYPPLLAYALAFLIIPAVRWYRQRK
                     ENERIQRRNRARKAWYQLLQKRDPNVLRKLESARYLRSNLRKIQAEDITYTTAKSLIE
                     QNQELLDDFDKKLH"
     gene            <374535..>375827
                     /locus_tag="CYME_CMQ154C"
                     /db_xref="GeneID:16996597"
     mRNA            <374535..>375827
                     /locus_tag="CYME_CMQ154C"
                     /product="fumarylacetoacetase"
                     /transcript_id="XM_005538037.1"
                     /db_xref="GeneID:16996597"
     CDS             374535..375827
                     /locus_tag="CYME_CMQ154C"
                     /codon_start=1
                     /product="fumarylacetoacetase"
                     /protein_id="XP_005538094.1"
                     /db_xref="GeneID:16996597"
                     /translation="MNEATAIVPIQENSDFTLYNLPFGVFRKKGEASREARVAVAVGR
                     NVLDLCALAETDLFEACSPDTPLRGAAADVFGQESLNRFIKLGEQCCSETRRLVQRAL
                     SRDSGLCPQLERALENSRADAFLTAQDVVDVLLPVEIGDYTDFYASKEHASHLGQMMR
                     GPGHELTPNYVHLPIGYHGRASSVVVSGTPITRPCGQIKPEGSDCPVFKPTERLDFEL
                     ELGAIIGRDSILGERIPVEHSRQYIFGYVLVNDWSARDIQRWEYQPLGPFNSKNFATT
                     ISPWVVTREALEPYRVAAPHQDPPVLQYLNEDAGRTNLDLNLSVMLNGITISQCNFRG
                     MYWTFEQMVAHHTSTGCNLRCGDLLASGTVSGAEPNTYGSMIELTWGGRHPLKLPNGK
                     QRTFLEDGDEVELHGYAGAGSRRVGFGRCHGCILPAVV"
     gene            complement(<376090..>377610)
                     /locus_tag="CYME_CMQ155C"
                     /db_xref="GeneID:16996611"
     mRNA            complement(<376090..>377610)
                     /locus_tag="CYME_CMQ155C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538038.1"
                     /db_xref="GeneID:16996611"
     CDS             complement(376090..377610)
                     /locus_tag="CYME_CMQ155C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538095.1"
                     /db_xref="GeneID:16996611"
                     /translation="MEQSHKHSENHTGALYAAGNNSRCTDLSQTRAAVEHASFGVRSR
                     YRFDNDPSLDQIFCASLLETMPEIGICTTDNDAHCAQSSSCSGVLHSSTFQEHIELRM
                     DHPDGLCDLCAISPSRAPRLVIHAARIGQRTGNLDPFRCSALSRPALSPDADAVVFGI
                     TEPDSSNSQGNRLIHVSLQPDPSSQSLPMDAASGGGQQGSCGQGANETYQWWACALNN
                     PVQDLVYARRNTVLLGLSTGHVAALHTTAESLGLGPDMPPRTTRLHRDAIREIVLTDG
                     NDCMFTISHDGQVLLTSIERLFAEASGAPLASADTVSNGAEIGRVSIGRPTSSVRPTC
                     TNSSSKETCTVTTDDGALYLVDMRMPTWQAAICVLETKRDGLFAHDHEAGDAPVVLLG
                     YADGLLSILDFRTFREIGRYRESPFASVGDIRSVGPHQFISFGSPTAVMWSYDEKTAT
                     LAPDWHMHPFRCEHQSEPSPDAFIPGSPTLAKGDLHLALSMIALTDTRGYLSLLSV"
     gene            <379207..>381546
                     /locus_tag="CYME_CMQ156C"
                     /db_xref="GeneID:16996612"
     mRNA            <379207..>381546
                     /locus_tag="CYME_CMQ156C"
                     /product="similar to Polycomb-group developmental gene,
                     enhancer of zeste"
                     /transcript_id="XM_005538039.1"
                     /db_xref="GeneID:16996612"
     CDS             379207..381546
                     /locus_tag="CYME_CMQ156C"
                     /codon_start=1
                     /product="similar to Polycomb-group developmental gene,
                     enhancer of zeste"
                     /protein_id="XP_005538096.1"
                     /db_xref="GeneID:16996612"
                     /translation="MVRRKDWKQRKQSSIPSLYRDVFERAEREFANEQREYVLALVAE
                     NRARLQRERSGTPLPVASAENEILRRRIDQSPTSRDDNGKLRLQRCRKIVFPHVDPLP
                     DSTAYIPIRRNFAASDIVTSNLFLPYLGDTKRNIESAYQIISAVDEIRRLQENQHDGS
                     GDEIDTGSLAAWRRGFSHGIPVPQNLGPVLECGSLSIMEERDSVALWTWMQSQKMALY
                     LLRKTASQFGEVQEALQYLSTYTSTSLTDLKSVLAEQEIQNREQVAPVHGRSPNQHCS
                     NVCLAEDSTDSLLGICESDTMRSLFCRRCYMYDCAMHGSHHPLPRVRRPRLGLFEFPS
                     AEVTFCSGRCFRRLWPNGIGSIEGELRSDATRRSETPEKADRIDFDLNQVVCAAYELP
                     LLQTGQEIFDNDFCRIRQVCLPWRSCVECAMLAMKYYREGGMQKKPSGQVKSNDMVQT
                     NHEDAASHQTMSAASELRPNAVRHVTSTAAPDHRNDASSSGLVSDVSHFALANGSVDR
                     LHGQQRRSCDIRLCRASRPMNQLSAGRSFVYRPCDHEGACSKETCECVIKGRFCEKYC
                     CCASVVMGESCPRAFKGCKCRTKCNNKKCPCFAADRECDPDSCTGCGARDPEDKHRTC
                     ENMNLQLGIQKRLLLGRSDVHGWGIFASAVIPKGAFIGEYCGEIVSQLEAEWRGRIHD
                     HTTGVSYLFDLNDEQCIDAHRAGKRTKFINHSRIPPRKNCVVRYRIVNGDIRVALYAD
                     RQIEAGEELFFDYGYESGTNAPLWARAEGGSSSTLAKAS"
     misc_feature    382228..383995
                     /note="possible transcribed region"
     gene            complement(<386280..>387389)
                     /locus_tag="CYME_CMQ158C"
                     /db_xref="GeneID:16996617"
     mRNA            complement(<386280..>387389)
                     /locus_tag="CYME_CMQ158C"
                     /product="unknown deacetylase"
                     /transcript_id="XM_005538040.1"
                     /db_xref="GeneID:16996617"
     CDS             complement(386280..387389)
                     /locus_tag="CYME_CMQ158C"
                     /codon_start=1
                     /product="unknown deacetylase"
                     /protein_id="XP_005538097.1"
                     /db_xref="GeneID:16996617"
                     /translation="MYLQASRLSSWINPFYRKLAFRPKITTWPRHRSSRCAHAAEIGS
                     AGALRVYFADVYAVELPAGHRFPMAKYELVRRKLEADSSFKGVPFLVSPLAELDDILL
                     VHSKDYVDRFIKGKLSDIEVRRIGFPWSTALVQRTLASVGGTVACMRDVVEGRSRCAA
                     QIAGGTHHAFPDHGEGFCVFNDIAIAARVALRDYAQVRRILVLDLDVHQGNGVAAIFQ
                     GDSRVFTCSFHGHGNYPFRKQKSDLDIEFEDNTDDTDYLQILEVWLPRIMAKHDPDLV
                     FYQAGVDALAEDKLGRLALTRAGLRLRNQIVLDYILQESEAGIVICMGGGYADPITKS
                     VDAHADVYLDAHFALARYRKANKRISSIDSNISRL"
     gene            <387517..>388974
                     /locus_tag="CYME_CMQ159C"
                     /db_xref="GeneID:16996618"
     mRNA            <387517..>388974
                     /locus_tag="CYME_CMQ159C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538041.1"
                     /db_xref="GeneID:16996618"
     CDS             387517..388974
                     /locus_tag="CYME_CMQ159C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538098.1"
                     /db_xref="GeneID:16996618"
                     /translation="MAVPASSEALQCFDLTTSGLPVLWGSEKLQVVAERVTVDLSSTA
                     SASDSRLEGTTVYVTSQRLLLKPQHQQQLFGTDLSDVTFIKASKSGSFLLCGACGRTS
                     SALVRVGKGTLLRFHWAADPSSVASFLNNLRSAVELHKNAKLRQQGTLRCKDIAGNDF
                     EARPAGVAGVRAAEQRLRDERKQLLNRAFTDMNHLSVDAENLRAMSEALVRESQRMRH
                     EALSQDPEALLSVMLRDMMRFAEDRVRIAAEPSERSKSSEYCSHLARDLYDFLEPIVA
                     KNGGLLHIFDAYVLYNSTRPVTDIVPADDLCDACAQWPILGLRLRLEMMESQLVIRTT
                     ETVPVSQRLLERIKEVGFMTSLQVADQFHIPVQVAAWQLESAEREGFLCRDEEETGCV
                     RYFLNEFDAIYAAEIGRETPATGTAGNELLPTPQTSANEHILETARAFTPPIFPNTAN
                     IKSDAMSVETLRRRRSAQPDQDTPKSLSEWDATPQ"
     gene            complement(<389156..>389572)
                     /locus_tag="CYME_CMQ160C"
                     /db_xref="GeneID:16996619"
     mRNA            complement(<389156..>389572)
                     /locus_tag="CYME_CMQ160C"
                     /product="cytochrome c reductase subunit 10(XI)"
                     /transcript_id="XM_005538042.1"
                     /db_xref="GeneID:16996619"
     CDS             complement(389156..389572)
                     /locus_tag="CYME_CMQ160C"
                     /codon_start=1
                     /product="cytochrome c reductase subunit 10(XI)"
                     /protein_id="XP_005538099.1"
                     /db_xref="GeneID:16996619"
                     /translation="MELEERCIKMDAFSIIIICPAIWDPWSTEFYHRERNGQCAARAA
                     ARAHRASRTTDRCTSCFRGAPGIDTCVCDMNAARPRGVPALQQLFRRLRPVDVGAAAR
                     WGLLVGLTAFWFIEPYDWIRSTFKNSETDDETKQPK"
     gene            <390721..>392484
                     /locus_tag="CYME_CMQ161C"
                     /db_xref="GeneID:16996622"
     mRNA            <390721..>392484
                     /locus_tag="CYME_CMQ161C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538043.1"
                     /db_xref="GeneID:16996622"
     CDS             390721..392484
                     /locus_tag="CYME_CMQ161C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538100.1"
                     /db_xref="GeneID:16996622"
                     /translation="MSPTIRLLGTEPSCMLSRTVSKRLARRNVRYILLLVVLTGVLSG
                     FLFLRSTFSTYYAGEKLRQCEERLAKGEALLLQRRVSNMDENTEQPPRRVAAKHFLRS
                     VLVFDAVEHFSSVINTNAPGRATFLGTSSRGRGRPGWAYEPRPLLLNLSNGAWYLPLD
                     GEPPSIPAVLLWLDRSRNERRLLVWTSTTAGIAYNPPRECAEAGSTCQLELITSSTTL
                     AGSCNVEKRNLSLFLSANGAAGTSCLAEVRMQVTLTSTNAQEWEPEPSLQTLAIVRPF
                     TEDQIPKLMRSLDQWNDPWRFPCERSGDFDRPDLVFYANNEQALVSARAVFQRNHSWS
                     SCFQRVRWIEANVEPTVDVHPDGTCFQFYSIFDDPRFRNYYQYFFLMEPDVHPIRAFW
                     LDSIQRQIKLSAPQATFWIRGSTSKCAGWYAANDFHINGNALYNLSSRQFRDYLIRVQ
                     RAFQPRGHVRHAPGCSGGYGGFDHSIFHYAVEIASKNSHKWKMYQKLCFDDRKSPVWN
                     FCKHRFLPWRVYTESNGSASLVHSSWGNNVDFWDPAVHGIKRLETSMLEMIRLWEQDP
                     FPLHPRFRAFALLHCRKRQLF"
     gene            complement(<393029..>394762)
                     /locus_tag="CYME_CMQ162C"
                     /db_xref="GeneID:16996623"
     mRNA            complement(<393029..>394762)
                     /locus_tag="CYME_CMQ162C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538044.1"
                     /db_xref="GeneID:16996623"
     CDS             complement(393029..394762)
                     /locus_tag="CYME_CMQ162C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538101.1"
                     /db_xref="GeneID:16996623"
                     /translation="MRRAFRRRAPENLGIGNVVATTHHLKDSSHQAGIRSRQRCARLL
                     LIAMLLVVRIGAAELAVITDCDEVFNYWEPLHFLLYGSGLQTWEYSPEYALRSYLYLL
                     LFKIPVLWWRWIGRGLGSEKTAAFQIIRIVNAGSCFVAEVSLAFSMDQLYQASNTGNW
                     YLLLSAMSAGMFYASPSVLPSSFTMIQFMFAYASWLSGKQLVSMMLVANAVLVGWPFV
                     GLLGIPLLLPVERRLPPGRFVVLAGVYAASTLAVMTLVDSAYYGRIVVAPMRLVLYNV
                     FPNKDRGPEVFGTEPWSYYIKNSNLNFPLLFAFAVWYAAVQLLHVLRLLGKRTGFASS
                     ADWRLCKVEALVFGAFLSWLAVFSAQAHKEERFLYPIYPLVCWGAARCTVVWRSFERG
                     TRRIGRFLMRALLVLGVVASWSRIIGQQRFYAAPFKVFRHLAKMHCAQSACTLCMGDE
                     WHHFPSSFFLPGNTTLRFVRMNASSLLPKPFVSTNIVPEGMNDRNAPVYDDRFVASIA
                     EECDFFAGLVNDVKAPPAMFRNWTLLATATFLDRNQARGLCRAFYIPGCSMRLPTRSF
                     VVLTKAPRETS"
     gene            394965..396867
                     /locus_tag="CYME_CMQ163T"
                     /db_xref="GeneID:16996624"
     misc_RNA        394965..396867
                     /locus_tag="CYME_CMQ163T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461555.1"
                     /db_xref="GeneID:16996624"
     gene            400308..401613
                     /locus_tag="CYME_CMQ164T"
                     /db_xref="GeneID:16996628"
     misc_RNA        400308..401613
                     /locus_tag="CYME_CMQ164T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461556.1"
                     /db_xref="GeneID:16996628"
     gene            complement(<401676..>402398)
                     /locus_tag="CYME_CMQ165C"
                     /db_xref="GeneID:16996629"
     mRNA            complement(<401676..>402398)
                     /locus_tag="CYME_CMQ165C"
                     /product="cytochrome b6/f complex iron-sulfur subunit
                     precursor"
                     /transcript_id="XM_005538045.1"
                     /db_xref="GeneID:16996629"
     CDS             complement(401676..402398)
                     /locus_tag="CYME_CMQ165C"
                     /codon_start=1
                     /product="cytochrome b6/f complex iron-sulfur subunit
                     precursor"
                     /protein_id="XP_005538102.1"
                     /db_xref="GeneID:16996629"
                     /translation="MFVLTTNSLTFRTVPRCYPGTVERQHTTLGRKRVALRMTYALPS
                     TVDNARGGSGSGGDGGGSSGSDDDYIPDMGKRTLLNLILLGSVGLPASIMLSTYASYF
                     MPPSKNKSSGGAIAKDALGTPIKKEEYLKTHPPGSRDLVQGLNGEPTYLVVNDAGELE
                     TYALNAVCTHLGCVVPWNAAQNKFICPCHGSQYDRTGKVVRGPAPLPLALAHTKVDDD
                     GFVQIKPWKETDFRTGEKPWWK"
     misc_feature    402600..405950
                     /note="repetitive element"
     gene            <406141..>407748
                     /locus_tag="CYME_CMQ167C"
                     /db_xref="GeneID:16996630"
     mRNA            <406141..>407748
                     /locus_tag="CYME_CMQ167C"
                     /product="sulfate binding protein of chloroplast sulfate
                     ABC transporter"
                     /transcript_id="XM_005538046.1"
                     /db_xref="GeneID:16996630"
     CDS             406141..407748
                     /locus_tag="CYME_CMQ167C"
                     /codon_start=1
                     /product="sulfate binding protein of chloroplast sulfate
                     ABC transporter"
                     /protein_id="XP_005538103.1"
                     /db_xref="GeneID:16996630"
                     /translation="MVVVAHLLYVTVSVHATLDEILSGWGRNLKCVLDRRRPGLAGPR
                     DTRPRPRSGGHVLDALFARKLPFPPKDSFDGWCTAPLQTMASLPSPWPIVAIKKRRRI
                     VFAGFSVTRAVFKRITESFQQRWLAKTGEDVDFGLSFAGSGIQSRAIRDGLPAHVCCL
                     ALVDDIEKLARGGFIDQAWRMRTPYNGIVARSLTVAGYRPQLDASPSTDKICECFYDI
                     LAKNLAVITANPKSAGAARWNFLGLWSAARSGTMRFEPTFIQNALQARDSTKNAILHR
                     MLETENDWIALAFLREVYLRAPVLPRDGRDATDVFLRQELGDVLITYENEAILAQMRG
                     LPLAYSIPSAEANCLIEFPISVVDRNADREKVRDVADAFVEYCFSDEAQQIFADYGFR
                     PVSERVFQQVRERFPSPSILETVDEHYGGWSAVMQKFFVTGAVFDILLEQVSLELLRR
                     RRSQRRWIFGGRRGRGAQQGNIPHHKHANLVMDSDESEQSTNYASMQIPRTNLVVVEY
                     EQQQQQQRLCRDGISDERCIRAASWLQ"
     gene            complement(<407832..>409259)
                     /locus_tag="CYME_CMQ168C"
                     /db_xref="GeneID:16996631"
     mRNA            complement(<407832..>409259)
                     /locus_tag="CYME_CMQ168C"
                     /product="similar to glutathione-S-transferase"
                     /transcript_id="XM_005538047.1"
                     /db_xref="GeneID:16996631"
     CDS             complement(407832..409259)
                     /locus_tag="CYME_CMQ168C"
                     /codon_start=1
                     /product="similar to glutathione-S-transferase"
                     /protein_id="XP_005538104.1"
                     /db_xref="GeneID:16996631"
                     /translation="MQVLFSLSCEGLGNGALSKLFGVRRSPREVAQCNRSAAVKMSDT
                     LARSVLAERLLKLAQKVPQGILQPDRRQAKRLVHFSFEEVCRVFDSGLGDDEVPVVLY
                     RDPALWCPYCQRVQFYLEERKIPYRTVHIPMRCYETEENPKPRWYLDMVPSGLLPAVK
                     LQPSGALLTESMDIMEFFEEHPMFSQYPAAYARSPAETRRKTELLRLERRLFSDWLRY
                     LTGSTFLSDRLREQFLQTMDAVEYALRESPRFPFLSVLAEGNEHGPGLVDCAIAPFLE
                     RIEYSIPFWKGIEIRGNARWPRLEAWFQAIEERPSYLKANAYSTVLNLPPQIGRCTTA
                     RSESAEATRVQEQVLHEAERTPWVEYSSESTCPATVRESRLEAAAAIIRNFSRIVNDM
                     RKHCRDNAPDADSIEVALCSVAQVLIHGTVEGTPPVSDPVARGALEHIRQRVCVPRDL
                     NLNASKQFYGAINALLAKSSATRKH"
     gene            complement(<410000..>413650)
                     /locus_tag="CYME_CMQ169C"
                     /db_xref="GeneID:16996625"
     mRNA            complement(<410000..>413650)
                     /locus_tag="CYME_CMQ169C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538048.1"
                     /db_xref="GeneID:16996625"
     CDS             complement(410000..413650)
                     /locus_tag="CYME_CMQ169C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538105.1"
                     /db_xref="GeneID:16996625"
                     /translation="MNQDERARKPANCRQKARLLLSTEQPGNAAFIRTLLELASHLQR
                     VRSQTSFSDVRESLVHTTEVLQRVQIDSQCLGRSTEVCVSVLSALFFSVAVVLERLVD
                     SRTALADTLIRTLSTAFSVQSAPLDEQVVDASVPQLEAALWRRFESLPLNMVSGSSPQ
                     VWKHTTGTCSQVFTEPAQVALRCVASWARARTDQTRGIEAPVAREPSTQELSLESGMF
                     GNGSSTFNENLKSLSSRKVTLETGRLDHENFALDDDLSSPLASQIHSHVGDASGEPKR
                     LAQLDLPEQHDNAGGVLIPDTVVRTRNPSPPNNDSMQHASDSNGQSSHVDRLWAVAHD
                     NQRKLEPKQNACPVIREAAEANAAFKEATCLKGGPRAQRRLTAGCRHCFPCAVLSEAL
                     KRAGRGAISCILLFLLELSRSRAQWQQRSSAIRLLHRFIAFLPQDELRQCLPGISSGL
                     CSVIAGDAQTRALVIAEAATCFGTLFARALEPSLGTEVTGSMTAPASVTSGCNWQQTK
                     SAVGIVSPEHASPVPSKADTKHWIHAVAPKLQALLNRILVENCNAFSLHHHPSALVQA
                     AGVYLCTVVLESIRMQDAFADDVPMLFANLALYLTSEHHQVAVLAARALRFIEALYDS
                     VLAERALDGIGEDLGEFSDDPERPWHRRRMRCAAGLLVYLGQCQRASALPRLVQYLYE
                     RRNILDLLLAIHDSDARAGPASPGVWILEAASEGAPPNARLFPGERCDLVQLLGYAGA
                     MDPLLDPMLGRLDSRKSDAQAQHLQSLLSFANNLLQGSLSREHPDASQAVSNRSNGDD
                     LLSVYLEIGEESRHDPATLIQILRGIRVYAAWAARDVVDFRRRCLHKYMAFVASVSLP
                     VATSASQMTAPVEDKIPRNASLAADSELEPGSGSAADTNALATAASQTLQVLATAAGF
                     ASVESLVRAQLSFLIRVVSTESARRFFFSIAGPESLVLVSDELVDIGRGIAFLSEERA
                     LRNLELLDTVCAVLGRHPCLRSDSEHRADADDVEEDPSLLRLAQVVESVGSAALAATE
                     RQSPELRRAALQLLHGLLESLASNQRLLLPMVARVLDHVPRCMLQTRADVRIAACDVI
                     ELAFILVPWFASSRTDKIWATMSRLLPQPLRTNARRRESPGTAREHEPLQLVRGITWA
                     TITRVLQCLCKIPVNSLRKHEQAIRAQCSAIQRFTSRSISVQAQSDFALALSAAQQLV
                     SILAAQYPEAEA"
     gene            <413896..>415110
                     /locus_tag="CYME_CMQ170C"
                     /db_xref="GeneID:16996626"
     mRNA            <413896..>415110
                     /locus_tag="CYME_CMQ170C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538049.1"
                     /db_xref="GeneID:16996626"
     CDS             413896..415110
                     /locus_tag="CYME_CMQ170C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538106.1"
                     /db_xref="GeneID:16996626"
                     /translation="MSAFLILFLKQHDPNKKADDAPHRARQKSGYWKDLVLVAQQIRL
                     FQSRFGLPNDRLPTEYELRRHGYNGGHTILRALRLHGGKRAFLQKLARLDDPEAKAPF
                     ASWQEASPQRKVSDARRVARSLKPELEGLARKLGLPGKTLPNLSLIREYEPLLANVIC
                     STPGGYAAIARELNCCIEQQKPVSWASMRRLKPLPLQELKRELLKFIAERTVTPGVMP
                     PERILAKAGRFDLIISIEYHGGSRAVAEICELRDSASWEYVLEMRDLLRELRAYLNLA
                     NKGNEMPSIAELQRQGREDLARLIRRHGGPLVFAARFGLYVPPSRRRREADLKWGPFS
                     LALAVRLLDACYQRGRAVDGIPELPPLSELDLELQTEIAEYGGPDTVARRLGLAFARP
                     DGASGTLREDHC"
     gene            <416762..>417034
                     /locus_tag="CYME_CMQ171C"
                     /db_xref="GeneID:16996185"
     mRNA            <416762..>417034
                     /locus_tag="CYME_CMQ171C"
                     /product="Sm protein F"
                     /transcript_id="XM_005538050.1"
                     /db_xref="GeneID:16996185"
     CDS             416762..417034
                     /locus_tag="CYME_CMQ171C"
                     /codon_start=1
                     /product="Sm protein F"
                     /protein_id="XP_005538107.1"
                     /db_xref="GeneID:16996185"
                     /translation="MTATGFAEAVKPTNLLSALQGNRVSVRLKWDLEYTGLLASYDSY
                     FNLELEHAEELQPDGSSLPLGDMIIRCNNVLYIRDLRSTVPVPPLS"
     gene            complement(<417188..>418084)
                     /locus_tag="CYME_CMQ172C"
                     /db_xref="GeneID:16996186"
     mRNA            complement(<417188..>418084)
                     /locus_tag="CYME_CMQ172C"
                     /product="triose-phosphate isomerase"
                     /transcript_id="XM_005538051.1"
                     /db_xref="GeneID:16996186"
     CDS             complement(417188..418084)
                     /locus_tag="CYME_CMQ172C"
                     /codon_start=1
                     /product="triose-phosphate isomerase"
                     /protein_id="XP_005538108.1"
                     /db_xref="GeneID:16996186"
                     /translation="MFVTLGVPSRAVSSKAESYAQRLRIVRTARTRLFMSAQSARKFF
                     VGGNWKCNGSKQSVQELCEAFNAGKNIDFNRVEVVVAPPSVYAMLTRSILRPDFGVAL
                     QNCWVGKPGAFTGEVAVEMIRDIGLSHVILGHSERRHLPEIRESDDVIGRKTKYAIDK
                     GVHVILCIGELLEEREAGRTREVNERQLSAVRAHLSADDWAKVVIAYEPVWAIGTGKV
                     ATAAQAQEAHSEIRSWIRRQVSEACASQMRILYGGSVTPENCLELAAQPDVDGFLVGG
                     ASLKPTFLDIVRAYQAKETVSV"
     gene            <420528..>423227
                     /locus_tag="CYME_CMQ173C"
                     /db_xref="GeneID:16996187"
     mRNA            <420528..>423227
                     /locus_tag="CYME_CMQ173C"
                     /product="tousled-like kinase"
                     /transcript_id="XM_005538052.1"
                     /db_xref="GeneID:16996187"
     CDS             420528..423227
                     /locus_tag="CYME_CMQ173C"
                     /codon_start=1
                     /product="tousled-like kinase"
                     /protein_id="XP_005538109.1"
                     /db_xref="GeneID:16996187"
                     /translation="MSSVFECHTEIETECVHDESYGTFREPLVYRSQRLSTQTLREKL
                     ALLERRLNPRPWDARTAQSEVLLVNKKPRFCVEGFERLSGNYSGEELVTAGAGAPADS
                     AAKLATPEAETWVYCAKAAADGCGSSVCRPGQSDSKSGSETRRTPIPRGERVPGKVDV
                     VAAATITSGAAECADASSVDASGKHTDQLHPGQSSSCTDNRFQAEIHDRTPEHRNEND
                     LRCPESCHRRGCEAGATPPPGSQSTSPGNSCSVAETILTVSRFEGRSGCQTELGSQTP
                     SQTPAATVDRSSSPVASNSGERSCRSEPARHAQEWTTPAAVAGQSTMNRPRKRKARVP
                     AAEENNGLTLDQFFSRAEKMTPSASAGACTFEMDSIESGSSRVSAADDAPGSQSIAGQ
                     QDARLVKATASVEEIHNQYVLQIEGLSTQLEELRAVAFELESTQERLSQVERTAGALR
                     NALMDALREQGRLERGLNARLVAEKCQRLGQPVIARSGTALQEVWEDGSEFQRLSERQ
                     NVIAAERESIERSRKELSRLRRPAPGQNDATADAPQWLSMYIAEQEEIFRVRIQLLKR
                     DEAALAEERAKLECERAMLLRELKRVRDESASRFREFPLLADRYLLLRLLGRGGFSEV
                     WKAYDIEQARYVACKIHQLHAYWSESRKSNYIKHATREYRIHATLKHPRIVSLYDVFE
                     IDDHTFCTVLEYCGEACDLDTYLRMNHHVSEREAKSIIAQVLSALLYLNSQPKRIIHY
                     DLKPGNILYTNGEVRITDFGLSKIMDENLNTMDGMELTSQGAGTYWYLPPECFEGISA
                     TSGATGPRISNKVDVWSCGIILYQLLYGVKPFGNDLSQERILRDGTILKASDRDLFFP
                     AKPAVSTEAKDFIRLCLTRNQMDRPDIRSIAMHHYLRGTITMS"
     gene            complement(<423289..>424209)
                     /locus_tag="CYME_CMQ174C"
                     /db_xref="GeneID:16996262"
     mRNA            complement(<423289..>424209)
                     /locus_tag="CYME_CMQ174C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538053.1"
                     /db_xref="GeneID:16996262"
     CDS             complement(423289..424209)
                     /locus_tag="CYME_CMQ174C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538110.1"
                     /db_xref="GeneID:16996262"
                     /translation="MRENEAVKPTIQAVYLAAGLSSRFGGRIKCLQEVGRHGETLLEL
                     SVRQLCEAYPAISSLVFVVSEATHLPIHALIGEQFYGLPVYFCVQRVPAWRKRPLGTV
                     DALLAAREHIHGPFIVLNGDSLYGVAALSLVCNHITAAKTACMPGYKLREVLPKEGRV
                     NRAIVQTDERHRVLEIVEQYNIGFEDIEEGRYTGDELTSMNVFGFHDTSIFARADERF
                     RRFLSELEALRDDHHLQQQQQSVKRCSTDENDVYAHKEYILSTMLNELLHDAQIELMV
                     LSCNSIRTPLELTNPGDFAFVKNHLDLVGL"
     gene            <425905..>426795
                     /locus_tag="CYME_CMQ175C"
                     /db_xref="GeneID:16996263"
     mRNA            <425905..>426795
                     /locus_tag="CYME_CMQ175C"
                     /product="mitochondrial ribosomal protein S9 precursor"
                     /transcript_id="XM_005538054.1"
                     /db_xref="GeneID:16996263"
     CDS             425905..426795
                     /locus_tag="CYME_CMQ175C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein S9 precursor"
                     /protein_id="XP_005538111.1"
                     /db_xref="GeneID:16996263"
                     /translation="MLRWWWWCRRFKANLPVSTLRGEQLFGSAQHRNLTQSSYVGESV
                     YLWQNKARVHGLVSPREIACSPRLRSILSGALSRRGYSTPASESVDVQRRLDEQLRAK
                     AAIALDPQGLATVLADSTRIEEANATVQPDSTANETQAQQRRRRRRLYPDGSVNATGR
                     RKTAVAVARLFPIESPGGPQSTAVDHETLVEPRFRVNRQDIADYFLRVDHRLEIMRPL
                     MLTGMENRFHVHAFARGGGITGQAEALRLAIARALEDYDPELRRILKPAGLLTRDPRM
                     VERKKYGRHKARRAFQWVKR"
     gene            complement(<428525..>430888)
                     /locus_tag="CYME_CMQ176C"
                     /db_xref="GeneID:16996336"
     mRNA            complement(<428525..>430888)
                     /locus_tag="CYME_CMQ176C"
                     /product="ATP-binding cassette, sub-family B, member 7,
                     mitochondrial precursor"
                     /transcript_id="XM_005538055.1"
                     /db_xref="GeneID:16996336"
     CDS             complement(428525..430888)
                     /locus_tag="CYME_CMQ176C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family B, member 7,
                     mitochondrial precursor"
                     /protein_id="XP_005538112.1"
                     /db_xref="GeneID:16996336"
                     /translation="MHILFRISTCVFPRVASRKRACKLSASIQWWCLQQGNGWTHEVR
                     AQEVSLYSMHSAHYTKRAANDRNRVQRSLLWNSEAFRRSPFQRGCRVHAGSPRAHAPE
                     EKLRRPADAPAPASKTLAERWLLLRQRSSEKVMRGLRSLGLISESESTSTSSKLLHSN
                     ADMAGLEGVKPASFRGVGRILSRYAWPRDNPVLRRRVAIAVSLLFVSKILLVQVPVTF
                     KIAVDMLSKAVDPAAAYASTWPVLILLAYGLARGAASLTNELRNAIFATVSQRAISDL
                     ALTTFRRILDLDLSYHSSRKTGALARTIDRGMRGIDFLMRAIVFNILPTILEVGLVCG
                     MLAYSCGERYAIIAGGALTAYTIFTLVVTQWRTQFRKSMNIAENAASNKATDSLMNYE
                     TVKYFNNESVEADQYAAFLEKYGRENVKTQVSLSVLNFGQNAIFTVAMAAMMVMAARE
                     VMQGQLTVGDIVLVNGLLFQMSMPLNFLGTVYREVRQSLTDMEMMFGVMQLRPRVVEL
                     ASALPLFLERDASIAFRGVSFAYPSWADPPSTGSTASHQILREISFDVPHGKKVAIIG
                     PSGCGKSTIIKLLFRFYDPDQGSIYIGGQDIKRVQLASLRRAISCIPQDIVLFNNTIE
                     YNIRYGRIDATKEEIEAAAKAAYIHDTIVEHFPHGYETMVGERGIMLSGGEKQRIAIA
                     RAILKNSPILVCDEMSSALDSSTELLIRHAIQQVASNRTSIFIAHRLSSISDADEILV
                     MNDGCIIERGQHQSLLREGNTVYAQMWRAQQSEAAVSQDASLAENIP"
     gene            <431312..>432367
                     /locus_tag="CYME_CMQ177C"
                     /db_xref="GeneID:16996337"
     mRNA            <431312..>432367
                     /locus_tag="CYME_CMQ177C"
                     /product="similar to ribosome biogenesis protein SSF1"
                     /transcript_id="XM_005538056.1"
                     /db_xref="GeneID:16996337"
     CDS             431312..432367
                     /locus_tag="CYME_CMQ177C"
                     /codon_start=1
                     /product="similar to ribosome biogenesis protein SSF1"
                     /protein_id="XP_005538113.1"
                     /db_xref="GeneID:16996337"
                     /translation="MPKRSGGYRKKRRTQPPQSTEPSESEAKPPQSFVFRRGPASPEV
                     RALLLDLRRVLLPNTAPRLREGDRSDLKDLLDVAGPLGVTHFVMFRESRLGFVNVRFA
                     RTPRGPTVTFRLERFSLSSDVHRAQRRPLTLKHTDFEQAPLLILSNLDTDTPNTQLLV
                     TMFRNLLPPLDVKNIRLEQDVKRVLLLDWNATTEELEWRHYGIRIRPQGVSRTIRRVI
                     ERRGRRAGALGAGHLHDVSELADPSLAATLLTSESEAEGPSEFQFERWMPPPNPEPSA
                     ISAGVGTAVSGARKRTTGSGRSRMSAASYAPRAAVRLIEVGPRMTMRLLKIEEGLSSG
                     TVLYRAASFSARDGAQL"
     gene            complement(<433884..>435557)
                     /locus_tag="CYME_CMQ178C"
                     /db_xref="GeneID:16996338"
     mRNA            complement(<433884..>435557)
                     /locus_tag="CYME_CMQ178C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538057.1"
                     /db_xref="GeneID:16996338"
     CDS             complement(433884..435557)
                     /locus_tag="CYME_CMQ178C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538114.1"
                     /db_xref="GeneID:16996338"
                     /translation="MGRTFTYVVTAATVTGLAIGGYYLYKSTRTQLRSLSSTASAHPS
                     ESEKTYQGRAAEQPVEAPTAANVTSSETESGSSGNHRIISESAAVTGEPSASASGAAA
                     QTAEAPPPASSSTTLAKPSETDTATGGVPSLPIIDESELAGQLDASLRNIQETGNADT
                     ARERKLLKKLQSIESYEVLSAPCRFVIAQWCHTVFCTRTAAQYNPSSGKISLEQALQV
                     REELKKTYLESAWSLLEMGGFDELAAEAATVSDAETRQLIRESVARSAALKLDIACRM
                     HDPEKMRTAYNDAVRQAEKDGKSMDVNDRLVLLASAALTGRCDEVVRLGGGVGRHELE
                     VLHSAALKDPSMIDYGALYLLSLKIVEEQHRLEKEAHDANKSPAVGQENSSTASLGFV
                     PGLAWEAYTVRKTRFRLQSKEASPSRSVVTTSSSSNTAPLRPGVVADKWTEQKPHAGV
                     NLIRTGALVHYINPGAVPIPISGFGTDKEIRLFGYIDVQDQESKEQMRHMELFRLVQD
                     AERADIWRGTETTTLFCVSGKRKGHTLATSVLDVEFEMEPDKTAIWRVL"
     gene            <436183..>436560
                     /locus_tag="CYME_CMQ179C"
                     /db_xref="GeneID:16996356"
     mRNA            <436183..>436560
                     /locus_tag="CYME_CMQ179C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538058.1"
                     /db_xref="GeneID:16996356"
     CDS             436183..436560
                     /locus_tag="CYME_CMQ179C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538115.1"
                     /db_xref="GeneID:16996356"
                     /translation="MRRRVNASAASLPHHISTTRVAEVSIRITAYVCYGYGCVKSIPV
                     AANFSMHQPMTPIWRSTKNLSRITSAFLTHYKPARSSCAERKCSARIRAITVAAAWQT
                     NGSICTLRVCMNSVTPYRRRAQS"
     gene            complement(<436672..>437142)
                     /locus_tag="CYME_CMQ180C"
                     /db_xref="GeneID:16996357"
     mRNA            complement(<436672..>437142)
                     /locus_tag="CYME_CMQ180C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538059.1"
                     /db_xref="GeneID:16996357"
     CDS             complement(436672..437142)
                     /locus_tag="CYME_CMQ180C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538116.1"
                     /db_xref="GeneID:16996357"
                     /translation="MPVQVNTSIEILAPASVIWDILCDFERYPEWNALFSNIRGELAL
                     GATLTVELDSGWRGRRFRSKLTQLRTGNELTWERKLVFGWVFRGRHSFRIEPTTNGCL
                     FTHTASFSGITADVFPSGRFRKRLLRDFEAFNHGLKSRAEQMARTDVPSPPAAE"
     gene            <440209..>441315
                     /locus_tag="CYME_CMQ181C"
                     /db_xref="GeneID:16996401"
     mRNA            <440209..>441315
                     /locus_tag="CYME_CMQ181C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538060.1"
                     /db_xref="GeneID:16996401"
     CDS             440209..441315
                     /locus_tag="CYME_CMQ181C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538117.1"
                     /db_xref="GeneID:16996401"
                     /translation="MPTTREAHDGSSGCTEQASQRVKRLRAALREHSTAIDAVKDTVD
                     AQKLQEFLDRNDELSVDVEDAVAQGLLSEAYLKITLLERALVAKVKTGLRVLDSDAFL
                     ERLRTKWSVSRQHGVPTRDTYASGVTLAESITTVPETSEPERPSEQAAANLRDASTGD
                     LVVDLDALGKRFYRFFRTAPAPTFMFGLVNLSTETASNVSSVEQTPVVRERAARERTV
                     VAATERAEQVSLNDVQEQVRTDVAVKQMFDFLEEHGPIELYDLVLDTSSFGRTIENLF
                     HLSFLIRDGRVELWREHDQYMVRPLHRHGQSLARTGQEPAPGTAGAELVAGKQAIFRF
                     DWQDWSELCMQRHGKRTLQPGTSPNPSHSSIAAL"
     gene            complement(<443460..>444065)
                     /locus_tag="CYME_CMQ182C"
                     /db_xref="GeneID:16996402"
     mRNA            complement(<443460..>444065)
                     /locus_tag="CYME_CMQ182C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538061.1"
                     /db_xref="GeneID:16996402"
     CDS             complement(443460..444065)
                     /locus_tag="CYME_CMQ182C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538118.1"
                     /db_xref="GeneID:16996402"
                     /translation="MFERRLNWGYHRNLPVLSSAVEVFAVQLYKAVRQPLQPAKDAPA
                     LEPVRDLAILPIPRWDSRLTPEASDDGTDEWVPAWKLTLTLLHITRVCLLGIVREIKF
                     SRACIRLAIDDGTGVAKAQCWNSPEGMLQGAGDWKQGTRSALQTGVVLYCSGRVNWHE
                     GNCICIVDELRVFPPCKSAAAEMRWWRRVIERQRELARQYA"
     gene            <445690..>447894
                     /locus_tag="CYME_CMQ183C"
                     /db_xref="GeneID:16996403"
     mRNA            <445690..>447894
                     /locus_tag="CYME_CMQ183C"
                     /product="similar to replication factor C"
                     /transcript_id="XM_005538062.1"
                     /db_xref="GeneID:16996403"
     CDS             445690..447894
                     /locus_tag="CYME_CMQ183C"
                     /codon_start=1
                     /product="similar to replication factor C"
                     /protein_id="XP_005538119.1"
                     /db_xref="GeneID:16996403"
                     /translation="MDVSGNGLLMPRNLQVRRSDGRVLSVRIREASLGEEANLHFGKL
                     EAAVACPVAGVHEASSWTREPVCRTNRQSSNNVDHEVSQSGLSLADKAATVNGMLWSD
                     AHAPKAYTELLGDDRMHRELLRWLVSWSQYRDVRSTSGASFRNGTGACRRFTAPLTPL
                     AVLAGPPASCKTACVRVLAERAGLEMWEPHMLFRDGLNCAENRFAEVLGSASLRTGRP
                     RLVVVDEGVLPAEAFASLKRSAGNASANTIHWSDVLVRVALTLKSVPVLFVLDDAHCR
                     EARILRAQGAVIFTCSRPGLQPLKRRLEQVTRHCGLKFAESAFLEHLALALNCDIRAC
                     LNQLQLIGACQWSDGLWSTIGLRDAPGPLREQCSQIFRVSARPASYMVQTGAGGVRNR
                     ATGTASDDSERDIPHRPAFGASQSPDLWKRQHFLSGEIRDYLDMCFENYLAVVPFDPL
                     MRRCSAAVDWHSCIDSMIHNELVDSMVLETLGLAALQSYRYHCGRSTAPVPHSLKLAR
                     FGCLDANSPMHTRNRDIIERYRQALIEDSSNASVRQAYALSLRREGVLVFIPLLVVTM
                     QAIVEATVAEKGARRAELLRHLGKQLSSYALRWAADDDSQANIAPEAPSGARRWNALP
                     LEPAIADLCIMQSASYPECKREGVRALQRQFGVLLRNCAGQRVRSARNVALRGNALHH
                     HAAHPLSLPVKRDARISELRSHSDGIQCIVRYQYREGHTNAVLRPCLIEDLL"
     gene            complement(<448936..>449868)
                     /locus_tag="CYME_CMQ184C"
                     /db_xref="GeneID:16996412"
     mRNA            complement(<448936..>449868)
                     /locus_tag="CYME_CMQ184C"
                     /product="similar to vacuolar sorting protein VPS20"
                     /transcript_id="XM_005538063.1"
                     /db_xref="GeneID:16996412"
     CDS             complement(448936..449868)
                     /locus_tag="CYME_CMQ184C"
                     /codon_start=1
                     /product="similar to vacuolar sorting protein VPS20"
                     /protein_id="XP_005538120.1"
                     /db_xref="GeneID:16996412"
                     /translation="MGNCIVSDRAVADAVIPRKRARRKDVRRPENQVEITERDEVILA
                     IKATRDRVTKLRNRYEEAAARELDVARTLIATGRRERALLVLRRMKVQERAVLNAETC
                     LSRLEEMLLLIETAELEQQTLLQIQKSTALVKRLNEHIDLHSVEDLLLETQEAAEHAR
                     SIEQALQGEVTPDVEANAQRALLELYQEQELAAFTMNRVLQQPLVTNRLAAQDERELT
                     PDTRLSGPAQEMRHPSRERNASPEQSAPTSRSLARDSALHLERVANIEAKETACVTGK
                     MRTPAGPSNSLTNADARAELATPARDEEHIAEAA"
     gene            <453570..>455234
                     /locus_tag="CYME_CMQ185C"
                     /db_xref="GeneID:16996413"
     mRNA            <453570..>455234
                     /locus_tag="CYME_CMQ185C"
                     /product="box C/D snoRNP component Nop56"
                     /transcript_id="XM_005538064.1"
                     /db_xref="GeneID:16996413"
     CDS             453570..455234
                     /locus_tag="CYME_CMQ185C"
                     /codon_start=1
                     /product="box C/D snoRNP component Nop56"
                     /protein_id="XP_005538121.1"
                     /db_xref="GeneID:16996413"
                     /translation="MGKLYLLFEAASGYAIFRVVEAEDVASGTTAVQSSWGDFHRFAS
                     IVKLRAFEPYVSADQALEDVSAVSENRVTPFLLEFVRGYFGSKRCLLGVSEPRFGAAL
                     QEQLGKKHVRVVADEHIQELLRNIRQHFEKFLSAEVSSEELSKAQLGLAHALSRSRIQ
                     FNPQRNDHAVVQAIHLIDQLDKDINTFGMRVREWYSWHFPELAKLVSDIVLYCRLVCA
                     LGMRSEMTTKQEEDVNSLLHGDEELTQRILRAARSSMGTEISPLDIIQIRLFAQRVIQ
                     MATYRDHLQGYLGQRLSLIAPSLRALLGDHVAARLIAHAGSLVNLAKYPASTVQILGA
                     EKALFRALKQARGKRLARTPKYGLLFNSTFIAKAKQRAKGRISRYLANKVSLASRIDC
                     FRSDRIGDTFGRKLREQVEERLQFYEKGLRPRRNAAVMTEAMNEALATSAMDDMRGSD
                     IEETPRPAAAGLRADRLENSLLVFGSATNADAEGVPESAAPETPAHDVMMRKRSHDDT
                     SFVDAGDAHLTTLGAQDSSREAIPREAPRKKKKQDKHRAEAVHETV"
     gene            456588..459144
                     /locus_tag="CYME_CMQ186T"
                     /db_xref="GeneID:16996454"
     misc_RNA        456588..459144
                     /locus_tag="CYME_CMQ186T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461557.1"
                     /db_xref="GeneID:16996454"
     gene            complement(<458388..>462356)
                     /locus_tag="CYME_CMQ187C"
                     /db_xref="GeneID:16996455"
     mRNA            complement(<458388..>462356)
                     /locus_tag="CYME_CMQ187C"
                     /product="DNA repair protein RAD50"
                     /transcript_id="XM_005538065.1"
                     /db_xref="GeneID:16996455"
     CDS             complement(458388..462356)
                     /locus_tag="CYME_CMQ187C"
                     /codon_start=1
                     /product="DNA repair protein RAD50"
                     /protein_id="XP_005538122.1"
                     /db_xref="GeneID:16996455"
                     /translation="MSRLIKLGFSGVRSFGPDEEQRLRFQAPITVILGANGTGKTTIV
                     ECLRLATTGELPPLVDKGAAFVHDPRLRESKETKAKIRLLFEDALGRQITVNRQLQLR
                     LTTAGKQSFSTVETSLSIRDKDGQHIKTSNRCNDINAMAPAFLGVRQAVLENVIFVHQ
                     EESLWPLQDPKKVKEKFDDIFEARGYAKALIAIQKCAQQKLAELKILHSELERWRDRL
                     ENLKQKQRNCRSMQAQCLEWSNSLGTLETELSEKIRAVTELEEARAKEVERRRQLQAL
                     RDEIRIRTEERDRLWRELGKELTETTQDLERLLTRITAEYSQVDAEYRKASEESLQLQ
                     KQLQLLRDREQRLQEECAAYSCQQAAIERQRASCAELLREIRKSHSIDGTDIGEGAIE
                     RSAKDLIHILERSRNDCEREMEHFKRLWEDALQREQKLKLELESDQRQAQQIRNEIAT
                     LEEACAETAARLQSLPMNVEIVAMKSALLVQFQAEKQQVDEELSNQTDMDRMSTIRKR
                     LEQIFEVRTKNLASRRNDVTHTATRGDTNASAIAAAFQKFREEEEASIQRLLEQRRLP
                     SCSVSEAQDRLASAERNLSAVRNRIMGTELEMRLRRAICDKESERLLSMRSRLREIDA
                     SVQPGTVDAECLKSQISALKRRHLELESTALERDGQANWLEEMRKRVHEQKTCPLCDR
                     AFSGMAEAANVESALARVRNTLTQAADSDSLEYVQDALNRAEHQWRLLEERAAITLQE
                     QRSISRIRSAESEIQRLEDARRSERTDQQVAEHELADARELLWYARRLAHLRQEMAPS
                     GPSSASGIAASSPVVAALEVDTREAPHQPTSAGDALAREETSLRGELDTLLGRRQELL
                     VRAQELHDLIQTTEKELTAERAKQHDRDQLEACLAEKRKQRSEKQASLCALDQKVEEA
                     LLQAAPPASAALLARLEAVRSRHRAIHTDLIRLENRLQVYIQESRRFEGDAHKLAHKQ
                     LETCREQIIQTLAEEAQAVQVVAQWAGQRQNADSYLRQVRDNLRYRQLQEMLVELQQK
                     DVELASTLPMTDEHDPHVSALEAAKAEADTLREKVHHLRGQRDLLAEQLRALTVELDA
                     DVFAQAEQQFQALRLQCDVIELVCRDLRNYHRALDLAIMRYHDLKMRSINRVLRELWQ
                     STYLGSDIEEIEIRSDFVADSLPMGRRTYHYRVVMRQGDTWLDMRGRCSAGQKVLACL
                     LIRLALAENFGNACGVLALDEPTTNLDESHVKALAASLSLLIQQRAQQRNFQLILITH
                     EERFLDYLHIREYADSYIYVTRNRQGLSQIQHHSLNETTGRREASELPFAYPGPLVVT
                     AR"
     misc_feature    complement(462420..465329)
                     /note="repetitive element"
     gene            <465782..>466384
                     /locus_tag="CYME_CMQ189C"
                     /db_xref="GeneID:16996456"
     mRNA            <465782..>466384
                     /locus_tag="CYME_CMQ189C"
                     /product="small GTP-binding protein of Rab family"
                     /transcript_id="XM_005538066.1"
                     /db_xref="GeneID:16996456"
     CDS             465782..466384
                     /locus_tag="CYME_CMQ189C"
                     /codon_start=1
                     /product="small GTP-binding protein of Rab family"
                     /protein_id="XP_005538123.1"
                     /db_xref="GeneID:16996456"
                     /translation="MQRPLVALKIVLVGNSAVGKSSLLLRFAEGTFAELPATVGVDFR
                     VISLENVQGYRVKLTCWDTAGQEKFRTLTSSYYRGAHGVIMVYGIDDPESLKHLETAW
                     LEEARRYVNNPNAVYMIVGNKSDLPTAVVPRADGRRLAERVGALFLETSAKSGSGVSE
                     CFVELVARILEAQPHVTGDGEQAGVQLEAGPYHETASCLC"
     gene            <467623..>468333
                     /locus_tag="CYME_CMQ190C"
                     /db_xref="GeneID:16996457"
     mRNA            <467623..>468333
                     /locus_tag="CYME_CMQ190C"
                     /product="hsp90 co-chaperone p23"
                     /transcript_id="XM_005538067.1"
                     /db_xref="GeneID:16996457"
     CDS             467623..468333
                     /locus_tag="CYME_CMQ190C"
                     /codon_start=1
                     /product="hsp90 co-chaperone p23"
                     /protein_id="XP_005538124.1"
                     /db_xref="GeneID:16996457"
                     /translation="MVLTPDFCWAQRKDKVFVTVKVPNVQKDTAVLKVTPEGQVYFKG
                     TGGEIGHEREYELDIRLLHGIKAEEAQHGIQARQVYFVLPKAEAGEWWPRLLHDPGRN
                     VHLSVDWNLWVDEDEDDQFDFGSHFGSRDMADLDFGMGDDDDLGDDEDDDDDDEGVDG
                     EGGLGDTEEKEDAQEAAADVTPTLSENHMHRDQEADENDVVKSEPGTVTEAAKDLGKN
                     AESVQAASTEGPASVFSS"
     gene            <469819..>471267
                     /locus_tag="CYME_CMQ191C"
                     /db_xref="GeneID:16996448"
     mRNA            <469819..>471267
                     /locus_tag="CYME_CMQ191C"
                     /product="citrate synthase, mitochondrial precursor"
                     /transcript_id="XM_005538068.1"
                     /db_xref="GeneID:16996448"
     CDS             469819..471267
                     /locus_tag="CYME_CMQ191C"
                     /codon_start=1
                     /product="citrate synthase, mitochondrial precursor"
                     /protein_id="XP_005538125.1"
                     /db_xref="GeneID:16996448"
                     /translation="MHCARFVLALGRRDLRRAEKSWPSDVWKRAVRALSTSSATSLQE
                     AVRSKIEPMRAQVHEVRERFGEEVLDACTVNQAYGGMRSLKAMVYETSLLDPQEGIRF
                     RGFSIPECQRLLPRAKPSGEQPLPEGLLWLLLTGEIPTESQVESVCQDLKRRAAVPPE
                     VLRLLDELPHERMHPMTQFSVAVSLLQHESKMAEAYAQGAPKSTFWEYCLEDALTLIA
                     RLPAVAARIYRNTFHGGKHVPAEKIEKVDDMGMRLARSLGFELNEFDELMRLYLVLHA
                     DHEGGNVSAHAVRLVGSALSDPYLSFAAGLNGLAGPLHGLANQEVLRWLLQMKEKLGN
                     RPMTTENLRELCWETLREGHVIPGFGHAVLRRTDPRYTAQREFALKHLPHDEMFQLVS
                     KLYEVVPRVLEEQGKVKNPWPNVDQHSGILLRYYGLVESNFYTVLFGVSRALGTLSSL
                     VWDRALGLPIERPKSVTTQWIREHFEKRSVSA"
     gene            complement(<471691..>472581)
                     /locus_tag="CYME_CMQ192C"
                     /db_xref="GeneID:16996449"
     mRNA            complement(<471691..>472581)
                     /locus_tag="CYME_CMQ192C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538069.1"
                     /db_xref="GeneID:16996449"
     CDS             complement(471691..472581)
                     /locus_tag="CYME_CMQ192C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538126.1"
                     /db_xref="GeneID:16996449"
                     /translation="MPQANAQALTGHGAFQLLRLESVFGGRVLQPAKMLLSKTMRMHR
                     IHRFIGSTGAHWQRGSGIDSRNLSTRRSAAFPGRTPTPLRTAYVTIFSRLEPDGLPFS
                     VLGSKRDFFGKLRSATVSEAPRDRSTQTALSRSFSESKLVPFSAHELYSVVADVERYH
                     EFVPWCTSSRVIQRYGERLLEAELKVGFQLFHEKYISLVRLEPDRAVRATATTSQLFE
                     HLVNEWRFRPGKNPNESWVDFYVDFRFRSPVYQAAVDLFFNEVARKMVRAFEERARVV
                     HRKFSERRRPSAAVVEEQQA"
     misc_feature    complement(474100..475889)
                     /note="possible transcribed region"
     gene            <476093..>478123
                     /locus_tag="CYME_CMQ194C"
                     /db_xref="GeneID:16996462"
     mRNA            <476093..>478123
                     /locus_tag="CYME_CMQ194C"
                     /product="similar to signal recognition particle targeting
                     component SRP72"
                     /transcript_id="XM_005538070.1"
                     /db_xref="GeneID:16996462"
     CDS             476093..478123
                     /locus_tag="CYME_CMQ194C"
                     /codon_start=1
                     /product="similar to signal recognition particle targeting
                     component SRP72"
                     /protein_id="XP_005538127.1"
                     /db_xref="GeneID:16996462"
                     /translation="MDAETSRQAETLRALERALVRTEHDKVLALSSQLLEGPVTQPSS
                     SDRSEEAALLRARLFQVRGTARANLGQTEAAVADLEQVPEVFRDESLRFLLAYLYYQI
                     RNLSAAKQHIPQETAEGAEFPSTSRRSWDLLRAQVAYVEGKLDQAANTWLRLLSSSVD
                     HAETGALWTNWFAAQSSKSAPVDLSGDASQGLGVLRDAQLYEGLFNVALWCSLRGDAD
                     TATDLLEDARRVAVSELGTEQHVDVARIDVQRGCLLQHQGQELAAQAVYAQLATWQAP
                     RAIVPVDGTTDWVRAFNLSVIEGCLDALLDSEPSTWTVTDAQRQILYWDRALVAIQRK
                     QPRIALDAAEAAFMHRNDAAMLKACALDSLGRHEDAEQLLLAHHLVMPAAQLRYQRGD
                     LTGALALLEQLPILDSPTNSGTVLGRNQPANVLFRVSVYRRQGQLQRALEALQEIDHR
                     KLSTRRLYVEILLENKQYNDALDYLAKDAISDCVLESYRLIALSYIDPLAAEQVLPKH
                     IEERIAREASIRSHQGGWRAPTSESTFGTLRSNQQGPYDTEPAAARAASARPSDAGNA
                     ETVASRRRRGHRKSRNPLPQSFRADAPPPDPSRWLPRHQRPGSRRKARRQAGAPGSAT
                     TDRATQGKIETATELDAQIRAASAAAKVLPMKGAATKLAGKRRVRPSRAGRS"
     gene            complement(<479379..>480974)
                     /locus_tag="CYME_CMQ195C"
                     /db_xref="GeneID:16996463"
     mRNA            complement(<479379..>480974)
                     /locus_tag="CYME_CMQ195C"
                     /product="cyclin dependent kinase, C-type"
                     /transcript_id="XM_005538071.1"
                     /db_xref="GeneID:16996463"
     CDS             complement(479379..480974)
                     /locus_tag="CYME_CMQ195C"
                     /codon_start=1
                     /product="cyclin dependent kinase, C-type"
                     /protein_id="XP_005538128.1"
                     /db_xref="GeneID:16996463"
                     /translation="MHAPENGTAQKTSAESKTTEGTSLGSAPWTVKPRLPSTSPALSS
                     LGNAEQTFTAKPLNIQRRKEAPWKIRDDTVYEKLEQVGEGTYGEVYHARNRETGQEVA
                     LKRLRMANEREGFPLTACREIKVLRELRHENIVNLIEMVTSRGQGGTQTNRKGDIFMV
                     FEYMDYDLTGLMDTPEIHFSEAQVKCYAQQLLRGLAYCHARGVMHRDIKGSNILISRD
                     GKVKIADFGLARFLGETGRRYTNRVVTLWYRAPELLLGENCYGFAVDIWSAGCLILEM
                     LTGRPVFPGKDEVSQANLIFSLLGTPTEDQWPGYRSLPYASTIFNAVPEAKHYPNVFR
                     TVFGSKGLSSIALDFAEKLLTICPERRPTAAEALQHPWFTTEPLPCRPEELPRYDSVH
                     EYQARKRRQLERHAQGVGGIAPNAGAALAMQARQGPVPSHGPLRMAQGGVPAAPVANI
                     AYGVRGSAPAATTAAAMRSAVTYTNLRRPDSAARTPASAPLRASELSPGGYNSLARPG
                     AKRNPPENRPEPLSRESKRERSQ"
     gene            <481971..>484271
                     /locus_tag="CYME_CMQ196C"
                     /db_xref="GeneID:16996464"
     mRNA            <481971..>484271
                     /locus_tag="CYME_CMQ196C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538072.1"
                     /db_xref="GeneID:16996464"
     CDS             481971..484271
                     /locus_tag="CYME_CMQ196C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538129.1"
                     /db_xref="GeneID:16996464"
                     /translation="MPVAKRRRGGKTAAVEPDTRDTRSDAVADRKRTAAEVPASKLPG
                     KITDFGSVPLSRPLAPPLLFELAEERADDLCRLVLVSHEGRPVSSVDALSESEWRGFA
                     TQAVLAREACFAAIQGVHQGEARSEDTIKGNQRAAARDVSETASDAEAEPSPETAIQT
                     SVSIAVSEMDEMITLLDAVIGGFLQTCAAERSGSTRVEGGASPAAPPPILRPVPRDRL
                     TSLKTPETLHLHSKDMDTERDTAIVSVQRGSSDSMGWAPLWMRRVQTLQSIAAFLRHQ
                     HEVLVGQGTKNRRFREDLAMLCYGDTTSCSVNRLRPVLLDTRLLSDTRTTTTTAAAAM
                     SPKAGTQRIRIEAHLHDDCWIPLWPCERHESALHGHISVHASDIASRLDCTCPVLLQC
                     FRGPESSTWYPDQEPLLPLQNPDPMSFRSVPSAMNANSEFVGVAAVRRLLFRVRYQQT
                     MRRLYERLIHQAHDWLRMSLQRRYPGSPFARYDGVCDLRDVDERGFTFYDALSEQALL
                     RVALEQKTPGVLRSETHSASVPPLLQVVDDIVGQHGADFPVLWQLLGNALRICHGTLA
                     VYTASQTLGLLVASRRDGSLHPHDAAASRADVAHFTLEVRWPQTAGDAASVCRLHFGS
                     DAVSGWASTDAASHPEKLSDPSQFIAFLIRSVESTLLRRAIDAWHRALRTQALEYEVA
                     LLASGVARVKVWPSGAAASSDVVEPQRITMHVEALQSPSALPKWTGHVQFRLCLNSEE
                     CFVGDAGALWTYLDESLNIQRLLPNL"
     gene            <485435..>486214
                     /locus_tag="CYME_CMQ197C"
                     /db_xref="GeneID:16996234"
     mRNA            <485435..>486214
                     /locus_tag="CYME_CMQ197C"
                     /product="similar to mitochondrial division protein Fis1p"
                     /transcript_id="XM_005538073.1"
                     /db_xref="GeneID:16996234"
     CDS             485435..486214
                     /locus_tag="CYME_CMQ197C"
                     /codon_start=1
                     /product="similar to mitochondrial division protein Fis1p"
                     /protein_id="XP_005538130.1"
                     /db_xref="GeneID:16996234"
                     /translation="MAMGTTASTPATLETDKKQLLERFAEEEAAFSEIRLAQQTLERC
                     QLLLEQAKAFYERALKSTQRDAQSDTALASTFDSGTVEVQPHSLLIRARLQLYRSQFN
                     YGWALVQQPQPTGRELVREGIQLLQRLASELERDEHANDENLASECYYFAAYGLYRLG
                     EWSEARNMLRILVSRRDGSSQQRRQASAFLAIVDDRIRRDGWIGLGVATALFGVAGAA
                     VVGGILAMQKLGNRDASATDATKARRGSAVASRREASQGPS"
     gene            complement(<489054..>489638)
                     /locus_tag="CYME_CMQ198C"
                     /db_xref="GeneID:16996235"
     mRNA            complement(<489054..>489638)
                     /locus_tag="CYME_CMQ198C"
                     /product="similar to prenylated Rab receptor 2"
                     /transcript_id="XM_005538074.1"
                     /db_xref="GeneID:16996235"
     CDS             complement(489054..489638)
                     /locus_tag="CYME_CMQ198C"
                     /codon_start=1
                     /product="similar to prenylated Rab receptor 2"
                     /protein_id="XP_005538131.1"
                     /db_xref="GeneID:16996235"
                     /translation="MAIQVSPNGGAASSVSSTAVMEAPGVLGSLLRRLPTGEDFRARI
                     GDLWTRSRPWNEFFNTAAMNKPELSELRERVSQNLAYYAYNYATIFAVLVVLMVLVSP
                     LSILGALAIFALYTYLFALNPEPITALGDRVVLDSRGKSVVVLVFSLVILWLTGAGAT
                     FSTLLFVVATIAIAHAAIRKPPGEADFESGIPGA"
     gene            <490232..>491950
                     /locus_tag="CYME_CMQ199C"
                     /db_xref="GeneID:16996236"
     mRNA            <490232..>491950
                     /locus_tag="CYME_CMQ199C"
                     /product="diacyl-glycerol acyltransferase"
                     /transcript_id="XM_005538075.1"
                     /db_xref="GeneID:16996236"
     CDS             490232..491950
                     /locus_tag="CYME_CMQ199C"
                     /codon_start=1
                     /product="diacyl-glycerol acyltransferase"
                     /protein_id="XP_005538132.1"
                     /db_xref="GeneID:16996236"
                     /translation="MRACVRCQAPAHVHEQHKHYRPLMTTESPASAPENEVIQGSNGV
                     QDDAAAVEVTRPSIYPQSHRPQPRDVPLSFIDERNLLSELKTSRLEGFYNLSFLLLGF
                     ALFYMTVRSIVEKGLLVDFGGILFRCPAFLSDVWFVLRFSAALWVYSLLFFLLVWLAM
                     AQKQYSRRRWLQRLRIALAVCGYIAVQAVLYCGSTWVLWQRPTTPALGGFLTLWVITI
                     SLKGHSYFITNWYLAEEAERAWRERARRKKETPVDAHEEPPHSDVALGDATSGTTKTS
                     PTESDRQSSSDMPDSRAGTQSRPLKRDSSVSSDLSSTMSVGFSRAVRQNRLRGFPANV
                     NLGNFAYFMVAPTLVYETEYPRTERVRYRYVATMVGVILLCIATQVAIMQQFMLPVLQ
                     GQSAGYSLVYHAAKLAIPSIIVWLLGFLWFFHCALSAWAELLRFADRQFYQDWWNATT
                     LESFWNKWNMLVHEWALRHVFIELQYRSKRVSKAAAGFATFLVSAVLHEYLFAVAFKT
                     ISVGMFLGMMIQVPGIWLTRHSYFQGRRRGNLLMWLMLFLGHPLGELLYFRAYFRNHH
                     NFFCHD"
     gene            complement(<492626..>493573)
                     /locus_tag="CYME_CMQ200C"
                     /db_xref="GeneID:16996188"
     mRNA            complement(<492626..>493573)
                     /locus_tag="CYME_CMQ200C"
                     /product="NADH dehydrogenase I iron-sulfur protein 30kDa
                     subunit"
                     /transcript_id="XM_005538076.1"
                     /db_xref="GeneID:16996188"
     CDS             complement(492626..493573)
                     /locus_tag="CYME_CMQ200C"
                     /codon_start=1
                     /product="NADH dehydrogenase I iron-sulfur protein 30kDa
                     subunit"
                     /protein_id="XP_005538133.1"
                     /db_xref="GeneID:16996188"
                     /translation="MVQLWRALLTHRGMVGRFWLHTLTRSTVLPVRHGTLGFRQRSTT
                     SDELNRERSADPVYRAGPEHSEPLRLESQKRFAASIVEMLPKFISAVYIHHGHDVNSG
                     GELVLEVPPTATVPVLRFLRDHATCRFRHFIDCCGVDFPDRPDRFRVVYNLQSLVYNT
                     RIRVQTHVNELTPLESATSVFKGADWFEREVYDMFGVFFMNHPDLRRILSDYGTSYHA
                     LRKDFPLSGYEEVRYDEVEKRVVYEPLEITQEFRTFDFQTPWEHFPAAGGSEVEFFRL
                     VKGQIVPDPEAAARASSAQQQQQQQRAGTASGASQRSPG"
     gene            <495805..>496455
                     /locus_tag="CYME_CMQ478C"
                     /db_xref="GeneID:16996189"
     mRNA            <495805..>496455
                     /locus_tag="CYME_CMQ478C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538077.1"
                     /db_xref="GeneID:16996189"
     CDS             495805..496455
                     /locus_tag="CYME_CMQ478C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538134.1"
                     /db_xref="GeneID:16996189"
                     /translation="METYGACVVGLAPECLQPLPNMSGKFMGALSVPTLGTENSNATP
                     CAKPVVLAVWRAAPQPLVHVPNCCRADVFLSFDQGASWVAAASLDPGQNSCLVVIPAA
                     FLEQTWRSSKVPGHAILQVGISVEDASVVPRPAQATGLTQVGFGEHPLAATAAGTGVV
                     PPGLPQALARDLYQFLHSFDTTLPERCSPLLDRWLKRVERRFEADPCWWRRVGQNT"
     gene            complement(<500514..>501371)
                     /locus_tag="CYME_CMQ201C"
                     /db_xref="GeneID:16996614"
     mRNA            complement(<500514..>501371)
                     /locus_tag="CYME_CMQ201C"
                     /product="similar to myo-inositol monophosphatase"
                     /transcript_id="XM_005538078.1"
                     /db_xref="GeneID:16996614"
     CDS             complement(500514..501371)
                     /locus_tag="CYME_CMQ201C"
                     /codon_start=1
                     /product="similar to myo-inositol monophosphatase"
                     /protein_id="XP_005538135.1"
                     /db_xref="GeneID:16996614"
                     /translation="MLESELDQALVFAEALARECGELIRQAFFKDWPFRTAPVGGYHT
                     AYDVKKRTDPVTETDRAVEELCRRRILERYGTGHRVLGEEGFDGRPESLQVKDLDPPT
                     WAIDPIDGTANFVHHIPLCAVSIALITEGQARLGVVYNPIMEEMFVARRSRGAFLNGK
                     PIFCSGVSELPDACIATEYGSDRSASKVAMMLEMVRSILENGTQAVRSTGSAALNMAF
                     VACGRFDVVTEWGPYTWDLAAGQVLVEEAGGVCLLPNGAQFILDGRGILAANRYLAEK
                     LRFQAYAFA"
     misc_feature    complement(501640..504578)
                     /note="repetitive element"
     gene            <504723..>506213
                     /locus_tag="CYME_CMQ203C"
                     /db_xref="GeneID:16996190"
     mRNA            <504723..>506213
                     /locus_tag="CYME_CMQ203C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538079.1"
                     /db_xref="GeneID:16996190"
     CDS             504723..506213
                     /locus_tag="CYME_CMQ203C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538136.1"
                     /db_xref="GeneID:16996190"
                     /translation="MWASVLRFLPKHKGNLGRCMSVRASVLRSEHTAPFWEAPLSRAL
                     PLYQEGFLPRTASVSQAEPTRTETAPVRFQMAPSGAGDSLVFLHETSSVRGALEEMVH
                     RNTAFVLVVGDPFNRSSPKADVPASTSDIVRISSEAEGDDQRVDTEHAAVIGLFTERD
                     LLRCLADAVAEQRTGEAAALSFRLRKAMSPLYDRFGTLKVSSNTIYDAVMVMRERNIQ
                     TIPIIREEEHEEDYILPGGHPAAGESASSSYTLALPPRSFCGVLTARDVARFFLAQDA
                     SVQDAVCSLETSTDAGVRASRSTRPMLLRHLLSWRLRRLFEGARPLSDTFLEEDIVVY
                     ESEHYRVVSVPRSASVRDAIAVMAQHDVRTLLISEDASSGFDAAGPYPSIYGVITLRD
                     LMRQVFYPRRNPLALSMQTLFRERWTAAGVSRPQLAAEERKYGISPDDEVAHALRLVG
                     GMNERHIPVYVYNDADQTSNCVAMVSVKEMLSGVHAAEQRRRGQRY"
     gene            complement(<507541..>510708)
                     /locus_tag="CYME_CMQ204C"
                     /db_xref="GeneID:16996290"
     mRNA            complement(<507541..>510708)
                     /locus_tag="CYME_CMQ204C"
                     /product="Ste20/SPS1-like serine/threonine kinase"
                     /transcript_id="XM_005538080.1"
                     /db_xref="GeneID:16996290"
     CDS             complement(507541..510708)
                     /locus_tag="CYME_CMQ204C"
                     /codon_start=1
                     /product="Ste20/SPS1-like serine/threonine kinase"
                     /protein_id="XP_005538137.1"
                     /db_xref="GeneID:16996290"
                     /translation="MADKGVDVVTAASPRRYPVTPDGYEFLEELGHGENSAVYRAICP
                     AAGNEAVAIKVINLEGLPLSLDDLIKEIRVMSLSSHENVVPYRTSFSVGHNLWIVMPF
                     VAGTPVGRILRHLYPEGFPDEAVIRYILHGTLRGLEYFHRNRQIHRNIKADNILLTPD
                     ARILLTDYTYLGLMLESGISRRLRQTFVGTPCWMAPEVMEQVSGYDYKADIWSFGITA
                     IELAQGCAPYERFAPMKVLQLTLQGPPPTLEHPERFSSEFRAFVELCLHKDPHKRPSA
                     SELLKHPFMQTELPLENGWAANMLSRMPPLELNPLSEKERISLQRGHVASAGAGAKHP
                     GQEPWSQQPASSASSSTMESQASQTGRRSPEHPRNVMGISGWNFADSPELIEAKRERD
                     LQRIPESIAVPAPDRLQPVTDLAAVVSENEHIQSLGSSVVEPAPVRTSRASAETESAL
                     SQETAPAAENLVKVETGSSRRAGRFLLVDTEPSRPHTSPSTACLVHEDIITREMLTED
                     VRARASPRPGAVSADPCASDSSSTSSVRPRFYNQSVGSRNTAPPELGMRTGTSMTTDE
                     GSTTITSLGDGIYPGNAQGQSTRRLLHSVESGNARPSEAAVTAAAAAASSSAAVHEAS
                     TSHPNRSSTPHVPSGGSALGEASRRSSHGRFEVIDIPLHQAMPTSASARAALSSGAAA
                     TTAQPPGSSASTGDVSPHNPLYVSLAALDGVFQQPQSATRSPPRAPKPKSPPPPPSRW
                     ATQPSMNNNHPNQRGYGSVPGTATCNAWQPHTRITASSSTSPKDPSTDASAAGTVPGR
                     AQRATTNLPLANVSEEDLLALLHHARGLQRTLSALLAGNLQFAASAADISIGAGPASS
                     AALYPGIPHGVSSIHDSGSGTGPLHSYVSPRVEHSQASGMESGAAAASGISVGPPAGT
                     SGYSPALLPHPAMGAVPSGNGPIKPGNEPVEHLRGELSSLRQEQGTLRRDIEALRQEM
                     ALVRQQLQHLTVLAMPATTRAERVPLVSGSGSQQPTDVFGDSGDRAYPTNSTAATTNP
                     KAGIGMSVASEAPQRSHHIGDPPGA"
     gene            510926..513023
                     /locus_tag="CYME_CMQ205T"
                     /db_xref="GeneID:16996291"
     misc_RNA        510926..513023
                     /locus_tag="CYME_CMQ205T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461558.1"
                     /db_xref="GeneID:16996291"
     gene            <513979..>515877
                     /locus_tag="CYME_CMQ206C"
                     /db_xref="GeneID:16996292"
     mRNA            <513979..>515877
                     /locus_tag="CYME_CMQ206C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538081.1"
                     /db_xref="GeneID:16996292"
     CDS             513979..515877
                     /locus_tag="CYME_CMQ206C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538138.1"
                     /db_xref="GeneID:16996292"
                     /translation="MPLATHSVHFLRTTTPTAMLQDKACPGWTIHMQTNARILLRHDW
                     LREDRTLQAAWYSVLDPTKLSKPGASLAGCANGFRAPISPRWSFGTGSQKESSDQEKL
                     QPRDSDPLARLQTPQMSDGVEAAAPGDSPEESNNTEYTPTLARKGASVASLTRRRRHS
                     ELEKASTRCTSPERSVSKHQLSCAASPEREHPSCQDAIRTRNASGDEPSAPARDLGCL
                     SLLVVGCKSPSNMSRQEKQALSEARTLWEMHGGRWLDPCDLSQVFQLLETFIETTGTA
                     SAATDDETSNACPSAGEESSPISKRRRYEPKPGVREPAAGKASPEPALLIAALHHSVA
                     ACLQSKQCCPVDGLAAQQLYAIASIAWQRGWALLIDLQNTKDDKDIRNAGAAALRVWI
                     RSVLSESASRMEQSKSEASLQDGNESLWERIRNHALENTTPSKLGVFSNFAFSFISEK
                     DHVGVSAPAAKRRKHVRQHSSETTERWSAGMQPGDEHWHHDVQLLIRLAGGICVPEQS
                     DAACIRERASISVTRQKRTRTQNPASTESPMHAFKVCRALDLARMEENANFPDSSLPL
                     IDWDRLLSAVCTGTGHALTSSTTASCHVEAPKSPERQASATPKREQSKRRGTRSPSRQ
                     SQRSKRRS"
     gene            complement(517410..520625)
                     /locus_tag="CYME_CMQ207T"
                     /db_xref="GeneID:16996293"
     misc_RNA        complement(517410..520625)
                     /locus_tag="CYME_CMQ207T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461559.1"
                     /db_xref="GeneID:16996293"
     gene            <520812..>523406
                     /locus_tag="CYME_CMQ208C"
                     /db_xref="GeneID:16996294"
     mRNA            <520812..>523406
                     /locus_tag="CYME_CMQ208C"
                     /product="similar to endoplasmic reticulum translocon
                     component SEC63"
                     /transcript_id="XM_005538082.1"
                     /db_xref="GeneID:16996294"
     CDS             520812..523406
                     /locus_tag="CYME_CMQ208C"
                     /codon_start=1
                     /product="similar to endoplasmic reticulum translocon
                     component SEC63"
                     /protein_id="XP_005538139.1"
                     /db_xref="GeneID:16996294"
                     /translation="MAFGTDDTYGSTTHGKYRPKSDMRYDGAAAQVFFTCLLGLLCVS
                     VTWGRWRHLIHQRKVSAEHERALCPCRACRSRRHAKIAQKRRSERLKRLVVNGVLLGL
                     WLLFLFAVVFLYRSVSASLANETPFDPYEVLGVSRNADREQIVRAYRKRSLELHPDKN
                     LQNPNYQPEAFVRLNKAYRVLTDPVALENYQKYGNPDGYQGTRYGIALPSWLVDRGTP
                     VLLGYALVLLAGLPLGVGMWWRRRAHLLSESVSQETYALFAEFLGQPTAIKFRNLPEV
                     YGAALEFATRTPFEAECGDREAISLLCQALETGGRFDHREQRLFNRGLPHFTMNNVLL
                     HAHLARIELDRFPVDMTRMKQNVEVLLAHVDSMIPAMVDVAGATPRPEVMRRYQRVFS
                     TGGYIDRVLRIIQLEQSLCQAMLPSESELLQLPWFGLSEVKVCATSRRFGADGIRTIA
                     ELRERVWEPDVLAMLASQGPSALFPIEAPATAAKRCIRRSDLQETRGRHGAATEASTA
                     PCGLESRLDTGAERLLRCNWDGTRLRSLLRMFSDAQLDDIHLFLIRYPRKVQLQVVEP
                     YVVDQDRAGEADLVRDPRVHAGDITTLEVHILIERLGWQEMPNRTTYYPCCSRLPFDK
                     NEHWWMIVGDRKMNSIVAVRRLHARQAVQQQPGSRQAAASAGEATDARDMTCTPSPPT
                     SASSRTSTQTDASDTATSGSNNIGDRDGASPVAASGAREYAQPTDKCDLAPYIRREAL
                     SYSVQFMAPPQVGTCKLVVHALPDCYFGLNRHVQLDVDIHEHKPPEPEMHYFDPSDLS
                     EDDDDRPTGQARSLTAEHTRAVPASNGEQGVSSERTSTQQVPNDTESAEDTDSSADDA
                     FDIDGEAD"
     gene            complement(<523774..>525477)
                     /locus_tag="CYME_CMQ209C"
                     /db_xref="GeneID:16996295"
     mRNA            complement(<523774..>525477)
                     /locus_tag="CYME_CMQ209C"
                     /product="MAP kinase"
                     /transcript_id="XM_005538083.1"
                     /db_xref="GeneID:16996295"
     CDS             complement(523774..525477)
                     /locus_tag="CYME_CMQ209C"
                     /codon_start=1
                     /product="MAP kinase"
                     /protein_id="XP_005538140.1"
                     /db_xref="GeneID:16996295"
                     /translation="MSDLRNSHAQGVQDGYNVGDRRQAPQPHRPAEARSAFFDARLIG
                     NRYRFVSIIGEGAYGVVCSAIDIQTGEKVAVKRIRRVFDEIPEAVRILRELRFLRLLR
                     SHENIISIREILAPSERDSFDDVFVVFELMPADLNRVLRAPIPLSQDHIRWLMYQLLQ
                     ALHYMHSCNVLHRDIKPNNIMINELCDLRVIDFGLARLAYNQQEDMACWTDYVATRWY
                     RAPELIMSYSSKYSAAIDIWSAGCIFAELLNRGKPLFPGMNSFEQLELIVKLLGTPDE
                     ESIAKVRNQRVRQHLRSLPPRPPKPLDTVFPDAPPDALDLLRNLLQFDPNKRLTALEA
                     LQHVYFRGLYTPESIVSGSPLPPEEFFFEREQLTASQMRQLFWEEILHYHPDLRETML
                     RGHAGGYEIPSEADRFRAALTSQQRDGIPYERAYASMPKEKLATMWNQVEGMARDRPE
                     DAPAIRLKPTIVGNAVESTYHTPCVAEHTKAAGADDQRAHVAAAAVTATGPLSQIVHP
                     QLLRNASIPNMIDVDDDDASAPLQSRIPNTGNTSDTDTGDDSTVMMEAQESFGESFRE
                     L"
     gene            <527649..>528596
                     /locus_tag="CYME_CMQ210C"
                     /db_xref="GeneID:16996318"
     mRNA            <527649..>528596
                     /locus_tag="CYME_CMQ210C"
                     /product="chorismate mutase"
                     /transcript_id="XM_005538084.1"
                     /db_xref="GeneID:16996318"
     CDS             527649..528596
                     /locus_tag="CYME_CMQ210C"
                     /codon_start=1
                     /product="chorismate mutase"
                     /protein_id="XP_005538141.1"
                     /db_xref="GeneID:16996318"
                     /translation="MFLNVQVCARSVTPKPAASLALLVLQSQRGPLPADAARCRRQFP
                     TSQTRVCRLRMASPVKKLNLEDLRTKLIRQEETIIFALIERAQFKHNAVIYEKNGPLF
                     RIPGFTGSFLDYLLVETERLHAKVRRYTAPDEHAFFPNQLPQPILPPLDYEQVLHPND
                     INVNHKIMQVYVHEIVNRLTEEGDDLNYGSSCVNDVACLQALSKRIHYGKFVAEAKYQ
                     ANKEQYQPLIERRDAAAIEQLLTDRAVEEKLLRRIEMKAATYGREVEVGQLQRWRTGS
                     DRFGDEVQQFPHLLANIYEHYVIPLTKEVEVLYMLQRWP"
     gene            complement(<531114..>532766)
                     /locus_tag="CYME_CMQ211C"
                     /db_xref="GeneID:16996319"
     mRNA            complement(<531114..>532766)
                     /locus_tag="CYME_CMQ211C"
                     /product="adenylosuccinate lyase"
                     /transcript_id="XM_005538085.1"
                     /db_xref="GeneID:16996319"
     CDS             complement(531114..532766)
                     /locus_tag="CYME_CMQ211C"
                     /codon_start=1
                     /product="adenylosuccinate lyase"
                     /protein_id="XP_005538142.1"
                     /db_xref="GeneID:16996319"
                     /translation="MLTLAFAFSAAPSFTSLRKSSHRGEIVARRRKGAAFRSVALQRC
                     VHSVMSANEAQKSQFNATGPTYVSPLSTRYASAAMRETFSDVYRFRLWRKLWYVLADC
                     ERSLGLQITSEQVEALRKAAEDDFPIPLEAAAAYEAKLRHDVMAHVHALGDQVPVARP
                     IIHLGATSCYVTDNSELLQQRRGLTLLHRMLWLCIGELAQFAERYRELPTLSYTHFQP
                     AQPTTVGKRACLWIQDFLMDAHQVERMLNEIKFRGVKGTTGTQASFLALFDGEHERVR
                     QLDRLVTERMGFAASFAVTGQTYSRKQDFFVLAVLAGIGQSAAKMANDIRLLQHLKEV
                     EEPYEEHQIGSSAMAYKRNPMRSERINGLARFLQTLVLNPAETASTQWLERTLDDSAN
                     RRLAISEAFLTTDAILQLVLNISRGLVVHPRVVERNLLQELPFMATENILMAAVRAGQ
                     DRQTMHEAIRQHSVAAAARVKDQGLDNDLLERLRNDDRFACIRDQIDSLCSGSEFVGR
                     APQQVDEFLHECVYPYLDEYRSRYAEADNNHSPLSMAGVLRV"
     gene            533101..533185
                     /locus_tag="CYME_CMQ212R"
                     /db_xref="GeneID:16996429"
     tRNA            join(533101..533138,533150..533185)
                     /locus_tag="CYME_CMQ212R"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:16996429"
     gene            complement(<534620..>535999)
                     /locus_tag="CYME_CMQ213C"
                     /db_xref="GeneID:16996501"
     mRNA            complement(<534620..>535999)
                     /locus_tag="CYME_CMQ213C"
                     /product="sigma subunit for chloroplast RNA polymerase"
                     /transcript_id="XM_005538086.1"
                     /db_xref="GeneID:16996501"
     CDS             complement(534620..535999)
                     /locus_tag="CYME_CMQ213C"
                     /codon_start=1
                     /product="sigma subunit for chloroplast RNA polymerase"
                     /protein_id="XP_005538143.1"
                     /db_xref="GeneID:16996501"
                     /translation="MFLSWARVSSLKRQVAARVCPVSRVARGHAVMTPHMKVTPLGSL
                     PESLRSLSTLVSVPNVPVIKDENKVLAQEEDLEKVEVDELEEPTSAAKKPRRRTNHTT
                     TCAATAYVREICKLDRISDEEVARLSRATQDYCALLKQRDELRNTLGREPTNAEWAAA
                     VDAPEEEIQQRVERGRRARERLVAANLRLVLAIANRYKSRAVVRSAWRSKTKSGIEVP
                     AHERVRLQRQHNIFLGDLIQEGAIGLIRAAEKFDPSKGFKFSTYATWWIRQAIQRCVS
                     EHSRTIRLPNHVTESLRQIYRTRARLQHVLKRPPTDEEVAEACNMTLKRLKKITQHAW
                     ETQTLSLEGPPSTEAQSLYKAQQGEAPLSIGSVIEATEETPEEALERSCMREDVECVL
                     RTLPFQEREILRLRYGISDDERPHSAEELSARFKLPVHTIRLIESRALRKLRHPSLTA
                     MLREYVNIL"
     gene            <537861..>538853
                     /locus_tag="CYME_CMQ214C"
                     /db_xref="GeneID:16996502"
     mRNA            <537861..>538853
                     /locus_tag="CYME_CMQ214C"
                     /product="similar to aspartyl beta-hydroxylase"
                     /transcript_id="XM_005538087.1"
                     /db_xref="GeneID:16996502"
     CDS             537861..538853
                     /locus_tag="CYME_CMQ214C"
                     /codon_start=1
                     /product="similar to aspartyl beta-hydroxylase"
                     /protein_id="XP_005538144.1"
                     /db_xref="GeneID:16996502"
                     /translation="MFVALGPAKLGLDRRLGAPRVSNRLRTLRLSFAERVERSLRRKF
                     PADSVARVIQAWRQIQRGEMLREDQREAHSYIRGLRTARFFDNAEFPWAAALERNWET
                     IRDELRHWETRRQELEALGSQVWVTAARAEAVAYGPDWRTLVLQDRRWHDDNCKLFTK
                     TTRIIRDCGVPSVEAFFARQAPQSGIKLHSDGCNFILTAHLALQAPPRQSWIAVGGER
                     RFWEDGKVLIFDTSYLHETYNESQDSDRYVLLLRFWHPETTRVEREALQYIFDVVDNP
                     SWVDRDLNDLGAGLDSSLVEDWIQRPNRKARRGTGGKDRKDRTLNPPRGFGRSE"
     gene            <542811..>548855
                     /locus_tag="CYME_CMQ215C"
                     /db_xref="GeneID:16996503"
     mRNA            <542811..>548855
                     /locus_tag="CYME_CMQ215C"
                     /product="chromodomain helicase DNA binding protein CHD"
                     /transcript_id="XM_005538088.1"
                     /db_xref="GeneID:16996503"
     CDS             542811..548855
                     /locus_tag="CYME_CMQ215C"
                     /codon_start=1
                     /product="chromodomain helicase DNA binding protein CHD"
                     /protein_id="XP_005538145.1"
                     /db_xref="GeneID:16996503"
                     /translation="MGLQLEHTGRRLRGDSARQSKRSRSESSSGTDALSEASSWLRDE
                     SSGLYPEAEGVRRQPRRSARASRSMRVESSASEQSDEALYLSDSSTSSQSSTGADSEA
                     CVPRAKRRREARGSEATRSSRGEVEEVSDAHTPRTPGDQGASLDSYPMERILARRVRH
                     MTLEEAAEMNSSLSPASKVSAGAEERSPAEGSGDRGRLRTPMVEEYLIKFRGLSYIHC
                     QWVREDFILAQPSGKQRLQRFLSKEQQEAAYRGVRGVLGSASDAEDHDEEDEAIPEDF
                     VTVDRIIAEHVGPDGTRQFLVKWCSLGYDECTWEYEHEVQDDLKIKEFYERNTLPPES
                     ERKRPPRPNPASFVRLSNPSFKNGGELREYQLEGLNWLVHCWFKRQGSILADEMGLGK
                     TIQAVSFLDYLYREQHLRGPFLVVAPLSTLGHWKREFETWTHMNAIVFHGNVRARDVI
                     LQYEWTYAGMSVRSGLFKWHVLITTYEIILQEANRLRGIPWAVIVVDEAHRLKNRQSK
                     LFDELLGFRSEHRVLLTGTPLQNNSLELFSLLHFLEPAKFPNEKEFQQAYGDIRDAEA
                     VENLKALLRPYLLRRMKEDVEKAIPPKEETLISVELTRIQKQWYRALYEQNFAFLEQG
                     GKRNNVGNLRNIVMELRKCCNHPYLIRGVEEIETQSLAALGEDALMRHLVEASGKLVL
                     VDKLLPVLREKGHRVLIFSQMIRVLDILEDYLHWRGYKFERLDGRVRGNDRQQSIDRF
                     QKDPENFVFLLCTRAGGQGINLTVADTVIIFDSDWNPQNDVQAQARCHRIGQERDVKV
                     YRLITRGTYEEEMFDRASKKLGLDQAVLQNMGVDQGGSGNMLSTMGRDDINRLLRRGA
                     YDVFNEDDSAADAFTAENIENIMARRTKTIKTGGAGDVGPSAFSKATFTADADGMFGD
                     ETWLNDKEFWKKLMPLAASAPNPDIIYEPRRRRQVQRFQPGENSDEESGEHESDSDEA
                     DLSEDKLGPDGRKLWNKSERHRFHRAMLTYGYGEWERIAQAMARAQKSANQRSVFEVQ
                     RAARSWLRLLAEHTAAALVAGDAADATQQERLAQERLVKLCNEKRVLQAAFEPWIDEN
                     TQQPVDESFTEPVFTEDSYLDAMERNGYNWIERLECIEDIKDLVRNGDVDGEIPSITA
                     SGIYVMPDWWDAEFDRALILGTHRHGYGQYDDMRRDPDLHFFGRLAPLPQPEPGNGNA
                     AEDGDARLAEWTALDQSYREKAASLGLDAEQLRAREMPTLHILNTRLKKLLKAFQRLR
                     RRQDRRRSQLEQAEERARAREEQQLARRRQREAFERERSARFEVQAQRWSKREKHDFG
                     RLLGRLGGVVYDADGRIDWSVYKERCQLSRKFDYNLERMYIEMLAMARESFRRTGDDA
                     LAKALDEPIEYALQWRASQHESRLAEMQRLSRESSDAATRLAALEECLRAPQLEGFPP
                     TELEELRTLFILSRRFVERVRVLHFIRVVAAPLLQNPELCSHLIENIPPPRSDTLPSW
                     WRVAEGHDLALLRGVIRYGFDTAPLALDPSLPFLPICSDLAQRASTAERAPEDGDLST
                     AETETRSTNNENDIVAMFAKHRGVFLRARIAAEVLVYGRIERVHASASSGSVKPDALP
                     PQVPPLPMDTSSMITHAAGTLGSLRVYATASGEPISSEGGDDFEPVPLELVTVDMLQT
                     FKQLKKRASGVVDVSSLPEQVVSLGRLLQRQMIREETMSGSTGLEHRSSAPAAAAAAA
                     ASLDMVTASAGSSGKNASLVPSLATATAERCGHTGDTETNPVPVATGQRAVVPAAAAA
                     GSTGHGSASQPQVRRSQLHKVARDEHGNVRLPIQIGVVLRIESLGHIDPRESFHNERA
                     IYPVGYRSVRTYTSCVDVNRSTQYVSEILDRDGHPWFRVTCADMPEEPFEDKSPSGCW
                     SQIMRIIRERTPLDRRRVHATVSGPEYFGLTQPIVEELLQSLPGAAQLKNYNFKRFLS
                     PEKAESEESLHPLGAATDSPAAGTAQEQLRAVERAKTMADPVRIRLCLEPMETNPD"
     misc_feature    complement(548868..550297)
                     /note="possible transcribed region"
     gene            549962..551695
                     /locus_tag="CYME_CMQ217T"
                     /db_xref="GeneID:16996639"
     misc_RNA        549962..551695
                     /locus_tag="CYME_CMQ217T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461560.1"
                     /db_xref="GeneID:16996639"
     misc_feature    complement(550471..553100)
                     /note="possible transcribed region"
     gene            complement(<553964..>555310)
                     /locus_tag="CYME_CMQ219C"
                     /db_xref="GeneID:16996641"
     mRNA            complement(<553964..>555310)
                     /locus_tag="CYME_CMQ219C"
                     /product="probable tRNA/rRNA cytosine-C5-methylase NOL1"
                     /transcript_id="XM_005538089.1"
                     /db_xref="GeneID:16996641"
     CDS             complement(553964..555310)
                     /locus_tag="CYME_CMQ219C"
                     /codon_start=1
                     /product="probable tRNA/rRNA cytosine-C5-methylase NOL1"
                     /protein_id="XP_005538146.1"
                     /db_xref="GeneID:16996641"
                     /translation="MHPVYRSVAQVLTLTETSSASLRTFLYRERTRLGTEWPRVYALA
                     TETHRWSHELERILQSAIQQQPKDERRWWHDWLRRPTNHWLARVVVYERCFGRGNLLR
                     AGGFIARKLKKLLSASTTSCGGSRTNTDEPPSFQQTEDYRFFWFRPQVLGGLDPAAVE
                     RAFPGCVERDLAYPDLFWCFHGDLGAFLSHEWVQRGLLIVQDRGSCLAALALQPQRGW
                     HLIDACAAPGNKSMFLANLLQQSGMVYAFERDAERYRAMVSRVRSAGFTQSIRMHLKD
                     FRTVVSDDAHDGALAQASAILVDPSCSGSGLVRYRPVGERYNWSRIGRLAAVQIQLLR
                     HALVAFPRVRRVVYSTCSVLIEENEKVVEALLADPFIASRWRLDTVFPAWPHRGLAGC
                     SAAVRIPAQAAQTRTPLGVSGPRIGASTAEIATAPVTGFSSRSAYFIAAFERRDAQ"
     misc_feature    complement(555860..557456)
                     /note="possible transcribed region"
     gene            <557160..>558617
                     /locus_tag="CYME_CMQ221C"
                     /db_xref="GeneID:16996643"
     mRNA            <557160..>558617
                     /locus_tag="CYME_CMQ221C"
                     /product="probable polyadenylation factor I subunit 2
                     Pfs2p"
                     /transcript_id="XM_005538090.1"
                     /db_xref="GeneID:16996643"
     CDS             557160..558617
                     /locus_tag="CYME_CMQ221C"
                     /codon_start=1
                     /product="probable polyadenylation factor I subunit 2
                     Pfs2p"
                     /protein_id="XP_005538147.1"
                     /db_xref="GeneID:16996643"
                     /translation="MQNRSDVSQIPEDRRVRYVVQKQTEIFDGKRLRRAMVRKTVDLQ
                     APAARWLLDRTWQQDSRQGPPLEPSAEYIYRLQPPCAAAFRERPITNACTHFVQHAQN
                     KQKCGINACCWTPEGRRLITGATSGEFTLWNGWTFNFETILLAHNLAVRNITWSHDGK
                     FMVSTDQSGIVKYWQSNLNHLKVFRAHQETIRDLAIAPTDQKLATCSDDQTIRVFDFE
                     SPARAGEIQGSPERILRGHGWDVRSVDWHPTRGLLASGSKDSLIKLWDPKSGKCLTTI
                     HAHKNAVVKVRWNPSNANYLLSGSRDQTVKLIDIRMMRSVQSFHGHRREVTTLAWHPI
                     QEDTFVSAGYDGSLFFWVLGDPEPAAVIPNAHATQVWDLSWHPLGHVLVSSGNDTYTR
                     FWTRSRPGDGMRDRYQRSSCRWEHVKLYATEDDPLVREVEELEALQGNGGVDGFGESL
                     LDRHVMMVKRQRTTAAQRPPPGLEYVQNDVQMTKS"
     gene            <561051..>564254
                     /locus_tag="CYME_CMQ222C"
                     /db_xref="GeneID:16996644"
     mRNA            <561051..>564254
                     /locus_tag="CYME_CMQ222C"
                     /product="presequence protease"
                     /transcript_id="XM_005538091.1"
                     /db_xref="GeneID:16996644"
     CDS             561051..564254
                     /locus_tag="CYME_CMQ222C"
                     /codon_start=1
                     /product="presequence protease"
                     /protein_id="XP_005538148.1"
                     /db_xref="GeneID:16996644"
                     /translation="MQRHIAFVCAPLYRRAVQLQKKGEHPHAVFRSSRCKVGVQRQVR
                     FTVPGLRATAVMPTPTQAPVRVQVPRRELGEKAFGFTLVRSEFVPEIQSYVRVYKHDR
                     YGTELISVVNDDENKTFGVAFRTPPSDSTGVPHILEHSVLCGSRKYPVKEPFVELLKT
                     SMNTFLNAMTFPDKTCYPVASTNLRDFYNLVDVYLDAVFFPRLTPDTLAQEGHHIELD
                     AVDQPMSIKGVVYNEMKGAFSSPERVLMSASQRALFPDTTYGVESGGDPADIPQLTWE
                     AFKSFYDRCYHPSNARIWFYGDDPEDMRLQKVAEFLDAFAESSDRPPSMDPKATAISV
                     QKRFAEPRRVELPYATDESGKFYTTVNWMLHDTVVSLDADRMLSLVVLDHILLGSSAA
                     PLRKALIDSGLGEDVLGGGLESDLLQMTYSVGMKGIAQEQDTERVADLIFETLRKLSS
                     EKLDDNLVLASLNTIEFRLRENNTGSFPRGLALMLRAMTTWLHDADPVLMLRFEEPLK
                     KLRERIASGEPVFQKLIQEEFLTNTHRVQVVLRPDPDYAKRTEEAEQARLAALKQSLP
                     AAEIEKIIQETQRLRAKQAAPDAPEDLAKVPSLHVSDLDRKVKTVPRHAENRAEGVTI
                     LSHPLATNGIVYIDVGFDTTQVPSELLPLLGIYAESLFEVGTHREDFVALQRRIGRDT
                     GGLRAAVLTTQQVDERGDGAVIQRLFLRGKATANQVASLFDILTDVLHEIKFDDRERI
                     RQLVVEERAGLETRLVPSGHVMTASRLKAQYRRSDWVNEQLNGISYLRYLRALQKRVE
                     QDWDQVKADLERLHQCVISRQGVIVNVTYPQIDEVMSHVDAFLEALPARALSAAADTN
                     AAPALDGVSLRPMNEGLVIPARVNYVGKAANLFDAGFRVHGALLLAARYLSNTYLWEE
                     VRVRGGAYGGFCRLDPRTGTFLFLSYRDPNVEKTVDIYDGACDFLRRIQLSRDEIDKS
                     IIGIIGDMDAYELPDAKGFNSALRYLTGETDELRQKRRDEIFSARIEDFRRLADALAQ
                     VREHGSVVVLGASESIRRAESCLKLERVEPALPGTDV"
     misc_feature    564162..565342
                     /note="possible transcribed region"
     gene            <566131..>568251
                     /locus_tag="CYME_CMQ224C"
                     /db_xref="GeneID:16996635"
     mRNA            <566131..>568251
                     /locus_tag="CYME_CMQ224C"
                     /product="heat shock protein of Hsp90 family"
                     /transcript_id="XM_005538092.1"
                     /db_xref="GeneID:16996635"
     CDS             566131..568251
                     /locus_tag="CYME_CMQ224C"
                     /codon_start=1
                     /product="heat shock protein of Hsp90 family"
                     /protein_id="XP_005538149.1"
                     /db_xref="GeneID:16996635"
                     /translation="MAQNTGQETYEFQAEINQLMSLIVNALYSSRDVALRELISNASD
                     ALDKLRYLSLSDKSVLDADEKMEIYIKADKEAKTLEVRDTGIGMTKSDLVTNLGTIAK
                     SGTKSFIEALQAGADVSLIGQFGVGFLSAFLIADVVEVRTKHNDDAGYIWESSAGGTF
                     TIRPDPEPLKRGTAVILHLKDDQLEYLEERRIKEIVNRHSSFIQYPIFLYKEVEKEVD
                     ADEDDEKMEDVDKAKEEGDVEEIKEEEEKKDKKKKKKVKTVEWVQLNKTKAIWMRRPE
                     EVSREDYNAFYKAITNDWEDPLAIKHFSVEGQVEFTALLFCPRRAPFDLFEPRKKLNN
                     IKLYVRRVFIMDNCEDLIPEYLNFVKGVVDSEDLPLNISREMLQQNKILKVMKKNIVK
                     KCLEMFSDLAENKEDFKTFYEQFSKNIKLGIHEDTANRSKLAELLRFYSTKSPDEYTS
                     LKEYVSRMKEGQKAIYYITGESKKAVENSPFLEKLKRRGYEVLFMTEPIDEYCVQALR
                     EYDGKKLVCATKEGLQLEEDEEEKKRREEEAARFANLLKVMKDILGDRVEKVILSERL
                     ADSPCILVTSEFGWSANMERIMKAQALRDSTMSMYMSAKKIMEVNPSNPIIRELRDRV
                     EADPSDKTVKDLVNLLYDTALLASGFSLDEPNTFSSRIHRMIKLGLSIDEDEEEETPG
                     VTMENGAVESGTGDAVESAMEEVD"
     gene            <571729..>572550
                     /locus_tag="CYME_CMQ225C"
                     /db_xref="GeneID:16996636"
     mRNA            <571729..>572550
                     /locus_tag="CYME_CMQ225C"
                     /product="20S core proteasome subunit alpha 5"
                     /transcript_id="XM_005538093.1"
                     /db_xref="GeneID:16996636"
     CDS             571729..572550
                     /locus_tag="CYME_CMQ225C"
                     /codon_start=1
                     /product="20S core proteasome subunit alpha 5"
                     /protein_id="XP_005538150.1"
                     /db_xref="GeneID:16996636"
                     /translation="MFLSRSEYDRGVNTFSPEGRLFQVEYALEAIKLGSTAVGIQCAD
                     GVVLAVEKRVTSPLIEPRSIEKIVEIDTHICATMSGLTADARTLVQHARTEAQNHRFN
                     YEEPMPVESVAQAVCDLALRFGESGYGEDDGEDEDGGGGDGSGQRGRNNAPVMSRPFG
                     VALLLAGCDERGPALYTTDPSGTYTRWLAKAIGAGGESAQVVLEERYRRDLSLAEAEA
                     IALQVLRQVMEEKLGAKNIEMARVVPDGKSGRFELYSMERLKACIESMSMTDSPR"
     gene            complement(<572487..>573860)
                     /locus_tag="CYME_CMQ226C"
                     /db_xref="GeneID:16996637"
     mRNA            complement(<572487..>573860)
                     /locus_tag="CYME_CMQ226C"
                     /product="similar to sodium-dependent transporter"
                     /transcript_id="XM_005538094.1"
                     /db_xref="GeneID:16996637"
     CDS             complement(572487..573860)
                     /locus_tag="CYME_CMQ226C"
                     /codon_start=1
                     /product="similar to sodium-dependent transporter"
                     /protein_id="XP_005538151.1"
                     /db_xref="GeneID:16996637"
                     /translation="MFQVKLLCKLQSAPAWCCWRSATQADRKPVATGVSVSRSRERFL
                     DSARASQAPLTGWHARRWRFACGTRERDDASGRSLPGLTQTLYMQDKSLQQRVHSGAF
                     SSPTSYYGSLAHAKDTRLALRLLGALLALGTLAFVFPRWFLFASSARVRYPSLAIITF
                     ALGLSLGSYELGNIKRLPLTIAMATLGRLLLMPLATALLVFPLGIQLDAASVSSLLLI
                     AASPSGYATLWIAALTNTTIRELAAMMTFSSVAASALTIPLLLLIAAAVARFPSSVGV
                     ADYLVASTGAPAILWYASLYVLLVTVPLLAGCVGAIFAPPAPVDRLRRVLRPVSWISI
                     ALLTLGTMASSRTARVMSGSRGVFVASLLMSLIGLLFGLIGGRLAGHSPRVRRTFAYE
                     LAFPGLAVAAATAPAETTGLACAATLAAQILLLLGMNVYQQFRKGYLGESVIDMLSIQ
                     AFSRSIE"
     gene            <574510..>575814
                     /locus_tag="CYME_CMQ227C"
                     /db_xref="GeneID:16996259"
     mRNA            <574510..>575814
                     /locus_tag="CYME_CMQ227C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538095.1"
                     /db_xref="GeneID:16996259"
     CDS             574510..575814
                     /locus_tag="CYME_CMQ227C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538152.1"
                     /db_xref="GeneID:16996259"
                     /translation="MSAVRPKRQRSHRSTAPGSRRSSSSRVPVGTVKAVNTEVPPSAT
                     SGDGEGSACVSVDRCCNAAAEGDWTTYLSNAKRVLRATLDRGTRVLDGHARSTGDAWL
                     VLRAFVERAHFANASQRFQEVYAALERCMQDAAFLGMLLSILQADIDRDLTGTVAQSI
                     TRLAFAENGRERLEAAGFLGALWEARSRYLARCDWCVVAHLSEALAILVQCDANVQRL
                     LSSEPNPTIHIDALRAEVQDSTDASGPAFALEAIVGLVASPSFSVTGAMAKSLSKLVI
                     QVTQTALSAMRTRPPAEHGFLIDRVVVASTLAQRLARSNPQDVLSELYEQWLPLIEQT
                     MTVQELDGAMRWRLMSNAADIEWVQRLGCSEKSGDRTEKGDLPLSLHPSDRTSKQADA
                     GTSIAGKTRLNRAGASSTQRGRGQRTGRGAGRARSAGVEVAS"
     gene            complement(<575734..>577569)
                     /locus_tag="CYME_CMQ228C"
                     /db_xref="GeneID:16996260"
     mRNA            complement(<575734..>577569)
                     /locus_tag="CYME_CMQ228C"
                     /product="unknown coiled-coil protein"
                     /transcript_id="XM_005538096.1"
                     /db_xref="GeneID:16996260"
     CDS             complement(575734..577569)
                     /locus_tag="CYME_CMQ228C"
                     /codon_start=1
                     /product="unknown coiled-coil protein"
                     /protein_id="XP_005538153.1"
                     /db_xref="GeneID:16996260"
                     /translation="MAYALSKASVLRQQRHLLVMYLLLRVHVIIPLFHFVCNWWVLKH
                     VPKVQRNKFAPCNLLGCRPRIGGRLPGSASAMSQQARLRDLGVAEACLLSRVLFTQEG
                     NSCSDLVCAQYVEAVMNAFQPCNELHGLVSGATEARCTSGRLCEPPRFVGLSVTLFPT
                     RSLLEVVVRLERFREKERQRWESDRARLSTEFELLRKTVQRTIESTPPPQKAESHQAD
                     ALYRENVTLRQKLREFEDRCHQLEEQEALARDSERKLQQELLEIVQAANSREQALEKR
                     QEELRKIADENRHRFEAMQGQIQHFESITEKVQKKLDQAKQSEQEWRQQAQRHVETLN
                     TVKIQHEEQMRAEQAVTKQWQRGLKGVARTLFSFTCGWERQCAELECGVAAKCRSLEQ
                     RLSQTLLHAAACAHRFAQAQATGQKRAHSQAERLYARIHELEGHEAAMKQEIQRNERR
                     ANQLERELRRLEQSKLQLVHELAEVRSAWETATKRERELHEQCERSQKELGLKEQALK
                     EIQQALESKENTAAELCERICALEDRLLTRHEEHLRQGQRSASKTQPGREDSIRKRLL
                     QEAQEFNTKLKQAAEAQAELRSNLDARTASTPSSATRSLASSPLS"
     misc_feature    577806..580104
                     /note="possible transcribed region"
     gene            complement(<579253..>580509)
                     /locus_tag="CYME_CMQ230C"
                     /db_xref="GeneID:16996270"
     mRNA            complement(<579253..>580509)
                     /locus_tag="CYME_CMQ230C"
                     /product="diaminopimelate epimerase"
                     /transcript_id="XM_005538097.1"
                     /db_xref="GeneID:16996270"
     CDS             complement(579253..580509)
                     /locus_tag="CYME_CMQ230C"
                     /codon_start=1
                     /product="diaminopimelate epimerase"
                     /protein_id="XP_005538154.1"
                     /db_xref="GeneID:16996270"
                     /translation="MFCSSCLTNTSKYRLSERHSCTGRSTWWRQIRVPVELGSQQPGT
                     RAARCAVSSTTRRFAMQVTGVRDARDGKPTSPKAFPWLQFVKYEGLGNDFILVDQRKC
                     AWPEVDTAQAVRLCDRHRGIGADGVILLLPAISSGADFRVRIVNADGSEPEMCGNGIR
                     CVAKYAVDVCNDSAAGPNEASTFGDGALSIETGAGYIRPRVLSDGRVCVDMGPPILDP
                     QCVPTTLPGSRRIADVKAAVEVPLDGSTAEDIAAARLPLPPPECCGASEFVWRCTAVS
                     MGNPHCVIFVDQKTFAWVDANLERIGPMFETHHCFPRRTNTEFIEVCGPRDLRMSVWE
                     RGAGRTMACGTGACAAVVAATISGRIPSQGAGASGDPVSADACVVHLPGGDLEIYWSP
                     ENRHVYMTGPANFVYRGECLLESSSL"
     gene            complement(582118..583803)
                     /locus_tag="CYME_CMQ231T"
                     /db_xref="GeneID:16996271"
     misc_RNA        complement(582118..583803)
                     /locus_tag="CYME_CMQ231T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461561.1"
                     /db_xref="GeneID:16996271"
     gene            <583942..>585495
                     /locus_tag="CYME_CMQ232C"
                     /db_xref="GeneID:16996272"
     mRNA            <583942..>585495
                     /locus_tag="CYME_CMQ232C"
                     /product="similar to GTP-binding protein"
                     /transcript_id="XM_005538098.1"
                     /db_xref="GeneID:16996272"
     CDS             583942..585495
                     /locus_tag="CYME_CMQ232C"
                     /codon_start=1
                     /product="similar to GTP-binding protein"
                     /protein_id="XP_005538155.1"
                     /db_xref="GeneID:16996272"
                     /translation="MFCQSMGIRCGFLLLSLTSQVVKGAPRWLCRKKRSHVAATGVCA
                     AVFQRSGVWRSPRMLHSETSGAASDDRKSALLQKPGSASKLLEACLSADGCLETSLGP
                     ETFSEVLETLCRQNATKHARTLINALCKGQSHSTVFAADEHIMRVLPTYVDLVRRERD
                     LEALNVIREALEQGKFGHALQKVTLVEQVYLSSVQLAIEREQLEEAVATMKALRRFAR
                     RPSTPCPPPGESSDGSESLTSNFDAVAQQFESERTERFCKTMRMFSKARDFRGLFLTM
                     DAVQLCGLSLSAAVLDCLAQCAVREVSFVTGAVSMDTMPDGRFPEAAFFGRSNVGKSS
                     LVNMVIGRKALAKTSKTPGKTKQYNFYLVNEGDPTNAFYLVDLPGAGYAKVSKGQRLE
                     WERMFGSYVRERKKLRVLFHLIDSQTGPLEEDARLMSSLAGTLPVNEGRGKTQGNRAL
                     HYVVVLTKIDKQDGSVPPSVFDRLEQVLESTGLLSSREIPVLTTSAQTKAGREAVWQY
                     LRLLHKHWR"
     gene            <587108..>588622
                     /locus_tag="CYME_CMQ233C"
                     /db_xref="GeneID:16996273"
     mRNA            <587108..>588622
                     /locus_tag="CYME_CMQ233C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538099.1"
                     /db_xref="GeneID:16996273"
     CDS             587108..588622
                     /locus_tag="CYME_CMQ233C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538156.1"
                     /db_xref="GeneID:16996273"
                     /translation="MTPAHSDRPCAAFAFGYGVFVPLNFASVRGSWRGRTCTSARRWF
                     PGTAGFVRRTPLRPERSAPSHLRTDSYQPWLWACNANEDAEAPSSGSVRDDVAETQLR
                     EQVLVMAATPGVADTRKPARGLRSRRRKRRTEAGSFKTTDRVIVGGALALGFAFILSM
                     GVAVSRPRWMATLPQPVVQEAQLARPSQGPAPSSWARTASILALSTLIGMIVPLLFLL
                     SIQNRLIYKPSRRIRGKPDQYGMVHYEDVYFCTADGHEIHGWFIKCAPAKYRERPTFI
                     YFHGTDLNMSYRLPKVFHIHSKLDCNVFLWSYRGYGMSEGFPSERGLQRDAAAMIQYL
                     STRSDIDQSQLWVFGESLGGAVALDFVYRHSDKIRALILENTFTALIDMIDLVHPYLR
                     LFKWLVTQNKWLSREKIKHIEVPVLLLSGLRDGFIPPRMMQQLYDAASRSRLRRLVRF
                     EEGTHNRTWMMPGYIDAIRRFIADVDAIVPESAATERAGSVLVEGEADCPAETP"
     gene            complement(<589289..>590932)
                     /locus_tag="CYME_CMQ234C"
                     /db_xref="GeneID:16996311"
     mRNA            complement(<589289..>590932)
                     /locus_tag="CYME_CMQ234C"
                     /product="dihydrolipoamide dehydrogenase"
                     /transcript_id="XM_005538100.1"
                     /db_xref="GeneID:16996311"
     CDS             complement(589289..590932)
                     /locus_tag="CYME_CMQ234C"
                     /codon_start=1
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="XP_005538157.1"
                     /db_xref="GeneID:16996311"
                     /translation="MATCRVSVLSLTFCTSFDVRVRSDNLNTSFTGNRSEPVARSARH
                     RLFPRVASRRSRVRAVQATYDYDLVIIGAGVGGHGAALHARSRGLKTAVLTGGDAGGT
                     CVNRGCVPSKALLAAAGKVRELRTVERLQAMGISVRGQVDYDRQAVSNHANSLASRVR
                     GNLVQSLRGLGVDVLDARGALVAPQKVELLKPRERTGERVVTARDVVIATGSVPAVPP
                     GIQVDGKTVFTSDDALKLEWVPEWIAIIGSGYIGLEFSDVYTALGSEVTFIEAAPKLM
                     PSFDAEISRYAERLLISPRPVDAYTGVLATKVVPGIPGQKPVHIELVNAETKAPVEVL
                     QVDAALVATGRRPYTDGLGLEKLGVRLNKGFVPVDDHMRVLDETGAPIEHLYCIGDAN
                     GKLMLAHAASAQGISVVEHIAGNTSYRLRMECIPAACFTHPEISMVGFTEEQARAIAE
                     RERFELGKALGHFRANSKALAENHAEGIAKVLFRKDTGELLGMHIIGMHAADLIHEAA
                     NAMQTGIPVHKLAFAVHTHPTLSEICDEAFKAAAGMAAH"
     gene            complement(591983..593754)
                     /locus_tag="CYME_CMQ235T"
                     /db_xref="GeneID:16996312"
     misc_RNA        complement(591983..593754)
                     /locus_tag="CYME_CMQ235T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461562.1"
                     /db_xref="GeneID:16996312"
     gene            <593961..>598823
                     /locus_tag="CYME_CMQ236C"
                     /db_xref="GeneID:16996450"
     mRNA            <593961..>598823
                     /locus_tag="CYME_CMQ236C"
                     /product="chromosome assembly complex Condensin II,
                     subunit D3"
                     /transcript_id="XM_005538101.1"
                     /db_xref="GeneID:16996450"
     CDS             593961..598823
                     /locus_tag="CYME_CMQ236C"
                     /codon_start=1
                     /product="chromosome assembly complex Condensin II,
                     subunit D3"
                     /protein_id="XP_005538158.1"
                     /db_xref="GeneID:16996450"
                     /translation="MRTERGNAVASSEAGAIWFQLLQAIGVPCSSSDDSDWLSPWRLL
                     LQTQYERFIAHWYRQTEEPTRAEVEESLGRLCVGDSLGLDISAENGDAERIPLEFLGS
                     GHDTLSLHQIPVALVHMEKFCFALESALEGVNREPARTDVQPASQGGDSVHTGAESVV
                     TGLYASCPDVSSIIGVLYAWIRVGMQLEEQCGAALVRRKRAVQFSQEGAPEKRAASEQ
                     NFRNGDKQERDERFRNQTTCRVTSDRASSSDDSAEDSQGKDHEQASTGLSDVLFTQTR
                     LRAAVLSMLASQAYWRVLSVMPEAFVPFVFKAAVHALRQMTRAQGIGALVEEVSTKTL
                     SALAALFDSIPWIRYLLRIGIQQVSVTGPLQPQGHRGSPLADDDSNSAGLEESLSGAS
                     ELILRRLVAVGLNKPRSTKLLCSKEQVFRSAWKNMIMVTAFSSEQLVRGALRPVLNLF
                     IEGLSLKGAAPVIDPSPTATPAASSNALHSLSTALCELLQAAGREAPEEAGTSITERI
                     SAAVLVLLQHLSIRAPETAVRRSTLAQCILSFLITMESTDIYRFCSFVQKLTQHPRAA
                     VRCLALEIAANIEEEPDDDPAKSSEDAAVAWALFYRSIWARIRDRHALVRARALTATA
                     AALDHLAGANQSKARALLLRERQLLISRLRDEKAPVRKSALTLAFITLEMLAQRSEWT
                     RAADRILAAVQERCADTHLAVRLAAAQQVTRLASSAPSAFRERFINAWCDSVLQLVYD
                     PEPAVVEACLEGFLELLFSAQNSVADAPAETQSQVCPLVGNTVLTIAAGKGDPRRPFL
                     FLLWHRLSQRAPLPDTLYQWLCESAHPQGQPGAWHLLAQLTSYAETARQAVVRHILES
                     NQRILIDLDPDDPVANEVTQVVAQTAPAAGRLVPLIQSDARTLLFQLRGNPGRIPALI
                     QCLARVATNPHWSQELIQACSELLSLEPAEYACSSLEERACALTAWSEVVLSGLAAPD
                     DERLRVRAEAILADSERSSENLRAYALLALGKLCIRGDDTLARHGTSVLLRELETSAS
                     SVLRNNAVLILADMCRVFSWLADQYAVRIAAAMRDPSPLVRRQTTMVLTGLLEEEFVK
                     PKKDGLVFLFLSVTEDDDPIVSKLARQCLERVFFPRNPAERVHQLLESLFYFNDCTCH
                     PRYNQHAGMHQSRAERARFTFPQQEASRHRIYQYLISNCTDEQVLLIADRLAAELIGG
                     LLDGEMGPFPAILDEDSSVYNVVSDTLKLLASRNLAGERWHLGTLGSSMHSLEWITEA
                     ETETETTAMWLLPAATKQTVRTTGALATAPVAIQSTTGAQAGLEAPRSAQGLASAQAR
                     PTTRDALPRAGNASEETALQVFRGHLLPVLARQSLEQTILPALVELRRHFEQLKHPLV
                     GVVIEAIREQLRPHRADLWVLLRDDPVFAREIAHDLHQETAALERQRASSSARVTLST
                     QVAKAGHTPRGTPGLRPYPDSNSAARPRRRGSFGPPPLQETNQDRSPRTPAAQLMTVK
                     LVHEDILTSRLRRPRQSGSGTKTPATHSVRKCVSFTPSLVESRTEAETEVSPPRNSRG
                     TPYPLHRVTPRSAGDPASGTPLSTTLLDAVDGLSISFEVPNQSSVPYERLIRQRRCRR
                     HLDGRYPSPF"
     gene            complement(<599416..>599802)
                     /locus_tag="CYME_CMQ237C"
                     /db_xref="GeneID:16996451"
     mRNA            complement(<599416..>599802)
                     /locus_tag="CYME_CMQ237C"
                     /product="V-type ATPase V1 subunit F"
                     /transcript_id="XM_005538102.1"
                     /db_xref="GeneID:16996451"
     CDS             complement(599416..599802)
                     /locus_tag="CYME_CMQ237C"
                     /codon_start=1
                     /product="V-type ATPase V1 subunit F"
                     /protein_id="XP_005538159.1"
                     /db_xref="GeneID:16996451"
                     /translation="MTDAGDLASVKDADRLIAIIGDEDTVTGFLLTGIGDRTRPTDPT
                     YLVVRRDTSDATIAEAFEHFTRQRKDVGMVLITQNIANRIRSNIEGYTGRVPAVIEIP
                     SKDQVYDPRQDTLMQRVQRLLGIRDR"
     gene            <599989..>603423
                     /locus_tag="CYME_CMQ238C"
                     /db_xref="GeneID:16996452"
     mRNA            <599989..>603423
                     /locus_tag="CYME_CMQ238C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538103.1"
                     /db_xref="GeneID:16996452"
     CDS             599989..603423
                     /locus_tag="CYME_CMQ238C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538160.1"
                     /db_xref="GeneID:16996452"
                     /translation="MDVRRLRLRLPQQVEDALSVELFEDDVRDRQQRYVARLVKNGAW
                     QGNWIIVAGSWIFLVRPLLGEGLIKAGTGSVPAAWDSATADASWSASGCRLPRHAWVQ
                     SSRQVAASALANGTELLVALIAHCSEAPSDRAGRLQASAVLRMLIITKPVSDGRPAGS
                     PEVQRPSNSTRNGRTLLVSSRELPLAELLAADETPEQVMDIFCFDRGRRVALVLGSQQ
                     LVTIRLDPTVSVLRGRQTGGRVKAATALRRWLQQWRTWTRVPSRCMQDTHRAEDYACM
                     YGYGGYLCSKRDAATWDCWILRQSQIETWQVTDTQVTLRSVSSAVFERLSQVLQVHRS
                     DLIPLYLGTADHGTHAVLGAATFSVAESEESNQEAATAASESDQLRPDHGEYQLQLWV
                     TPVSVRHHPESIWELGGPVPLANVRVAAVEEVFLHFYWTCADGLVFVFDQCSGMLFWA
                     SAAWGLAAAQQVRGQIALSLDASFGDSSSVICGFGASSETGVLCMHADCRVDQILLPY
                     RAPTGVESAASEADVLSGRDAFPRRAIWEQVLNILALEAAGERSAALASFHNARSRWN
                     REHVSIAVRQIHEHILKRNLNCIVQGALEQQVLEMQREWMRRLCSFLLAHSALGCADD
                     AKEKLWDDLPLSERLNISQSIYSIYILYALRCMLNAKSSSAWDVLDRQIQALSAAERA
                     PGDNVQGILSVMNEFYTSERARFLASEDDVSADYVQSLLQVARYATGLILDGVCIVRT
                     ALPELQELERRACPWLHSSKSPLNLLLRGVTEELPTYLARQKRLQTASALATLYHVVQ
                     ARIELERAVDSGTVESRPGPVTMLEHLRLAGFVDEASRLARHYGIYEILMRIAQDTEE
                     VLEDPDSASAFLETCFVELGRPFAWYAFDWWHERHEFVKLFAYKSPLLREWLQERQHH
                     EWLWLQLLFDGDYANAAQDLLRIEKDCTDDVDDALFYLSIAVLCCRAANPDDRALEMQ
                     ARLRLQRARAYQRLGCSKFQDFDELVNWFRETGARAPLTALSSNALLLLQIADAEGKS
                     LDAIGLVLDAVVQRELHLWQRLTEQGHEMNDVEKELLLSQTAFYQVLRQRQELAHHPA
                     LLDYLTACQEQAAPYIAFCFERARQSSSPPRNLVSAEASANATHTLAASNAHAHSA"
     gene            complement(<603741..>604277)
                     /locus_tag="CYME_CMQ239C"
                     /db_xref="GeneID:16996453"
     mRNA            complement(<603741..>604277)
                     /locus_tag="CYME_CMQ239C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538104.1"
                     /db_xref="GeneID:16996453"
     CDS             complement(603741..604277)
                     /locus_tag="CYME_CMQ239C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538161.1"
                     /db_xref="GeneID:16996453"
                     /translation="MSSDALANEAPVNYDLLRQLSHSLPELWEFYESVICAPSNMRPS
                     EGRVPTSLDSQEHAQGTYPTRPVVERPLHAAPKPPVSLQRRQRVADRIWEHLWTKARE
                     ASPTFRAARALLARIVERLEVLMYRRAVDGSTYANMASHLVRRIRSWDVERIASVETL
                     FLYLSATFVHDMLGNTNG"
     gene            <605294..>606082
                     /locus_tag="CYME_CMQ240C"
                     /db_xref="GeneID:16996632"
     mRNA            <605294..>606082
                     /locus_tag="CYME_CMQ240C"
                     /product="similar to DnaJ homolog"
                     /transcript_id="XM_005538105.1"
                     /db_xref="GeneID:16996632"
     CDS             605294..606082
                     /locus_tag="CYME_CMQ240C"
                     /codon_start=1
                     /product="similar to DnaJ homolog"
                     /protein_id="XP_005538162.1"
                     /db_xref="GeneID:16996632"
                     /translation="MSESRSFYDILGVGRTATPDEIKKAYRRLVLSVHPDRVHAGGRA
                     GDPAALREAHENFLQLQRVYETLIDEEKRAYYDETGKCLDEGQHLVEESTLDALHRFF
                     RTCQRRITEEDIVAFEAKYRNSDMEREDVLNHYRNFCGKVEHLIDHIPYSDESDISRF
                     IQILDDALSKGELERTPAYAGSRKTLLGRAKRSTHRARKPGKSERNKFAALQEAIISK
                     REDRATQLEALCDRIAAKYAAVTGPNSTTAKRGRKERKRSTASK"
     gene            complement(<609857..>610750)
                     /locus_tag="CYME_CMQ241C"
                     /db_xref="GeneID:16996633"
     mRNA            complement(<609857..>610750)
                     /locus_tag="CYME_CMQ241C"
                     /product="probable plastid-specific ribosomal protein
                     PSRP-1 precursor"
                     /transcript_id="XM_005538106.1"
                     /db_xref="GeneID:16996633"
     CDS             complement(609857..610750)
                     /locus_tag="CYME_CMQ241C"
                     /codon_start=1
                     /product="probable plastid-specific ribosomal protein
                     PSRP-1 precursor"
                     /protein_id="XP_005538163.1"
                     /db_xref="GeneID:16996633"
                     /translation="MVFISSVLFSNRTQWFLKLRTRSCGVSGGRHGSSVQQVPALSPV
                     TRLGNSRVRVASPRCLRMSAPTTTPITVTGDNIDLTSALREHVLDKIGHVVEKFPGLV
                     TRVEVHLSVAHNPRIKNAHDCEVTAYARGRVLRASVKMENMYAAIDLTADKLKRTLRK
                     YKERLHEHSPTADLVEVALLEDRRTRASSPSAPVESMDGLASVPATSPVPVDDGAPYE
                     GSKHRREVESELEEMGIEPSREVVRKKRFPMPLQTVEEAVLCLDYIDHDFYVFRNADT
                     GEVNVVYRRRHGGVGLIEPES"
     gene            <611845..>614811
                     /locus_tag="CYME_CMQ242C"
                     /db_xref="GeneID:16996351"
     mRNA            <611845..>614811
                     /locus_tag="CYME_CMQ242C"
                     /product="WD-repeat cell cycle regulatory protein"
                     /transcript_id="XM_005538107.1"
                     /db_xref="GeneID:16996351"
     CDS             611845..614811
                     /locus_tag="CYME_CMQ242C"
                     /codon_start=1
                     /product="WD-repeat cell cycle regulatory protein"
                     /protein_id="XP_005538164.1"
                     /db_xref="GeneID:16996351"
                     /translation="MSTAWTPRRSRRSGDRFIPVRERDSALGLDSTQLRFQLQVATEL
                     SFQGRNTPSRDIAAESENNASDVGQVTESSPSRRLRDTSPMHQRRLLMAARARHVEGS
                     EALATFVPGHQIESELSLAQAAERYIENARRDWSDIFGASPSAPALLVSGSERAGQRS
                     LQLETSPDADEGTLTYQSRLGRSVNEPPVESSRESGTSPNRGLAAAERAGVRAELETL
                     LATLSVGRASDARNGAYDGSERPARTSRAEQPPARRQSRRERELADLLERMDREQRDA
                     NHSVSSSSRSSTVEQIRALLQAAAELGDAADDVAVVDLAMELFADPRALYSMETLRGS
                     VQHLAGTLMRGTLASPGGTGISSLAPGMLATDVGSRVTELQGVITWSEGGTVTRPGAA
                     NANAVLALSAHLPPHAQHATIESATRSANEAAYLTQTSGTGGAAPNTSTPGISPSTTG
                     RFVVSAPGGPSTYAIILENELLHEVNTTRTELATDMDALVAENESTSPTEPPPSGRRP
                     EPGFGLATPPRHSNPTRATRNSPVAASPGASHVSSSSATPVVARRSLLEFSRQDTSVH
                     ESSPSPRHRQYSENNGSPIRLDALRTSPVLAADPTIARQLGLGLRRKQRKISRVPFKV
                     LDAPNLADDFYLNLLDWSARNILAVGLGNSVYLWNAYNSKVSKLCELDTPPQGVCSVS
                     WAPSGDLIAVGLASGVVHLYDPTRQEAAQMLTGHTARVGCLAWNGPLLASGSRDRTIM
                     EHDVRAGREPVRTLEAHRQEVCGLRWSFDQTQLASGGNDNKLFIWTPQARRPLFRFEE
                     HEAAVKAVAWSPHQHCLLASGGGTADRCIRLWNTTTGSLLQCVDTGSQVCNLLWSRAV
                     NELVSTHGYSQNQIVLWRYPSMQKVVTLTGHLLRVLYLAASPDGSVIVTGAGDETLRF
                     WNVFPPPRSAARMSQQRAASSLSPSRLGGTRSLYAAALADLTTLPSAYAPTPSQASPM
                     HDLWNTSAMIPSSFIR"
     gene            complement(<616151..>618364)
                     /locus_tag="CYME_CMQ243C"
                     /db_xref="GeneID:16996352"
     mRNA            complement(<616151..>618364)
                     /locus_tag="CYME_CMQ243C"
                     /product="N-ethylmaleimide sensitive fusion protein"
                     /transcript_id="XM_005538108.1"
                     /db_xref="GeneID:16996352"
     CDS             complement(616151..618364)
                     /locus_tag="CYME_CMQ243C"
                     /codon_start=1
                     /product="N-ethylmaleimide sensitive fusion protein"
                     /protein_id="XP_005538165.1"
                     /db_xref="GeneID:16996352"
                     /translation="MALTLRVAACPGQEQAKTNRVFLHPQDLAQLRQATFVTLGTEWA
                     YPTAADAAVERGTVGLNAVQRRELQLALGDAVPVRTYTLTKDTHHAVSATFEIDTVVK
                     RRSLAAPELSTDELEALARKRLVPFVISVGQSVVLDYYGTLLLLVAARLDGMAAAPDG
                     GRPTPVSPLLAMLGAETSFLFVRARDANVRIRGSENRPRELFRADFNFERMGIGGLDK
                     EFSDIFRRAFASRVFPPAVIQKLGIGHVRGMLLHGPPGTGKTLIARQIGKMLNGKEPK
                     VVNGPEILNKYVGQSEENIRNLFKEAEADYLAHGDQSELHILIFDEIDAICKQRGSQR
                     DGTGVHDTVVNQLLSKIDGVNALNNILIIGMTNRKDLIDEALLRPGRLEVHIEIGLPD
                     EQGRLQILQIHTAKMRANKMLLDDVSLEELAAKTRNYSGAELEGLCRSAAAYALYRHI
                     DLNQITKPVDPDAVYVGMDDFRRALEEVRPAFGVSMDELQRCLVGGFIDYGARLERLL
                     QSGRLFRDQVRQAERSPLMTLLIEGAPGTGKTALAAKLAIESDFPFIRLIAPEQFVGF
                     SEPAKVAAIARTFEDAYRSSLSIIVLDNIERLVEYAPIGPRFSNLVVQSLLVLVKRVP
                     PANRRLFVVATTSNSEVLDVLELRSAFQASLQTSWLLPEEVASVVRGSGFAFASEKER
                     NKAIEALSGKRLGVKKTLMLLEMARETTLTGKDTGESEENLVRLDRLLQVLADVT"
     gene            complement(<622156..>623793)
                     /locus_tag="CYME_CMQ244C"
                     /db_xref="GeneID:16996353"
     mRNA            complement(<622156..>623793)
                     /locus_tag="CYME_CMQ244C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538109.1"
                     /db_xref="GeneID:16996353"
     CDS             complement(622156..623793)
                     /locus_tag="CYME_CMQ244C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538166.1"
                     /db_xref="GeneID:16996353"
                     /translation="MRNVSIRNPTFSFKKYGRSRPVHVDALHPEALEVRHCSMAAGIR
                     GLVRRIERSREFLWIRLLGGVVLTAWVILLLRALGARQGFPFGSRPTSSSGVATDVPG
                     LPPFMSDGAAPPNLSTFEGVTKLPYLRLSRAVLTGDQVLAPASVSPNSTATSHFLTVM
                     SSYYSASQNVKLLDEAQFYGAHADGTSPLRLCRRFEARTAVLTRPSHFGLRNLAHTTV
                     DYLYPLVATLLMLEKVNLVRHIEQDPTLYPLPFVVVFDLRDIGQSGFPPNGGRERLLR
                     VIRMIHSLVEDVYFIGRDVGLPYPVSDAEGWCFRDLSVGAREQPIRNWDWTYNPNSKG
                     LNGISASERAAANALRPWLLEAFRLATFKFFEKECSKEHVERAKQRPARPAVVLGRSS
                     QRRRLLNSDQLAERLDADYIPDFGELSWCDQYVAVHQRRSLIAMHGAEWSHLFSLGKP
                     RHVVNIELFPALARKPDMYAALAIMLGVSRHAMAQVLHLNGTSFDPAYPGHEACIRMM
                     ERHRPMSAECLFQANLVLHESEMDQLRTWLDNHIQRD"
     gene            complement(<624304..>625863)
                     /locus_tag="CYME_CMQ245C"
                     /db_xref="GeneID:16996253"
     mRNA            complement(<624304..>625863)
                     /locus_tag="CYME_CMQ245C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538110.1"
                     /db_xref="GeneID:16996253"
     CDS             complement(624304..625863)
                     /locus_tag="CYME_CMQ245C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538167.1"
                     /db_xref="GeneID:16996253"
                     /translation="MYRRCSPNKQRVSDLSRRFCARVRLRLLSRVVWSVLGVAVLVQI
                     AVYEWKLYGGGVRSARYALREFEKDLLSRRLPLFVNGTGTWSVSYARVRDAVLRVSGT
                     ERRVFVLCRSLDACRSSSTADEDALLLNERTLLRVRTAYRSAYISVHFVVNETEKRAF
                     EAECQRTDGGWEHRTTLYQPLTPFVMKNLAHWTFDLVYPLYVTMRLLSRNPLDWVRQR
                     VYPPRLIFDTTSLGRAGRSALRLPPDGRRLLHRLGGISTSLTPNLEFRSMGRALESTF
                     CFRDLVLGAREQNLRHSNWNLLELSRSMDAQRGKLLRAFSAFMRNDADRECSSKSVDR
                     KRVITPSHDLFGERPQRDQNRHTIWILGRGSVRRQLRNGTALVRRIPHAQYVEAFGNL
                     PWCLQYTIIRDASGIVAMHGAEWSYLLLVRKPSRLRSVELFPPCAAPLTFYASIARYL
                     GVMHHMKLQTSNRTSMEFDVRYPQQRTCLDAYRNHTSVRGTLPGRCCLDANIVLSEYD
                     QERIVRFLAED"
     gene            <626197..>626565
                     /locus_tag="CYME_CMQ246C"
                     /db_xref="GeneID:16996254"
     mRNA            <626197..>626565
                     /locus_tag="CYME_CMQ246C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538111.1"
                     /db_xref="GeneID:16996254"
     CDS             626197..626565
                     /locus_tag="CYME_CMQ246C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538168.1"
                     /db_xref="GeneID:16996254"
                     /translation="MPSEREAAAASPDTSETTLRRVIRQTRLVCGDLAEKPLVQATIV
                     HPERTLYAVDAAFSRAVSVVVRRTRETLAGASPLLPVAALGLSFWGGARVYRRLRELV
                     LPSTQQKLPTTGLHQAKRGP"
     gene            <629951..>632815
                     /locus_tag="CYME_CMQ247C"
                     /db_xref="GeneID:16996255"
     mRNA            <629951..>632815
                     /locus_tag="CYME_CMQ247C"
                     /product="plasma membrane H+-ATPase"
                     /transcript_id="XM_005538112.1"
                     /db_xref="GeneID:16996255"
     CDS             629951..632815
                     /locus_tag="CYME_CMQ247C"
                     /codon_start=1
                     /product="plasma membrane H+-ATPase"
                     /protein_id="XP_005538169.1"
                     /db_xref="GeneID:16996255"
                     /translation="MADVESGSSSSHDGKEVTSANGSAGQTGDAKPLPEGLDKRSLSM
                     SMLETVDLEKDDLDYVMACLKTSREGLKPDVAARRLAKFGPNALPEKKVNPILEFLMF
                     MWNPLSWVMEAAALVAIFLTIPGGKTPDWEDFVGILLLLLINATIGFIEERNAGNAVK
                     ALMDALAPRAKVLRGGEWIEIEAKELVIGDIVSLKLGDIVPADARIMSGKDIKIDQAA
                     LTGESLPVGKEKGDMIYSGSVVKQGEFLAVVVATGMNTFFGKAAHLVNQTESVSHLMQ
                     IVSAIGLYCMAWIGTFVLLLIVTQWPIHLENYRHGINNILVLLIGGVPIAMPVVLSVT
                     LAIGAHELAQHKAIVTRMTAVEELAGMTILCSDKTGTLTLNKLTIDQESFFTMDGYTV
                     DQAMILASRASRTENQDAIDFAVVNSLPDPKMAREGIEELDFHPFNPVDKRTEITYRD
                     NSDGKIYKATKGAPQIILGLAHNKNEIEKDVHYHIEDFAKRGFRALGIAVAEVPSGEP
                     HGDPGPWTMVGLMPIFDPPRHDTKETIAEAIRMGVEVKMITGDQLAIAKETARRLGMG
                     TNIFNCDVLNFSDQRASTELGASVGELVESADGFAGVFPEHKYRIVEVLQKRGHMVGM
                     TGDGVNDAPALKRASVGIAVAGATDAARGASDIVLTEPGLSVIIHAMVMSRQIFQRMK
                     NYSMYACSVTVRIVVTFAVLVWAFRFNMPPFMVLILAYLNDGTIMTISKDRVKPSPIP
                     QRWNLREVFIVASSLGLYLTASTVIFYVTLFKTQFWHDTFKLELPWLKTPKPDPNYFQ
                     LHSIIYLQCSIIGQALIFVTRAHWFFFMDRPGLLLMCAFVVAQLVATFICVYANWGFT
                     QIEGTGWGWAGVVWVWNVVWYAPMDLVKIGVRSIITGDKTVIHKLFAARRMFSFDASK
                     HGREDRMPKSSIEAAQARASVHRSMEAYRASLQRNVNSLD"
     gene            <634332..>634685
                     /locus_tag="CYME_CMQ248C"
                     /db_xref="GeneID:16996506"
     mRNA            <634332..>634685
                     /locus_tag="CYME_CMQ248C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538113.1"
                     /db_xref="GeneID:16996506"
     CDS             634332..634685
                     /locus_tag="CYME_CMQ248C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538170.1"
                     /db_xref="GeneID:16996506"
                     /translation="MLLWNISVKLFSVKQHDRRSRRRMQYGLIAGSGIATHDSQDILT
                     RRCATSTMGTSIMPMTASIETNLQNQMRVNLERFMRRIPLALLPLYAHSTGPEYSGPM
                     EWILRFSEYMSVHVT"
     gene            complement(<635754..>637073)
                     /locus_tag="CYME_CMQ249C"
                     /db_xref="GeneID:16996507"
     mRNA            complement(<635754..>637073)
                     /locus_tag="CYME_CMQ249C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538114.1"
                     /db_xref="GeneID:16996507"
     CDS             complement(635754..637073)
                     /locus_tag="CYME_CMQ249C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538171.1"
                     /db_xref="GeneID:16996507"
                     /translation="MSNIKSLPELFVEDPPRGPRHRPLPPLLTATEPGTWAHDTMSRR
                     IREEILARIFRENTFFSGAVLDRLKQLDRELAEPTAHRLRPLEEPPPGGGPAPDLFTW
                     NRRILERFHDCNWLSSPWCIAEFYFYRRVMEAVEYFSTKLDPFRKQKELGVSANTKTM
                     DEWASRVLPLLQTPLRRSTERKHWFTHFVQIALNGNRMDLSLWPVGGETPAVDTETGV
                     RLLVDDGERLWEYVAASMPIAEIGIIVDNAGMELFSDLLLADYLVHSGIAERVVFHTK
                     GHPTFVSDATATDLHTMVQVLGDMPRDMPLQRLASRWARYLGDGSWRCRDDLFWAQPQ
                     AFWEMDDPLWDCIRQEVLVFVKGDANYRRLLGDRAWPLSTPFSDVVSYWPSAICALRA
                     LKAELGCGIPAEAAMRAACEDPKWMVNGRWALVQFFAQRQSDARDTL"
     gene            <637929..>639644
                     /locus_tag="CYME_CMQ250C"
                     /db_xref="GeneID:16996201"
     mRNA            <637929..>639644
                     /locus_tag="CYME_CMQ250C"
                     /product="probable phosphoserine phosphatase"
                     /transcript_id="XM_005538115.1"
                     /db_xref="GeneID:16996201"
     CDS             637929..639644
                     /locus_tag="CYME_CMQ250C"
                     /codon_start=1
                     /product="probable phosphoserine phosphatase"
                     /protein_id="XP_005538172.1"
                     /db_xref="GeneID:16996201"
                     /translation="MYHDRNFSDCGYPSHNPRSMVHVNVLSNQKKWYTRRVQPPIPPC
                     PLGKSRHCVQIPKSGCTRASASSRKPASFNIETVVHGRTRGIATSARGRVSTPTALKR
                     AVDRNMFLKPLLLDRLQVPCSRRPISTTAQRGSGKRCSGVATGYDFARRKRTFASRLS
                     HTVCLQARAGNVWTRLVQLADLESGRVAPGKALFWKQLCDVVESESRDLDLRSLSRDH
                     DAEAHLTDEWTITVLGNSTQAPSNNGKEAERLDGTAAGWALHALFHLLSASFHWDVSR
                     LRLLAPSALEMNVLLWRRESSMSWDDALQQIRNQWRIQRCAHPQISMVVQREGPDRRY
                     KRLAIFDLDSTLIQNESIDELARIAGVEDAVARITEQAMRGELDFAAAFRQRVALLTG
                     LEAGAAMRAVRARLQLTPGALRLVRVLRTLGTRVVIASGGFQLLAESIREQLAADKVV
                     ANELEIDPITGAVTGRVNGPVVDGAVKLSTLEAEWRRLQIGCASPTGRLAHTMAVGDG
                     ANDLPMIRRASLGIAFQAKPLVQDAADACINTARIDTVLYLLGLSEREICELAGAQDT
                     QSACS"
     gene            complement(<640514..>641239)
                     /locus_tag="CYME_CMQ251C"
                     /db_xref="GeneID:16996202"
     mRNA            complement(<640514..>641239)
                     /locus_tag="CYME_CMQ251C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538116.1"
                     /db_xref="GeneID:16996202"
     CDS             complement(640514..641239)
                     /locus_tag="CYME_CMQ251C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538173.1"
                     /db_xref="GeneID:16996202"
                     /translation="MACGCSNSRGANVFHAFFLLLLSGLGLALVGLGIWATVKHKGLD
                     LDFQGWYHALTRTGVAAIVVGGVTFLICLLGFMLLCRTGKCSGMFFRIIYGLALVILG
                     AVLIFVGVFAVLLALGPNGPSWLRNGFHDAWLSTVRNQPSVACGIESQYNCTGFLRNT
                     NCSSTPDECPTGCSSDNNSPLGCYRAIMNDYRQWAIPVAVISLVAGVLAVFDLGLLCC
                     IGPVDDSTYYYKGRDYYSRRARV"
     gene            complement(<642526..>643470)
                     /locus_tag="CYME_CMQ252C"
                     /db_xref="GeneID:16996203"
     mRNA            complement(<642526..>643470)
                     /locus_tag="CYME_CMQ252C"
                     /product="nitrilase"
                     /transcript_id="XM_005538117.1"
                     /db_xref="GeneID:16996203"
     CDS             complement(642526..643470)
                     /locus_tag="CYME_CMQ252C"
                     /codon_start=1
                     /product="nitrilase"
                     /protein_id="XP_005538174.1"
                     /db_xref="GeneID:16996203"
                     /translation="MSTSAGNSLRIALCQVRVDPDKRVALANAQHWVERAVQEGAKLV
                     VLPECFNCPYDTSCFPKYAEPLPRPGTTAAPCDTSVSETAGVLQKLARAHGIYLVGGS
                     VPERSPDDQRIYNTSLTFGPGGELLARHRKVHLFDVDVPGGIRFRESDVLSAGDSLTS
                     FALRDGIDSEPNANAGLRVGVGICYDIRFPEMATAMAREPHNAKLLIYPGAFNMTTGP
                     AHWELLIRARALDNQVFVGACSPARDLSATYTAYGHSMIASPWGEVIARTDERESLVV
                     ADIDLNRLEQVRNAIPVRKQRRPEVYNTAQKAAENTAT"
     gene            complement(<645838..>647139)
                     /locus_tag="CYME_CMQ253C"
                     /db_xref="GeneID:16996226"
     mRNA            complement(<645838..>647139)
                     /locus_tag="CYME_CMQ253C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005538118.1"
                     /db_xref="GeneID:16996226"
     CDS             complement(645838..647139)
                     /locus_tag="CYME_CMQ253C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005538175.1"
                     /db_xref="GeneID:16996226"
                     /translation="MLEAMNEWNVSCEQSVALGEEHEQRAEAVAGNERSNSRFSGLEL
                     LFWAAALSESRSSSPNLNYVNASATPENSVCLRRLEGVVTKLEDAGAVSRPGSGAAAG
                     RRAIPTNTTGSDLVWGNPGSDGTFAAISEKQAPLFCIGLENERVAGAQLARCASMPIR
                     HSPVSDTDTPKMGAMKSAPSGTPVDSFTTTNAHLAQGSLIQPEPVAMWRCWSPGEEPR
                     VWPDTLSRVSSESKRSSPDVSSTPSNRAQVQSTPSARRVSERKEVKGPWRPEEDELLR
                     SLVEKMGPRRWSLIAEHIPGRTGKQARERWLNQLSPQICKRPWTPEEDRIIISAHARL
                     GNRWSEIARMLQGRTDNAVKNRFNSFIRRAQAERNQAAKRLHRNQGGNSTSRLEQVAS
                     AAAAAEAELEAVDASLDASGTTASQESKAPDSIGTGPISPA"
     gene            <648638..>650869
                     /locus_tag="CYME_CMQ254C"
                     /db_xref="GeneID:16996227"
     mRNA            <648638..>650869
                     /locus_tag="CYME_CMQ254C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538119.1"
                     /db_xref="GeneID:16996227"
     CDS             648638..650869
                     /locus_tag="CYME_CMQ254C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538176.1"
                     /db_xref="GeneID:16996227"
                     /translation="MRRHGSPTRASTHQSSSGLEAHAEPLRSAWTTDPEEQNDATCTA
                     DTSSINWAALLFGSEDLAQVPAITALDWLDTLHGSVPLGRLRRACLHHVIPSAFRPWA
                     WLLLLGALPPMRATWRIGLVVRRDMYNECVRFATLTGLRKLALTHGAKADSAIEIIFW
                     AYVGYLAAALETRHLTRMDEAAGAGLAAVRTPHLRPYRTDWVSRLERTRHWIQNPEQR
                     SERSAILAQIHVFDAVFRGKPELAWWCLVRFREQERRLATNRLGQTVESFDSAYRVRL
                     VLHLVDVADQEAAQSPPGTPPQTDDSEGSTIRLPKQAKRLGGFSALVMAMLKLAKPGA
                     PQHQVLPRAEDAKGASGRRDSPRFARSSEETSLTEHSGAPATVTVRALFERAAAAGSS
                     AGQGRSQSTQELEMYARHLLQSAFAERLSLEYCVLMWDRVFAAGPDLMAHLAFQLLVQ
                     LAFRHHEHGAPPERATLDKGSPHSGKLQALLQRPSAFLCAADIEAICDRASNAADYLL
                     GYDGELLDDWDPIYAFDVQWPVLERGDQGALVRILQHLLRARGYGNWFTIDGVYGIRT
                     CTAVARFQQDLAKQFRPDRELPAQRAVHALATSRLDTGRPLTVRLERLSSGTAVQAAA
                     PAAAHRPQMMGALTGRRPLGSPESATASREYERYRGDQVNDQLWPELVVPVSAGDRGD
                     AVMALQVALRDLHGYDAVRIDGFFGRRTEAAVRDFQRRGAARLMPIDGLVGPVTWLHL
                     LGS"
     gene            complement(<651274..>658260)
                     /locus_tag="CYME_CMQ255C"
                     /db_xref="GeneID:16996215"
     mRNA            complement(<651274..>658260)
                     /locus_tag="CYME_CMQ255C"
                     /product="CAD complex"
                     /transcript_id="XM_005538120.1"
                     /db_xref="GeneID:16996215"
     CDS             complement(651274..658260)
                     /locus_tag="CYME_CMQ255C"
                     /codon_start=1
                     /product="CAD complex"
                     /protein_id="XP_005538177.1"
                     /db_xref="GeneID:16996215"
                     /translation="MTTIQGDASYGAQDLELQVPGLLTDAGKRRSRLELADGSVFEGW
                     SFGAARSVAGEVVFQTGMVGYEQTLSDPSYCQQIIVFTYPLVGNYGVPSMSERDAYGL
                     PLHFEAARIHAAGLVVLNYEQEYSHWLAKQSLGEWLQEQQVPGICGIDTRLVTQKIRE
                     HGSMLGRIVLEDDRNEDQAFIDPNRLNLVAQVSCKQPYEYGAPDARYHVLAVDCGLKY
                     NQLRCLARRHCRMTVVPWDEDINADKYRSCDGLFISNGPGDPTMVLETIRNIQQWLSE
                     ERPVFGICLGHQLLALAAGAQTYKLKYGNRGHNQPCIDERTGRCYITSQNHGYAVDTN
                     SLAPGWEPYFTNANDGSNEGIIHRKKPAFSVQFHPEARAGPCDTEFLFDLFVEMMRTK
                     QPPPAPQRLAATGACPASDKSIRKVLVLGSGGLSIGQAGEFDYSGSQAIKALKQEGIY
                     SVLINPNIATVQTTGGLADKVYFLPIDPESVMRIAENERPDGIFLQFGGQTALNCGIE
                     LQKRNFFQENGIRVLGTPVETIMDTEDRELFNKRLAEIGEPFARSATAASVEQAITEA
                     ERIGYPVIVRAAFALGGLGSGFANNAQELRQLASKALSCSPQLLVERSMKGWKEIEYE
                     VVRDAYDNCITVCNMENFDPLGVHTGESIVVAPSQTLSDAEYQMLRNSAIKTVRHLGV
                     VGECNIQFALNPNSREYCIIEVNARLSRSSALASKATGYPLAFVAAKLALGRALPAIR
                     NSITQETTACFEPSLDYIVVKMPRWDLKKFERVNRQLGSSMKSVGEAMAIGRNFEETI
                     QKAIRMVRDYYVNGFERDVEPYSDEEMQTPTEARILAIASGLASGHSVEEIHEKSQID
                     RWFLMRLARITRFEQTLERLAANAMNTGSENWLTADLLCAAKQLGFSDRQIGRLVGNT
                     ELEIRKLRKEYGIVPNIKQIDTVAAEFPAKTNYLYATYAGSQGAHDVSARFGGIIVLG
                     SGAYRIGSSVEFDWCAVAAVRALRAKGTRTIMMNYNPETVSTDYDECDRLYFEELSFE
                     RVLDICEREAVDGVIVSMGGQIPNNIAMSLHRQGVHVLGTSPEMIDSAENRYKFSRML
                     DRIGVDQPRWKELTSIADAAAFCDSVGYPCLVRPSYVLSGAAMNVAYKEEDLERYLSE
                     AARVSREHPVVISKFILEAKEIDVDAVARNGELVVHFISEHVENAGVHSGDATLVLPA
                     QDLEPETVRKLEDATRKIANALNVSGPMNLQFIAKNNEIKVIECNIRASRSFPFVSKT
                     IGLDLAKMATKVMLGLTVQPYPVDISTVPHVGVKVAMFSFARLLGADPILGVEMASTG
                     EVACFGESREEAYLKGLRAAGIRLPQRNICLSIGSYKEKLEFLESAKKLAAIGYRLYA
                     TPGTADFLVEHNVPCTLVVWPSDEYQQGTLDVTRLIQDKMIDFFINLPSQNKLRRVAT
                     FMSNGYISRRTAVDFSIPLLTNIKCAKLLVRALARYGRGVSLPLQPYDVRFSARVITL
                     PGLVNMCTSRLEHEPFAAPNGDRCDPESPLMNGDQHPKRNAAADARLCALLDDFDRQL
                     LRGGYVAWVGAAVAPDFLVAESETLRTVREQLARWGRCDHAIYAYATAANAATLPSLA
                     NEVAGLFIALDNTEPMIHRRAAASAAATNAVSADQAPLRENLTPWLRHLELWPRHKPV
                     ILHTSSTQALSAMLFGAVLYARPIHIHAVRRREDIALIRSAKERGIPVTCDVRVEDLC
                     GDALQHELEQRDVDALWDALDAIDTVTGSPRLVLGLLLEAVHRGRLTMTWLLSRLVEF
                     PRSFLGLAPAGSSAHADTYVEVDIDQTERFVPADGDSNEKAYQLRGRVLRVVVRKRIA
                     YLDDKVLLEAGAGHDLLESATETATATAEDTVVGAVPAQPALPSAPDVRNARAASSVR
                     PSFRPATLPVESAVAAVTTDDSTADIDRARAAVEQRARQLDMVNFPRVSVANRSWMPS
                     TKANRSTLLEPRPLDSFSCAPVDVPLVRRSWQAASPQPGWPHYQTSLPAPVSVPAGSS
                     AQRDLLRHQSILSVSQFSRAELHALFGVAQEMRQMVNRMGMLDLLRGRVLALVFYEPS
                     TRTSCSFAAAMQRLGGTVIQMNDLQSSSVAKGESLLDTVRTMASYADAVVLRHPEAGA
                     AERAAQALPKTPLINAGDGTGEHPTQALLDVFTIREELGTVNGLVITFVGDLRNGRTV
                     HSLARLLALYQVRINYVSPRELRMPSQVLEEVATRGIEQREYTNLEDCLAETDVLYMT
                     RLQRERFADPGDYERFNAFYVITPRTLTRAKDTMIVMHPLPRVNEIAPEVDSDPRAVY
                     FRQMEYGMYVRMALLSMVLGRS"
     gene            <660731..>662416
                     /locus_tag="CYME_CMQ256C"
                     /db_xref="GeneID:16996216"
     mRNA            <660731..>662416
                     /locus_tag="CYME_CMQ256C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538121.1"
                     /db_xref="GeneID:16996216"
     CDS             660731..662416
                     /locus_tag="CYME_CMQ256C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538178.1"
                     /db_xref="GeneID:16996216"
                     /translation="MSPYCSSSNIDAAYLKKLGEKIEKQGQSARRSVFHFRPPWVSRQ
                     PGSAENVRPATKCTSSQHCRRSALIMTDGGCGLGIAYQQGIPGKVWRQQGADAALACE
                     LAAGTVGVRRRTQRRLNTYRVFRATRRKARTSFHTTGTSSDSSGGTLKPSVSATALGP
                     ILGKCALPQSARVLITGGTGCIGSYVIAELLLHTNYTLELIVRGGAQRFLSVSDERFR
                     FSFQQRRIRVHDVDLASAADLQSERMQQLVGTCDALVLCAASWGGDTAKAVNVDAVLS
                     LLHASSRQHRCRHVVYFATASVVSPQGKVLLEEALQWGTEYIQSKAIAVIRLLDTLQC
                     MDKPVPTTILFPTLVLGPTSHLGTAFRASSPAALRDSPLYRAGKHVLRFLSVDSRVRA
                     HFIHAADCAQIVRLVLQGASSTTRALSIAHDTGGNVFKPVQRNGYALPLQCFVVGQEP
                     PFSFDDAVHALCRLYGLVIPMRWLRIPADPLLWLMAHGWIPVDAWTRFCLRRRRELFL
                     FPQAVRPEDLGGTSVAPDLYTALQRCMIPSREAVGWMERDPEKRTTSQVMRFG"
     gene            complement(<662821..>664293)
                     /locus_tag="CYME_CMQ257C"
                     /db_xref="GeneID:16996217"
     mRNA            complement(<662821..>664293)
                     /locus_tag="CYME_CMQ257C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538122.1"
                     /db_xref="GeneID:16996217"
     CDS             complement(662821..664293)
                     /locus_tag="CYME_CMQ257C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538179.1"
                     /db_xref="GeneID:16996217"
                     /translation="MQWREWLRVDVQREHETLWCATWSPNGQLIATCGTDKAVRIWDA
                     RTGLLLGGLGGDTFARSVRRIDWSPCGLQLALACFDSKVRVYRLVEGVSGGNGLSLER
                     EPANAVLAAYLRLELVATLEGHESEVKAAVFNASGTLLATCARDKTVWIWECGPGAFS
                     DLDFECVAVLAGHTQDVKSLVWHPRTELIASASYDNTIRLWCEDVYDGEWYCCAVLSG
                     HESTVWSVAFAPTADAGYEHLLASAGADGRLLLWQRCEDGTRPETIRHDALVEDTVSV
                     RTPTQPHSEKGVGAGTPQPTDEGVMAEAPSSARRESGSWSLDLSSTRDALASAPIEKD
                     PEEHARFAEATQVDSSTPRNLDPPLVSSVMSGKQRWLVIKQVRVNAGDAGFADEEDES
                     VYCVDWSHDGRLLATACADGHIRVYEATELRILLDIPAAHSGAEVNYVQFQKRRDACG
                     DWSIHLGKRFQDMSTETLQRSYLLASTGDDGRLRVWVLFT"
     gene            <664292..>665371
                     /locus_tag="CYME_CMQ258C"
                     /db_xref="GeneID:16996194"
     mRNA            <664292..>665371
                     /locus_tag="CYME_CMQ258C"
                     /product="similar to mitochondrial carrier protein"
                     /transcript_id="XM_005538123.1"
                     /db_xref="GeneID:16996194"
     CDS             664292..665371
                     /locus_tag="CYME_CMQ258C"
                     /codon_start=1
                     /product="similar to mitochondrial carrier protein"
                     /protein_id="XP_005538180.1"
                     /db_xref="GeneID:16996194"
                     /translation="MEAKAGVATADAAMPALVLTRSTHSGFVLLSSCVENAKRLYFWG
                     VLCGDMVVSGHNEDAKLIDFATGGVAGFLADLVTYPFDRLRTIFIVSSRHTNNWDTFI
                     QAGGFRTLYQGFSTVALFTLPVHGVYFGLYEWTLRRFRGSEQRSGAADTLAVPVAGLV
                     AELGTAPIWNVQEVIKQRIQAQSLQRLVPGNGTFQSPWQMFRHIVQQEGPRGLFRGFS
                     AGLLVYAPFACVYFWIFEHGRERGRAPLVNGVLSGTCATIVTHPLEVLRTHMVVSKYP
                     RSAWSVALDIHRRYGIRGFLKGLGARTLWLAPSAALSLAFYQHLQEVWKGNPRPMLSR
                     AISEPKLPGCENARIRRGLSSNRNG"
     gene            complement(<667062..>667493)
                     /locus_tag="CYME_CMQ259C"
                     /db_xref="GeneID:16996195"
     mRNA            complement(<667062..>667493)
                     /locus_tag="CYME_CMQ259C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538124.1"
                     /db_xref="GeneID:16996195"
     CDS             complement(667062..667493)
                     /locus_tag="CYME_CMQ259C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538181.1"
                     /db_xref="GeneID:16996195"
                     /translation="MLAQSAFITVFAQSGTPGDVNNTESKRGKQPHQRVCVACRRSRP
                     KPAFIRVCRAADGTGIRVFAEALENEASRRVHGRSAYICRDSLECFSYVRNRKRLGGA
                     LRTKVPSEVYQACERLLKAPGRTSSPSPVRSTTKQAEDSET"
     gene            <668991..>672944
                     /locus_tag="CYME_CMQ260C"
                     /db_xref="GeneID:16996191"
     mRNA            <668991..>672944
                     /locus_tag="CYME_CMQ260C"
                     /product="unknown kinase with aarF domain"
                     /transcript_id="XM_005538125.1"
                     /db_xref="GeneID:16996191"
     CDS             668991..672944
                     /locus_tag="CYME_CMQ260C"
                     /codon_start=1
                     /product="unknown kinase with aarF domain"
                     /protein_id="XP_005538182.1"
                     /db_xref="GeneID:16996191"
                     /translation="MVDPIRRCHLQLTVSLFYVTAGARVGVLRQLRGAAWSSWRHSRT
                     HGRAEQTIHAKRPAPSTRVLRVRQKDKRSVSRSARWLIANASAEAGFCAALWVAYRQL
                     QRSRKHAQLTAARWLWKRRLRLVPAAFPTLNRPGRPESNPTLTGHEEEEEACQLDSVP
                     DNSHRPRSGDARVQHGSLFQTAKEYVTLAFLLAIVSPPSVEAIGLVPANAPDCMPMVP
                     IAFAEGGELTHRSIYPDTVLELNPPWQQQRYRRWYETDRVLLEEARRMHDRDAAEAEA
                     IQAMLEHDVWIPNESNAYSEDSNTYSGSGGQSPALVAAHIAKDENSAQPESRDVFYWR
                     RLGVGAFVGTFLWWSHIMNVRNSNRVRLPSTYDPGAIAQYFALRPEQVALRTVSIISE
                     AIWYIAGIQRDQLEYRIFGMKQHPGGESGQRAAGADAPETIATPSLANATLSPGEPGM
                     ASWTKAFRRRLVQIPETLISSLRKDETFWVWRRQRRAVLLRQTLERLGPAFVKLGQAL
                     ATRPDIVGEAAARELQRLQDDLPHFPNEEAFRFIRAELGAPPNRVFDWISDSPVASAS
                     LGQVYKARLDGVELAVKVQRPGIVERIALDIHVVRLLGQLYMRSPWAPRTNLVEAIDE
                     YASRLFEELDYDHEAKNMHRFRQLYGSLPGIYVPEVYPEYSSAHVLTMEWVNGRRLID
                     DTATVRREDIPLIKLGILCSLMQLMEAGFLHADPHTGNLLVTEDGTRLAYLDYGLMSE
                     VPQSVQLSIICAVVHLINREYEQLATDFFGLTLMRRDDLDTVLPEFADALRETFESEA
                     NATNPGDFTLQGVAEKLLRMTVRFPFVMPPYFLNNLRALAILEGLALNADPCFRIMDI
                     IYPYVVRRLLTDSSPQLQRALHELVLTPFGEPRWDRVEKLLEDAARTVPNMGLVSLDP
                     RPVAVLELAAREAAEAARSRLNGTVEGQMRATTSAYFRLSSPELVLGSGAPRSSSPGE
                     WSDEQRTPDASLECPNTAVVLDDERRMQLLVSFITSPAGGFLRRALERQLADDWNDYM
                     QSMLDAVERRLWPAVFREKDQAVAPTGQAETSGIRHTTVETTATPEASCVCEKTSAAE
                     TGPPEEVLDTTDVVVVKTKNGSASRRHRSGPRLTAATEENRRRLSQIMTHLRLRHWRA
                     ILGLVPVLALFYARVVLAVAWRVLERLGFDLGMLLMLGWRALGNLRPLALVSRDRSAQ
                     ETSPLMDGSAADTDNGLRAAAKRSHITNAAGNGAAEAQTLGSDIVPSTLNGRVAEDRQ
                     VTDTARSRSNGVANSTKYAPNGVQLQRASTRGRRRSGAVPDTSTADDNDNERKRS"
     gene            complement(<673848..>677276)
                     /locus_tag="CYME_CMQ261C"
                     /db_xref="GeneID:16996192"
     mRNA            complement(<673848..>677276)
                     /locus_tag="CYME_CMQ261C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538126.1"
                     /db_xref="GeneID:16996192"
     CDS             complement(673848..677276)
                     /locus_tag="CYME_CMQ261C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538183.1"
                     /db_xref="GeneID:16996192"
                     /translation="MASSSPAPGRTLFIRQVPVEFPFEPYPCQVRYMEHVIEALQTGQ
                     NALLESPTGTGKTLGLLCAALAWRSLLVAQVQGQASTQRISKSLADDSPKNDYGERLL
                     QGVQGAAGAVVAPEASLRGLVPAASSENGPGPTPLQSVPRIIYLTRTHSQIKQAVREL
                     SRTAYGASVRTVVLGSRQHLCVHPVVSRLENATMQNVRCTQLTKERRCSFYLNAEQKF
                     KEVGDDFFFIAVDSTSTLALPGRRPRDLEDLAAYGHQHAMCPYFLSREASAEAEIIFM
                     PYNYLFDGKCRRSLGLSVEGDIIIGDEAHNLESICCDSLSFDFTAAERQRCVSAIQQL
                     ASALSSGLLNRDGREGSNTEPALHASDLHALLEIMVALEERISLVSQADAKASHARPG
                     AENGGTVCFGQRRRIEGIDGVVLPGHAIESFLQCSSKDATLTEEAYERLLRGVEAAIR
                     ALTQLRQQFPDGTAAALDHSQAPEADAIETRDQGDPYTGLLHRQVRTTQRTSAAAWAA
                     QVHALEQLSQVLELSRLFGKPETASTFAICVHEPAKGTAGTTHQAMNPSRLKTPSAYD
                     GVGWPRQTPSQQRPPLSGTAAAEAASGKYVHQSAREHRSSTGYTLSFWCLWPGLALRR
                     ATSNAHAVLLTSGTLSPLESVASEMGASFPVRLQNSHVVDPATQVFAGILTKGPRDIQ
                     LNSSYANRHNREYISDLGSALVNIARVSPRGMLVFFPSYVLLARFVEIWQTGAFHHNN
                     PLNPAHRGRQPTQATVWDRLNAVKRIFMEPRDADASRQTVDAYRQWISSGRDACLFAV
                     CRGRTGEGIDFADDFGRTVILVGLPFPSTTDPRIILKRDYLERQALHLRDHGKTITGR
                     LWYVQQCLRAANQAMGRVIRHAQDFGAILLCDERFRAHLRDLPRWLSAASSDADPRAT
                     HNIQVFERFGTFMSNLCGFWHSERIRQLSAAQLELATSVPPVRTPVDPFQASKDEQPR
                     LQSMAQHAAMIGRQSQEYDQAGKTGTCDARRARSLSLSSQSSKRLRETNVAATAVSST
                     STAEPGLVWKAKAERRAVSAVHKDAALARGSQMISKTIMERIRARVGDRTFSLIFQQM
                     KRYYRLALIARQPQHSVELQQIQTELQRLVNDPSDFEQLRLLLGEGAPAMRSST"
     misc_feature    complement(677722..680351)
                     /note="repetitive element"
     misc_feature    complement(680751..681035)
                     /note="possible transcribed region"
     gene            <681347..>683611
                     /locus_tag="CYME_CMQ264C"
                     /db_xref="GeneID:16996211"
     mRNA            <681347..>683611
                     /locus_tag="CYME_CMQ264C"
                     /product="glycerol-3-phosphate transporter"
                     /transcript_id="XM_005538127.1"
                     /db_xref="GeneID:16996211"
     CDS             681347..683611
                     /locus_tag="CYME_CMQ264C"
                     /codon_start=1
                     /product="glycerol-3-phosphate transporter"
                     /protein_id="XP_005538184.1"
                     /db_xref="GeneID:16996211"
                     /translation="MAAVRTAGEQFALASWVAGVRALSSTSIACGEGATGGNGAQRNP
                     LQRCSASTAARMRFAGTLDATSDTCNSDKVRLGVADARHLELAFGVHVMETKTLVRSA
                     AAAGSRCPLQPLLLQTHSTRFEHRSMALNPRWMMPFTAPRSRSRSLGCAPSRRCRLVC
                     AGVDDPIGKRARQEDAFSASIPGSRLDGERQQSSSNVSSDGSALAYTGASSAVVLEGA
                     NPQLDAKYRHWRVRVFYSIFLGYAFFYFTRNSFTYTAPALRAALGLSLEQLGVIMSVF
                     PLAYGFSKLFLGIAADRFSSRVFMALGISLTGLVNIFFGLQSNVYAMTALWFLNGIFQ
                     GSGAAPCAKLLTRWYSKNERGTWWGLWNTSHNTGGFFIPLIVGYSVKRFGWRYGMIVP
                     GVLGILMGIFLLNRLRDCPEEVGLPPIEIYRDDHAEDVQRRSTAATRSTSPNGAAPGS
                     SSSPANAETPKTAGKSASAREQAATNKFLEVIGNPYVLLLAISYFFIYFCRQGISSWT
                     VIYLTSMGVPPQEAALRVGSMEIGGLCGSLVSGAVSDRLARGRRIPVILFWMLGVVAA
                     LVAMWLSPASRRYLSMLCIFTFGFFIYGPQMLVGLAASEMVSPDSVSSTIGFLGWIAY
                     IGAATSGYPLTRIVSALGWDAYFAALICCACIAILLLLPMWRIGERQAKAIARKWRAL
                     VAGAAANFQALHVQDDGQYVDCEACAGAGTRLRMECGPATPAQTVSCKLVETPCEKCF
                     GTGSIRLPAEDATR"
     misc_feature    complement(681858..684605)
                     /note="possible transcribed region"
     gene            complement(<684990..>685799)
                     /locus_tag="CYME_CMQ266C"
                     /db_xref="GeneID:16996213"
     mRNA            complement(<684990..>685799)
                     /locus_tag="CYME_CMQ266C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538128.1"
                     /db_xref="GeneID:16996213"
     CDS             complement(684990..685799)
                     /locus_tag="CYME_CMQ266C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538185.1"
                     /db_xref="GeneID:16996213"
                     /translation="MSNCSTMSGTVRELNRATYTSWSETAARQLATIPLQTGFVNACS
                     PSSQTKKPTPSCRYCFGKQQALVCEKQRKTCAFAVRSRAQATALLRGVVGPGPQPESG
                     ESQKRALAALFVGLCLMCGLPKDAVAISGGGLDYAGQQLSEQDLSHRKLSQKDFSGST
                     CRKTNFSGSDLSGARFFKADLTEANFENAQLIGASLEQTVLRGSNFQNAVLRSTYWTE
                     SVLTIANIENTDWTDALLEPTWQMKLCSRSDAKGMNTLTNTDTRESLMCPD"
     gene            <688142..>692410
                     /locus_tag="CYME_CMQ267C"
                     /db_xref="GeneID:16996214"
     mRNA            <688142..>692410
                     /locus_tag="CYME_CMQ267C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538129.1"
                     /db_xref="GeneID:16996214"
     CDS             688142..692410
                     /locus_tag="CYME_CMQ267C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538186.1"
                     /db_xref="GeneID:16996214"
                     /translation="MFIFHPNVVRAALAAKLTLGFFLTSLLVTVNDFREQLSCWAPLL
                     YTILVGPLSEFSYTGAIQRTVSGLLYGSLLGTACAAVVFFLARYYVWLRVICIFVIFI
                     PISILRLSDQHALFSIFTAVALGLVLNAALVSQALESDTSTASNIGRSLAETTSSVQS
                     LMRQFCISASVAYVVGVFIGVVVLPVPASAALRDRLERVLQELGKQASALASELFGLV
                     AQAEGAWREIQRHSKKTSGEAASTEELQDSDGMLSATTTTMATSAQSPLSGLRGNGKR
                     VEQCFSVDFTFLDEEDYAALHEEGALFLQEQVWELQSLVGFAYREWTFPEVTCDLSIT
                     AWARMILAVREIVSRLAGVECILSERRRRSGYSMGLALDQLFRQSLVDVMRMWAIISA
                     SCYQLSGMLADSHWRWYRWTAQRHLGKRSRHRAFSVLKTLLETKSLMRIRQSALASGL
                     VGYEKYWQQMMMLYQQQQQHDHCNDRNAYKLDRNGSRCTALFAEDVSAAWFSAIMMHR
                     ILDAVLEAYHAAEAFAPPPETSALPLSGRLRSGADRVRTLLFNLVSEFFALPIQIGTD
                     VLQLGLRLRVLRWNDVREMLRTHHWQVVFFWKFFLLSATTLSVVTSIPNKTALRSDWN
                     IIWLYYSVIITARPTTESAVSIGLMRVSGTIIGAALGFLVMFRPVIGTNAYAVTALSV
                     FVLYILFYLAHLNRHKWLQYASRVGVLTYTLVVMCQYQGVNYVAQWQYALSRCVMTCA
                     GVLLAVLVVAALSPRMAVRESRQTLGQVFRAAAEAARSFHAVYVTRDTSTQLPARLDP
                     AFLLEHYSNFSSLMRSPSLVTLLREHDAADETRQRRAARATTANAAADAEATSTQALN
                     SFSDRAASLLLQRITTDLMVARAAVRPAFGGNTQFTMWRSGLFSAPQYILRGIDSSWL
                     LLLRLEVIEGVLERPPIYTNRYTGAAIRLFIQPLESEWRALFDALHALSEAIHAYLSA
                     FSLWHDLGLERACRCGSCWRHDAEEVHVASTARADALSDRSLPASQQTTELDAKDVQY
                     GGERLRRAIVDARGHEEWLDAHVADALLLFRKRRARLWSSLTKRRNRVRRVALSRSLN
                     KQERQVVDFVGALFLAQEEAERMNFPGMVPEQDSDPAISKPADVASAIARLDSATGRM
                     RAVELPPGEPSPSSTTARLEAGSQLPGRQLLEMEDTGTASKIQSLAESTRRSEAHTSG
                     GYAPQQRDERQRHDSAVSPMEEIAPRYNSSATAVAAAAVAVADDDDDALDQTTGIVER
                     VPRHVPGGEHEALPLYPSTHSEMKLRISSLAGSRAAATADAGLGVAAEHPTDTSPNAI
                     EQAAQPVREKGGRRRHRRVHHRIPPDEEESIVRELSQLATYTEAHPLFASSIQKPIHT
                     SHAIGLPIDDFVHFSSYLFALRETLNVFDFAARMIARQPAMSSP"
     gene            <694467..>695861
                     /locus_tag="CYME_CMQ268C"
                     /db_xref="GeneID:16996232"
     mRNA            <694467..>695861
                     /locus_tag="CYME_CMQ268C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538130.1"
                     /db_xref="GeneID:16996232"
     CDS             694467..695861
                     /locus_tag="CYME_CMQ268C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538187.1"
                     /db_xref="GeneID:16996232"
                     /translation="MERGAFAFTSSSPMNPGGRLLSSGLGSESHATEPAVHYDDSLRL
                     SAVGLDAVYHVRTTSASAGQSENSADSRFIGPASAILRARRTGVSAWNNGSSVYEKSS
                     FTQSGWLGRTAPSEESAEPDSSSVSSLAVANTVRALVHPLYVSALSGLRWLGTFRGVQ
                     AFRSRLLSYNMLNSDEAVERAVTTCCAQAGCEPVTPTLKSTTSVDRELRALINKLFVR
                     HLSNDGRWVDYQALMLDKDFVNFVSLTRGLRDLDVLEMSRARRLAFFLNIYNALLIHA
                     ITILGRPRSFVARFRFFQTASYCIGGHLYSLNDIENGVLRGNRAPPYPFASKPFGELG
                     SGDIRAQAMITGGDPRIHFGLNCGARSCPPIRAYDESNVDQALEAATANFIRDNVKIV
                     SENHVELSRIFLWYASDFGSNVIWWILKHWPLKTEEDMQNYRRIVQWVESGQLRITYS
                     KYDWALNEVTENER"
     gene            complement(696793..698605)
                     /locus_tag="CYME_CMQ269T"
                     /db_xref="GeneID:16996233"
     misc_RNA        complement(696793..698605)
                     /locus_tag="CYME_CMQ269T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461563.1"
                     /db_xref="GeneID:16996233"
     gene            <698982..>701007
                     /locus_tag="CYME_CMQ270C"
                     /db_xref="GeneID:16996241"
     mRNA            join(<698982..699518,699784..>701007)
                     /locus_tag="CYME_CMQ270C"
                     /product="mitochondrial chaperonin hsp60, precursor"
                     /transcript_id="XM_005538131.1"
                     /db_xref="GeneID:16996241"
     CDS             join(698982..699518,699784..701007)
                     /locus_tag="CYME_CMQ270C"
                     /codon_start=1
                     /product="mitochondrial chaperonin hsp60, precursor"
                     /protein_id="XP_005538188.1"
                     /db_xref="GeneID:16996241"
                     /translation="MQSIACSGTVQSLRRLVSVGTLGCAQASSRRWLASGKDLRFGSE
                     ARNLMLRGVDLLADAVQTTLGPKGRNVVIDMSYGSPKITKDGVTVARNIEFRDKHLNL
                     GAQLVRAVASATNDAAGDGTTTATVLTRAIFTEGVKAVAAGLNPMDLKRGIDLAVEKV
                     LEKLKEYSKEIGGKNEIKQVATISANGDEKIGELIAEAMDKVGREGTITVADGKTLTD
                     ELEVVEGMRFDRGYISPYFITDAKSQKCELEDVLILTAEKKVSSLQSILPLLEQVVKA
                     RRPLLIIAEDVDSEALATLVVNKLRGGIQVCAVKAPGFGDNRKANLMDIATLTGGEMV
                     SDELDVKLEDMTIHRLGTAKKVTVSKDDTIILDGGGDKMQVQNRCEQIRAAIENATSE
                     YEKEKLQERLAKLTGGVAVIKVGGASEVEVAEKKDRITDALNATRAAVEEGIVAGGGT
                     ALLRAGKDALENLQGKTFDQNVGIDIVRKALRVPCMAIAQNAGHEGSVVVEKVLTSSD
                     KNLGFDAATGKYCDLIASGIIDPTKVVRTALERASSVAGLMTTTECMVVELPKEEAKA
                     FGGAGGGGGGMGGMDNMDMY"
     gene            complement(<701893..>702888)
                     /locus_tag="CYME_CMQ271C"
                     /db_xref="GeneID:16996242"
     mRNA            complement(<701893..>702888)
                     /locus_tag="CYME_CMQ271C"
                     /product="similar to endonuclease"
                     /transcript_id="XM_005538132.1"
                     /db_xref="GeneID:16996242"
     CDS             complement(701893..702888)
                     /locus_tag="CYME_CMQ271C"
                     /codon_start=1
                     /product="similar to endonuclease"
                     /protein_id="XP_005538189.1"
                     /db_xref="GeneID:16996242"
                     /translation="MADSSLNLTGWELEQIEKSYLVQRSWIQTTGSAPATTKSDLEQL
                     RLAGVDVAWDRVPCTAALVIPGRLGAVEHQNPAQVPPYVPAFLAYREAPLVRSLVLRH
                     RQDLDVLLVDGNGILHPRRFGLASAIGVECGVRTIGVAKTYHWFANTLQGHRAPCIPA
                     LAALVASQNSPVTGTWQGRMLYPSERDIRHVMQVEQLTVLPLCMRWRPCDAKARDALS
                     QRLGNGNPGESSLYVDEVLGAAVRTGKRAVNPIYVSIGHGIDLSRAVALVYAAAREHR
                     LPEPLRMADQLARGTLASSEASSQPPKLEISSSFWYLEGNPHAQRQRSPDESYSS"
     gene            complement(<704844..>709376)
                     /locus_tag="CYME_CMQ272C"
                     /db_xref="GeneID:16996243"
     mRNA            complement(<704844..>709376)
                     /locus_tag="CYME_CMQ272C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538133.1"
                     /db_xref="GeneID:16996243"
     CDS             complement(704844..709376)
                     /locus_tag="CYME_CMQ272C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538190.1"
                     /db_xref="GeneID:16996243"
                     /translation="MAEEYDPAVYDAEDDAPPALQAVKYRAFRAELSAVLLRFEKASD
                     WADYASQLGEVRRCLNRHAQHAFIPEKYALSKWLAHCLYGGFPAGLHLKALEVYELIF
                     QRIGARRLARDLSIYAVGLFPLMSYCSTAVRPKLLDIYRRYIVVLRAEHLLPASQPQS
                     TLVSAAPWQGTSPDASMSDVAPGWTVPNDRTRSRSDTQQPRAAASVLPGPGASPSRHA
                     AVSEDAKLLDSTLDVPTGEHPLPSLSSAAAVREASNFEGASQSLSSAEGTLVELEPKR
                     TTSWIAVDQQPTAGHATFDPARLDTSAGNWSPLRPVIAGLVQGLLPALDEVPAASSTD
                     LSDVQASDLLAQVRQNLSDDAFFAEALWRAMLCMDFNGWMVSEWMPAALASATPTDRS
                     LAMRTASPRGPRAVRARPKVRSARWIAPKREGVSTANLISFRALQQADLDQTHHAESS
                     LASRLRLVTMQYLLKLDDEARTPSTPDGVTPVSRAALFGNTGLVTAALERALMDGSAL
                     VVRQALDLMLQTIGFVPMEHQPVEKLQPVRLEHIPLLRVRETAILFTEVESKTLLAQA
                     LLVVLREDASLRKRLYAWMEDQPAEHLFQAVVEEILQDIGAWGIEQSVFTGTKAVSLA
                     TPAVTAATGACPHAPKKAASDALADGASETASLVSAAAFTQDPLWIADAALTLAQVLR
                     KLAQRQCLREHLERILVSTTWRLGRLVLLQQQQQQSSSSSTLPLTQAPEAFAPIEMDP
                     SIQRLLREPHHGCLPPGGAPRSELRPAEAPGLTAALPALAKMWSAVEHSLREALQLLG
                     PDQVWGMLHHQLHQMESQLEPPRSLRVLFECLLFVVAYAGLPSLSMLGQVLDTCRYAV
                     ILCARLQGPCCPETQLPALEWRHHFTVLARVVSAIRIALRDSDPATKLSIFTQALRLL
                     ETVEKRIWRPWLERNRLTHGDLPEGAASFCLERLRSYRFACEPWLVEDARAGCDLIAE
                     LVQLALSICAFAEGEDACSDVSAGVSAAPNGARATSSSEMTVNDTADTVVLLQTRVAS
                     ALEDAVQLAVCRTLPLMLLGLDHYLDLLDSASQQCTASVDLLASVPIEKFRDLLIPQC
                     WLFLHPSLLPYGRQAALLWYSLQEFYPTECQAYIAAALKGEWGSPVEHLAIFRQAFCL
                     ARELRLAQSLSSNCLFLALDALRSENSASRIEAERFVRSAVRLAPELVLGPLLGLLLC
                     ESYPILNDHQEFITRPDIDRIVYALETLRLVLAVLEQHARNELVAGFRGIGTDAQSVF
                     RALSAPVSTAIATALTAVHGPEEAAFTQDYLDACVFAALWYLRARWSSHWVQRMQTYA
                     EESGPFCFSMRNLQASIADAQTAAVQLLEQLVQFAGMHGDVERLQRIAPTVVALLELL
                     LGASRERSSSSGSIATSKTLSVLCARVLRQMMRFACVDASSETVHLETLSSALGTADT
                     SPAPTKATATGPNVHQRETGSSLEPPVAGTASPDDATSGASKHRKSKRHGRRFWPKYA
                     SWSRMGAFLTQTHHAA"
     misc_feature    710398..712349
                     /note="possible transcribed region"
     gene            complement(<711286..>712512)
                     /locus_tag="CYME_CMQ274C"
                     /db_xref="GeneID:16996208"
     mRNA            complement(<711286..>712512)
                     /locus_tag="CYME_CMQ274C"
                     /product="similar to oxidoreductase"
                     /transcript_id="XM_005538134.1"
                     /db_xref="GeneID:16996208"
     CDS             complement(711286..712512)
                     /locus_tag="CYME_CMQ274C"
                     /codon_start=1
                     /product="similar to oxidoreductase"
                     /protein_id="XP_005538191.1"
                     /db_xref="GeneID:16996208"
                     /translation="MTLIWTLVAIFAFCWVLWRVSVHYDLRARRASLRGRVVWVTGAS
                     SGIGRALAFRLAVFYGARVVVSARRVELLESLAAQVSEALAGKATASTDTREMDKPAV
                     VIEPVNLRASGNELDHVLQRVLQLGVSVVILNAGVNQNGCLFVDTSLDTLREVLETNL
                     WAPARILHRLLRELLSAPNEPTKASGHNCSVDVNRTRSRARKSKPSPSSSGIPEHRAR
                     LKIVDAFRDLLQTKIPASCRPSDQQASTKDIIASAPNESSALVENLDVVVVSSLAAYR
                     ALPGGALYGATKAALNYLTESLRMELRIAGDHRVRLVTVCPGFVDTPAIAHQRHWKPC
                     CLSPDAAADHIIWALLRRGDHYGFPWIMDHIVMAVAVWIPTRVYRWIMAKSWRPPASA
                     ESAVCTIHHGSAHVEH"
     gene            <714980..>716548
                     /locus_tag="CYME_CMQ275C"
                     /db_xref="GeneID:16996209"
     mRNA            <714980..>716548
                     /locus_tag="CYME_CMQ275C"
                     /product="tyrosine--tRNA ligase, mitochondrial or
                     chloroplast"
                     /transcript_id="XM_005538135.1"
                     /db_xref="GeneID:16996209"
     CDS             714980..716548
                     /locus_tag="CYME_CMQ275C"
                     /codon_start=1
                     /product="tyrosine--tRNA ligase, mitochondrial or
                     chloroplast"
                     /protein_id="XP_005538192.1"
                     /db_xref="GeneID:16996209"
                     /translation="MRAALAFRAPCRGLVVPSWEATRGRCLISPRKCPLSLSRRSVAG
                     LVRTTRRRGLYGCTTPVAQSRDGATAPTSAPVYPGVDGKPNVIQVLESRGLIDAVTST
                     DVYAVCARPVAVYVGFDPTADSLHIGNLLGLLVLRWFQKLGHRPVAIIGGATARIGDP
                     SGKSVERPLLAASVIEENAARIAENLRQVLDFSGDSSSTTEPLVLNNYDWLGNMRLLD
                     FLRDVGKLARVGTMLSKESVRLRMQSEEGLSFTEFTYQLLQGYDFAYLYKNHQVLLQA
                     GGSDQWGNIVAGLELTRKLYGGTVHGLTFPLLTSKDGKKLGKTEKGAVWLSPQRLSPY
                     EFYQYLVKVADDDVCNYLRKLTFLPLEQIDALENDMRNSERSGYQANTAQKLLAMEVT
                     RIVHGDKGVETALAATAVAAPGHVPGGEHTNGSTRLRADVLEAVSSSLPGATLPRTAL
                     VGVPLVDVMVRAGLQKSKGEARRLIANGGAYVNDEKVSDSGRTIEATDLIEGRLLLLA
                     AGKKNKMLVRVSDT"
     gene            716687..719124
                     /locus_tag="CYME_CMQ276T"
                     /db_xref="GeneID:16996210"
     misc_RNA        716687..719124
                     /locus_tag="CYME_CMQ276T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461564.1"
                     /db_xref="GeneID:16996210"
     gene            complement(<719087..>720841)
                     /locus_tag="CYME_CMQ277C"
                     /db_xref="GeneID:16996250"
     mRNA            complement(<719087..>720841)
                     /locus_tag="CYME_CMQ277C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538136.1"
                     /db_xref="GeneID:16996250"
     CDS             complement(719087..720841)
                     /locus_tag="CYME_CMQ277C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538193.1"
                     /db_xref="GeneID:16996250"
                     /translation="MDEILSTASALDGMLHEDVSATGLLTIRQVAGTLDLNEQQAAQA
                     LEAYARELPSERLVFATVEPQADADNPSRRCFRFRVHCGYNGPGDRLYGVLRPGVVIT
                     EAELPAVVAGAGVNALTEASGRKSKSNALLLGQTLKADEPHRNAAPSGVSAANEKGSA
                     SNSSQTALYRFLTEEQEVVRAPAVRSPDGVCVGSSLNGNGSSEGMVAEPETKRLRPGA
                     STGAFPADLKGASTASGASALDVASVASRTVVKGTKADATTQDLFIENQRATPMERTA
                     TIVATTSQRIASGKAKHPGTCRHDVPGHTEPMSEECAPTSPDRMSLEQGRDSASGMQD
                     QRRYSTTETLPLMPASPRRSRRRLVTSDDEDEQHPVRPDARESRPCEEACLSGQNAER
                     STWNRQAPEACFPALDTPANASVTDPKLLASEFASVQTCEAPGANDLLSETERSALVP
                     SRGTCRHPEQGTVHSNEKHSRASVAAGKILEETITPDGEILVRLADASRQGHAAAPEQ
                     APANDTKEKRAWIAPASTERLPAPRIPRTKTSTLHQTPSGTPAREPAPREATSVNSRI
                     SAEPQGIRKFFTPRPRAS"
     gene            <720952..>722454
                     /locus_tag="CYME_CMQ278C"
                     /db_xref="GeneID:16996251"
     mRNA            <720952..>722454
                     /locus_tag="CYME_CMQ278C"
                     /product="7,8-dihydropteroate synthase /
                     2-amino-4-hydroxy-6-hydroxymethyldihydropteridine"
                     /transcript_id="XM_005538137.1"
                     /db_xref="GeneID:16996251"
     CDS             720952..722454
                     /locus_tag="CYME_CMQ278C"
                     /codon_start=1
                     /product="7,8-dihydropteroate synthase /
                     2-amino-4-hydroxy-6-hydroxymethyldihydropteridine"
                     /protein_id="XP_005538194.1"
                     /db_xref="GeneID:16996251"
                     /translation="MPLEPVGHFRYFIAFGSNEGARLRTITSALRSLCAIGEIDATSN
                     LYETEPLYEASQPVFLNGVVALQTDREPFELLSELQRIEKDHGRERSTDTEKRFGPRT
                     LDLDVLLAERWQPNGFRGLPPVTSSRLTIPHPRIKERSFVLRPLKDLGISVRDARPLP
                     GRVQQVLVTANEMVLPVRRCAAGMPHVMGILNVTPDSFSDGHPDNLSMEKALRTAERL
                     VRHGARLLDVGGQSTRPGAVRISPAEEAARILPVLKALRARFPAQKGIWISVDTFYAS
                     VAKLAIEHGADCINDVSSGRLDPGMLPFLAEAHVPAIFMHMRGNPQTMMDHANYPEGE
                     VVDVVASELAERLDAAQRAGIYRFNLIADPGLGFAKHSNHNIALLRGLERFRELLSRG
                     RGEWPMLLGVSRKRFLEQFAARSATLPDAAATTSGKEAQKDNSVPLDAAARDFATAGA
                     VTWAALHDVDIVRVHEPAVCDAARCFLYLQRDAASRSAAASTENETCAPY"
     gene            complement(<723198..>724841)
                     /locus_tag="CYME_CMQ279C"
                     /db_xref="GeneID:16996252"
     mRNA            complement(<723198..>724841)
                     /locus_tag="CYME_CMQ279C"
                     /product="probable cytosolic purine 5' nucleotidase"
                     /transcript_id="XM_005538138.1"
                     /db_xref="GeneID:16996252"
     CDS             complement(723198..724841)
                     /locus_tag="CYME_CMQ279C"
                     /codon_start=1
                     /product="probable cytosolic purine 5' nucleotidase"
                     /protein_id="XP_005538195.1"
                     /db_xref="GeneID:16996252"
                     /translation="MSASGEPSDETSRATLPGGGATRSPMSPKSVLNHLAGGERASDL
                     VRVITADDIRSWKAQGAVRKFRRAAAQRVYSNRDVNLDHITHIGFDMDYTLAAYLRPA
                     FDQLQYNLICRELVEQFCYPECILEWRFDEGFLIRGLLVDALRGNFVKCDAYGVILRA
                     VHGRRRLTAEQVDAAYPAGNIASAQVGEEFQSMDTLYHLPIANLYADLVEYFDQSAEE
                     SAEGARFGDGDHGRLSFFNLWQDVRAAADRIHDHGILKNETLARLADYLPNDDAIHRM
                     LRLLRHAGKQLFLLTNSEYWYTDAVLRFILGRFANGAEPNAGWREAFDFCIVGAQKPL
                     FFRSGTALREIDTKSGRSMLYEVRTDQLSARPLRGRVFKGGSISAFHELAGISRGSTV
                     LYVGDHIYADVLVARKTHHWRTLLVVPELSAEIGALARARGLLDRLGALEFLRAEMFR
                     GLDASARQRPDEEGILQAELQKVRESIEDAFNPHFGGLFRSAHRTTLFAHQVSFFADL
                     YTERCSNLADYPGFYYFSSAVSPRMPHEDQPYFEHEAQC"
     gene            725036..726562
                     /locus_tag="CYME_CMQ280T"
                     /db_xref="GeneID:16996247"
     misc_RNA        725036..726562
                     /locus_tag="CYME_CMQ280T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461565.1"
                     /db_xref="GeneID:16996247"
     gene            complement(<727264..>728382)
                     /locus_tag="CYME_CMQ281C"
                     /db_xref="GeneID:16996248"
     mRNA            complement(<727264..>728382)
                     /locus_tag="CYME_CMQ281C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538139.1"
                     /db_xref="GeneID:16996248"
     CDS             complement(727264..728382)
                     /locus_tag="CYME_CMQ281C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538196.1"
                     /db_xref="GeneID:16996248"
                     /translation="MMRVSSGGKTVFLAVVLCTLLVSTRCLLVLGSKSVRGDEKASDD
                     SSESTALEVLSVFDKFVRRHLISKVHPLTDPPDAPEDIEYAYAFVGGAEHNSTAKAGH
                     EAETAVKLAAGDSKYVLVTVAHQDAEDARNSADNVTEHEPYLVVGAIGALHAIQNPSA
                     HLQNMSFLLVNRTLTRGQELSFVYPLAVHAAFPPGPCILRLTVFLERQWKNRELLIEL
                     GFRPEQLASLVSTQPEGSIAAFLDRNSMLGYSIKVLDGVVEITPAESGREYRLLFTIL
                     AVVASTVVMLVAILISVDTPLNRKVIQVLKQQMQKMRRSRLPPRNDARSRSGETAAAA
                     EHSNEWLIEHHQMMRSIVGTGSKGAVRTAKTTDTGSKR"
     gene            <728950..>729381
                     /locus_tag="CYME_CMQ282C"
                     /db_xref="GeneID:16996249"
     mRNA            <728950..>729381
                     /locus_tag="CYME_CMQ282C"
                     /product="similar to nuclear cap-binding protein; CBP20"
                     /transcript_id="XM_005538140.1"
                     /db_xref="GeneID:16996249"
     CDS             728950..729381
                     /locus_tag="CYME_CMQ282C"
                     /codon_start=1
                     /product="similar to nuclear cap-binding protein; CBP20"
                     /protein_id="XP_005538197.1"
                     /db_xref="GeneID:16996249"
                     /translation="MADLVRERLAPVSTYRDRQYVGTYEQREEQLLKTQTVYVGNLSV
                     YTTEEQIYQVFGMAGEVKRVVMGLDRFKLTPCGFCFVEFMSREGAEYAVELLNRSTLD
                     DQIIKVDFDVGFQEGRQWGRGISGGQRAQDRQEKRVARKYR"
     gene            <731384..>734680
                     /locus_tag="CYME_CMQ283C"
                     /db_xref="GeneID:16996244"
     mRNA            <731384..>734680
                     /locus_tag="CYME_CMQ283C"
                     /product="26S proteasome regulatory subunit RPN2"
                     /transcript_id="XM_005538141.1"
                     /db_xref="GeneID:16996244"
     CDS             731384..734680
                     /locus_tag="CYME_CMQ283C"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN2"
                     /protein_id="XP_005538198.1"
                     /db_xref="GeneID:16996244"
                     /translation="MQTLRATPLLSQLGESDAELQQHAIKELLQIVDDCWPEIASLLP
                     RIEELYEDQGWDEASRQHSALLAAKVLFHLGEIDEALMYAMMAGDLFVGDDSSEFSRV
                     LRARCLDKYVARRQLDGESENASTTTTTTTTTEAYAEDLAPNVLEAVVNQSIWACVDA
                     GEYNEALGIALEALRLDAVSAVLGTAAAAAAAAAATQSAVSSLLEYAIVCCQELISKR
                     WRREKILRHLVEWQNSQPEDQRDEMILCRCLMLLRDASGVTQILQRQLRERKESLAYQ
                     IAFDLWDHDDRALVAQVRNDIVAAIESRDAVAAADLSRTNEHAILLSILNGRMPSELY
                     LDFMRRRNCFDKRLLKSLLHRLVAPPSLAQSAILFAYGLGFAGTADDTFLRENVEWLM
                     RTANWTKFSATATLGVAHIRNADQAFALLAPYLSSSHQGSMGSSAYSEGGALYALGLI
                     AASGVEAHKVAEFRRYLLEALRNAGTNEVIQHGACLALGLCALADGERETNNVSPSES
                     ESFQELRNVLYMDSALAGEAAALGMGMALVGTGDAGAIEQMLEYARETQHQKIIRGLA
                     IGLALVVYGCEEEAEPLIHQMLASEDGTIRYGAVFAIGLAYCGSGNNAATKRLLHAAV
                     SDVNDDVRRAAVLNLGFIFARDRDQLPQVVSLLAESYNPHVRYGAAMALAIGCACSGN
                     QDAAKILQKLSNDTVDFVRQGALIALAMLYQHHNQTRSAASAALRKRLDTIAKDKHEE
                     ILTKFGAVLAMGISDSGGRNAEIALLSRLTQSLRPTAVAGMALFMQYWYWYPMVPFLT
                     LSLRPAACVFVNQGMQLMRLKLQVEGDDERLAQFTYAPMFEEDDNKIERKREKMVLSV
                     TAKADRLKRIHPTSQQRNDQESEHGTRKPAKSNAAAPTRAPEQMDVIANDVVEEPKMV
                     TEQTAGDASRDHHPEAKAHTPKATNALALAAVSLLENPARVLTAHEGWVSLDGDDALR
                     WRPLRRGAGIVLVEREPVRDSAYPDAPDGVVERLPPLAPPVALANGARGRDVSGGSGA
                     DAGVSGIPEHPVYDDEDREPATPEPFEYTSNTASAEQGSNQKHPPSPPKSPSTHKKND
                     DDDKDDAAAV"
     gene            complement(<735853..>737529)
                     /locus_tag="CYME_CMQ284C"
                     /db_xref="GeneID:16996245"
     mRNA            complement(<735853..>737529)
                     /locus_tag="CYME_CMQ284C"
                     /product="probable calcium/proton antiporter"
                     /transcript_id="XM_005538142.1"
                     /db_xref="GeneID:16996245"
     CDS             complement(735853..737529)
                     /locus_tag="CYME_CMQ284C"
                     /codon_start=1
                     /product="probable calcium/proton antiporter"
                     /protein_id="XP_005538199.1"
                     /db_xref="GeneID:16996245"
                     /translation="MDEATHDEWSPLVAASSGGSGFGRHASGHLELLPEHWTIRREPH
                     QRLAPKTTSLPQRFFPYSWMRYRVNVLLLLVPPGLAGSRLNLSPSFIFWSNFFGIFPL
                     GILLGRFTEHISWYSTAALGALLNATFGNAVEFIFAVSALRHRLTDVLKATMLGSIIG
                     NELFVTGFCFLVGGLHFREQTFAPTFSDTNMSILHITTIGILFPSVFRQAVDAHRRQA
                     VANETASNATSIVNNASSRDVYVSRCTSVLLLALYVAYLVFELVTHAEAVEAPGSRSS
                     PLSASASALGFLGAEQALERRDAGAGDGVDAQRLECSAGTQCDESDMISVSAGVLHEM
                     ERGQSMDTSSFPDDAYANTRYGDADVRRMRSLQNNNAADAQVGAGNPAGQAARSTRPQ
                     PCTAEQATLTEVPDLSLWANIVLLLLCTLLISFCTDALVGSLEQAAAALSLPPPFVSF
                     ILLPLVGNIAEHLGAVSMAMQNKMDLAVRIAVGSAVQVGLLVFPALVLVAWLLGIPLT
                     LEIPLFGGFALIASTVVLANAMRDSTSNWLEGIELLAVYFIICVCYYFTS"
     gene            <737809..>738660
                     /locus_tag="CYME_CMQ285C"
                     /db_xref="GeneID:16996246"
     mRNA            <737809..>738660
                     /locus_tag="CYME_CMQ285C"
                     /product="probable eukaryotic translation initiation
                     factor eIF-3 subunit J"
                     /transcript_id="XM_005538143.1"
                     /db_xref="GeneID:16996246"
     CDS             737809..738660
                     /locus_tag="CYME_CMQ285C"
                     /codon_start=1
                     /product="probable eukaryotic translation initiation
                     factor eIF-3 subunit J"
                     /protein_id="XP_005538200.1"
                     /db_xref="GeneID:16996246"
                     /translation="MQQSSSVPVADSWEDDEVEFDLQAGAAIDSRTRQQQQQEQLEQA
                     RKAAAAKRSDPDFDPTLVAKLAERKHKEQEQLERQRILQAELDALPETARKLRLQKLT
                     EEADLQYASEWLGGCTSSASATASATPVDSFSLDSTQPRTKADFERFAQALVDRLCTL
                     RRGAKTPRSYILFLKDVLHGLFVTSDVLSLAEVCELADYVHETLKSERELRERSGVAS
                     GAGGGAGSAAAGASTASHTAHSRGARKASIRVERGDDFEAFAVRGSRHGASAIAERLP
                     DDEEDFM"
     gene            complement(<739264..>742902)
                     /locus_tag="CYME_CMQ286C"
                     /db_xref="GeneID:16996228"
     mRNA            complement(<739264..>742902)
                     /locus_tag="CYME_CMQ286C"
                     /product="DNA primase, bacterial-type"
                     /transcript_id="XM_005538144.1"
                     /db_xref="GeneID:16996228"
     CDS             complement(739264..742902)
                     /locus_tag="CYME_CMQ286C"
                     /codon_start=1
                     /product="DNA primase, bacterial-type"
                     /protein_id="XP_005538201.1"
                     /db_xref="GeneID:16996228"
                     /translation="MSDGATLGKRRSYPRNGVPLQAPAFAPQSVCERLIATTKAQHGL
                     SVSARLRRGGRGGFRRALVACSRIDRESVQQAKKRVSLFDLVQPHVRSSRPSGPNRYM
                     CLCPFHDERTASMLVDDERGYFHCFGCGASGDAIRFLMNIHKTDFHAAAKTLLSYVKD
                     NKEIVSTSPLQASETRHAKDAVQHVPFVNAGVDAIAPKELSMQSAVQQKVLHMNSLAL
                     KFFRRQLKDLQSRPEHLSPEARRLFRYLCERRGFSPRTIDTFRIGYAPAGWRELVDYM
                     LYEQTELAVTGEDLVLAGLAKVRPLPQDKEKLGIRTPSQGLYDVFRDRIMIPILDAEG
                     RVVGFGGRRLESREPDPAEAVLVLPPAENGSSGSHGHGAASLPGPSISMVGTASSMFS
                     TASGSTAMRDADSYLTKVQLRAVTAPTQEEAFTGPKYVNTPETPVFQKARILFGMSET
                     LRRVRFPEEFADDWRLADAFGPCVVLVEGYLDVLRLHQEGIWFAVASLGTSVTSAQCE
                     MLVELVRLIENEHALRSSKRLRPRLILQLDQDEAGSRATKRTIGMFLDKYQRYGERFG
                     LHLCVAQLPSHVKDADEYIQAYGSEAYLRQVVTQAQVWWRHEITSRLDTYVSAVEASR
                     QCIKAEEDVTRLFWCRSPALNACLEDIANCIRMAQLKSKEYHAVTVQVAQRIAGLFVP
                     FHHLEDPYRELVAEIKRRVQQRPVHVPHHNADTQVNGALVQSTATPAMGTGAPYYKLQ
                     ARDGTNISPAWRGTAPAVPASYIPPPYGDYPPWIWAEIKLLRIVVCATAAQRESWRQR
                     LQEESIPLLMLITVPTIRRAIAFLLGLSTDRTGRSESNGSVFPMDDIVAVTDALIDRG
                     IIEECDLDATDAPVEDHRHRHPLDRQQGHQYPLDAYRIPKEVFGPIDGDSSATLTPRR
                     APSATPAAAPERTASAGSNPAWRLNGSASSAASPLGNGLSTGDITASGRGVHKDEADP
                     NAAANSTETPASSSSANPMLNGTSKSLGPGAQVSLAKPPCMRTKPAFADSDSFASRTA
                     RIITRTIRSIGVLRVCRPEQALPLDMGAGTVHEANARLQENAALTERQRPWLQNHDLA
                     LSLVLHLERHRMDATFFAQIAWLRYLRCKVRLALTWQAWNDAIESLEAQVALSDSTSP
                     ETLDASSASVPAPSGGAPQNIGQPTRCSTSLELPGLTDTAIWRRCEAYLAEIHTIEAE
                     MERLKQSW"
     gene            <744136..>744777
                     /locus_tag="CYME_CMQ287C"
                     /db_xref="GeneID:16996229"
     mRNA            <744136..>744777
                     /locus_tag="CYME_CMQ287C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538145.1"
                     /db_xref="GeneID:16996229"
     CDS             744136..744777
                     /locus_tag="CYME_CMQ287C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538202.1"
                     /db_xref="GeneID:16996229"
                     /translation="MNASDSPPSEASDSNLFQRAWRNTLAYAVRSLWGIPCFRWRLHD
                     FSSETEAIRKPLASGVPVLYVLSVRGCRYCEFTRRLFERAVNMPVLPIESQHAESSRV
                     WLIGDALHVVWVDCGRSEAAERFCESRSPRTIPLVELALPRSPDGSIPAEGFSTVEFS
                     RDTWDWSVIGLRAFLRACGVLPPPGLPPWLYERWRQSRRLEQTGQMDAHHHIE"
     misc_feature    complement(744287..746092)
                     /note="possible transcribed region"
     gene            <746208..>747227
                     /locus_tag="CYME_CMQ289C"
                     /db_xref="GeneID:16996198"
     mRNA            <746208..>747227
                     /locus_tag="CYME_CMQ289C"
                     /product="glyoxylate reductase/hydroxypyruvate reductase"
                     /transcript_id="XM_005538146.1"
                     /db_xref="GeneID:16996198"
     CDS             746208..747227
                     /locus_tag="CYME_CMQ289C"
                     /codon_start=1
                     /product="glyoxylate reductase/hydroxypyruvate reductase"
                     /protein_id="XP_005538203.1"
                     /db_xref="GeneID:16996198"
                     /translation="MAATGIVRVLVTRQIQEEALEYVRKQVPNVELQVHPDEHQSPAR
                     SELEAWLERGVDGLVCVIGDVIDEALLTHDTQGRLRVVSTMSVGYNHIDVESCRQRGI
                     AVGHTPDVLTETTADLAVGLAIATARRFREALQAVEQPGGWKSSWSPTWMCGTDVHGA
                     TVGIIGLGRIGVAVARRLHHGFGCRILYHGTREKPVVAAEIGQARFCADLGELLAESD
                     FVIPLCPLTQKTRNLINASSLRLMKKSAFLINVSRGEIVDQDAVCDALEAEALAGYGT
                     DVTVPEPIPTDHRLLKTRGVTVLPHIGSATLQTRLAMARLCVENLVAGVKGDPLPHPV
                     PLHAE"
     misc_feature    748165..748840
                     /note="possible transcribed region"
     gene            complement(<751953..>754424)
                     /locus_tag="CYME_CMQ290C"
                     /db_xref="GeneID:16996615"
     mRNA            complement(<751953..>754424)
                     /locus_tag="CYME_CMQ290C"
                     /product="DNA mismatch repair protein MLH1"
                     /transcript_id="XM_005538147.1"
                     /db_xref="GeneID:16996615"
     CDS             complement(751953..754424)
                     /locus_tag="CYME_CMQ290C"
                     /codon_start=1
                     /product="DNA mismatch repair protein MLH1"
                     /protein_id="XP_005538204.1"
                     /db_xref="GeneID:16996615"
                     /translation="MEINSDVNAAVPSEVDQQTNDEEKLPRRILPLGPEVVSRMAAGE
                     VVARPSAALKELLENAIDAGSTRISVSIIRGGIVRLEVVDNGCGIRVQDARLLCERHT
                     TSKLRSVEDLAKVATCGFRGEALASISHISELCIVSRTHHEEHGWRASYRQGKLVAPG
                     VQAAARTPGTTILVTDMFRSMPARYESFLRTHAEEYRQMLSIVSRYALYHSGRIAMCC
                     RKRETCALRATEAETDDLHTFVHASHLDNIRAIFGQKVASSLGTLGCRVLHRVQHAVA
                     GTVQEAEILLERAYFSLLGASQTKPLHIYFVNGRLVECRTLRRAIEQLYARYYLKGPH
                     HPFCYLELKVPPEILDVNVHPAKKEVRFLDEQIAFSNIVQALEQQLISSGAQRSFAVQ
                     APRVRAGSGTAALLPRDSDAEAARATVSLESLREALIGSTRKRAAEAMAGPPNDAGTG
                     KVVACANAQDGGSRQLDAADCWEQLCTEHKQRLFSQRSSTCTLPPSQRIRVDAQSTRL
                     EQWQSVTGVIQGRVRVLTTPARSAGHNGDSTLSRCLQLEATTTRERIAEALHRECVDG
                     YSHAIAEVFREHVFVGAVDDRCCLIQFGTALVAVDLSRILEELYYQQLVGALEPQPAA
                     TPIVRLQSPWVVELDVSNRPSVDANGEFLSSWYSYALELAFYCGIHLCLEPLCPEIGH
                     MSELGEGPTRLSCWSARPQALHLYLHSLPWVDCSVAVHPRASSLTLFGDRLVRYRHEA
                     DRQTRIRQVIRALALLYTESYLEAFTMEKHSTEDLAAIAGAAERVLILVRDHERFHAP
                     AVWGRDGTLTVVARTERLYRIFERC"
     gene            <754695..>755864
                     /locus_tag="CYME_CMQ291C"
                     /db_xref="GeneID:16996200"
     mRNA            <754695..>755864
                     /locus_tag="CYME_CMQ291C"
                     /product="dCMP deaminase"
                     /transcript_id="XM_005538148.1"
                     /db_xref="GeneID:16996200"
     CDS             754695..755864
                     /locus_tag="CYME_CMQ291C"
                     /codon_start=1
                     /product="dCMP deaminase"
                     /protein_id="XP_005538205.1"
                     /db_xref="GeneID:16996200"
                     /translation="MLVGIIGRRCAGKKTVHSLLVERFGFLPAYLEPAEIEANPQVRQ
                     QPVSLVSGQPACNDEPLAALTLEAPSDCWRSDRFYVLPPGLSTKQARALRKRPYFLLL
                     AVDAPGLVRFRRWQSQCASEGTNCIASASQSSVLEFLRLDDADYFGQAVTDAGWDARC
                     EHEAVAVPRPSPDDPDALWRAFELSDVRVYNPTDNREQLAAALQRLQLQRPDWLRPAW
                     DTYFMRIAELASMRTNCMKRRVGAVIVRDHRVIATGYNGTPRGTRNCNEGGCQRCNGG
                     ARAGHALDVCLCLHAEENAIIEAGRERCAGSTLFTNLCPCLACTKKIVQAGIREVVYG
                     ATYAMDTRSARLFAEAGVRMRHYPCTLSRGSSAPFEVTSVSPVVSNHSTQLQSSG"
     gene            complement(<756869..>757651)
                     /locus_tag="CYME_CMQ292C"
                     /db_xref="GeneID:16996204"
     mRNA            complement(<756869..>757651)
                     /locus_tag="CYME_CMQ292C"
                     /product="chloroplast ribosomal protein L15 precursor"
                     /transcript_id="XM_005538149.1"
                     /db_xref="GeneID:16996204"
     CDS             complement(756869..757651)
                     /locus_tag="CYME_CMQ292C"
                     /codon_start=1
                     /product="chloroplast ribosomal protein L15 precursor"
                     /protein_id="XP_005538206.1"
                     /db_xref="GeneID:16996204"
                     /translation="MAFLTFPRLSCGRGEHLRASLSTQSAWCPVGSTRRAMLHAGASP
                     FLSSWRLASARRVATGNSVHSGLRELQAIRIVDKEGKIPEEIANENFTLGNLAPAPGS
                     VHRKKRKGRGIAAGQGGSCGYGMRGQKSRSGGSIRPGFEGGQMPLYRRIPKYRGRPPG
                     PSHRRIEYQPVNVKALNTCAEGSVVTPHVLIETGAIHRTNLKLFKILGDGEITVRNLT
                     VKAHAFSSSAVRKIEEAGGRCVLLSPTTGKDIELPSEDNQDE"
     gene            <758291..>759439
                     /locus_tag="CYME_CMQ293C"
                     /db_xref="GeneID:16996205"
     mRNA            <758291..>759439
                     /locus_tag="CYME_CMQ293C"
                     /product="60S ribosomal protein L4"
                     /transcript_id="XM_005538150.1"
                     /db_xref="GeneID:16996205"
     CDS             758291..759439
                     /locus_tag="CYME_CMQ293C"
                     /codon_start=1
                     /product="60S ribosomal protein L4"
                     /protein_id="XP_005538207.1"
                     /db_xref="GeneID:16996205"
                     /translation="MAYASRPLVSVISTKTGESIGEQVKLPQVFLAPIRPDVVQIVHT
                     GVAKNARQPYGVSRMAGEWATAHSWGTGRAVSRAPRVHGGGTHRSGQVSGANFARGAR
                     MFAPTRIWRRWHVKVSRGQRRYAVASALAASALPALVMSRGHRIDSVPELPLVLSEDS
                     ESLRRTKDAVALLKAIGAYEDVEHAAKSKNQRAGRGKMRNRRYTMRRGPLIIYANSEK
                     DPKSGAPDNLSRAFRNLPGVECCHVERLNLLQLAPGGHLGRFCIFTKQAFERLDEIYA
                     TGKSGFKFPRAVMTQADLSRIINSDEVQSALRPIRRVPRLPRLKRNALRNRRMMRLLN
                     PAYDAFIRKMSERVPDASRRLPASERARVRAIGKRYIRQLLDTNPTEV"
     gene            complement(<759988..>761877)
                     /locus_tag="CYME_CMQ294C"
                     /db_xref="GeneID:16996206"
     mRNA            complement(<759988..>761877)
                     /locus_tag="CYME_CMQ294C"
                     /product="similar to ankyrin"
                     /transcript_id="XM_005538151.1"
                     /db_xref="GeneID:16996206"
     CDS             complement(759988..761877)
                     /locus_tag="CYME_CMQ294C"
                     /codon_start=1
                     /product="similar to ankyrin"
                     /protein_id="XP_005538208.1"
                     /db_xref="GeneID:16996206"
                     /translation="MGCFVSREQPVQRPQEDTKTSDVTPLGKAVLANDPRQIRKILTT
                     TGNGVDVNEPVNASGATALILAIYENKSLEVIRELVRTPGIDLSRTTPQGFFALSFAA
                     EYRDVNVVRLLLEAGADVNQQSDASGWTALIRAMRHNRDREEALRITRLLVKTPGIDI
                     HRQDASGWTALHHAARYLPVEFSRILVYEGHADVNHGKTDGWTPLMLATGSNECDDVL
                     ETVQLLATAPGADLERRTSEDEATALMLAASIRDAPIVRVLVDAGARVDAVDSNGWAA
                     IHHCLRYSELPDVSEIVRVLLSAPHADVDQSDREGWTPLMYAARYRTSAEVRVIAVEF
                     RASVQKTTNQGSTALSMAVRHSTDAARCVEILISEPVCHPTTVQDALGWTPLITAVRY
                     ASDIRVIELLARAKDAPLNAGEFKLGWTALMVAAKYRDATVARILLETPGCNPNTARH
                     DGIVALHIAVAREDRMRVGSFLDRLSSASGPSATPALRNRKRIARERYADERAAAEEL
                     LRAARDSLSVEERYAIQLELVRVLLETPTQEPICIDAQEKRAGWTALHFAAAYDRADL
                     VELLLAAGASPWVQTLDGKTALDLAEANDFTATVRMLRIAMDKSSVERGDSTGDRCQA
                     PQLSN"
     gene            complement(<763795..>766125)
                     /locus_tag="CYME_CMQ295C"
                     /db_xref="GeneID:16996196"
     mRNA            complement(<763795..>766125)
                     /locus_tag="CYME_CMQ295C"
                     /product="cell division protein FtsH"
                     /transcript_id="XM_005538152.1"
                     /db_xref="GeneID:16996196"
     CDS             complement(763795..766125)
                     /locus_tag="CYME_CMQ295C"
                     /codon_start=1
                     /product="cell division protein FtsH"
                     /protein_id="XP_005538209.1"
                     /db_xref="GeneID:16996196"
                     /translation="MFCAFAFFPATLSGKHGFCGAGGALQPARSRLVETPFPGTRARQ
                     GPSRVVSKDKLQSGYGVWMTSSLGRIGRLAQELMRDNMVNGTADLGRYRQEFLAIASE
                     ADLKGSKVSRTLQRFAAATLAAMIVLHGFEGGSGFPLPVQAAPMTTTTTTTTTKVDAN
                     RTAPATGERDTAPVPAGSARGAKEMNSRNVHVRYSEFWDMIVHDRIEKVTFSPDMQRA
                     LVIDTDGNRFRMDALPNDPDLLPTLTKHKVDIIVLPAQQDNGIGDFLRSLIFPALLFG
                     GLYFLSRRFSRGVGPGGMGNPLELTRSQAKVQMVPKTGITFNDVAGCDGAKLELQEVV
                     SFLKNSDAFTEVGAQVPRGVILEGPPGTGKTLLARAVAGEAGVPFFSISGSEFVEMFV
                     GVGASRVRDLFSQAKKNAPCIVFIDEIDAVGRQRGAGIAGGNDEREQTLNQLLTEMDG
                     FEGNSGVIVMAATNRSDVLDPALLRPGRFDRRITVDLPDLKGRLEILKVHSRNKPLAA
                     GVDLEMVARRTPGFSGASLQNLMNEAAIFAARRDSKEISNEDIDNAIDRVLLGPAKRD
                     AVMSERRKELVAYHEAGHALVGALTPGYDQPIKVTIIPRGSAGGVTFFAPNEVRAESG
                     MYTRQFLESQLSVALGGRIAEEIIYGPSEATTGAANDLQQVSNIARRMVTQFGMSELL
                     GPVALEQPSGNPFLGRDLGSRSLPSSAATRALIDAEVRRLVDRAYERAKTILTKNRHL
                     LDKLARLLIEKETVSSEEIAMLIAQNNVVMADYAVL"
     misc_feature    766546..768690
                     /note="possible transcribed region"
     gene            complement(<767468..>768919)
                     /locus_tag="CYME_CMQ297C"
                     /db_xref="GeneID:16996218"
     mRNA            complement(<767468..>768919)
                     /locus_tag="CYME_CMQ297C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538153.1"
                     /db_xref="GeneID:16996218"
     CDS             complement(767468..768919)
                     /locus_tag="CYME_CMQ297C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538210.1"
                     /db_xref="GeneID:16996218"
                     /translation="MGYTTRRVLTGTQKHQLVWLRYTDHYARPSAVVACFICSTAQGT
                     RWRETCCREWSGEQLLAWCLLPRVLRSIHAPASSRLQALYVCRREASVPVRSDAQQGV
                     STVQQQQQQLLQTKRKTSFRRVHSILRTAMSRQEPQAGDSKNKARAGKALKASGTRTD
                     AGVASVTNCLAALLATGFPDPETVLLFFQVLLCLSDDTTTQRSTQSRRAETRARISAA
                     LRGRKRPPEVCQRIAASLRGRSLSDAHRRRIQASLSGERNPMFGRRRSEEERARIRES
                     VLRTLEERGRKSSKAASSETQPADAQALERPDSINKQQHQRSLSKEANSLPLDELVQA
                     IWLQARAAGALLEHAERQVLTEPSNASYERRARIGRDNGFGDQTSAVDKRMDAAAGYM
                     RGAVESLALSHPVQRSAPSSAHLVYTSADLARRTPCTTCNGRGLVLCPHCVKRFGHSS
                     KTCSHCGGSGMGICDHCQGTHVVMPSDANSYRT"
     gene            769165..771837
                     /locus_tag="CYME_CMQ298T"
                     /db_xref="GeneID:16996219"
     misc_RNA        769165..771837
                     /locus_tag="CYME_CMQ298T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461566.1"
                     /db_xref="GeneID:16996219"
     misc_feature    772218..775387
                     /note="repetitive element"
     gene            <775253..>776542
                     /locus_tag="CYME_CMQ300C"
                     /db_xref="GeneID:16996220"
     mRNA            <775253..>776542
                     /locus_tag="CYME_CMQ300C"
                     /product="mitochondrial peptide chain release factor RF-1"
                     /transcript_id="XM_005538154.1"
                     /db_xref="GeneID:16996220"
     CDS             775253..776542
                     /locus_tag="CYME_CMQ300C"
                     /codon_start=1
                     /product="mitochondrial peptide chain release factor RF-1"
                     /protein_id="XP_005538211.1"
                     /db_xref="GeneID:16996220"
                     /translation="MRKIGRSSRWPLQKNGEASAHWFMTSSLGHVCRHCCTRSASFDC
                     VAFGVRSGSKHLNKSNSFDVYVRYMWSGCVRQLVRRTQRRVRCGPASFRCVSDQATTD
                     VTRTALVSIEAELTENRQLLTELRTAETPEPELQRLVREEIQRLEAQQRSLLERARQQ
                     QQEAPVEFAWDTEPQRHSELADQNHEEGDPREIQSLFLEVQSGAGGIEANIFAHELFK
                     MYERYAKRRGWRFQILDECVARIEGAGAYERLRYEAGGVRVQRVPSTETRGRLHTSLA
                     FVIILPETDNTYGTDASWPNREDLRIDRFRASGAGGQHVNKTDSAVRVTHLPTGLQVA
                     VQTTRSQHQNLALAMRLLRARLADAQRRAKREAMEAKRRDQIGSRARHERVRTFHFPR
                     NEVVDHRVNRKVSELTRILRDGDIDLLPSPASSGISP"
     gene            complement(<777042..>778136)
                     /locus_tag="CYME_CMQ301C"
                     /db_xref="GeneID:16996221"
     mRNA            complement(<777042..>778136)
                     /locus_tag="CYME_CMQ301C"
                     /product="probable alcohol dehydrogenase"
                     /transcript_id="XM_005538155.1"
                     /db_xref="GeneID:16996221"
     CDS             complement(777042..778136)
                     /locus_tag="CYME_CMQ301C"
                     /codon_start=1
                     /product="probable alcohol dehydrogenase"
                     /protein_id="XP_005538212.1"
                     /db_xref="GeneID:16996221"
                     /translation="MSGAATTAYTTPAYAVKSRDAKFEKWSCPRRAPTADDVRIQIEY
                     CGICHSDVHQARDEWTGSIYPMVPGHEIVGKVVQTGENARTKGKFKEGDIVGVGCFVD
                     SCRACENCKNGLEVQFCPQLVMTYNGRDKAGEPTYGGYSREIVVDYRYVLRIPEKLAK
                     PDVLPRVAPLLCAGITTYSPLHYVGVKKGMRVGIHGLGGLGHVAVRLAKAMGATVVVL
                     SRSEKKRQDALELLKADQYLLTSDEETMKREAGTFDLILDTVSAPHELTVLTNLLRRD
                     GKLCLLGIPPKPYVVPAQALVFGRRSIFGSLVGGIKETQEMLDFCAKHNITCEIEMVS
                     PNQIDEAYERMTRSDVRYRFVIDIKQLETA"
     misc_feature    778512..780593
                     /note="possible transcribed region"
     gene            complement(782659..786074)
                     /locus_tag="CYME_CMQ303R"
                     /db_xref="GeneID:16996238"
     rRNA            complement(782659..786074)
                     /locus_tag="CYME_CMQ303R"
                     /product="28S ribosomal RNA"
                     /transcript_id="XR_002461567.1"
                     /db_xref="GeneID:16996238"
     gene            complement(787896..788049)
                     /locus_tag="CYME_CMQ304R"
                     /db_xref="GeneID:16996239"
     rRNA            complement(787896..788049)
                     /locus_tag="CYME_CMQ304R"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_002461568.1"
                     /db_xref="GeneID:16996239"
     gene            complement(788901..790691)
                     /locus_tag="CYME_CMQ305R"
                     /db_xref="GeneID:16996240"
     rRNA            complement(788901..790691)
                     /locus_tag="CYME_CMQ305R"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_002461569.1"
                     /db_xref="GeneID:16996240"
     gene            complement(<796141..>797112)
                     /locus_tag="CYME_CMQ306C"
                     /db_xref="GeneID:16996222"
     mRNA            complement(<796141..>797112)
                     /locus_tag="CYME_CMQ306C"
                     /product="similar to ribosomal protein L11
                     methyltransferase"
                     /transcript_id="XM_005538156.1"
                     /db_xref="GeneID:16996222"
     CDS             complement(796141..797112)
                     /locus_tag="CYME_CMQ306C"
                     /codon_start=1
                     /product="similar to ribosomal protein L11
                     methyltransferase"
                     /protein_id="XP_005538213.1"
                     /db_xref="GeneID:16996222"
                     /translation="MPEPKADRYRLVRLTISDTATSELLSEYLLELGAVSVSLEAHNS
                     AHGKRPTGDAALAAETWARPHWTITDVVAMVPQEIRTEALLQAAATVFPEVMEVPVVE
                     QPVDSSRDWVRAVRESFQPLLIGERLLVRFPWNTEVSVRSLLDGDGKERVQLTIEPGA
                     AFGTGEHPTTQLCARWLELHVQPGSRVLDYGSGSGILVMYACKLGADPARSVGIDIDE
                     EAIAVAKRDAVRNQLDGLVFATPDEAEHLLQEQRFDLLVSNILAPTLQELAPRFCSLV
                     RTGGRIALSGMLAAHTAAVWASYAADFHLEESFVQDEWVLVSGIRRR"
     misc_feature    798263..799975
                     /note="possible transcribed region"
     misc_feature    complement(800066..800868)
                     /note="possible transcribed region"
     gene            <801312..>802529
                     /locus_tag="CYME_CMQ308C"
                     /db_xref="GeneID:16996616"
     mRNA            <801312..>802529
                     /locus_tag="CYME_CMQ308C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538157.1"
                     /db_xref="GeneID:16996616"
     CDS             801312..802529
                     /locus_tag="CYME_CMQ308C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538214.1"
                     /db_xref="GeneID:16996616"
                     /translation="MLKFFRQDGSNEDKDDTKKRASVLERDVSSPPERQEHGTDDLSE
                     SAQRSRVLFGLIVGSMVALWGRRHRPNPNMEKRPASNGSGRERQSRCSALVSAAPVIR
                     MGLVADVQYADKDDKEVSGSTRHYRNAIHKLARIVEAFDSEAGSLDLVLQLGDLVDGQ
                     EQLDGSRADLELVLGQFARLPVPLYHVLGNHCLKCGRDWLLKRLRTRAFYDMPLRARM
                     SSGPSATTTPSETPWRLVVLDCLDISLHWDDPEDPRRLQAKRYLKEHASTAPNAVPYN
                     GGIGETQLVWLENVLAEARTRQEFVIVAGHVPIAPQSAAPSLLLWNYEEVMALFRVYR
                     DVVKLVLAGHEHDGGYAQVDGIHYITLHGVVNCTDGDDNAYAILELVGHSFARLHGFG
                     RVESRLLLFDASP"
     gene            <805515..>807275
                     /locus_tag="CYME_CMQ309C"
                     /db_xref="GeneID:16996225"
     mRNA            <805515..>807275
                     /locus_tag="CYME_CMQ309C"
                     /product="similar to glucosyltransferase"
                     /transcript_id="XM_005538158.1"
                     /db_xref="GeneID:16996225"
     CDS             805515..807275
                     /locus_tag="CYME_CMQ309C"
                     /codon_start=1
                     /product="similar to glucosyltransferase"
                     /protein_id="XP_005538215.1"
                     /db_xref="GeneID:16996225"
                     /translation="MDKTSHPQEGVGFGLLLRLYCVTALLKALLVRAPYSTDLLVHLH
                     WKSLTRRFPVSAWYTPATGPPYLDYPTCFAYLEWFLGALAQLLRIPLDHENGSVRLST
                     LIFMRITVIALDVFLFLGMRPWCAGPETAAAASFPSVVLDRLLWVVTHPALWLVDNIH
                     FQYNGLVIGVILYSLGVLFRESVYAEMEKRRSQRGMWRASAAFLVALGLKHTTALSIA
                     PVVGLVLWKQRAWKNIYVVVSGFVWLLLMLGLPFGCVGWRALWERLFPLDERGLFHAY
                     WAPNAYALLAAADKVVARFCALVFSRLVERGLAKSPHGSDLLPMLHRSGRVSNSAGLV
                     QTAGGGFYLLPEWTPMLATLCCVVAMTPSLLALHWAFQESARHGETQPASSDATAVDR
                     LDQRRCMEFLAKICAQVSLSLFLFGWHVHEKALILPVFLAGLGLGPRHPVAAALSTAC
                     SLAMFPLVSSPGVRLVRLALLFWHWLYFAPLQPWPPTRAWLLVYSYGGIGLMIGELLA
                     SWHGWQRLGLPFLPLMLQSVYSALAVVFAWGYLSWQVWRSTRADYMGCSPNAEAKHLL
                     IAPSVQAGARPLLVRSSSKH"
     misc_feature    complement(806042..807678)
                     /note="possible transcribed region"
     misc_feature    808355..809321
                     /note="repetitive element"
     gene            <809374..>810699
                     /locus_tag="CYME_CMQ312C"
                     /db_xref="GeneID:16996257"
     mRNA            <809374..>810699
                     /locus_tag="CYME_CMQ312C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538159.1"
                     /db_xref="GeneID:16996257"
     CDS             809374..810699
                     /locus_tag="CYME_CMQ312C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538216.1"
                     /db_xref="GeneID:16996257"
                     /translation="MRSGFLHEAEPPALDPADAVWRRLSSVEQQRYFLHRIVLHTFAQ
                     KPLRIPTEILEHNSGQSGVHEWQGPVASFLRLLRRLCHGLRWEHRGAERSVVVLHPGV
                     YVGCVADEHTVDDVPLIVHRCDDLGAYSVTVLLEPLLVLAPFGKQVTRVRFRKAVTEN
                     SSPETIDAFMHVTLPLAQALLGTDSWSELAPCRALRVQLLRRDVPQSGSDTQRMHAPR
                     GVVLFECPVLKTGLHWETLRETLARGSFPHGRSVIQRLGGVVSTAGVAPTWGLRLISM
                     SRSHFERWLSDVYISAVRVPKSRTPMCSLTVWAESADNCAYVANTSWFEDLDTFSNER
                     RDLLGFAALEKIFYSKLLPRLRRRIRNAGRADTQHHPLLLWFMAMAPPKGPLQTCLGA
                     EVALPSHLLIQDLEHVLGVRFHLQQDQKTTLWWLCCQGLGYQNWSRVRH"
     gene            complement(<810649..>811794)
                     /locus_tag="CYME_CMQ313C"
                     /db_xref="GeneID:16996258"
     mRNA            complement(<810649..>811794)
                     /locus_tag="CYME_CMQ313C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538160.1"
                     /db_xref="GeneID:16996258"
     CDS             complement(810649..811794)
                     /locus_tag="CYME_CMQ313C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538217.1"
                     /db_xref="GeneID:16996258"
                     /translation="MRRQRETPQESGAEDEPAARSTEVTASGEAVIAARLLQRRRALL
                     QRRMRRLSARIVALLAGYFDADSLDRLSETQLRGARLWYDLGRRLAGLLGQAFPSWLG
                     ASSTAAGASVLVAPGFQLHTLYEGAQAPGALVQQSVFTTRAATGASASEAGSRSGPEA
                     AAPEAATLLGTDPSETHTAWTAATADSQRASRAGTDAVVVARATQTDTPVAAPDRTGL
                     VDPVPDTDARKWEYPAVERGRRPEWLVELHRTQARTVATQTEDVGVFASIWTNVAMDR
                     NWESAQLQLPSAYDPQWAVRPASQRVDALATTPLWAYASYRVEQDPGSSAPLIPRTGA
                     PAALQTVLVSLDQTRQAGNRTQQEQASPLNNLMANAAPVLVTQTLAA"
     gene            813464..815337
                     /locus_tag="CYME_CMQ314T"
                     /db_xref="GeneID:16996266"
     misc_RNA        813464..815337
                     /locus_tag="CYME_CMQ314T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461570.1"
                     /db_xref="GeneID:16996266"
     misc_feature    816291..819542
                     /note="possible transcribed region"
     gene            complement(<816760..>819249)
                     /locus_tag="CYME_CMQ316C"
                     /db_xref="GeneID:16996268"
     mRNA            complement(<816760..>819249)
                     /locus_tag="CYME_CMQ316C"
                     /product="exonuclease"
                     /transcript_id="XM_005538161.1"
                     /db_xref="GeneID:16996268"
     CDS             complement(816760..819249)
                     /locus_tag="CYME_CMQ316C"
                     /codon_start=1
                     /product="exonuclease"
                     /protein_id="XP_005538218.1"
                     /db_xref="GeneID:16996268"
                     /translation="MGIPRFFRWLSLRYPVINQSLEGDREFDNFYLDMNGIIHTCTHN
                     NDGDIIFLDEVEMFARIFAYTDRLYRIVKPRKFLFLAVDGVAPRAKMNQQRSRRFRSA
                     KEAERVLAEAIARGDLEDGFIEERFDSNCITPGTAFMDRLSQAFREWIDYKMRNDRAW
                     QTGCKVVFSGPEVPGEGEHKIMEMIREIKRQHRHRGDMPIRHCMYGLDADLIMLGLVT
                     HEPYFALLREKLVYRGRIGERLGAAARSPPITSLSNPAAASESGDNSPLARALAARRM
                     GLVDAPANLDDFEEFHLLEINLLRDELYKEFAELASRQRSDAPPFHVDLERIVDDFMF
                     MGVLVGNDFLPHLPHLDISDGALELLFGAYKELLPIMGGYLTDKHRIHPDRLEAFAAR
                     LAEEERAYFNRRGVDENIQEYCDPERYRVAYYRDKFRLNLDAPDGNERLRGQVIQSYL
                     EGLHWVLQYYHHGCPSWTWYYPYYFAPLCSDLRDLGSYKVRFLKGKPFTPLTQLLGVL
                     PPESSGELPPPYRQLMLDLESPVRDFYPAEFRTDLNGKRFDWEAVVLLPFIEERRLLE
                     AVGSIDPHRELTSEERRRDLFGQNDVFDPDTGNYFQERVPSGEIAWSNTPSAAEQRRG
                     FARTIAELEARAKPDRSKPVTTPQTDANDATRTAVQKRTTQVSTTTSSSGTKRTVRMT
                     TETTVVRRAERTSRPPASSTAANKGRERAQAPAASQSTKPRSTRNDSTRVSQASGSHN
                     GPASAAPKPADGSTNADGHTGAARSSPSQASKPQRQSMDEGHGRERPSNASASTTGND
                     SSSSRTNNWVQRQQRQQRQPLPPQPPSADAQ"
     gene            <819928..>821823
                     /locus_tag="CYME_CMQ317C"
                     /db_xref="GeneID:16996269"
     mRNA            <819928..>821823
                     /locus_tag="CYME_CMQ317C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538162.1"
                     /db_xref="GeneID:16996269"
     CDS             819928..821823
                     /locus_tag="CYME_CMQ317C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538219.1"
                     /db_xref="GeneID:16996269"
                     /translation="MHFAYLREPAQRVPTARHVAAAPQRKTDHGSGDTKARTTESDCT
                     FGEPCLGALIVHCKRGHTDSSTACTALGERLEGMRGLESHRLGAQHLFLGFTVPFWTE
                     KNESPNRPTKRQLLAINRKRRGLFGTAGGLLAGGAAAPGWEAGPRSGTRGSLLRLEAA
                     RAASVTERQHQGASVVGKTTPEAVAYEIDRHGSVYAYRATSTAGAGSLERLADLRSSD
                     WRQRARQALAAAPGQLVLQLRSVFLPEGFPESVGPSYLRYSLWRGAQNVVSAMTAVLS
                     THALLAAVGLSSTPVAAATSWVLKDGIGQLGKLLTARRGRDFDADPKRYRLSSDLLYD
                     AGLSLEILTPLFPQYFLALAALGNFTKSVAITVGMACRNSVLSSFVLRGNLGDISAKN
                     DAQNVVTNLTGMGLGIVTARALPPKPSVRLGAFAALTALYSVLNYQSMKAVKLNVVNR
                     QRGAIIADSFVRSHAEDVLDVETVNDLECIIPFVPEHFQWLPLKLGVSLERVGRLPPP
                     QRRPRARYVMSMNERELRVALHERAAPRDLLQVLLQSAYLRYLVSVRSGGMERCSPAR
                     QRTAIGLPRVCFPLRLSPDMDQGQLMAQAEAYAERYVDAFCRALERRGWNTRVLQLAP
                     DRYRCRW"
     gene            complement(<822995..>823276)
                     /locus_tag="CYME_CMQ318C"
                     /db_xref="GeneID:16996264"
     mRNA            complement(<822995..>823276)
                     /locus_tag="CYME_CMQ318C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538163.1"
                     /db_xref="GeneID:16996264"
     CDS             complement(822995..823276)
                     /locus_tag="CYME_CMQ318C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538220.1"
                     /db_xref="GeneID:16996264"
                     /translation="MLRPLQQNPFFRVGLPFLTLMVASLYGVTYLLEGRYELDRTRRR
                     LERHAGTAVSSTTSAPSRTESVENAEAPPSAYVNIPVPGRARSSTSGTR"
     gene            <823673..>824317
                     /locus_tag="CYME_CMQ319C"
                     /db_xref="GeneID:16996265"
     mRNA            <823673..>824317
                     /locus_tag="CYME_CMQ319C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538164.1"
                     /db_xref="GeneID:16996265"
     CDS             823673..824317
                     /locus_tag="CYME_CMQ319C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538221.1"
                     /db_xref="GeneID:16996265"
                     /translation="MFAFSAAPLLRTGKVSLLIAAKPSFRPCACNLSANSFGDRSVWR
                     RSGHQRTQNARLVSVNASLDPVNEKDTTAEASLPPKPSKPPGVTRGQVIVGTLVGCVL
                     PFVLFRALERLPGQDAVSAGRWTVAGITVLTVGWVATYLTRVGTKRTTYAQQLRAYED
                     AVLRRRLAELSDEELQVLLADGDDGESTGPERSFESGAASSSLSKSPEEPDRRK"
     gene            <826105..>827106
                     /locus_tag="CYME_CMQ320C"
                     /db_xref="GeneID:16996274"
     mRNA            <826105..>827106
                     /locus_tag="CYME_CMQ320C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538165.1"
                     /db_xref="GeneID:16996274"
     CDS             826105..827106
                     /locus_tag="CYME_CMQ320C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538222.1"
                     /db_xref="GeneID:16996274"
                     /translation="MDGSENGQDSIAEKLRRRLLEKMLAEREALREQERQAPTTSGPA
                     PSLPAATRSTDPDEATEPRHQVARELSISDSQPTPAEVSQGALPAAGTSSGPALASEH
                     QRFEAATSGNAASTTRQSPAVESAALSVPGNTEPWLRGQPAGDDALPAETRRSASLYG
                     AGCVEDTDRNAHSATELKTSSPSALPDPEDAHALASRTSGTPESGTSSERSLATCSVS
                     PVLGPADSSERHAAMHWTADTPEFFVGADHGASAEAVDPQPLSTKTQDDRHSRDRQGA
                     TEPSSLPGTQETAFVRMGYSAEELQRIECAVQSFCAYALAVAERTFQRVQRAEREVS"
     gene            complement(<827889..>828584)
                     /locus_tag="CYME_CMQ321C"
                     /db_xref="GeneID:16996275"
     mRNA            complement(<827889..>828584)
                     /locus_tag="CYME_CMQ321C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538166.1"
                     /db_xref="GeneID:16996275"
     CDS             complement(827889..828584)
                     /locus_tag="CYME_CMQ321C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538223.1"
                     /db_xref="GeneID:16996275"
                     /translation="MHLARPWARETATSCRQLWSLGARHWTSRAAAAAVAGGSTEGSV
                     PDLHEYRYLFRYMTWDMRSKRLNDVLRRMQLLIRAAGGELHGGVASPSDKLERIAVLR
                     SPFVDKSSQEHFERVTRFRVLRWTWRADTQSSVASKSNEHQPVDMGHAVAMETPAGYG
                     LRVTETRNGLAALAFFFTDIVDSQHKLGSNGHAAGVDAAPRAAGVVEARESSHERGNA
                     IPGAWSREAHTAA"
     gene            complement(829486..830996)
                     /locus_tag="CYME_CMQ322T"
                     /db_xref="GeneID:16996276"
     misc_RNA        complement(829486..830996)
                     /locus_tag="CYME_CMQ322T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461571.1"
                     /db_xref="GeneID:16996276"
     gene            <831289..>831783
                     /locus_tag="CYME_CMQ323C"
                     /db_xref="GeneID:16996287"
     mRNA            <831289..>831783
                     /locus_tag="CYME_CMQ323C"
                     /product="V-type ATPase V0 subunit c"
                     /transcript_id="XM_005538167.1"
                     /db_xref="GeneID:16996287"
     CDS             831289..831783
                     /locus_tag="CYME_CMQ323C"
                     /codon_start=1
                     /product="V-type ATPase V0 subunit c"
                     /protein_id="XP_005538224.1"
                     /db_xref="GeneID:16996287"
                     /translation="MSATSHACPPAAAFFGFIGAASALVFSNMGAAYGTAKSGVGIAA
                     VGVLRPELIMRSIIPTVMAGILGIYGLIVAVILSGQISLQSYPYYLGFAHLSAGLAMG
                     LSGLAAGICIGVVGDAGVRATAQQPKVFTGFILILIFAEALALYGLIVALILGGKTAP
                     GACT"
     gene            <832660..>835347
                     /locus_tag="CYME_CMQ324C"
                     /db_xref="GeneID:16996288"
     mRNA            <832660..>835347
                     /locus_tag="CYME_CMQ324C"
                     /product="polyribonucleotide nucleotidyltransferase"
                     /transcript_id="XM_005538168.1"
                     /db_xref="GeneID:16996288"
     CDS             832660..835347
                     /locus_tag="CYME_CMQ324C"
                     /codon_start=1
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="XP_005538225.1"
                     /db_xref="GeneID:16996288"
                     /translation="MDWRRTLRLSTLTRTLQKRLSLRGATARLAACSTAGPLSSVSLD
                     AEAWAKHIQHQTGVAVRCGFGLDFETGRLARLATGSVTVHAGSTQVLVACVLAAHRAP
                     ASFAQLDALLQQQHTAGRLSEWQRTQELLQTLHTAPLWVDVRERASARGLIPTSYHRR
                     ESAATEKEVITARLIDRALRPTLPRGYCIETQLTAEVLSADGQLDPDTLALNGAAIAL
                     LLAFQRCFPQQVMQAQTRPRLVAAVRIARLAQTSTAADTVAFPPSESASMTPARPRWI
                     IQPSYAERLASDLDLVFAGTSDGCCVALEGEAKAVPPEDIAEACRLASAALEPLRQQQ
                     EALLQQCRLAASMPGAGAGPPALFWAMPRPQVVAEALRHSGERLVSIYAHAPEKTERG
                     IAVAQESAQAVAHLRQHAASLRSAPATDASSVSPGVDAVGPAEAALAVLEASREAWRQ
                     ALQRHQHRVDGRLPREMRPMEARVQVLPSDTCHGSALVSRGETQVLAVATLGFPSLAK
                     RLDAYGGGADTKQFYVHYQFPPYCNNQLGRGDALYRRRRREVGHGILAERAVRSVLPS
                     DLWHAVRLEADVLASAGSSSMAAAAAGSLALMDAGLPLAGPVAGVSIGGILATTSAGS
                     SATTEAYLRSPFAQDAEPCADLFLVDILGLEDFFGDFDCKVAGTEQGITALQLDVKHQ
                     GLTLEQVARALEEAHRVHHVQLEKVLRVALPAGAARPFLPPQAPRRGSWNLSLADRGR
                     LLGAGGQRVRELEQHTGCSIQLEDDGSISLWAPNAQVLEQALEILQQVTRIPACGDSF
                     HGRVLQILDFGAVIEIQPSPSSFRLQGLLHRSAFASALEWTRVQVGDALVVRVTQVDP
                     RTGSLRFAQVAPMDGNGVPNGTSTLDERRDAASSEMPRN"
     misc_feature    836120..838309
                     /note="possible transcribed region"
     gene            complement(<836489..>837937)
                     /locus_tag="CYME_CMQ325C"
                     /db_xref="GeneID:16996284"
     mRNA            complement(<836489..>837937)
                     /locus_tag="CYME_CMQ325C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538169.1"
                     /db_xref="GeneID:16996284"
     CDS             complement(836489..837937)
                     /locus_tag="CYME_CMQ325C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538226.1"
                     /db_xref="GeneID:16996284"
                     /translation="MGKKKSSKSNKVTVSLSEFVAGSGQQPGSGPIVAADPELAVLPT
                     APRSRGPDDERGFGARYGGSFGGYGDRWERFGGPGARMRSAFGEAPCDWADDDDSGFA
                     GAGAASDRAFGAGNRGADAEPELDWSAARRGLTPRGPVGDAGGRDWLRNADHSRGFPA
                     PAAAAGLNGAGPALEAEAAPEPDFTRRGLAPPAALETAEKGLGSFGGRQPERRREMFG
                     QLVTDSAEGTLERRGLLPPAVTTRAQVSPVEDVDVDFRKRGMLPPAAEAKASASEPQP
                     SRGFIPSDVEVDFGKRGRLPPAASEGTRSEATLPADAPADTRTEPSARDARPGRPQEL
                     PSHMNPPPASSTTHAAKQGASTEPTTLDFSRRGRLPPSAVKASASNDTSSRHRRRPFA
                     GMAAAAGDSSAVEFSRRGVPSPAAAAAAAAAAADADAGAVPASERAPRKAPSSQGAKS
                     FFGKDTQVDWSQVRRGVPPPPATETSPNANTP"
     misc_feature    838558..840043
                     /note="possible transcribed region"
     gene            complement(<840708..>842759)
                     /locus_tag="CYME_CMQ328C"
                     /db_xref="GeneID:16996285"
     mRNA            complement(<840708..>842759)
                     /locus_tag="CYME_CMQ328C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538170.1"
                     /db_xref="GeneID:16996285"
     CDS             complement(840708..842759)
                     /locus_tag="CYME_CMQ328C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538227.1"
                     /db_xref="GeneID:16996285"
                     /translation="MSSFHGIIGEKNLGFCSVTAVSRCTPKAFSTGAWRRGSGISRRP
                     PGRFSAVATLTVSEEVADEVRCPRLWRNSSCVYPAPRTFGTAFYYVETRRFEAARQLF
                     EELVWQHPFDARIWVGFGQCEAEAALAEPTIYTDDEKNGLVGGDIMRRDGTAELELSA
                     VDDLTWASSVFHRLHGVARARAVFRRGLIRAGGVWNESTVDENGTVPVHTFADYIGTE
                     FVPDIEGWNEKDAEAGRWCSASKLYHAWALAEVRFLEQQELRRSMSSVSKKLVPLHKN
                     EKRPETDSSRRPSNCAGARLVRRLFELSARAVNGRDPITWQAWVRFEASLGLGVTRAR
                     ELFKLGVASVEQINPTCKELACLYQTWGVLEQREHRYDEAICCYERAVALNPNHARTL
                     HAWGMLEQQRGRIDEARVLFERAIEVSNGSPHTAPAAYNLLGKLEWRQGRLDKARMLF
                     QKGLEIAPGDRHLCHAMASLERHCGNYELAREYFARCTKLDELVVRDWAEMETRDVGF
                     ADIQLGEASRLGEAIEALSMLHLFTRTDEDISTCSCDEKSVKPGNESLGQQPQDPPAF
                     QRPGSMQCGTLKSREAANEPYRRLLSWFYERLKHDQTLLNTLAKNNAVRADQLRLWIT
                     RRGEDDITAFRAWARSMAQSQPKLLRMLFRVPGPMNAFGFKIASNERKGPGRSHLRSG
                     K"
     gene            <843897..>845507
                     /locus_tag="CYME_CMQ329C"
                     /db_xref="GeneID:16996286"
     mRNA            <843897..>845507
                     /locus_tag="CYME_CMQ329C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538171.1"
                     /db_xref="GeneID:16996286"
     CDS             843897..845507
                     /locus_tag="CYME_CMQ329C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538228.1"
                     /db_xref="GeneID:16996286"
                     /translation="MESSFRVRLPSASHVRIFGSALSCLARCQTAYSLQRFSEAGAKD
                     NSAFEGIWLAASASSLTLSIQNLGCVAEISFPRAFFSREQGGRLEAPPGRTLSVSVDP
                     VLWWPVFRHAVGSAGAAANVERRRAHPGTPSGPKAPSNASGGVPVEQLEIRADTRDRE
                     LVLDAVASVGYALGRKARPPVGFHDNRHWRFQFRFQALMRYQALSLNERSAPEHYRCR
                     MRFAPRVFLEALSNMHRRVVHLHFYFEQHQLRLASAVTEQLARHYGERPDSRIVSLHT
                     QVKIDGSELDVYEGFAQFFQEAGTNQNLDDAENRSAFETSISSGRTVFVVPLRPFKAW
                     LELSQRLQCSVWMLYESGGQLMLRLEKAPATDYAQHLSAATDAQSVMGDTWPADFTDD
                     SQLLSSLLSADMQLNIRGSASLTSALSSLGQAQHGTWLVAASARNSSAALEHTQNQND
                     ASRAALIAAPCIANGSDRLPFGSSSLLHVDEAARDIPQAALFADHSRTASPVLNSGDN
                     TESDDESERSVGGTPPPVASFIADVWPS"
     gene            complement(<845997..>846929)
                     /locus_tag="CYME_CMQ330C"
                     /db_xref="GeneID:16996280"
     mRNA            complement(<845997..>846929)
                     /locus_tag="CYME_CMQ330C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538172.1"
                     /db_xref="GeneID:16996280"
     CDS             complement(845997..846929)
                     /locus_tag="CYME_CMQ330C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538229.1"
                     /db_xref="GeneID:16996280"
                     /translation="MASRLLTGRIRCPSHPYSASSTWNASPRRSTASVLYRALQRSLR
                     DYAREWTRVESSRSVLPSAFHAREWSIFCGTLGPALNELARVVPGKAPRDPWQLAAAL
                     RRSVRERSFTEQQPSERELELGFGLLRVLQSRVVALKRLVYEPHSSCLTAGVRVQVDS
                     LFLGREQRGVGLDGLRDMYHFTYFVRIENHGPAPVLLLGRHWDINDLEGQLQTVRGLG
                     VVGQTPTLQVGDSYEYRSQCVLAAPLGVMRGFYRMFQMPKGDEVAVEIKPFGLIASTL
                     HKEPQEEQVPADGSVQTASSYARRARVHPARPPL"
     gene            <849094..>853617
                     /locus_tag="CYME_CMQ331C"
                     /db_xref="GeneID:16996281"
     mRNA            <849094..>853617
                     /locus_tag="CYME_CMQ331C"
                     /product="similar to DEAH-box RNA helicase Dhr1"
                     /transcript_id="XM_005538173.1"
                     /db_xref="GeneID:16996281"
     CDS             849094..853617
                     /locus_tag="CYME_CMQ331C"
                     /codon_start=1
                     /product="similar to DEAH-box RNA helicase Dhr1"
                     /protein_id="XP_005538230.1"
                     /db_xref="GeneID:16996281"
                     /translation="MIEATAVEVDREGNHGQRNRWHRVPKRRRQAVPAAALKENAQRR
                     QETAAKRGLERHAERERYFAILGSQMLSSSLRDQLLPSQALSGHKRRRAGPEVASHPH
                     PPERTEAERAPTPTATAPKHLSQAPVQKRFRSRQHQTPAALAARIGSDPEPGTDTPPE
                     CSKANARTSVVVRCESGHPVSMPEPKDTQNLCEMPSHAHSDVMVDRTDATLNTLAGIA
                     VCSPSSALSIDTRLQTSCETTRRASNVSSSSSSSLMLAPSITDVDNGRTTAEQTSTGK
                     LSLALVSLPNQGAYCQHLYQHRQEMLAPVHHEDDDGYAAVVPVAHGLPAAAYRRDSVA
                     APAPRSFYVTLERTADIQTRRASLPVFELEQEFMEMVRDRDVVIVVGPTGSGKTTQIP
                     QFLYEAGYGHPDERRRPGGSVAIVQPRRLAAVWCAERVASELGTEILRQTREDETGGV
                     RQPVQLGVQVGYHVRHDRKVHDEHTRLVFVTDGILLQQLAEDIALRHFGCVVLDEVHE
                     RSIQMDLLLGLLSRTVRLRRSPAWQSAYPNIGPLKLIIMSATVDAESLARHPRLFTSA
                     TSAMLAKLPSGSVPEMPRSPATRSEALRVSSCAISDVPSVSSEATLCCFAKASDAGVS
                     SPDAEAHLLPAVAPQHAGSDALDTRHTQPASVAALQALRAAAEADAAIAAGRSAGDKP
                     EAGAASAPAVLVVPGRQYPVTIHFARQTHRDYIAAACEKCLKIHQRLPAGHILVFLPG
                     RRAIAQLCASLRKACRGTCERPLHVKPLYAGISRVAQEALEHAVHGTERVCIVATNVA
                     ESAITIPNVRYVVDSGLVRRVMTHAYNSEGVSLHQVTWTSQASAQQRAGRAGRTAPGH
                     CYRLYSVATFVNLFPATDTPEIQRMPLESVLLFLSRLGIRHPLRFPWVTTPGAAALRK
                     AHWVLRVLGAVQDERASRHVTSPSVEERALAAPSAAPDDLSLEAPTPLGIAMARVPVS
                     ARLARLLFWVRDHSPDAIRYGIRLVALLSVREIMSSGSGSGSGTLPLANKDSSESASG
                     GRYAFRRALYHPQSELLTKLRFLGAAEYAWRAEGGFRALTRFCALYGLQESTVREALL
                     IVQQLERRADRFLGKQCLDDLAPNGTAETRPEGSETDGCKRPQDVRDLAAGCFCGSEP
                     DPMIDDDDTETEADNDNDDGIPFQDPSVHVSKGQRRGFVCRWGDEPLRPPSPEQEQTL
                     CRALLAAFPDQVARRMHTEEAKDWRQQHSGVRTNGVLFRCPVWETKDCESVEGVVARV
                     SPCCPVDVSGDEVQYLLYTEVTLEELEPSPDPATKSPATVATLRGSTRIEPAWLTTLN
                     HPCLVRYGDVVAEPAPKYDAEADQVMAWVRCLYGREAWTLPLCWMPLPAFTQDPLDGQ
                     IEDQRERRICIFARALLERQVLPRLPPPAIQHALQPSPAVLTWGLEHGERSTSGDRHC
                     NLGYRRHRAAVLLVTALKRYDITSRQALFRQWRRDPFYLRYEFLLWVPAAHQGMIQQQ
                     WTTLTQQDAGCSV"
     gene            complement(<854028..>854480)
                     /locus_tag="CYME_CMQ332C"
                     /db_xref="GeneID:16996282"
     mRNA            complement(<854028..>854480)
                     /locus_tag="CYME_CMQ332C"
                     /product="unknown heme-binding protein"
                     /transcript_id="XM_005538174.1"
                     /db_xref="GeneID:16996282"
     CDS             complement(854028..854480)
                     /locus_tag="CYME_CMQ332C"
                     /codon_start=1
                     /product="unknown heme-binding protein"
                     /protein_id="XP_005538231.1"
                     /db_xref="GeneID:16996282"
                     /translation="MLPIASTATQMGSNKTRIFARQPAKAPPPLAWLSRPRDPRATAI
                     AAAGQQSSRRVSKRELESHGSATDAWTAIHGVVYDITAYFRFHPGGAEILFIEAAGKD
                     STAVFDEMHPWVNVAWLLKDYRIGLYAPESEDDGGDDDDDDRTMTSPE"
     misc_feature    854618..856679
                     /note="possible transcribed region"
     gene            complement(<856177..>858153)
                     /locus_tag="CYME_CMQ334C"
                     /db_xref="GeneID:16996278"
     mRNA            complement(<856177..>858153)
                     /locus_tag="CYME_CMQ334C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538175.1"
                     /db_xref="GeneID:16996278"
     CDS             complement(856177..858153)
                     /locus_tag="CYME_CMQ334C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538232.1"
                     /db_xref="GeneID:16996278"
                     /translation="MKRSDVVRQTKSNERISPRLAPGMLLGSGTDTDPERVPIGAASD
                     PAGTAGGVAPGMSIDGAKDAPWNAPAGDVSMASREQAVADLAFPLTSQDDTVGGPEAS
                     EGVSTDAGQCSIVFRLFPLQLCLHPSMTHPTRVSKNALGSELTEMVKKCTTFRPLVGS
                     VCEIVTGREHAEATHSRIGMTSFNRMFCLQDASPMEWHAGETANLRLELAHGLPYALE
                     RFRVRVEMRDASETMLLLERLDETALPPERCRAWSLRLPFETPGEHFVSCQLLLAQPS
                     AGLQLSTHRASPGSAFAKNATPISPTATPMTSFQQTFRFQVSDAWQLEGYALAWGSTT
                     LDKRSERGRQTFLWLVNIQNTSHEPLYLLAGQCRPDAPTFQGSEKPLEPPETVPYIAS
                     PMETQEKAPFSAGPSPASGATASTSSWKLMPLRFRTKAPLLSPGDRARFVFMLHRRPA
                     SSKSANSAPSLDTPFHPGSVSIQWRTTRGVLGERTWVALSTRWLPQQIYFSPLPEIPE
                     GTGTSSPYRIVLQFCRPAARIRLETPFEICYTIEVNWSVPHKSGSKTLQTEFSAVGTE
                     SPCGVLHLEAETLPGTLLPIGNCTRHLVSLYSASACSIRFWYFPLREGCFPIPRLIAR
                     ESDQSGNTAAKAAYLLPVSTRRLPFGHCLLYIHR"
     gene            complement(858441..860259)
                     /locus_tag="CYME_CMQ335T"
                     /db_xref="GeneID:16996279"
     misc_RNA        complement(858441..860259)
                     /locus_tag="CYME_CMQ335T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461572.1"
                     /db_xref="GeneID:16996279"
     gene            <860429..>863701
                     /locus_tag="CYME_CMQ336C"
                     /db_xref="GeneID:16996308"
     mRNA            <860429..>863701
                     /locus_tag="CYME_CMQ336C"
                     /product="leucyl--tRNA ligase"
                     /transcript_id="XM_005538176.1"
                     /db_xref="GeneID:16996308"
     CDS             860429..863701
                     /locus_tag="CYME_CMQ336C"
                     /codon_start=1
                     /product="leucyl--tRNA ligase"
                     /protein_id="XP_005538233.1"
                     /db_xref="GeneID:16996308"
                     /translation="MATTRRDTLLKIQAEVQNWWEQEHVFDVDAPEDFDAEGGWSSLG
                     VEPRQKPTFFVTFPYIYANGPIHLGHAFSLSKAEFAVAYQRMKRRPCLFPFGFHCTGM
                     PIQASATKLARELETYGCPPQFPDTPQRTGADAGLDAPVDGSVGLKSKVLAKTGGLRF
                     QYRILQAVGVPDTEIPSFTDPFKWLMYWPPIGMQDAKQLGLHVDWRRSFITTEANPYY
                     DAFVRWHFEKLRAQGRIKFGKRYTIYSPLDRQACADHDRASGEGVQPQEYVLIKMQVL
                     EPFPAVLEPLAGRRVYLAAATLRPETMYGQTNCWIAPDGSYGAYEVNADGDVFIVTER
                     AARNLAFQYWSPVYGETRCLLGPFPGAALLGAAVRAPLSSYEHVYVLPMLSITSDKGT
                     GVVTSVPSDSPDDYRALQDLKEKPALRRKYGLRDEWVLPFEPVPIIQVPEMGSLSAQA
                     ACERYRVHSQNDRDALAKAKDEVYLRGFYDGVLLVGPHAGQRVHVAKPLIRQLLLDQG
                     DAVVYSEPERPVVSRSGDECVVALCDQWYIDYGEEQWKQLARTCLEAMETYHPETKRS
                     FEAVLEWLREWACSRSFGLGTRLPWDPQYVIESLSDSTIYMAYYTVAHILHRDLNGQV
                     PGAAGPASQLTPAVWNYVFLGQGDAESLPIPSSVARAMRREFLYWYPLNLRVSGKDLI
                     NNHLTFFIYNHVAIFPPDKWPLGVRANGHIMINNEKMSKSTGNFLTLAEAVRNFSADA
                     VRFALADAGDGVDDANFQVKTADEAILKLTTLLALATEAQALLKNGQMRSGQPLQFWD
                     RVMEAEVDALVAAAAHAYERLEFRDALKFAFYELQDALGIWRVAVGGDTDLTKLHHEV
                     WRHYIHAQVIALYPICPHTCTWIWRRLLHEKSPAPPMHWLETSPLLGSPERVAIRAAG
                     RYLQALLHRARLVLQKRLAHRSQRAGDAAAPTASTSTDDKEERERDPSDQVGARAVRV
                     RLVVRTTPTAWQTRCVELVQQAYDPTTQSFAADLPKRIASDPVLRRVAKRAMALAMTL
                     RERKDFTVALEFDEKAVLLENLGYLAQQLGVHEVELDVDGPEAEQRGVIMGEPVILVF
                     DA"
     gene            complement(<865199..>867160)
                     /locus_tag="CYME_CMQ337C"
                     /db_xref="GeneID:16996309"
     mRNA            complement(<865199..>867160)
                     /locus_tag="CYME_CMQ337C"
                     /product="2-isopropylmalate synthase"
                     /transcript_id="XM_005538177.1"
                     /db_xref="GeneID:16996309"
     CDS             complement(865199..867160)
                     /locus_tag="CYME_CMQ337C"
                     /codon_start=1
                     /product="2-isopropylmalate synthase"
                     /protein_id="XP_005538234.1"
                     /db_xref="GeneID:16996309"
                     /translation="MWQAYATIAFCGPSWTSHRTISSVRKECFGHVSDQASRAAFTFP
                     FASRRGVPRAAGRPRSRGLGGLRTRDSLQRLLMIGNAVSDASARAERPVVRVPVKPTA
                     HDVATGRDPERVRIFDTTCRDGEQSPGAAMNAEEKLTLARQLAALGVDVLEAGFPAAS
                     NGDFEAVRRIAEQVGNRPNPPIICGLARATAADIKRCWEAIEVAAFPRIHTFIATSDI
                     HLEHKLRKTRAEVLDIISEQVRYACSLCKDVEFSAEDATRSDPEFLYEAFRRAAEAGA
                     TTLNVPDTCGYITPNEMYTLIRGIYENVPGVRTGDVILSVHGHDDLGMSVANFLAACE
                     AGARQVEVTVNGIGERAGNASLEELVMALYVRRNYYARVFGRDDIASGHSDRQLTNIQ
                     FREIAKTSRMVSSLTGMVVAPNKAVVGANAFRHESGIHQHGYLRNASTYSILSADTVG
                     ATTNAISLGKLSGRAAFRARLTELGFELSDDDLNRAFLRFKELADRKREITDADLEAI
                     VSGGLKEIGVEHFKLKRVQVQCGSSSIPTATVTLLVMETGKEVTVPRTGTGPVDAAYC
                     AVNAVVAQHGLDIELLEYTVSSVTSGIDSLGEVMVRVRDRRMDRIFTGYAADTDVVTA
                     SVQAYVNALNRCSRNTNTPQPIHPQHSSA"
     gene            complement(869355..871975)
                     /locus_tag="CYME_CMQ339T"
                     /db_xref="GeneID:16996310"
     misc_RNA        complement(869355..871975)
                     /locus_tag="CYME_CMQ339T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461573.1"
                     /db_xref="GeneID:16996310"
     gene            <869658..>870365
                     /locus_tag="CYME_CMQ338C"
                     /db_xref="GeneID:16996301"
     mRNA            <869658..>870365
                     /locus_tag="CYME_CMQ338C"
                     /product="similar to ATP-dependent RNA helicase deaD"
                     /transcript_id="XM_005538178.1"
                     /db_xref="GeneID:16996301"
     CDS             869658..870365
                     /locus_tag="CYME_CMQ338C"
                     /codon_start=1
                     /product="similar to ATP-dependent RNA helicase deaD"
                     /protein_id="XP_005538235.1"
                     /db_xref="GeneID:16996301"
                     /translation="MQQRNQLAPLPLHRLQGGQLWCVAATMTRGSLAQVEALARALTP
                     SRKLFIARDNGLHEPPRIVRIRFELVQHPPQKVTRLLEWLQADARGLLRDGKSTLVFC
                     NSIQTCRFVQHTLREQGVLALACHGGMPTRMRDAAVEQFANGTADVLICSDLMARGID
                     WPFVGRVLSFDAPATYHHFLHRAGRLRRGGDCITLIRRARREQDLAMMIAKRFPERTH
                     WQVMEQQPSLGRDRLRP"
     gene            complement(871085..873419)
                     /locus_tag="CYME_CMQ341T"
                     /db_xref="GeneID:16996300"
     misc_RNA        complement(871085..873419)
                     /locus_tag="CYME_CMQ341T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461574.1"
                     /db_xref="GeneID:16996300"
     misc_feature    871540..872282
                     /note="possible transcribed region"
     gene            <873647..>877303
                     /locus_tag="CYME_CMQ342C"
                     /db_xref="GeneID:16996302"
     mRNA            <873647..>877303
                     /locus_tag="CYME_CMQ342C"
                     /product="similar to chloroplast inner membrane protein
                     Tic110"
                     /transcript_id="XM_005538179.1"
                     /db_xref="GeneID:16996302"
     CDS             873647..877303
                     /locus_tag="CYME_CMQ342C"
                     /codon_start=1
                     /product="similar to chloroplast inner membrane protein
                     Tic110"
                     /protein_id="XP_005538236.1"
                     /db_xref="GeneID:16996302"
                     /translation="MQSPAEALSQQHAQGWHFTRGPFAVLGFVNLFPAGAGSNFATRN
                     LLRKGRCSKQQLRGKRWCCVRGFRVERQSLQAAAEVPTPYRFALGRAPVERAKAAGPI
                     SQQHARSEEELNELVAKRFLELVRSEGTGPVGVPAQLVKPAWLEWSDRMATRLAGLGQ
                     VWRVLFSVLLAATIGAAAAGVTPPGRRRAAGFAAGALPTAALAVVMLRRGRSIGAPRA
                     LASALVESTVAVSTKNMPSASDDQRRRADDNGGEDTESDDNGATSSNAPPRLGLASHI
                     DPEMIQRVAIQYGMQPDAPSWKLETLVGLYERYLLALVQTSGTPRVSEVRQLKALRSA
                     FGLSHVDVGDAHHQVAMRFRRENFVYIDDYIRAQDVDDRNYDEIFRERAQDVNQKLSK
                     LLFLSARVLDDPTEPEEAYRYEMARLRNVFDLSESEFQARVRDIAVPFYQTAVRKAVW
                     LLEQGRSITLEKLRSAREMLDVDDGTASRLHLEAYGALVQRLLQAHSNEKVPRLSAKD
                     MSVLQEARRLLDIDAGDADALLRDAAEPLYQQEVERVVESADLRIPTAHGRLAVRREE
                     LGLSVELARTAAEKWIRGRVTAILKDATRALRVQNLTMTIEELNRLLGLIRRSLSIIH
                     GVVWEEVVPNSAEQRTVNASLERIMSVLLDELADLERQQLYRVYLAKCLEDRMIDAQE
                     GRNLDDLRAVLRISENEAAQAYNRAAGPVYREAVLEVMANRSEFTDADIQSLNQIAGD
                     LHIPAKVAHDIRMELYRERLEASTRDNRVPSEEESSQLARLRELLQLDSEALAALHAS
                     VCAGTYAQSVDECMGSNGIIPEPYRAGLERLRQRLCLDERRARELFLQVARRRMAGYV
                     QRAIKLLQKKQSFRGQDEERDVGDDPFVRRAGAFLGIEAGTITIELSNLIDFYIRNGI
                     LEMENEQAVYPVNLRGVFDLNILQEMYRQYLIQSFAAKSRTEKERLFNNLAHLGNILG
                     LTSAEVNAIHSNIGSVIYKTYASQALTNNRLEEKDIEFLRNIQNMLSMDEATCRTLLQ
                     ETKEARAGFLFDKIFSRTFGMAEAVAEFRRVCRELDVDPVRDLKLTEDRRVRAFRAEI
                     EHAIENGLITPENQSLLKESQEELGISAEKARQVLLDCIQDRCEALIVQAAASLRQRR
                     QEGAARDLSRALRFGKLLPFQVQTPTVTGAERQELYLVYQAYALGTARSNAENDQVKE
                     DLALLREMLGIQAA"
     gene            complement(<877561..>879366)
                     /locus_tag="CYME_CMQ343C"
                     /db_xref="GeneID:16996304"
     mRNA            complement(<877561..>879366)
                     /locus_tag="CYME_CMQ343C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538180.1"
                     /db_xref="GeneID:16996304"
     CDS             complement(877561..879366)
                     /locus_tag="CYME_CMQ343C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538237.1"
                     /db_xref="GeneID:16996304"
                     /translation="MQQKHGPDWHRLLQGPWLLWPLVDRTLQTNPAAAEALFRWLAAV
                     PSDTAQRVRLSALPARVQRHAFLILLRYPQCFRQDKVHFLLKDYILDRVDAVLQTGVK
                     VQRRTPGELCTDKPTKPLQSGQLGAWTDENVLRTSQSSTHRPQHAVANAAFVLEQPAG
                     VPVAENPAYHDTVDTLLKRSGSANETSGDDTTILSDIHSRTALTRNDLGMPRQGRLRA
                     LSPAPLPLPLTMPRWIAGRCAACQSCLHDRMGEAFADDPYMKILWEQCWTRFGEPPDS
                     EMHQGKRIKVAEAVPLSTEAHAPPPASRTSNEGEDVSPGSPHVVADQGALRAPCSPNM
                     RGEDAQQVLEWLRKLREDDLGSKEPSPPLAIDRLRTAADWEILDAQSASSVDLLYCLE
                     TMLKLPERVSVCCIESGTRTFLLRLVRQLKQPAPRSVLGVVRSLQRQCPRILLEQLLY
                     PLLTCSATCQGPSVACLQPLGAPQAELCVQILEGDWEPAFRREMLHELLERQLCEPWT
                     EHTLQVLECSLKRLQPAVLDSNVGARLAQALEAHANAPTLQRAGLRFAKLVHLLLNRY
                     PAVVAEQRLVLIAALQQAPASFLRESALRKLQAPT"
     misc_feature    878941..880737
                     /note="possible transcribed region"
     gene            complement(<884284..>886059)
                     /locus_tag="CYME_CMQ345C"
                     /db_xref="GeneID:16996306"
     mRNA            complement(<884284..>886059)
                     /locus_tag="CYME_CMQ345C"
                     /product="GTP-binding protein of Nug1 family"
                     /transcript_id="XM_005538181.1"
                     /db_xref="GeneID:16996306"
     CDS             complement(884284..886059)
                     /locus_tag="CYME_CMQ345C"
                     /codon_start=1
                     /product="GTP-binding protein of Nug1 family"
                     /protein_id="XP_005538238.1"
                     /db_xref="GeneID:16996306"
                     /translation="MPGNRKAAVSGSVPKDGLGRALTRPRKNLSGRAYRRQRQHELED
                     SSLLLLPESEAAASVLDRVQWVELLARAELAGRDFTAEPALPVQNVVSEPRLVSSTDA
                     IAETLRGAVPALDGPSAPDHGAELPLTIPERPVWNRGMTAEQLAASERQAFHRWRASM
                     DALEQQLAQERQRGSLLSRFFTPYEKNLQIWRQLWRVLERSELVIQVLDARHPLLFYS
                     PHLERYLQKRHPEKKCILLLNKADLLTPAARRAWKDYFAERNQTAWFFSALYPEGEKS
                     TLEPAEGDESRSESGICADDHAASGITEIIRNSLLLNGAPAGANGSAYSIQGSPLHQT
                     HEAETWSEPREAPDAQRTRHSSVSGDPQKRSPNANHENDVQASNLCSRTQLMNLVRRL
                     LSTIEPSQTSSGPRTSPQHRRTVGFVGYPNVGKSSTLNCLLGKTQAAVGPNPGKTKHF
                     QTLTLDEDLMLCDAPGLVFPQWAHSRAELICAGVIPIDHAGDLLDAVQFICSRLPASK
                     LASHYSLTLPPKFNRTAPEKVHCDAATFLDTLALARGFRTSHAQTDRHRAARLVLKDY
                     VRGDLPDMHWPPVPADGVGKSTEAL"
     misc_feature    886221..887373
                     /note="possible transcribed region"
     gene            complement(<887379..>889571)
                     /locus_tag="CYME_CMQ347C"
                     /db_xref="GeneID:16996297"
     mRNA            complement(<887379..>889571)
                     /locus_tag="CYME_CMQ347C"
                     /product="probable D-lactate dehydrogenase"
                     /transcript_id="XM_005538182.1"
                     /db_xref="GeneID:16996297"
     CDS             complement(887379..889571)
                     /locus_tag="CYME_CMQ347C"
                     /codon_start=1
                     /product="probable D-lactate dehydrogenase"
                     /protein_id="XP_005538239.1"
                     /db_xref="GeneID:16996297"
                     /translation="MFSACASTVRKLVRVAWKQRSLLVTSTVGSAALVTYAFYTNEPV
                     RAQKLITRPAPHPAGNQPPKASQSAAKPQHELPYAERLQKAVARIREAQPQLDISLDS
                     SHLESHARDVSFHEPHLPDVVIYPRSAEEVAAVLRSATEFRIPVVPYAGATSLEGHIV
                     PRFGGITVDCSQMNRILAVRPTDMDCDVEPGVPWEALNEHLRPYGLFFAPDPGPGACI
                     GGMIGTSCSGTNAARYGTMRENVLSLEVVLPTGEIVQQTRSRARKSSAGYDLTRLFVG
                     SEGTLGIATKATLRLRPLPAYRGVAKCTFERLEDAAATVQDVLGPPLAVSIGRCELMD
                     RLAVQAVNLSTNQELELDESRHLLLFELVGESMQVIREQAHRVKMCAERHHVHEWRMA
                     AAPHCLESLSRPAEADKPQTTHVDALHTNAALRANLDGAGDARVETHPGSAEHPEVPP
                     PATANHVAADAFATASVQMPEQRGRVADAVPRNRSTSEVGGQTQAPTWLVPESPDDRQ
                     EIAASRAASVEDIATFDPAPGAWPAQQPGKQLTADDMDAAERRLLEERERLWRSRKVA
                     YWSAYELRPGAEIWTTDVAVPLSKLADVLRETQQDIEQTNRAYTERHGSLVPLVAPLV
                     AHAADGNFHLLMLVDPKDPVELERAQQVNDRLVQRAIAAGGTCTGEHGIGEGKRQYLV
                     PELGLEAVDLMRRIKATIDPAGIMNPGKVLPPEVGDTGELLLHRSYEA"
     gene            <892025..>897100
                     /locus_tag="CYME_CMQ348C"
                     /db_xref="GeneID:16996298"
     mRNA            <892025..>897100
                     /locus_tag="CYME_CMQ348C"
                     /product="eukaryotic translation initiation factor eIF-4F"
                     /transcript_id="XM_005538183.1"
                     /db_xref="GeneID:16996298"
     CDS             892025..897100
                     /locus_tag="CYME_CMQ348C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-4F"
                     /protein_id="XP_005538240.1"
                     /db_xref="GeneID:16996298"
                     /translation="MEKSSLQPSSERPVGGAHCDAKRQVAGSAATGTGAAGVGGSAAL
                     GTPSSQSGVGARTSGYAAIVSRGSATGGGGAVASHPSGTTPVDSGAPGGNGAAVQHKI
                     SIEPEGPTAATAVGRSTAGVPAGGGGAAQTFAPVDGRMPVNPGTMSPWSSNIALATNS
                     TNWGGAIPAAVAGADATSGRGGNAAAYGGGMVRAPPPSTVGSIARPGPAAHHGRSPYA
                     GASSRPSASTRGAPAAAFARDGTSSAYGPNVVYGGGSGSGGISHMGAMGMTSFSGATA
                     YMNPNEMAAYMPDMQQAAGFNMYVPPQYYGGLRNPMIGGTEYIPYGMPFNPAANAAAF
                     YRQQYQQQARAPMNTGVATSSDRSVSPLAGNSSNTNGEIDVQTATVAAPPSGSVRSNA
                     HASSVATRAAGSTTSSPSSSGEVAPDAMGILPNLGITGEGTVLMRAGGERNVTGFQGF
                     ASSAAPMNREVDRPLVPPIPPRREKKILKIVDPETGKEINLGSVQEELATATGHGQPA
                     KAPDAKAPAAETSEEERAPQVPANSAAEETRGPEVSQIEVEDGLARGPDAASSGIRKQ
                     PVEHGLPATPLPESESLDRPNEKESLGATRPELEEFRSAAVRAQFDSANFAVHSETRD
                     RFDVRVEHDSASTAGLLQPENTSTGMVSDAGDVKSVVSAESAKVDVSTQNGYFESPYR
                     EVSPAIAVQDTLEPSSTRVAETELVAMTKALADVRIETQEDRTEASEQQKAPSTAEPS
                     AMDTVHAEARTAATAQRDKPSEPTEEADMDSSPLEMTPHESDREDILSTVDTEPVPDD
                     ASESSSLVDDEETTHPGVLVFGPGERRMYPREWLLRMRDICVECPPEVHQCEIRAGAS
                     FESVQQRRSGGGGGGGGGGGRARHGTGGTASSRGAPGAGKGDGMDLANARARAPPVAS
                     TGGESDRRGHRGGGGRGNRRGANAAVIEEALALLPRAENAWRPRKVPESEVERKVRTV
                     RSILNKLTLEKFEPLYQQLLSINIDSLEVLRGVVKEIFEKALLEPNFGAMYAELCARL
                     AVDLEKVIEGNEAFIEDGKLQTFKRILLRYCQREFEGNSSPVIPEGASPEEAQEIATK
                     AKLRMLGNMVFIGHLYRNKLLSDKVIHASCFATLLKLSNQPQPDEDAIECMCKLMTTV
                     GEKLDNSNPKSRELMREYFAKFVEMSQRPDLPARFRFMLQDLIDLRNNRWVQRRSDGG
                     ARTIREIHEQVRREQLQQQQLKRRPSGLLLSGPSGRRIPGSAGNGPGSTSLGGGGASA
                     HAQTPSPRMMTPVMSNDARRERSSSALQPGWERVQRAVPETKEAARALDLGTVRLRPH
                     GGRRSPAPSAASTPSLGTPRNSFAALQDEQMPLSPEPTSGTDEVDSEQPAAGIAERSE
                     RSSAHPSATQADEMEKIPEWEPNRVERRAKTIYDEWMALRDVKEARLALAEVPPRSRA
                     ALVANIVQRSLDLSGEQREHLLRLFTETVHARLVPLDDIATAEPVANDTRSGADASAR
                     VAPDQQTPLPGEHSNSSLVRPLEPMHLRRATTLILADLEDLVIDHPRALSFLAHWLAH
                     CLVQTTVAADTQEQRAQPQGAGVSLWGRPVTARDAAAALRELLLPVVDSWLANGSDLA
                     LPLVAHTADALRTRSPLFTDDQLAAFLRALALPWAAWATAATGASGASATDQDVSRHI
                     RAEFARVGLETVWSNVASAAAAD"
     gene            <900350..>906451
                     /locus_tag="CYME_CMQ349C"
                     /db_xref="GeneID:16996299"
     mRNA            <900350..>906451
                     /locus_tag="CYME_CMQ349C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538184.1"
                     /db_xref="GeneID:16996299"
     CDS             900350..906451
                     /locus_tag="CYME_CMQ349C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538241.1"
                     /db_xref="GeneID:16996299"
                     /translation="MTDADLAASSHPLWPRWKGLVRFLRSSRGALPSAQPAARLLRTS
                     HRLTRTLTDEADVQLDVSGSRFLLTRRIPDVEPNRFQWLIYVGDCSTSPGTVDRDPAG
                     HLLRLWTAEPLVPAKSSGKKRRWPWQRRDDAPDWRYVFALDPAGRFVYGLAVSDCTSC
                     RVDWASIETLNSNGMREEAVAASVKSRWLRLGPGEDLPESSTHGDRLVHWCIQPATQH
                     ARGNGEPASQVVSSAAPIGCKVEEAGMPRETAAFHVYTAAGWHACWTLDRVSGTPSSR
                     PVLVESLDARICYGWQQQQSESRCLESWLLAYRERDASPKEWLLFSGSPLCQRAVWSD
                     PSGFLAEEIDFAVVFAHGAFLLCGSHTRKRVALFDLRPGGSHPLRWTRASMEQEQEQQ
                     VAALVLWAVPWGSDSVLVAISHENGDRSDPSVVGRLECWRWDLLDPGTTSEPERLFVI
                     DWTSLVRDTDADVGSAPPPSEYGCAASTLAPNVQTGADSNATASATTTTAALEAQTPA
                     RRYRWTWLGWRVPRKQALRQPAEALDPAAPTLVQMCAVGAAQALALLVDQHHGYVVYL
                     EQPDRASALAEVLLEHDSDTCTALMQAMHIPAPMEALLRWRCSPRDADAARALVAALP
                     TEWRWAAAYEAIQNRAATLSAARVLLRAVNAAQVPRMVAEVAGLSATLVSERAFLISA
                     LSADALSAEHCRVALLLHQRAGWDVVLEYLGACSATAALRVLLLDEQEVSQQQQPSIL
                     DRVWKATPLTADPQQCTALIEAKFQQDRDPLKTVDYFREHAGRLDDATGSLRLVHRLL
                     AAVMTVLDASQASLEPASSVASARSSATEFLQQTLRLREALQWEQLQPQVENLSLLEF
                     ARMDALQVLERLLKASLQAMQTGRALQEASMLREVLESDLVMHMLEGVRALDAHQFLE
                     SALEAAFMNDARPLDTRFGAVQIEGWCNVLCELLEASRSCKLCRKLDWRDAYFQNWCW
                     SWLARALLIRVALTRSQVARLAAALRAHDEAEPMLESIALSEMLSSDTPDPYERLQLR
                     QWLWQARQEQLQRPSSRLVAGEWRKRLISGYATAAGMQASDSLDRLEALLEIHGLQLD
                     CRERLSGLLAAYRRNTALVTHLVACIEQCGASEVTDAASLLWQVALFCFKEESYPVSC
                     TEQLLQYGAKTWRSGSPALQARIRALLQTARMVLALQELGLPTLHPRRLAWEARPAAW
                     LWHFSELIQRSETRAGEPELQQVAALGHLDTATAWLLARRTPDTPSVLDSMMYYPPDA
                     VAWLRSNCREAALHSSLQRGYSNDDMDASRYRLSRLWGTLARRLLDEAEPFRPQVQQL
                     IFDQLTAKGALPLDLAWIQRYYGGEPSVDHAVQVACTAPVSTIAAEAWRYRLTVPAIL
                     YRYPLEQLDPTSWLDTSIALWILRQPADTPVGRAPFLPPAGDVRLHTCGMLQHWASEP
                     AMPTAAQALVLKFQRAAEAFCEAFRWVSQVMQHPALEQDTDLCERYVRRFLEDASYRE
                     TVVVAALAHTTDEGRLAVLIQPEIDAAARLGVSSAQCRLEHVRWCFEQAQRAGAAAGA
                     AGATAAAAGVVDVVEATAPRSPIRGSTLSSVESPARWHQEHALVTLLVQHDGLGQALL
                     ALTNEHLEAMAQKAPHPLVYLVLASTERHPRAVALSEALREHVVDMALDWASLWLLFT
                     ANADAYGPLATYLCERSATDPEAGLQLWRLVAICVSTPAPLLAAAVEGFLSRASSAEQ
                     VYRWLLETTRHDDDAVRHELLGVWAAALVQCGGRSVGTAAAERSRIFEWIDGFPLDTM
                     RGGEELQCESQFLVFFVRRVLEYMEALWNDRVLASARVSAMLCERYASACSAAFQASL
                     GSGELSPAVLNTQDSSLGARAERSADRLVVEQTLAWLRTLSTAELQQWQPRLHAIFAI
                     ADATVSLTVPEAAVPARDEAQRRVEQEESNADASPVLTSDSASNESTEDSIVAGILRG
                     NIWQAGSTLLQRRRWSLVYGNTPEAALVLLQRHLEEALATSSSGVEASRFASRSEVLR
                     ALAVVSEWRTALGLPDT"
     gene            complement(<907059..>907667)
                     /locus_tag="CYME_CMQ350C"
                     /db_xref="GeneID:16996316"
     mRNA            complement(<907059..>907667)
                     /locus_tag="CYME_CMQ350C"
                     /product="probable 1,4-benzoquinone reductase"
                     /transcript_id="XM_005538185.1"
                     /db_xref="GeneID:16996316"
     CDS             complement(907059..907667)
                     /locus_tag="CYME_CMQ350C"
                     /codon_start=1
                     /product="probable 1,4-benzoquinone reductase"
                     /protein_id="XP_005538242.1"
                     /db_xref="GeneID:16996316"
                     /translation="MAPKVLVLIYSMYGHITQLARHEVQGVKKAGVHCDLMRVPETLP
                     EEVLKKMNAPPKPEDIPVLQDPAKLAEYDGILFGYPTRYGQSPAQMSAFWDATGRLWM
                     SGALQGKAAGIFVSTSTMQGGQETTALTALTRFVHHGMIFVPLGYADPSMMDMSQVHG
                     GTPYGASTFAGPDGSRQPSEMELRLAEIQGERFANFVKKIAS"
     gene            <909702..>910469
                     /locus_tag="CYME_CMQ351C"
                     /db_xref="GeneID:16996317"
     mRNA            <909702..>910469
                     /locus_tag="CYME_CMQ351C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538186.1"
                     /db_xref="GeneID:16996317"
     CDS             909702..910469
                     /locus_tag="CYME_CMQ351C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538243.1"
                     /db_xref="GeneID:16996317"
                     /translation="MDEISYPPSEDTYLLIDGCRSWFQEHGIRAAHPRTRPVLVLEVG
                     CAAAFVLEALATDVAWLDGPQASSHAENCGLLPLLPFFIGSDVNLAALYQAQRRLAAT
                     LPIDLVCGSLMTALRADVFDLVLFNSPYVETSADELAEAQRCRDLRAAWAGGWLGLQV
                     AAALIRQFMVTPTAALTSEHHASAWLLLVTQDRTWWHRAFSNQFAFFVKQRRAGDERL
                     LVLALSRSQASLWYKWIWQELRAVDDSDRMSALVDME"
     gene            complement(<911743..>915849)
                     /locus_tag="CYME_CMQ352C"
                     /db_xref="GeneID:16996313"
     mRNA            complement(<911743..>915849)
                     /locus_tag="CYME_CMQ352C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538187.1"
                     /db_xref="GeneID:16996313"
     CDS             complement(911743..915849)
                     /locus_tag="CYME_CMQ352C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538244.1"
                     /db_xref="GeneID:16996313"
                     /translation="MGTEEDTEGIVHAAIEALKSCDCDRGRVKHGDTVCTRLSHIWET
                     VLCKVPQLHTPVGEPLLKRSVWQQWCQAVARLASLNPLKRAQPPMRGVLACVLLECLR
                     ISAPKIPFDDETFQDVLQVCIQTLEDLRIPVTHQSGRPVTEGADGPEPCSASSGSVPT
                     SQTGEVAEGHRWSLRVLELAAKTKVFVLAHACQVGSLVELLMSAASNITLSYRCKMQI
                     AEIISSTLVEQAQETDPWTGSLDTITRVLDPVLTALNVQLPSVFLAATESQMLSEKPS
                     SVHTWRFSARNIAEQIVQRASEVLKDPLVRYLRELPAEKRYSLIESLYFTAPGVLQGV
                     LPDLSAESRARDTQTRLRCVQLIAKLFARHFSNISGSGTLFNDSNTVSRSLFLDLLER
                     FQDVEAGVRAGTVCAVHDLLIQLHRHVDQGALSVKDGPAESKVVTGTANPLVEQMLNE
                     LDRGLQDRMLDQDEQVRLAAVRTVLSSEHRAARLALRIVAHLPLASTTCLSRARDKRA
                     AVRHTAIQGLSRLYRAFLRWHHEQVQNTASETIDERDSIPPKVHEWISQLVRELLASY
                     IQLTQVGCAGNVPTDEMIGSIVQIEALFYDPRMSIADALSCWREALQDPHAQRINRSF
                     GVHGWTAFPANDALRLMMRARAQFQRDMRALLDMRDEARQRCRLSERSFSDTAASLLD
                     RLARSLGKPATVCNVEDQVCGVRLLLDVMLGRDERVFQNLRLLLHDPGSEYSTNSLPL
                     IRDTVERLTRRSKAAAEWFQALVLLRMVPCLGRPSDVHMLVDIVLGQPEGANAASVEC
                     ALLLEAASCYGGAFHEATLTRLVAAVPHQAALRVLSTLGPCLMNMGIECRHSLARCLE
                     TYLLGQVAEERSFRSLRCIKLAASVLATLWASDALTPSWERIVPQLESRSFEALKSGN
                     YDECACALTTMAKIVRCAPNTVPVPTQIQILDVCLQLLTERPPDVGEPLTVASIIAAC
                     SILMSGFTALPGNASAQRSNAHGHSLEADAHDPAASSLQVRAGWSTAQGQQLASPERV
                     DRFLHAVLLLVLQQGDWKALTRHSKSADELVSAPVPVSDAVLDSEPCARLRYYAAKSI
                     LKLARIRTIDQALLPAERHMVCLLMQDPIFEIRHDFALKLFRGLACGLLPWHWMAGLV
                     LAAIDPERENVTNARWYLTALIRQRRQLVRSLEQQALATATEAAVSYLALMPECVLPY
                     VLHLLAHHPDYLIDAQNAFADNRKYLSFILDTLLEHEQHVGILMQLLRLVSASEIPPP
                     VPPLIGGGNGETHGRHRRSSMIVGEPIAQDLNLATQIMTERVHELALLCTDILKQKQA
                     HKRWDLAEFPGPIRLPGPFFTTKRDVPFAETRQRSGDSPLRSAVALAP"
     gene            <918920..>919273
                     /locus_tag="CYME_CMQ353C"
                     /db_xref="GeneID:16996314"
     mRNA            <918920..>919273
                     /locus_tag="CYME_CMQ353C"
                     /product="ring-box protein 1"
                     /transcript_id="XM_005538188.1"
                     /db_xref="GeneID:16996314"
     CDS             918920..919273
                     /locus_tag="CYME_CMQ353C"
                     /codon_start=1
                     /product="ring-box protein 1"
                     /protein_id="XP_005538245.1"
                     /db_xref="GeneID:16996314"
                     /translation="MSAIEGASKGAIPVEGERAVESGSQYPKKRFEVKQWNAVAAWSW
                     DLRVDNCAICRNHIMDLCLECQADPQNARASECVVTWGICNHAFHSHCINKWLETRNV
                     CPLDNRPWHKLKEGR"
     gene            complement(<920066..>921430)
                     /locus_tag="CYME_CMQ354C"
                     /db_xref="GeneID:16996315"
     mRNA            complement(<920066..>921430)
                     /locus_tag="CYME_CMQ354C"
                     /product="phenylalanine--tRNA ligase, mt?"
                     /transcript_id="XM_005538189.1"
                     /db_xref="GeneID:16996315"
     CDS             complement(920066..921430)
                     /locus_tag="CYME_CMQ354C"
                     /codon_start=1
                     /product="phenylalanine--tRNA ligase, mt?"
                     /protein_id="XP_005538246.1"
                     /db_xref="GeneID:16996315"
                     /translation="MVENWGIGFIVAQRWRTVPAQRLWLPAVNSTHGTLARHLSRGRG
                     ARALRAQSTITKSNIPPHILEKAKATPSEKLHNRVHHPLCTLRKIIEAYFENELGAKQ
                     GRPPVQFAKFHDLPPIVSTRACFDELLVAPDHPSRRPTDTYYLDEATVLRAHTTAHDT
                     ELLRQGYRAFLVTGDVYRRDSIDKKHYPIFHQMDGVRVFADAPSEAWVLEDLKETLYG
                     LAQYLFRWPKNSEADKSPRTSALSDADAAPIPVRWVDAEFPFTRHSLELEVLWQGDWL
                     EVLGCGVIQPDVLRAGDVDPAKHSGWAFGLGLERLAMVLFDVPDIRLFWSSDKRFIKQ
                     FQDGVITQFQPYSKYPPVYKDVSMWVKDQPEASDGNGSTSGRLFHENDLCELVRNLAG
                     DLVEDISRVDEFVHPKTKRRSICYRITYRSPDRSLTDEEINRIQNQVRECIRLEMSDV
                     AELR"
     gene            <924194..>925579
                     /locus_tag="CYME_CMQ355C"
                     /db_xref="GeneID:16996334"
     mRNA            <924194..>925579
                     /locus_tag="CYME_CMQ355C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538190.1"
                     /db_xref="GeneID:16996334"
     CDS             924194..925579
                     /locus_tag="CYME_CMQ355C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538247.1"
                     /db_xref="GeneID:16996334"
                     /translation="MEQVSGTESPARRQGSVPPQLESTAAGFPAAGHRDAPAFATLGA
                     LARERIARTSVSHRQLARESGSVSEESERRPSADALAWQHCCWRAPTERSDAVALFSL
                     SEVFLLIRSEYAPQSVYGWLMLTHMLRMPPETLAREAVIDPEIRAEQASVGDENRTYG
                     GFLELVLFMHVGVALRDALHSRNRNVNEAALECLAHLLHRLFDSDVLAFVDGCVFEDD
                     KDQIGDDYNEEALIDLWASMELRNDSDNPSSRAKHGDNDNDTVDEDAEVGAAGSTAMG
                     SNLYEDYRPTSHDWVIEMVTTGLVPVLLGLFQSKLRQHVIDPRVTRLSYFLIWVLHPC
                     LRLDEGASILKQLLSIALALLERVGSAEPQQTTNSETGPLAAAAQSALMHSLRAAAVL
                     AMDERLDIEESVQHVMEAKLQLWLNHLDLENKLGRQVARSMQALVSIMTRNRRQVTSL
                     SQSVNNELQYS"
     gene            complement(<926163..>928262)
                     /locus_tag="CYME_CMQ356C"
                     /db_xref="GeneID:16996335"
     mRNA            complement(<926163..>928262)
                     /locus_tag="CYME_CMQ356C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538191.1"
                     /db_xref="GeneID:16996335"
     CDS             complement(926163..928262)
                     /locus_tag="CYME_CMQ356C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538248.1"
                     /db_xref="GeneID:16996335"
                     /translation="MASVSDKLWPSIPAHWRHLKAFRERLSEALAERQHYRRQRERLG
                     AAYASQQREASAEGLAPAFVLSSGTEVEQLQRLVQEVFNVLSERPRDARTDAGRLSRD
                     QLRGARYYLPYYAVVRLRTAIDMLLWLHGKYSAEVSEGILAPSQDTIATGTGSKLPVT
                     WSMDERPDIADSRSERARVSLRGAPVRYPQTHREPFPIPTEDMSSRFVLNSLLREAIQ
                     LSDAAFFVERFRNLQVEPGLVEIWHVLVSSLCLLTDAERSGSMDRTARPSVPCRRHEH
                     VLHSMIAIQRWRAAVRLREPASPWFASATCVAFMLFEGFRRASAAFDDQTRALAYFGD
                     LLNIIELMTELPGLGLLQRLSTLRAWELMFLICCSESKLWNVRIPPRQAETNASAVFH
                     AGASFAAGFYERLVRPLHEFRLSEGLDARHTSYAADDALLLAEHCGELAMQTLRAVIF
                     DNAHGAAYKRAVVSLLTQLMFELGQASRTSRTRLTRATLCKQILDASGDDYGVLDGAL
                     LCLPLQRGIDAGGVGVHTPSGGILRWHLLLEPVDDSVTAQHTYIDLLMQRAMVWRSLP
                     RFPWLVLFLVHQVALSSFEQVGYLDRLDQPTRQLVALYRQRMRSSSQPSKDAVPTRAP
                     LVSVSGPGVEEGCGNAHDPETHTTFVQVRAGDVAHAVLSAIHSDTVSAVVQPAQQFLW
                     DVFESASPDNAEACLSV"
     gene            complement(929949..930772)
                     /locus_tag="CYME_CMQ357T"
                     /db_xref="GeneID:16996321"
     misc_RNA        complement(929949..930772)
                     /locus_tag="CYME_CMQ357T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461575.1"
                     /db_xref="GeneID:16996321"
     gene            <930901..>931674
                     /locus_tag="CYME_CMQ358C"
                     /db_xref="GeneID:16996322"
     mRNA            <930901..>931674
                     /locus_tag="CYME_CMQ358C"
                     /product="similar to candidate tumor suppressor"
                     /transcript_id="XM_005538192.1"
                     /db_xref="GeneID:16996322"
     CDS             930901..931674
                     /locus_tag="CYME_CMQ358C"
                     /codon_start=1
                     /product="similar to candidate tumor suppressor"
                     /protein_id="XP_005538249.1"
                     /db_xref="GeneID:16996322"
                     /translation="MAYRGLHALSQPAYLEDFINSVSNLPQELRDKYGRMGELDALVQ
                     RLKNEADALVRELLRKPGSSDPDRGRDTTSLQQMGTKLEQLQAQCVKLNQEKLQLAET
                     AYNTVDQHVRDLDTKLREYEAYLRREGQWPDDLQSLVVNTDHTKMASMKNAAAAAAAA
                     HTAAAPATTARSTQKAPSKGQRKSGEPSTLHIMDDMPIDPNEPRYCYCQNVSYGQMVA
                     CESGDCPYEWFHFECVGLTEPPKGEWICPDCRARTGRVR"
     gene            complement(<932621..>933859)
                     /locus_tag="CYME_CMQ359C"
                     /db_xref="GeneID:16996323"
     mRNA            complement(<932621..>933859)
                     /locus_tag="CYME_CMQ359C"
                     /product="mannose-6-phosphate isomerase"
                     /transcript_id="XM_005538193.1"
                     /db_xref="GeneID:16996323"
     CDS             complement(932621..933859)
                     /locus_tag="CYME_CMQ359C"
                     /codon_start=1
                     /product="mannose-6-phosphate isomerase"
                     /protein_id="XP_005538250.1"
                     /db_xref="GeneID:16996323"
                     /translation="MVALSVDAKRQQQGIWLLRGHVQTYAWGRRGMGSRVARYAVAQG
                     TLESERVSESVSYAELWLGAHPSGEASVVTEANESVPVSIFVPAGSLPFLLKVLSVER
                     ALSIQAHPDIALAKVLHKQFPELYKDGNHKPEMCVCLGPGQFEALLGFRPVAEIVRAL
                     KQVPEFRGACGAYAETFCSSPSAPDGLRKLFESLMRNEDVSRQQAHQLRQRLEAADVL
                     DAEHALALRLLKQYPNDAGIFAAFLLNHVRLEPGQAIFIEPNEPHAYLEGDCVEIMAT
                     SDNVVRAGLTDKHKDVETLCKMLTYRCKDPVQILQRDAQNRFLAPVCEFELECLELER
                     HGEESADLHLESSASYSILLDVEGEAQISQHGIDHSYRLSPGMACLVAPHTPVVVRPL
                     TVSCQLFRARAPATVPVNGL"
     gene            <934277..>934789
                     /locus_tag="CYME_CMQ360C"
                     /db_xref="GeneID:16996324"
     mRNA            <934277..>934789
                     /locus_tag="CYME_CMQ360C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538194.1"
                     /db_xref="GeneID:16996324"
     CDS             934277..934789
                     /locus_tag="CYME_CMQ360C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538251.1"
                     /db_xref="GeneID:16996324"
                     /translation="MCPGAERLDLAPGATDRRERAVEWLLFQSRLQEHSKRAPLTRPV
                     ARSPLEERLQAFLPEMQAENAALFEKMRKGTAVAVDTDFSTADAPEDECDVPTVEVLL
                     VTASAHAQDTVEAAAPQRLVQVLGQGDAEQCLMTGEQPRATPMEAPVGKAPHPGAASR
                     MRKANRHDEP"
     gene            complement(<934822..>935943)
                     /locus_tag="CYME_CMQ361C"
                     /db_xref="GeneID:16996327"
     mRNA            complement(<934822..>935943)
                     /locus_tag="CYME_CMQ361C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538195.1"
                     /db_xref="GeneID:16996327"
     CDS             complement(934822..935943)
                     /locus_tag="CYME_CMQ361C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538252.1"
                     /db_xref="GeneID:16996327"
                     /translation="MLARKAFGWTALLLALCMCCVSVEPKGAPGNQAAFGAAAAASTA
                     SAATEVVQRLKDLRQNYETGVIPVRRASSLERTVFGSKERPFGVLLFVTATEQESNCG
                     LCAYMRHNLELVARLVKRSNARYEARGQLPVFTLMVDLTSKNRNEFVPWLQKLKIPLL
                     PSVLYIPANADIAPDAEYARFRPGPPPAGDGMDRKAFAEWVMRQVNADMQRLGRQPPL
                     RLRVGGPVYVVPTLRRHWLLVLSLFVAGLYLGWRWRWYQRTGTWLAFVLLLYAFALGG
                     GHGWIIQGTPLFVWDGERIRVRSTNPYARRRGPVPPDALAAEGFIHAARYILTAALML
                     ALDRLPRKTRRSWQYLLCVSVLYGLLAYSCYDLLRTPLL"
     gene            complement(<937090..>937527)
                     /locus_tag="CYME_CMQ362C"
                     /db_xref="GeneID:16996328"
     mRNA            complement(<937090..>937527)
                     /locus_tag="CYME_CMQ362C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538196.1"
                     /db_xref="GeneID:16996328"
     CDS             complement(937090..937527)
                     /locus_tag="CYME_CMQ362C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538253.1"
                     /db_xref="GeneID:16996328"
                     /translation="MASIHSLRNVILLVAWLLLHLGSICTAAQPEPSIGSVAAVPSPA
                     RQDWSALPRASVSPLGAFSVRFGPGAQTVLPVTGTSSATSTAQSGMASMMSGLQSQAA
                     VMHSMGAQIMPNETGLEQNHINQNQFATINAELEGALNNMQDA"
     gene            <938723..>942046
                     /locus_tag="CYME_CMQ363C"
                     /db_xref="GeneID:16996329"
     mRNA            <938723..>942046
                     /locus_tag="CYME_CMQ363C"
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily a"
                     /transcript_id="XM_005538197.1"
                     /db_xref="GeneID:16996329"
     CDS             938723..942046
                     /locus_tag="CYME_CMQ363C"
                     /codon_start=1
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily a"
                     /protein_id="XP_005538254.1"
                     /db_xref="GeneID:16996329"
                     /translation="MTVEGSLKGDAAAPVADAEPAASPRNEPEAAPGPPSPDTSRRLN
                     HELAKQNAEVARDTQWSTRQRLKYLVLRYDIFAHFLSSGSLAKQKLVEAAGSVETASP
                     GEGAAGGTPGRRRLTEREEDALLLEADEEGHSESVHLTVQPPGIRGTMRPYQIEGLNW
                     LVRLHQHGINGILADEMGLGKTLQTIALLAFLKVYKGIRGPHLVIAPKSTLGNWNLEF
                     EKFCPDFRVVRFHGDQEERARVAASQLIVNRFDVCVTSYEIAILEKAVLRKFHWRYLI
                     IDEAHRIKNENSVLSQVVRMYNSQNRLLITGTPLQNNLHELWALLNFLLPDVFSSSED
                     FDAWFEQVEGTTEEDAKAEMVRQLHAVLRPFLLRRLKSEVARELPPKKERIVFVRLTK
                     MQHELYRSLLKKDVDAISGQGGDRARLLNILMQLRKCCNHPYLFEGVEDRTLDPFGEH
                     VVQNSAKLALLDKLLPRLRAEGHRVLIFSQMTRMLDILEDYCCEQMRGYPYCRIDGST
                     DSETRERMIEEFNAEGSDKFIFLLSTRAGGLGINLASADTVILYDSDWNPQVDLQAMD
                     RAHRIGQKRPVTVLRLICESTVEERILRRALMKLKIDNMVIQQGRLVEGQKALARGEV
                     LDMIRFGADSFFRADAQDFKDEDLDEILQRAEAKTKEVTESMEEEARKRSQHGLNLMD
                     FKMSDDVGSVYQFEGKDWSAEAASSAKNFFFLDVGKRERRNTIKSYDEAAYFREALYH
                     GGASGDVGSTQPQPKQRMRLPPEPKVYDWQFFNVDRIMELYEKERQIIDEYNRTCENL
                     TEDQMPPEPEPLSPSERAELERLLQEGFSNWRYREFQQFLRACERHGRHNIEAIAADL
                     AQVKTFDEVKEYAEAFWRLGPDHIRDWPRLLEQIEQGEARVAKREEMERALRNKIARY
                     ADPWNELELPASVQGKVFSDEEDRFLLIMVNNLGYGRWEELKMEIRRSWRFRFDWLIK
                     SRSAVELKRRVDVLLRAIERENAEFEKAEAAAANRKKHAQVRSVRRVKSEASSSEKES
                     AHNDSRTTKRAAAGKASEQKPTANAKRKASSSTVTTLDSTSKRSKRPNTDSVTATSEK
                     RSTGPIERYARRKGTTKAA"
     gene            complement(<945120..>946424)
                     /locus_tag="CYME_CMQ364C"
                     /db_xref="GeneID:16996325"
     mRNA            complement(<945120..>946424)
                     /locus_tag="CYME_CMQ364C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538198.1"
                     /db_xref="GeneID:16996325"
     CDS             complement(945120..946424)
                     /locus_tag="CYME_CMQ364C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538255.1"
                     /db_xref="GeneID:16996325"
                     /translation="MSTEDRRVLRRMNAHKRRPGEAPTLIPLATSWSGTRPALCAWFS
                     VRAGFTLERRGVRSAQALERLRASPQKRHLSGQMPAKALCFIPVGLTASRRRSWLLCA
                     PRAGITAVPAAAKRGSYHYRRYEANAFLFALSRSPCRMSNVDSGHSAETAAAQQTSRG
                     RRESQVALWLGCAFFGLGWLLPTYWSWHDQVNLDTHLRMLVLYTVFAVLHSGGAALRP
                     RAAELLGERLYRVLFAFMSLPTAGVTVAYFLAHRRDGISFSWLQQDLPAHFPFFHEMV
                     WVVSAISFLFLYPATLDLAQVSAIKRPTVRLFEQGIMRVTRHPQLWGQFLWCLAHGAW
                     IGSSMAITVSCALIGHHFIAAWHGDRRLRQRFGAATWDAFAERTSLWPFWSMLQGKQS
                     PRVAIQEMLRPAYIGVLVFVYLAYKAHPLLFEWAAANTRFLS"
     gene            <947020..>951351
                     /locus_tag="CYME_CMQ365C"
                     /db_xref="GeneID:16996326"
     mRNA            <947020..>951351
                     /locus_tag="CYME_CMQ365C"
                     /product="phosphoribosylformylglycinamidine synthase"
                     /transcript_id="XM_005538199.1"
                     /db_xref="GeneID:16996326"
     CDS             947020..951351
                     /locus_tag="CYME_CMQ365C"
                     /codon_start=1
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="XP_005538256.1"
                     /db_xref="GeneID:16996326"
                     /translation="MKPALPVSAEALSFVQTFNLANSNMLLGFVTSPWCGTNTRWQGF
                     GLHKRACRASSAHCVQRRTAKRAHWRCVDAAPVSERPDQESSQPISQIIRFYRYLGLD
                     PLAMSAAKVAYRQAATYMGLLPEPIPSFSVEREDCFYVLWDTKAGDITETELGALRWL
                     LSETFEPERFREGVPFLNQRVLEFGPRLNFQTAWSSNAVSICQACGLRNVRRIERSRR
                     YFLEPEVPSNALAGEAHQILSSTHFQDALFERLHDRMTEQLYKEPLRSLDTHMKPADV
                     YRIPLLQEGEGALRRASEELGLSFDDWDIHYYAQMFRELGRDPTNVELYDIAQSNSEH
                     SRHWLFRGIVVIDGHEMPYSLMDLVREPLRRHPGNSVLAFCDNASTIRGLGPVPVLIP
                     SRPDAPSPYLLHDMDYDALMTAETHNFPSGVAPFAGAETGAGGRIRDTAATGRGSLVI
                     AGTAGYSVGNLQIPGYPLPWEDGSFAYPENLESPLNICIQASNGASDYGNKFGEPLIQ
                     GFCRSFGLRVLSQNQRREYVKPIMFSGGVGMMDHQHAHKQAPECGMLVVKVGGPAYRI
                     GLGGGAASSMLQGENQSHLDFDAVQRGDAEMEQRTYRVLRACVELGPNNPIVSLHDQG
                     AGGNCNVVKELIYPLGARIDVRRVILGDQSLSVLEIWVAEYQEQFGLLLRPSSLPCFE
                     KLCERENVPLAVLGEIDGSGRITLYDSLRDEVVVDLDLERVLGKLPRKVFRDSRASRT
                     RPTPLALPFLNASTLRTESPAELLRILDRMLRLVSVGSKRFLTTKVDRSVTGLIARQQ
                     TVGPVQLPLADVAVVAQSHFSTYGTAIAIGEQCVKALISPAAMARMAVAEMLTNMAGA
                     RISAFTDIKCEGNWMAAGKLPGELVDMYEAAEALSDTLTTLGIGIDGGKDSVSMAARC
                     PGERDPVRAPLTLVLSGYAPVPDVMQVLTPDLKRPGESVIILIDPSRGARRLGGSALA
                     QVYGQVGDSCPDLDDPVLLRQAFEAVQMLQDRQQVLAYHDRSDGGLLVALLEMAFAGN
                     CGLDLLVDAQDVGELFAEEVGMLVEIAASDAPSVLEWLRSLDSRRPLPCRLVARTRRD
                     TQLHFRAGAAAAAAAALERQPLLDLEVRFAAHLSADMRDLRALWEETSFQLEALQANP
                     ICVEAERQACYDRRGLTYVVPYTTEPTNLQNYPRTQLSPPRVMILREEGSNGDREMAA
                     AFQLAGFEVHDATMRDILARRVTLDAFQGIAFVGGFSFADVLGSAKGWAGVIRLRSEV
                     AAQFERFRHRPDTFSLGVCNGCQLMALLGWVPGRFVRNESERFESRFSLVRINPDHPS
                     IMLRGMENAVLGVWVSHGEGRAIFPAGDRPSVIPMQYADDLGRAVSVTDKNRGYPFCP
                     NGSVEAVAAVVSADGRHLAMMPHPERTIHLWNWAHLPEDYRRKWKVSPWLRLFQNARQ
                     WCEELAS"
     misc_feature    complement(952554..954186)
                     /note="possible transcribed region"
     misc_feature    953651..954871
                     /note="possible transcribed region"
     gene            <956686..>959496
                     /locus_tag="CYME_CMQ367C"
                     /db_xref="GeneID:16996634"
     mRNA            <956686..>959496
                     /locus_tag="CYME_CMQ367C"
                     /product="similar to nucleosome/chromatin assembly factor
                     C"
                     /transcript_id="XM_005538200.1"
                     /db_xref="GeneID:16996634"
     CDS             956686..959496
                     /locus_tag="CYME_CMQ367C"
                     /codon_start=1
                     /product="similar to nucleosome/chromatin assembly factor
                     C"
                     /protein_id="XP_005538257.1"
                     /db_xref="GeneID:16996634"
                     /translation="MNEHTESDTARACPVPGALDPPPRATAPTAFNETAPESTASGTL
                     GWEVAERESHPIGESSSRRKSATLSGWSLMNLDARHMQWRRECLPLLYDWFLCWPMVW
                     VLGGVQWGPRLQVLRAFLADDPGTGTAGPLIAANATETTDSSELPSTKRRSAKSFGIR
                     LEPISRLDQSTFERQELYFSERTGPTVPDAPSEPNTLLVAECCIARENFMRASDIGNA
                     WNTDLYSSCGSGSGAHDVPLAERAASARRAREHREHTLRCRLEELEEQARAAKDALVA
                     AGIHTNHSSEDVSGSMVSSNGGVCAQARAVLEAFAELLRLPECERLVRSTSEQVYQEL
                     YDAVIGKCASENALQASVTSGYSLEALRTKRAQQSRFHNPMLPFHTRVPHGISIAVPI
                     ANMRRKGVLPSTMPSPELNEGHRGPETESLSSQSGPLRDSVRLDYDEYLGEVINLTPE
                     EFDDNNVPVGSRRDGLSGMGGIYVVNEDGSSGCWARDSSAFTGGIVVRRRRRANASNA
                     FGAAASAAGAAAATEEHSQHAQDNGVRVFYDEFRVRKRLIHPGEVNRIRYLGMTFDPN
                     VNHEDCFPADALEDDVESEPVQTTQCARWIVTHTDAPELMVWNVNEQVHRPDNDKLRP
                     NVPDLVLVGHTSEAPYAIDTTFGGDVFPDAFLVASGGSDHQVLVWRLTSDLLLESREQ
                     KRATVTDTIDDLSGSLHPVRHAARYTMNVAPTHRLFGHSATVEDVCFHPINPSLLASC
                     GDDGCLLLWDLRAPPRPIGGVRRAHAGDVNCLDWSRDRNARYMITGGEDGVVRLWDTR
                     AMSSWAIEGTLHRKSQPAEPLYEFMADDRFGGAVSCVQWNPLDPRYFLSAAETEVIVW
                     DTETMDILFRHAGHRTRIQEAYWNPYIPWVIMTTSEAGESEADGTPSMVSLWRVLDLV
                     HMHDAQVAAEFDVWQNTVAQSV"
     gene            complement(<960295..>962337)
                     /locus_tag="CYME_CMQ368C"
                     /db_xref="GeneID:16996332"
     mRNA            complement(<960295..>962337)
                     /locus_tag="CYME_CMQ368C"
                     /product="unknown periplasmic-binding protein of ABC
                     transporter"
                     /transcript_id="XM_005538201.1"
                     /db_xref="GeneID:16996332"
     CDS             complement(960295..962337)
                     /locus_tag="CYME_CMQ368C"
                     /codon_start=1
                     /product="unknown periplasmic-binding protein of ABC
                     transporter"
                     /protein_id="XP_005538258.1"
                     /db_xref="GeneID:16996332"
                     /translation="MILNPQQKRPQAHCRGKRQPKLRPALQTHRSVLFVLVLLLVATL
                     TVPPARAHVFDRCDTSSYAVFPTSFSFDHAQTLRNYSAASDGSWAQLAMQVDADGLWE
                     VHAFVRCGFNTTEHPDFNSTGMVTQVHAVPPRGLALTDTLQAGYVGYGIVRPYAIRAF
                     QEPDYLTGTLFKALAEVGYIHGWACNASTPGSLCGAPYAVGCTPTTQEFIEPGTYACA
                     GDFGNLTHLQRLLENTSLNIDVFIVSQVDADWRQVLRNGTLRPAEQNVSVLFLGEDYE
                     STPLGRAEYVKLFGLLFGIPTQTSEQFRDIVRSYEEAKGLAQTAERRPSVLYGYAYDS
                     TFYFGSKYQATFIRDANAYYVFGENDEELPQELAYCFDNGIALGKPDTGLNLTLLGAN
                     SSQFWTGFSITTPTEKTVAQVLQNYTYARNWTAVLCDNLFDATKYTDPNPIFEQGVLR
                     PDLILRDQIRIFHPELEPEYVFNFYRHMEPSGLRTCPIVTPVPSSRAGVHVQAAYMVR
                     GIPRVLVESQQQRLRDMLVELLGIHGKHISLWYPTNASRWLSNAVDAAGVQVNQSLVR
                     NANGSVFLVLQVYTPESRDLASTMERADVALMLQQTLRSLGVLYANATLLAVTSPIQN
                     YVGASGSLGNGLPTGAIVGIVIGTFIGGVIITALGAFMFIETRYRKRKRRIWRSGA"
     gene            <962886..>963479
                     /locus_tag="CYME_CMQ369C"
                     /db_xref="GeneID:16996333"
     mRNA            <962886..>963479
                     /locus_tag="CYME_CMQ369C"
                     /product="similar to submergence induced, nickel-binding
                     protein"
                     /transcript_id="XM_005538202.1"
                     /db_xref="GeneID:16996333"
     CDS             962886..963479
                     /locus_tag="CYME_CMQ369C"
                     /codon_start=1
                     /product="similar to submergence induced, nickel-binding
                     protein"
                     /protein_id="XP_005538259.1"
                     /db_xref="GeneID:16996333"
                     /translation="MRAWKLEIPPGADIRQPHAKPGGDEVSLVELNALGVLYQYFAPS
                     DYDKSGTETHARWLQFRSDHGFKYADVLEVSPEQLPDFESKLQMFFEEHIHADPEVRY
                     VTAGSGYFDVRDESDSWIRIAVEPGDMLVLPAGIYHRFTVDSSNYIRAVRLFADEPQW
                     VPINRTSAERHPARLAYEQLYPERSFSTEPEQQALRV"
     gene            complement(963274..965120)
                     /locus_tag="CYME_CMQ370T"
                     /db_xref="GeneID:16996345"
     misc_RNA        complement(963274..965120)
                     /locus_tag="CYME_CMQ370T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461576.1"
                     /db_xref="GeneID:16996345"
     gene            <965327..>966940
                     /locus_tag="CYME_CMQ371C"
                     /db_xref="GeneID:16996346"
     mRNA            <965327..>966940
                     /locus_tag="CYME_CMQ371C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538203.1"
                     /db_xref="GeneID:16996346"
     CDS             965327..966940
                     /locus_tag="CYME_CMQ371C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538260.1"
                     /db_xref="GeneID:16996346"
                     /translation="MEPARPVPRLRSVHSIAGLLLVGTVASLLAKIIYGVESTGRDGR
                     IRPFRKPLFEVFSMFLGMSLCRLLEWIQPPEQLPPALLAQTTSSASADPLADVLVRLP
                     SPWCELLLKAHHWLGALTPAATHVILVPAVLDAAATMLMCTGLLFAPVSVYQMLRGSM
                     LVFCAIFSVTLLRRRLHLYNILGVALALGGITTVGLASVAGEEDLEARGALLVGILLM
                     IAGQAMQALQVVAEEHLLQNLLLPPMQVVFYEGIYGVALCLCIIFPLAYILPGNDYGH
                     RWEDTLDSLVMIAHSGVLVLILLSDATSMLLFNMFSMNVTQLSSALFRTMLETLRTFL
                     VWMIDLWIYYRWSDGRFGEAWTRYSWLQVVGFLVVVAGTWLYSQHPVSIGPEPAPEME
                     HSRASTETTHALAKQMLPDEELERLLVDRDHVRYSTGETTAAPTSMSLSPEAGESVGE
                     VAERESMQAREPRLLRERLRASPATSLYGTSPAFFMHHGGTIPAVYVGSPLPFATIGS
                     QREARLRRNNLSRTASSASVSDEDSNAGP"
     misc_feature    complement(965441..967157)
                     /note="possible transcribed region"
     gene            <967850..>968386
                     /locus_tag="CYME_CMQ373C"
                     /db_xref="GeneID:16996348"
     mRNA            <967850..>968386
                     /locus_tag="CYME_CMQ373C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538204.1"
                     /db_xref="GeneID:16996348"
     CDS             967850..968386
                     /locus_tag="CYME_CMQ373C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538261.1"
                     /db_xref="GeneID:16996348"
                     /translation="MIEKLTELGVVAYRHVSSTRGEIDAAHVQKRALNRWHQVSIAAA
                     KQSLRRTLLDVGGHHSNPGSGWLTGVCSEATIAFDHLVQWIESTASANQVFLLAAPAA
                     MQTLMTWRADAFPLRTASASSMMPRRVVCIIGPEGGLTSDEEAALIGAGSIGVSLGPQ
                     RLRTETAAVAFAAALLTP"
     gene            complement(<969478..>970056)
                     /locus_tag="CYME_CMQ374C"
                     /db_xref="GeneID:16996349"
     mRNA            complement(<969478..>970056)
                     /locus_tag="CYME_CMQ374C"
                     /product="similar to chaperone DnaJ"
                     /transcript_id="XM_005538205.1"
                     /db_xref="GeneID:16996349"
     CDS             complement(969478..970056)
                     /locus_tag="CYME_CMQ374C"
                     /codon_start=1
                     /product="similar to chaperone DnaJ"
                     /protein_id="XP_005538262.1"
                     /db_xref="GeneID:16996349"
                     /translation="MAKASVEGSEWRPTSAEAEIQRILSENNNYYLVLHVRPSADVNE
                     IKRNYKRLSLLLHPDRCNLPRAKEAFQEVNIAHTTLTNPVKRKMYDLYLGDRLQGTGA
                     TESYTEWEARMAQGPAVRIPGWLLFILRLPVVGLVVAILLVVLLVPLLLVLLILMFIL
                     AIVCFPCGLLSMSRRPQNSDNADEGETVNNQV"
     gene            <972399..>973400
                     /locus_tag="CYME_CMQ375C"
                     /db_xref="GeneID:16996350"
     mRNA            <972399..>973400
                     /locus_tag="CYME_CMQ375C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538206.1"
                     /db_xref="GeneID:16996350"
     CDS             972399..973400
                     /locus_tag="CYME_CMQ375C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538263.1"
                     /db_xref="GeneID:16996350"
                     /translation="MSGDSGLPAPGRRAEGAPIGDVTAPLPSEVKHSEGQFDESRLAS
                     IIARLQDWDQSLSRLRRLCALLESEGEQARGELWALAASTDSLANSVRADLALLSTEQ
                     EKSFMRPGQAGAVLRLHKVRRDVERLSRAHANVMELIQDLESEVSEWGMDTQPELEVV
                     DPQIPAVARSEYQHQTVVPSGRAATQTTPKRTSPATSPDRAEPYGTFETDQRRSAAQT
                     VQVAAESEEAQLQARYDAQYAVHDMQERQTLLQRIQNSVQQAHAIFLELASMTEAQQQ
                     PLDDIEARTQRVRCEQESTAEEWARFARRRRTRRRFCFWFSIWMTLVLLFTIYVLFH"
     gene            complement(<973759..>974415)
                     /locus_tag="CYME_CMQ376C"
                     /db_xref="GeneID:16996342"
     mRNA            complement(<973759..>974415)
                     /locus_tag="CYME_CMQ376C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538207.1"
                     /db_xref="GeneID:16996342"
     CDS             complement(973759..974415)
                     /locus_tag="CYME_CMQ376C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538264.1"
                     /db_xref="GeneID:16996342"
                     /translation="MGLAQSSSKRYQEHIFKLLLLEKHLRRQANRCQRERERYVEQLK
                     AALKSGNAEMSVVSAESAVRKARERTTYLRLAARLDAVVGRLKAARDLGQIGSEMGLL
                     ASDMDSAIRVLDVERLESSLQLLENRLDDVQVRDVLINSGLDRVSAGVASQTPEEDEV
                     ALLIRQTAEENNLELSHALGTAPTLPLLQRDLAQAQERKRLQQEQADLSARLRALQLP
                     "
     misc_feature    974700..977145
                     /note="repetitive element"
     gene            <977191..>977454
                     /locus_tag="CYME_CMQ378C"
                     /db_xref="GeneID:16996343"
     mRNA            <977191..>977454
                     /locus_tag="CYME_CMQ378C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538208.1"
                     /db_xref="GeneID:16996343"
     CDS             977191..977454
                     /locus_tag="CYME_CMQ378C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538265.1"
                     /db_xref="GeneID:16996343"
                     /translation="MVHATKGYLVRCDVPMKQLLLHLDREEHFIICDLDEKHLFVKED
                     ALSLIQQSVEALYDEVYYGPQEPGPRRQRAGASTGTGTQESLD"
     gene            complement(<977789..>981376)
                     /locus_tag="CYME_CMQ379C"
                     /db_xref="GeneID:16996344"
     mRNA            complement(<977789..>981376)
                     /locus_tag="CYME_CMQ379C"
                     /product="calcium-transporting ATPase, plasma membrane
                     type"
                     /transcript_id="XM_005538209.1"
                     /db_xref="GeneID:16996344"
     CDS             complement(977789..981376)
                     /locus_tag="CYME_CMQ379C"
                     /codon_start=1
                     /product="calcium-transporting ATPase, plasma membrane
                     type"
                     /protein_id="XP_005538266.1"
                     /db_xref="GeneID:16996344"
                     /translation="MEQFDVTNADLERGNEREDEAFFRITVSELVPLTKHRTLRDLEA
                     LGGVTQLARRLRVDLQRGIDPESVVARQQYFGANLLKYAPPPSFLRLVFAAWNDVTLV
                     LLTGAALISLVLGLALPSERTRYGYLDGCAILVVVVLVVCLDATIALQRERRFRSLNA
                     VKDAFPVRILRGGEVRLVDAPGVLVGDLIKLSAGDKVPADGILLQGTDFACDESTLTG
                     ESVPVSKTGAFDRPAAAAAAAAASNAAKTTATIQLHADGDDVSPAPPSVHEEADIFVL
                     SGTIVTSGFGTMLTVAVGMNSVWGQLLTSLRPTPPQTPLQVRLNRLARSIGYIGLGLA
                     FLVFGVLFIRWLVDSIRSGSWPIMKLTESITAAIAIAVVAIPEGLPLAVVLSLAFAMR
                     QMMKENILVRRLEACETMGSATQLNIDKTGTMTWNQLRVTEAALPAGSLSDLLQRRTI
                     SPIYLRLLASCIAINSQADLRDQQNGTVEYIGNRTECALLELLHRMGISYRELRAASS
                     LRRVYLFNSTRKQMCSIEQLAPDGRLERLHVKGAPDQLLERCVLEMNCRTGALTRMSW
                     SKRNAYRSAMEAFAEQGLRMLLVAFWDQQQPAETGNLPGVNEPPETELILLGIFGMSD
                     PLRPDTAASVRALQQAGVFVRMVTGDSVQTATQIAQAAELLEPGSSPVQLVWDAAAFR
                     QLPRAVQQNVSMRMRVLARATPADKLELVQLFRALEQVVAVTGDGSNDAPALREADIG
                     FGMGVSGTELAKEAADVVLLDDRLGSIVAAVLWGRNVLENIRKFLQFQLTVNIVAVTL
                     DLFSACAGMTLPLSTVPLLWVNVVMDSFGALALATEAPRSALMQQPPQGRNAPLITPA
                     MVRNMLGIALYQLAVMITLLFVTVPLFHIPCYAVSTSSDPCGGQTLQRNGFIFNTFVF
                     LQLVSELNSRRIAERHVFEGIGRARLFLCIVFGSAVIQVVLVEVLGRTAVGQSVGIVN
                     LSGAQWGAGLLIAGLELPIGFLTRLCPVSWVHQPGRLWQALCHQLMQRNLRRYQAGTN
                     YRLGDAPMGNEPQSAAAPADSGFAQITAALPTISNAQDDAHGGSSGSSRMGTSAATSV
                     QLKDRCAQSRRRFRVFCHAAVALQRMDLCACTRESARIQQAIYGQSSLWSESSKRNLR
                     SRLWAVVGMLRLLRVSVPSPYEAERTALTSELLGAQLKMNPVALHSKQS"
     gene            complement(<983415..>986789)
                     /locus_tag="CYME_CMQ380C"
                     /db_xref="GeneID:16996399"
     mRNA            complement(<983415..>986789)
                     /locus_tag="CYME_CMQ380C"
                     /product="similar to COPII coated vesicle component Sec24"
                     /transcript_id="XM_005538210.1"
                     /db_xref="GeneID:16996399"
     CDS             complement(983415..986789)
                     /locus_tag="CYME_CMQ380C"
                     /codon_start=1
                     /product="similar to COPII coated vesicle component Sec24"
                     /protein_id="XP_005538267.1"
                     /db_xref="GeneID:16996399"
                     /translation="MHAPPGPPWPRPREPGAGPASDTVQSNEPAGTMGVQRGVQSPTP
                     GMVQGAHYAPAESFSAGRAAAPAPNAQLTGRLRPVLGERSQVLQAAVQGAQSALGTSR
                     HPAGGDWGPQPAVPRGAGVPGGQHPGAAVIQSSLPQAQSMRWPVAGNPGHPGAFPQAA
                     NAQAMGSNSYQVRSRSGVAGTVHGWMTTGADASAFSSVPSQRDPWTANGGQQPLTSPG
                     QSTSPPSGASKLSPSDVPRPAGIDRDYIDRSRPVLVCRHEYGRGTQAETPSLSPSFRE
                     AVDTFQIDRGNARPRYVRWTVGSVPRTPDLARSSGIPLAVYVAPFADATDEKPPPVID
                     TRPHGPVRCSRCQAYLNVGIRYVDSGRSFICNLCHHLNAVDVDRFVPLDPVTQLPVDF
                     ANRLELSHGSVEYIVPEEVYGHQGRTSEPVFVLVADAPSLGSLLPYAAFRELLAESLA
                     LHRARLALIVTSAGCLHLFPIQPSGSVQEIILPDIQEPFLPVPPTQLLQSPDLEYWPA
                     IAEYIQRTDWYTTAESESPGSHIFAGVLAAAELLEDPSIGGGKILAISSGLSLGPHRA
                     GLALRNRWLELDTRSSHQKWKSSMDRERWLLQPANDAFAALGKRLADAQITLDLFLHP
                     GMFPGTATPRPLPYFDLATLRTLTEHCGGKLFYYQQGRDVAGLQRDLIHAIRAVRALE
                     AVLRVRCSPGITTGEHLGSFRPPGTDRPDIYIPVMSTSTNLYVAIRHDLSEGIVTHPL
                     LHQRSGTGDDAEASAAEAHASTAADSAVSPCVCVQVAVLFTHPGDRTRRVRVHTLAAP
                     CTTLLGQLFRTLDVTCLMGWLARSAAARVQAGGLLPKLRDHLTEQLVDMLFVYRRYCA
                     SRSSPGQLILPEALKLGPIYTLGLLKSAAFRAEQVAPDERAYRLHQFMASSLLSMQAA
                     MHPLMFDALNSTVLDPMVGTPIPGTGVVSREATGVPSPSLVSWNSPAGPRAIAAPPSA
                     ATSETDAQLAAAPDGAAKLPPLQALTSERLGPDSAWLLLDGWHCLLWIGEFVNPDQQQ
                     SVPGVYAGLAGLPVPVMERLYALFPGLLSPDMVSQRSPAEQTFMQLLIEDRMSYAPSY
                     IEYLVTLHKLVQRKLASNEAEKQHRMLGEWEWAHTY"
     gene            <987415..>988041
                     /locus_tag="CYME_CMQ381C"
                     /db_xref="GeneID:16996400"
     mRNA            <987415..>988041
                     /locus_tag="CYME_CMQ381C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538211.1"
                     /db_xref="GeneID:16996400"
     CDS             987415..988041
                     /locus_tag="CYME_CMQ381C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538268.1"
                     /db_xref="GeneID:16996400"
                     /translation="MAELLGERAGTRGPTLAELEFFAEDSLVTVIPRVNLSRIELIAG
                     DFGPFTVNEACAVPLWLAVCLKRAGYCSIVPPSWLRLKALTAAREEEEQSPELSASLP
                     FHYQQIASLLLTHAAADIPQACHIHEVLEDIVTVRQGKIRALLQRIVSEHEATRPARL
                     GYLGSIELFRFRPALVHSLRTQSSLHSESAADHHWPEDRDFSSMTGSL"
     gene            <991675..>993614
                     /locus_tag="CYME_CMQ382C"
                     /db_xref="GeneID:16996375"
     mRNA            join(<991675..992042,992351..>993614)
                     /locus_tag="CYME_CMQ382C"
                     /product="similar to U3 snoRNP component Utp15p"
                     /transcript_id="XM_005538212.1"
                     /db_xref="GeneID:16996375"
     CDS             join(991675..992042,992351..993614)
                     /locus_tag="CYME_CMQ382C"
                     /codon_start=1
                     /product="similar to U3 snoRNP component Utp15p"
                     /protein_id="XP_005538269.1"
                     /db_xref="GeneID:16996375"
                     /translation="MEAFQPLRSIEHIPPVERKGPEERFWETFDEKARIRLTGAVQGV
                     HFSPLGSNQVAVTAESRVTILKSSTGDLIKSFPRTDTVAYAGRYRTDGKLLVAGTESG
                     LVHLYNAHSRSILRTFSGHKSSVRSVYFTIDKLRVVSASDDMTVRITDIPSEQCLLSL
                     HHADRVRAQTPCPASPHLWLTGCYDGAVRLFDLRLPSQKPVRMVWHAQHGQVDDVCFL
                     DSESSTFVASGGGSSVRCWELLHSSSDVEAGSQRALLAELEPHRKAVMSLALDATRRR
                     LLSVSLDGALKVHDLSVLSTLHTRSIGAGCLCMDLSADGRSLATGHVDGQLRIERRGV
                     SKPSGIENETNVDERSGEPDWASLARGHLDRGDALRPYRPGTRRYFLRGMYAKPDSDI
                     DDVILGDGDSTSGTSRRRRRQHDQKPYDHHLRRFAYDKALSAVLETNQSGLIVSMLVE
                     LDRRKGLQNALSSLNEQQMITLIEFIAKHIADSRYIQVLVPVSHLIVDMHHTKDSLSG
                     SLLAALQRLAARVQQQVHHLGDMEKMAAAIELFLS"
     gene            complement(<994302..>994925)
                     /locus_tag="CYME_CMQ383C"
                     /db_xref="GeneID:16996376"
     mRNA            complement(<994302..>994925)
                     /locus_tag="CYME_CMQ383C"
                     /product="histidine biosynthesis bifunctional protein
                     HisIE"
                     /transcript_id="XM_005538213.1"
                     /db_xref="GeneID:16996376"
     CDS             complement(994302..994925)
                     /locus_tag="CYME_CMQ383C"
                     /codon_start=1
                     /product="histidine biosynthesis bifunctional protein
                     HisIE"
                     /protein_id="XP_005538270.1"
                     /db_xref="GeneID:16996376"
                     /translation="MWVPAASFRSGGRSGAAAALWAPTKGAFSGTSERAQCARFCKWC
                     TVEETLPRSVRRQFGVFSVSNSVQELTAETWRRVRFDAAGLVPAIVQDAETNQVLMLA
                     YMNRDALSETLQSGRAVYYSRSRKALWRKGDTSGQVQWVRELYFDCDMDALLLRVKQV
                     GVACHTGRYSCFWQRVAADGQTEEALPVLVEPQTLYGRQAAPGSPAA"
     gene            complement(<994958..>997453)
                     /locus_tag="CYME_CMQ385C"
                     /db_xref="GeneID:16996377"
     mRNA            complement(<994958..>997453)
                     /locus_tag="CYME_CMQ385C"
                     /product="probable pre-mRNA splicing factor ATP-dependent
                     RNA helicase PRP16"
                     /transcript_id="XM_005538214.1"
                     /db_xref="GeneID:16996377"
     CDS             complement(994958..997453)
                     /locus_tag="CYME_CMQ385C"
                     /codon_start=1
                     /product="probable pre-mRNA splicing factor ATP-dependent
                     RNA helicase PRP16"
                     /protein_id="XP_005538271.1"
                     /db_xref="GeneID:16996377"
                     /translation="MWAGACAQDSAVELENDSGVSPDAAGPALCALLERHPVVILVAE
                     TGTGKSTKVPAFLWKQGGFNWIACTQPRRLAAMALASRVATELGVKLGCEVGYSVRFA
                     DQTTPGLTHIKYVTDGWMLRAFVRDPLASAYDLVMVDDAHERSLATDLLLALFRRLLW
                     QQDATANPTSNNPRKLPRLVVSSATLNADQFSAFFGGAPVLRIVGRRYPVRIAYAISM
                     PEDYVLAAVSQVMQVFGEWCESKHNQRDRIVDGMDVLVFLTGQEEIERAAQLMKHQAQ
                     QTLACSPATTMTTTSKIHRSGGASDASATNKSSCSDEGTSMKQPGLGVDSLNRAATQP
                     RVLTVALYGALPSSEQVRICCERPPPGTLRVILATNVAETSLTLPNVRVVIDSGYVKQ
                     RIYDHLEVVPASQAAAEQRAGRAGRSSPGVCYRLYTREFYSEQMAPELIPEIKRVDLS
                     DAFLLLKRMGIDRLDEIVWLDPPDTANVRRSLRLLRRLGALTTVAEAETEAAAERTGS
                     QDTENSAVAPPAALSERKLQSCSSAREVLSVPLGQRMADMPLEARLARALLAAEELGC
                     TRELLSAVAILSTGYPLLTRRGLAEAVPRFCRTKPNQLRDPLAYNDFLLFARVFDAWK
                     AASDATLWCYRLGISERVLRLAESICKQLSVYLRQPLASRPEALAAALYTAFADQTAR
                     LTSRGTYVHERPDDDDNPVVVQTAAVASEQRCRLQRTPLRLHPSSCVHGREWAPPRLL
                     FYELLIAKQPFMRCVCALTASDCMPQQSASVSQQPQSRAATAHAPLSPQAPQRSSSER
                     RARWSGAALEAVPTRSAVEARSVRKRSRWDKVN"
     misc_feature    995137..996167
                     /note="possible transcribed region"
     gene            complement(997742..1000484)
                     /locus_tag="CYME_CMQ387T"
                     /db_xref="GeneID:16996378"
     misc_RNA        complement(997742..1000484)
                     /locus_tag="CYME_CMQ387T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461577.1"
                     /db_xref="GeneID:16996378"
     gene            <997877..>999319
                     /locus_tag="CYME_CMQ386C"
                     /db_xref="GeneID:16996372"
     mRNA            <997877..>999319
                     /locus_tag="CYME_CMQ386C"
                     /product="similar to V-type ATPase V1 subunit H"
                     /transcript_id="XM_005538215.1"
                     /db_xref="GeneID:16996372"
     CDS             997877..999319
                     /locus_tag="CYME_CMQ386C"
                     /codon_start=1
                     /product="similar to V-type ATPase V1 subunit H"
                     /protein_id="XP_005538272.1"
                     /db_xref="GeneID:16996372"
                     /translation="MDIGLAVRSPLDALDLPSRDVSTLLRYLSLTRVQRAALVQAELV
                     EVVATAHRATARLVERLKLASTQGIKAESFNRAVGAMQEILESLMEPAAGRALDETGR
                     RRLEWFRQHDDWGRYVDLALYAGVHRPAGILLGNPLTDAEQERPLLEQFAPVLVSSLW
                     QRLGPFRTAHYADPLLMDALLSTTAFLRNSTARIIFSTSNVFHEGDGEPNKAAEAAEM
                     PSAPSSFFGKQHVHGISALSAYLEQPAAAPLEVIYQVLFSLWLLSFSVREIGPEPFES
                     GRLPLRLNGVLRELKAQKAVRLTLAVLRNLSEDATLCREMIGAGIATYLGTNNAALRR
                     WNDEELQLDVMHLRSRLAEELSSMTSLEMYLEELLVGSLDWTPAHRDAAFWEENANKF
                     EAENWKVLRRLCTLIRDSQDAHTLNIAMNDVCEILRVQPRARLILETEQIKPRLLELL
                     THSSSDVKRRALSCLQRLVLSGSRAIPSMN"
     gene            <1000580..>1001311
                     /locus_tag="CYME_CMQ388C"
                     /db_xref="GeneID:16996380"
     mRNA            <1000580..>1001311
                     /locus_tag="CYME_CMQ388C"
                     /product="similar to DNA/RNA-binding protein
                     translin/TB-RBP"
                     /transcript_id="XM_005538216.1"
                     /db_xref="GeneID:16996380"
     CDS             1000580..1001311
                     /locus_tag="CYME_CMQ388C"
                     /codon_start=1
                     /product="similar to DNA/RNA-binding protein
                     translin/TB-RBP"
                     /protein_id="XP_005538273.1"
                     /db_xref="GeneID:16996380"
                     /translation="MTSDITSGFAAVATALEHEGQLRERLRLQRDELDVAVRSLETQL
                     SRLHYEVDWSDAVAGARQQLRTIGSGFLELQSLVPEGMFYKYNDLWRQCSIHIVQSCL
                     LIRFFETVHAPGPQFSDNLDQSQANDSVETCTAALVTKDEVLEMLDGEKAPTQPALRL
                     DLEEYLLGLCGGIQELARLAANRVVLGDYATPRKLAFFCNQVYAGFRLLNFRNDSLRR
                     SYDALKYAIQRLDSILYDLRIRKLS"
     gene            <1002019..>1002867
                     /locus_tag="CYME_CMQ389C"
                     /db_xref="GeneID:16996373"
     mRNA            <1002019..>1002867
                     /locus_tag="CYME_CMQ389C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538217.1"
                     /db_xref="GeneID:16996373"
     CDS             1002019..1002867
                     /locus_tag="CYME_CMQ389C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538274.1"
                     /db_xref="GeneID:16996373"
                     /translation="MFTVPICKQQQFRTLWSSGVLCRESNIVQGKMLSVPLRRTVLRT
                     PLHCSTETTEPTKRATGVADPVEARVRKELESAGIELEQLLNPSKVVNLERKLAEYQT
                     RLAELTSSGNAAERDRLLSKFSKMQRELEQEKRAVMRQWLKNLFVAQGILTAALGGWM
                     AFDSRLPLYVQALGFWMVWLFTIPSLRARKPSSAEKNALNVSFLIAPVMNLVLPVFLK
                     DTGELWLAQILQLIGCYLYYGVWTPSSVKDARKTAVQQEDQGGTKRLNVRLPAILRWL
                     DWGSWR"
     gene            <1005916..>1006875
                     /locus_tag="CYME_CMQ390C"
                     /db_xref="GeneID:16996374"
     mRNA            <1005916..>1006875
                     /locus_tag="CYME_CMQ390C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538218.1"
                     /db_xref="GeneID:16996374"
     CDS             1005916..1006875
                     /locus_tag="CYME_CMQ390C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538275.1"
                     /db_xref="GeneID:16996374"
                     /translation="MQCALRGLEHSCRRRSCGDLLLVEVVRRGSYTQRSRKSGVWASN
                     SLSLAITLSPYMQTYGHSNILRASRGLSTTLGRIGCALGRVGASSTSALPEMTRAGLR
                     APFGKVCWLSGSSVSAPASKLCVVTLNGADRRGIVHRFTAEVSKHGGNFEESRMVRLG
                     GEFAIMSLLTVSTERLEELRKALEGAFPDYSVTCRETREEPVVETDVRMLEISVEGPD
                     QPGIVRSLTEALVPFQAHIEAMETETVPAPFAGWPLFRLKAQVSVPRSTSVGTLEEAL
                     SREVEEKFDLLVDVSSIPVRKQRNWPKKPTGLVDVAADAQHAT"
     gene            complement(<1008225..>1008629)
                     /locus_tag="CYME_CMQ391C"
                     /db_xref="GeneID:16996359"
     mRNA            complement(<1008225..>1008629)
                     /locus_tag="CYME_CMQ391C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538219.1"
                     /db_xref="GeneID:16996359"
     CDS             complement(1008225..1008629)
                     /locus_tag="CYME_CMQ391C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538276.1"
                     /db_xref="GeneID:16996359"
                     /translation="MHPMPSSMLRRIVQQSRCWGAASARVGWTRSYAIRATTAQPVDT
                     SKARIVAPSSLSFHYSLRKSLRRLRETLSDPKAKLELSSADKDAIIVELLAVAKRSGM
                     EVTEAWLRENIPIADSYTLEEIQRLLETPMIK"
     gene            <1009850..>1011022
                     /locus_tag="CYME_CMQ392C"
                     /db_xref="GeneID:16996360"
     mRNA            <1009850..>1011022
                     /locus_tag="CYME_CMQ392C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538220.1"
                     /db_xref="GeneID:16996360"
     CDS             1009850..1011022
                     /locus_tag="CYME_CMQ392C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538277.1"
                     /db_xref="GeneID:16996360"
                     /translation="MLLPCGSCFSGSLTLIRSPNRQARRSVALMTVPPATPPGAATPL
                     VRHALLGALATTGALLAASYVFRVKLIEFFIWKTHRLRVRIGSIARRKRGSYELHRVR
                     LLAPPPPAGVGEREACSVRLIETKFDEGAALRSFMPAWMKPGSETAAVGVDVELHEPQ
                     AFLEFDNLELTDSNWRRLAREVASTRKAKAPKRSRDTATDATTGQKLAQTRRFALERL
                     SVAGSAHLRVASRALNEMLLPDLVLSGGEIRLLELSRSPSAACAELERIAAQRMLTGN
                     LASGINADTRRRLEHYARIVLSKTTEELRMRSREHLDRIEQLLRETRKTLDGFSLPSS
                     QRDKLQKQSERLQKNLRRANEWIGGLDRPEKLASPEKKPVTEKEEPSSVPGGDAQR"
     gene            <1013675..>1016710
                     /locus_tag="CYME_CMQ393C"
                     /db_xref="GeneID:16996361"
     mRNA            <1013675..>1016710
                     /locus_tag="CYME_CMQ393C"
                     /product="chloroplast preprotein translocase SecA subunit"
                     /transcript_id="XM_005538221.1"
                     /db_xref="GeneID:16996361"
     CDS             1013675..1016710
                     /locus_tag="CYME_CMQ393C"
                     /codon_start=1
                     /product="chloroplast preprotein translocase SecA subunit"
                     /protein_id="XP_005538278.1"
                     /db_xref="GeneID:16996361"
                     /translation="MFHVTYPFTQRQCFLRSREACLATLPAGAFRKHLWRPSCWSFRT
                     RLRKEASLRKSTVLAPLTRRLQLSLFGLPERFVRKSKSPVSAESSVATELTRDRVKDP
                     TLAKYWDTLLEINALEAELEQLKSDELRARLDALRRNDSVRSGDPPLAEVFAIVREAA
                     RRTLSMRPFDVQVLGGLALFHGCVAEIATGEGKTLIATMPACASALAARGTVLVVTVN
                     DYLCRRDFENMGPLYRSLGFSVGCVTSATERAARQRAYACDITYVTNAELGFDYLRDH
                     LVLSAADQVLVRPKPFYFCLLDEADSIMIDEARTPLIISQAAEAPTEKYATAAKLAAN
                     LQRDRHYTVYEKERNVTLTGAGYEACEEALQVPTLFAAADPWAPFVLNALKAKELYQR
                     DIDYVVRGDQVLIVDEFTGRVLQGRRWSEGLHQAIEAKEGLAVRTEPRTVASISYQSF
                     FRLFPRLAGMTGTAATDAAEIRETYGLEVVVVPTALPVVRRDYPDVVFRTSRGKLLAV
                     VAEIRRLHLRKVPVLVGTTSIEASERISALLSEGERVPHEVLNARPENAERESEIIAQ
                     AGRLGAVTIATNMAGRGTDIVLGGNVSSLARALLQRELLATFALGPECSSGAGDRAST
                     EHFLSCLEEAEHHQLHCFGEKIAEALRSQRSTDPGPRLIIESMEQLHQLMLQAAEFQE
                     PTLPFSAEAQELVREALQWLEKQLRPRLDAERAAVLDLGGLHILGTERHESRRIDNQL
                     RGRAGRQGDPGCSRFFLSLEDPIFRVFGGDRMARLAEAFRLDETTPIESVQVARTLDN
                     VQRSIEQYYAGIRKQLFAYDEVLSQQRKVLYRQRNRFLEADEALLFGSDAAAARASGV
                     LAGLAGDWIRTTIQDILQANRRDPAKCVQKLKAFFPGALLNESMCQSAAAIDQVAAAV
                     GVRLSQHRRMLQQSAPQQDVAVFRYLALVQHDQLWSEHLRKLALLRDMSSLQTLRQVD
                     PLQQYQQDSFQLFEQMMAQIRRNTVYSFFKYSPGPTVSA"
     gene            complement(<1019153..>1020322)
                     /locus_tag="CYME_CMQ394C"
                     /db_xref="GeneID:16996393"
     mRNA            complement(<1019153..>1020322)
                     /locus_tag="CYME_CMQ394C"
                     /product="probable platelet activating factor
                     acetylhydrolase"
                     /transcript_id="XM_005538222.1"
                     /db_xref="GeneID:16996393"
     CDS             complement(1019153..1020322)
                     /locus_tag="CYME_CMQ394C"
                     /codon_start=1
                     /product="probable platelet activating factor
                     acetylhydrolase"
                     /protein_id="XP_005538279.1"
                     /db_xref="GeneID:16996393"
                     /translation="MALQCEATAPGEQRIQFPVGTIVRWICSQVLVRFYYPAAIVGDG
                     GLPTKERAHWIASPQALYVRGYSRFLGIDFRPVWWTLRCLFGSIRMEAYPDLSPATER
                     RWPVVILSHGLGGTATAYAKLCCALSAHGMVVLAVEHQDGTASATLTRSGTALFYRKP
                     NLRDPVGKRKRARKEQLEKRCREIQTLLEWLQGTEPATAEEDRLQLELLKVCDAKRIT
                     LCGHSFGGATIAQWLLSPRADQFSLHRCLLLDPWFWPLLNETEIENGNEGRREPTQEA
                     SSLPLPTGAIAPSLLLVNELFSRSLSPTERRALQLWPATHRLMLRGAAHQVQSDFEHR
                     LPRIVTRFARLASRQDPSRLFQTQLDLIIAFLDGDEARWVATLEREADLVVPLEP"
     gene            <1020643..>1021830
                     /locus_tag="CYME_CMQ395C"
                     /db_xref="GeneID:16996394"
     mRNA            <1020643..>1021830
                     /locus_tag="CYME_CMQ395C"
                     /product="26S proteasome regulatory subunit RPN9"
                     /transcript_id="XM_005538223.1"
                     /db_xref="GeneID:16996394"
     CDS             1020643..1021830
                     /locus_tag="CYME_CMQ395C"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN9"
                     /protein_id="XP_005538280.1"
                     /db_xref="GeneID:16996394"
                     /translation="MNTAGGAKEYIDQKAVEDPARYGELADLYDKRLWHQLTQCVVAL
                     VEHWQETGVQSEEALAFYYRFLRDFETRLNPLSLTQVVIGLSRLVHRQNARNAAAFLR
                     ECLGEKAPVEHSVAARTLYLSELIRLLLRTGDDSAVDEAKRLLAEASSLVAATTGTLD
                     PAVSSAYYRAASDYYKAIGSAGEFYHHALAFLSCTPIEVLSEAERVEWALDIGMAALL
                     GKDIYNLGEVLQCDVVRALAEQDERKWFHRLLQAVEIGDIDEFERIMEREVTEPRLQE
                     LLRTNRATLSQKIRLLCFTRMASFDAVYAGKIPFSAAAKECRVTLDEVEHMVMKAFSE
                     CLVQGSIDQVDGTITVSRVRPRVLNRQDVSKMIEYLKAWEMRTDEMLQSLQTEAQELI
                     TPS"
     gene            complement(<1024292..>1024963)
                     /locus_tag="CYME_CMQ396C"
                     /db_xref="GeneID:16996395"
     mRNA            complement(<1024292..>1024963)
                     /locus_tag="CYME_CMQ396C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538224.1"
                     /db_xref="GeneID:16996395"
     CDS             complement(1024292..1024963)
                     /locus_tag="CYME_CMQ396C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538281.1"
                     /db_xref="GeneID:16996395"
                     /translation="MVSFKTWLPWRRLEGAQLALCAYLFLKGAVVAFIFSWNVTGALY
                     MLSGLTGFTPALLFLVPLGCREVWKLYAFCGFRYCDGPRRLILGWIMNTLLTTPLSTG
                     LLLYTSQWARTAARRTLPAPVPQAPRGRAAVTAYGRRRARLEASLHRMLQVLLAWLVG
                     VDVRTLVCSINFFTRDEEVRWIEQIGKRAVPESLIVPQGVGRTMGAAEIFLELSRSFY
                     GLPLS"
     gene            <1025434..>1026315
                     /locus_tag="CYME_CMQ397C"
                     /db_xref="GeneID:16996391"
     mRNA            <1025434..>1026315
                     /locus_tag="CYME_CMQ397C"
                     /product="probable S-formylglutathione hydrolase"
                     /transcript_id="XM_005538225.1"
                     /db_xref="GeneID:16996391"
     CDS             1025434..1026315
                     /locus_tag="CYME_CMQ397C"
                     /codon_start=1
                     /product="probable S-formylglutathione hydrolase"
                     /protein_id="XP_005538282.1"
                     /db_xref="GeneID:16996391"
                     /translation="MTAASLVSSTLCFGCKVNQYRHQSKALGGLEAVFSVITPPEVDV
                     EQSKPTPVVYYLSGLTCTDQNFIQKAGACRAAARLNLIIVAPDTSPRGAGIPGEDDSY
                     DFGTGAGFYLNATEEPYRSHYRMYAYVVEELPEVVRELFPSPTGQRLCSITGHSMGGH
                     GALVCALRNPGKYRSVSAFAPIAHPTACPWGQKAFRGYLGSVEAGRVYDATCLVQDAS
                     IVKACNLDDILIDQGTADQFWREGQLRADDFVSAARDAGQKVTLRMQEGYDHSYFFVS
                     TFIDDHLEFHAARLRRL"
     gene            1029074..1030832
                     /locus_tag="CYME_CMQ398T"
                     /db_xref="GeneID:16996392"
     misc_RNA        1029074..1030832
                     /locus_tag="CYME_CMQ398T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461578.1"
                     /db_xref="GeneID:16996392"
     gene            <1030852..>1032030
                     /locus_tag="CYME_CMQ399C"
                     /db_xref="GeneID:16996414"
     mRNA            <1030852..>1032030
                     /locus_tag="CYME_CMQ399C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538226.1"
                     /db_xref="GeneID:16996414"
     CDS             1030852..1032030
                     /locus_tag="CYME_CMQ399C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538283.1"
                     /db_xref="GeneID:16996414"
                     /translation="MFVIFGTGLRRCTNRFTASGVVGQLPHKAERSACRQRSARTLAR
                     LEQRRRENVPGDVYVTSGCIDCDTCRWMAPSIFDRVGSQSAVVHQPETDAERVRTLQA
                     AAACPVGTIRTESPPPAGLSKQAREAFPELIATSGDERSGTRVYHLGYHSAKSFGATS
                     YLVLPDGDRWKDAAFMTDSPRYFRPLADQIEQLLKREGRQLRYIFLTHVDDVADHEKW
                     AERFQVRRIMHADDIDDADERSTLASIEIPLTGSGPWLLTPESVTKWPAGAASPAPDR
                     HGVKIIHVPGHTRGCIAAIVDNYVAFTGDHIAYSETRNAVTGFPQVCWFDWSLVIEST
                     AKLAEEAFVWIMPGHGRRYHYASVEAMRQGLTESIALMDSDLYWAMVPYRARGRVRSS
                     "
     misc_feature    1035145..1037731
                     /note="repetitive element"
     gene            1042287..1044075
                     /locus_tag="CYME_CMQ401R"
                     /db_xref="GeneID:16996415"
     rRNA            1042287..1044075
                     /locus_tag="CYME_CMQ401R"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_002461579.1"
                     /db_xref="GeneID:16996415"
     gene            1044929..1045082
                     /locus_tag="CYME_CMQ402R"
                     /db_xref="GeneID:16996416"
     rRNA            1044929..1045082
                     /locus_tag="CYME_CMQ402R"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_002461580.1"
                     /db_xref="GeneID:16996416"
     gene            1046901..1050315
                     /locus_tag="CYME_CMQ403R"
                     /db_xref="GeneID:16996417"
     rRNA            1046901..1050315
                     /locus_tag="CYME_CMQ403R"
                     /product="28S ribosomal RNA"
                     /transcript_id="XR_002461581.1"
                     /db_xref="GeneID:16996417"
     misc_feature    1050785..1053636
                     /note="possible transcribed region"
     gene            complement(<1052579..>1054084)
                     /locus_tag="CYME_CMQ405C"
                     /db_xref="GeneID:16996432"
     mRNA            complement(<1052579..>1054084)
                     /locus_tag="CYME_CMQ405C"
                     /product="unknown protease"
                     /transcript_id="XM_005538227.1"
                     /db_xref="GeneID:16996432"
     CDS             complement(1052579..1054084)
                     /locus_tag="CYME_CMQ405C"
                     /codon_start=1
                     /product="unknown protease"
                     /protein_id="XP_005538284.1"
                     /db_xref="GeneID:16996432"
                     /translation="MMQGRIGFSFCPNWQQGVNEAVALRCARRALPTDHRSTLCNRGT
                     LRHKRRCYGVLPVKRGAARRLLWCSSSSESAYEDSAQSLRKGAEVARTSPAHAASGSV
                     TPAKPSSASNSIWQPDYSTERPDWAPAWLPAFVYRMPALVQVVVVLAFYAFHLLVLSR
                     HSWAPPGAFQPLLRKIVLAAPHTASFADPLDKPNAKAAAEALEAIASGKEPVTVGYDS
                     IAGLVLILVILWFRWMARKRNPQRYTVLPPLIRPMPSRGLPWELPKTARSKIGMTTLM
                     LLGAYLLSGYGAVVCEQVLLFLSVIGLPLTVPTLRALKVLLGHLMWVFMGVKILGNNL
                     KPFFPPRGKWMRARVHSNWCWWAIGVYYVSSLLFNIADFVNQFIVPQNILNEESVVSK
                     LIHPENQDGIAMAIGSIGPCITAPVFEEVLYRGYLLPAIACFMPVWLAIPVSSVLFAA
                     HHLNLGGMLPLSVLGWAWAYTYVMSGNLFVCAFTHGLWNSRVFLSSLLGFD"
     gene            <1056126..>1057742
                     /locus_tag="CYME_CMQ406C"
                     /db_xref="GeneID:16996433"
     mRNA            <1056126..>1057742
                     /locus_tag="CYME_CMQ406C"
                     /product="similar to splicing factor 3a, subunit 3"
                     /transcript_id="XM_005538228.1"
                     /db_xref="GeneID:16996433"
     CDS             1056126..1057742
                     /locus_tag="CYME_CMQ406C"
                     /codon_start=1
                     /product="similar to splicing factor 3a, subunit 3"
                     /protein_id="XP_005538285.1"
                     /db_xref="GeneID:16996433"
                     /translation="MNALTALDSALNEFEQLASEWCTLVRLLEAAELARVRVERGEWA
                     PWWNARRIVLTRLARRWSRHLASKSTAACVTSLRSLQQSVVPSSRPAVTATSTNEGLI
                     ATLRQKAREPLSPLSAPLLGDTVEELPLMEADLDLDFTSAEVSGLCLDLQEVYRSYLS
                     LLPPLIASQLPYLRFLEILEALPRSNELRALVVFRRLDGRCLPPECLDASALEAACQK
                     LSPGCRNAYAGWLLDVLRYLVEFARRAMPWLSPAHWDRMRSTGRKIPSIVRTKREAEA
                     LNTPRPTKAILRIASASADQRPDHDSMPSSKHSTHVDTVNTPVDVWLGQELDQSVAPN
                     LADIETLEQHLASLVTDDECGIFRASLLRTIRHVERQQVQTLTEWMFTNRVEQVTRED
                     LATERSGQWFLRAGPPDADASNTTGIKINKSTAVTSKEETENFPGWLRRAFALHQVYR
                     CEICDPVQTYYGPLAYERHFRSAVHVRGLHRLGVYYTADWDYIDTVADALRLKAHLAK
                     LNDSGQVGIVAVEREADGAPMEASTGSSRT"
     gene            complement(<1058782..>1064988)
                     /locus_tag="CYME_CMQ407C"
                     /db_xref="GeneID:16996434"
     mRNA            complement(<1058782..>1064988)
                     /locus_tag="CYME_CMQ407C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538229.1"
                     /db_xref="GeneID:16996434"
     CDS             complement(1058782..1064988)
                     /locus_tag="CYME_CMQ407C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538286.1"
                     /db_xref="GeneID:16996434"
                     /translation="MPDPLEEREALWYQLQRAQVAAADLESHAHSWTRDLNWVLMEST
                     LVPGEDSGPTPPSLVVTLTAARLMVSRERAREVARRLARQPPFERAATEPFPPVSTPS
                     STGTLTEDQVTWLENRYLRFVRATLGTLWLLLEHAADSDSALALAARQALHRLELGNV
                     IELLGRRAVEGIHGRYGVQLERAWHLECLLRFALMPSSLLGTEAAAQLDVLWDSILER
                     LFVALNARWFLIDDRTASGLAVCIVAVLLCRMHSSGTRYRWAHPVVVVSTTEELLESL
                     SLEASTEPSLPNADRYHRSGTLTRLLAFLCVLAQTCVASSERFAGAPDGDARQRGIDS
                     EAETPAMEAFIRDDLLELALAAVQELLDGPLAASAPAWRHRLATCNTDPAWALWQAQQ
                     SLLQARTVPVRVLVWSTPNPVLLEHTVDAMAVCLQQSKQLSRSFWKAVWFGATDTATA
                     HMGDAPYWERSATAARFWRELCMLLPLTATYVFRVAASAIQEPLGAFLAFQFFQQECV
                     SFAEPWKIAPAYVQTMDTHPARDESGLVVHRLQTSAPRQVLETPGLVLPQGSQGLWYA
                     DFDAAIWKVHWDGLLLVPECPAGLALFHRIGWVLFSSSGVMQMERLDLPSPQAPGQEP
                     DGTDTQQQQQQQQQQFLGAHKATLSSIQDACNDTATLNRYLQDTREQLWIWLETHWTR
                     LRRVLMDYRQHRGERELHTTLASLPKAQAMATLMTIICNRYASSGSSAVEQKLFTQAV
                     DLLNPAAPVPKDEAEALWLARAWMQLAFIPSPWHHWLVTLPADLETEAQRSPATLLES
                     VQVRYALVTRALEKSLPPRKSATKRERPAGASTWNGAGGYLVPTGSNAPSALEWPWWQ
                     HQTLLDQLWMHAWRVVHTVDAIQTELMMHHSRAAYVLPSAVTNLSRAEVRHASEFTAA
                     ALSLVNCCAGMCQAVLCFQRTMLTVRFSRTWSREALVRIASDEVSRGADFAGSQHEPD
                     HWLLQGRHAKHLPALWRFLWRTLHPQAPALAHFETGPACRARTELIARGIAADIWDIW
                     ALLHLGVRECLDASIAEADALSELWPTTWWPDFFPLVQRALQVDPEPVLCFLLAALAV
                     DQPVLLDNPNAAALLVSWGSVTARVSQQTEERSSSAERRASESPFSSPASGVLRSSRL
                     WQLLWDEWRCFIPTEQRVNLTELAPLGALFVRLGLGQVSTPEVESWLTMLFRDMLIPW
                     RKRILAKAPDSVTAVAVFTTSIVLACFLELVNRLWMRSRPTQGVQRKLVAEAAPKSSA
                     MNPALVSAWTELITLLCRVPTDDIETPGKGSATCSPPASIGETEESQRVLWPEGQILW
                     NKHYRSDVTGLWSVTTLLVLQTILSRDLDVEPQNRRKEALVLQSLATSDQLWIPWLHQ
                     TVLATNLELLLCVVEAPQPSTERPVLTLPAQQASWSVSLKRLEQVLLRLCASDTGTGL
                     GAMRRLAWTELIFRLSRLEAAVTGDNAASCRTTGIAFAASAALDMQRMQSHVRMLLQT
                     LERQLDRLEASVMSEMKGTDDWYPAGIQSWRLLRPDAETSSVEVLLEVGVTERLVLAL
                     CKQVVHGGLHREAASTIYAASELAYGEGLLQRLLERSARWPSLQPATALLCQFWFSPA
                     RLDETEWAKRFLPVVFSALCAPVTPPNKQTHRWWLVLLLLNWAVRSARCADVIIRQQQ
                     GLWSLGRLSSARIHQRLTPDGKRPTSDFMMYLMLLRLYAVLLQQARAHTTAATQQRLR
                     LEVYAFVSSFEGAPTQLAAFTRHWLDTALRLSESETRQAWSTTYAWHWAMLSEFSAIA
                     GFLEALLTSPPEADLLPELESQWSPEWLQQRYQQVGLSLAAALRCLRMAPRWLSLPLP
                     DLGMWTHASLRGSLAEYPLMLSSSMKDGIGERHTQTSISGTLTIVQETLADKLEQAMG
                     RLISIALHLTGHYGVWAPMMTWTDLETPTMGLGLMLVLHWLQGLNSSSEMPQRQRRRI
                     LLLEGSLLLFLKQLVHHNEHGTLPLGFAEECGKRLAGLEHRLRSQAEDVLPSTQRSVL
                     LRMLQAVETLLLVRGRTPDTISWSKMLLRKQELAHHGLRSGFAAYATNKNDA"
     gene            1065177..1066695
                     /locus_tag="CYME_CMQ408T"
                     /db_xref="GeneID:16996418"
     misc_RNA        1065177..1066695
                     /locus_tag="CYME_CMQ408T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461582.1"
                     /db_xref="GeneID:16996418"
     gene            <1066940..>1068502
                     /locus_tag="CYME_CMQ409C"
                     /db_xref="GeneID:16996419"
     mRNA            <1066940..>1068502
                     /locus_tag="CYME_CMQ409C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538230.1"
                     /db_xref="GeneID:16996419"
     CDS             1066940..1068502
                     /locus_tag="CYME_CMQ409C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538287.1"
                     /db_xref="GeneID:16996419"
                     /translation="MVRGRVSHSQPSPVLARVRRSSRRRKRGFFLLVSAVGSAFLIGL
                     WLGLKLVSQSQRAAASTSITQRKESLRQVSIPSIGRASDASLCGVLPAPCSGHGECRI
                     QQGLPTLYPAPEGNVALPSELPPNSVAFCACDAGWAPPACDRPLCPGGGHCSGNGVCL
                     QGTCVCEGAWGGEACSELQPGTATMTTAAPCPRDADTGLVCGGPQRGACVSNGTCVCH
                     APWTGTLCENQAFRTVYEFARRGAGTLQPCQVSPSPQATPFIVAALPPAEAGRRWLGF
                     QALLIPTNHEPYFGTKLPWLCIAYDLAERLSSNSIVSAFDIVVTRWIEMLISGERAWQ
                     LTAAMYVPANWTLDTFLPRYVMQILPIKIGVPVRIEDVRIDGEVSLIIANDSERASLF
                     SAQVTRTTTATRNASSVSVVEAIGIAAMGALTFVAVLAAVFGIDAWLQRRRRSLQHQQ
                     RYADGDTSANSSAATSPPLPLGTADPAAMPSAPPADRAPDSTPLGMNLEELVTISLSP
                     ERPWKYRSWRHR"
     gene            <1070528..>1072210
                     /locus_tag="CYME_CMQ410C"
                     /db_xref="GeneID:16996420"
     mRNA            <1070528..>1072210
                     /locus_tag="CYME_CMQ410C"
                     /product="probable 2-methylthioadenine synthetase"
                     /transcript_id="XM_005538231.1"
                     /db_xref="GeneID:16996420"
     CDS             1070528..1072210
                     /locus_tag="CYME_CMQ410C"
                     /codon_start=1
                     /product="probable 2-methylthioadenine synthetase"
                     /protein_id="XP_005538288.1"
                     /db_xref="GeneID:16996420"
                     /translation="MFDTPSAHLLPSNPGSTTATIGAWRAEQLELRFRWQAQHMRAFI
                     TNSVWTFRCPRFGHPLGPVEPYATDLQRRLHRYLRPALQRATCRLVEDGLEAPSRQHD
                     GLEVDSRAPIRVAVVAMGCAKNTVDAEVFLGDLSAKGFQIVSENEPADAIIVNTCTFI
                     DEAKSESISAILEAAARKKSGTRALVVTGCMAQRYADELAKEIPEVDAVIGFAAYNQL
                     AEQIQRLVRKQHRMEKQSTVQVGAVDVPFRPEYRRHRLGASHTAYLRVAEGCDHQCAF
                     CAIPQWRGRFRSKPFDQLVEEAHHLVERQGVRELCLIAEDTNMYGMDRGPETPRLAEL
                     LRYFQRELVPRGLVWIRLLYCYPSYFSDDLIAAIAECPAVVRCIDIPLQHASDAVLQR
                     MRRPLMSHTSALLNKLRQRIPNLKLRSTFISGTPGETARDHQQLVRFIQEMRFARAGF
                     FSYSAEERTPMAEMEDQVPPQVQERRRDQLFSLQQTIQEQIAESLIGTEIDILIDRSE
                     GGHLVGRTFMDAPDIDAVAYVLQNDWEPGSLVRARVVSTSGWDLLCVACPLP"
     gene            1072595..1074438
                     /locus_tag="CYME_CMQ411T"
                     /db_xref="GeneID:16996439"
     misc_RNA        1072595..1074438
                     /locus_tag="CYME_CMQ411T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461583.1"
                     /db_xref="GeneID:16996439"
     gene            complement(<1073003..>1075141)
                     /locus_tag="CYME_CMQ412C"
                     /db_xref="GeneID:16996440"
     mRNA            complement(<1073003..>1075141)
                     /locus_tag="CYME_CMQ412C"
                     /product="similar to psbB mRNA maturation factor Mbb1"
                     /transcript_id="XM_005538232.1"
                     /db_xref="GeneID:16996440"
     CDS             complement(1073003..1075141)
                     /locus_tag="CYME_CMQ412C"
                     /codon_start=1
                     /product="similar to psbB mRNA maturation factor Mbb1"
                     /protein_id="XP_005538289.1"
                     /db_xref="GeneID:16996440"
                     /translation="MFTSIGLGWGVGSLISRAKLSRLKAPGTGEVCSGRTRHPFWERS
                     KRACVTLRAEEAVSAPHVNPVTVTRPHNVPTADEDSGPDLSRSRNFGSSVKPVASSST
                     ALASDDFGATAAVLSAHPEATATVERPRKPGRARRQQALAQQAREDAEAVIRDVRREI
                     RRRNWPTAERLLRALVDREPTNGRAWLLLAQLYAYRLRDLEKARATFAAALQVNCTNT
                     RLAHAFAMFEARCMQNTDAARSLLDKALKIDPSDGVIWQAYALLEERTGHSERAQELF
                     EAGLARDPRNVFLLQAFGMFHLRNGASVEACAYFERAVESNPSHVPSWQAYGIALSKQ
                     GDWEHAAAKFEQALRLDPVSVPTLQAYGIAEARQGHYERARNLFQRAAELWPSHVPVY
                     HAWATMEDRLGNHEEARKVFERGILAAGGRVDDVRRVRSELEGAKRTDPMLKAWADME
                     QRLGHISPAPEWNVYRSNRSDPETRERRRETIGERLLMLRKLIDRRSEEDLRTVLTFI
                     AERTRMDRQARAAITERSRDDLDRVRRWAERRNEEDVRAFQKWFEKRYEEDRLVGQYV
                     FGWNLGPPLRSTVVSSPSTENTGGGDSASAVPPEWLRAAPMPRPLSEYEKELYSGERE
                     LQLVPAMAWISSFAENLSSRAAISTLLLGLMMFLSVGFAHIYELGRYEIGNVESTLLQ
                     ILSTRVPEGVDAALIDLNPSALDDIAAEHW"
     gene            <1075761..>1076927
                     /locus_tag="CYME_CMQ413C"
                     /db_xref="GeneID:16996441"
     mRNA            <1075761..>1076927
                     /locus_tag="CYME_CMQ413C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538233.1"
                     /db_xref="GeneID:16996441"
     CDS             1075761..1076927
                     /locus_tag="CYME_CMQ413C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538290.1"
                     /db_xref="GeneID:16996441"
                     /translation="MGCTCGEAHSLDRKRLQCAIRTCTRRGAKTGRSEQAKQVELPGT
                     QFPDSVKDWCRPYREPEFSLDDTRVYTRPHGNPEVGCYFRRVDYVALDPQVARSGRVW
                     QFVQCLRSHACYSTRDEVASFVVVGILCDCLRQPRARLNDMGALMGTDLGSMASAQRF
                     GNGRARFCTDAVPDAVASLADGRDANAPAANRETDTSAPSGNGMLARGRASPARRSAS
                     SASLDPAQRNPECCQQCIPGASTAAFTSVGRPGELLTVSTKTSVRSRNGAGHRASVSP
                     TNSAYAKHGSPDPDENHDHHTGQFRLLHEVSSLSPAPTVGFLVGDSAPRPLRMISDLL
                     EKLVTEGRWVAALMLVSGAFIMSCGLVALILALLLRSLYVTLFLKQKHPLGFLS"
     gene            complement(<1077145..>1078107)
                     /locus_tag="CYME_CMQ414C"
                     /db_xref="GeneID:16996442"
     mRNA            complement(<1077145..>1078107)
                     /locus_tag="CYME_CMQ414C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538234.1"
                     /db_xref="GeneID:16996442"
     CDS             complement(1077145..1078107)
                     /locus_tag="CYME_CMQ414C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538291.1"
                     /db_xref="GeneID:16996442"
                     /translation="MRARTLPYACIPERASKCESFCVWTVRKAACIHWLFEKPFWVQA
                     TGIGVDSARFTGTKEGRAWRSFFFVMAGNPDAPRDTPVVTCYASSSANAPEHYQQAAF
                     ELGVAIAKRGWSQRNGGGRFGLMGKLTEGALSVGGRVDAVILDIFRVHNCHPELPSVR
                     TVTNMAERKRGLYLDSDAFVALPGGLGTLEELAEVLSWRQLGFHNKPIVLFDVDGYWE
                     PIVEWMRAAASLKMINAHFLHHGGVRCESTAEGVCDAIEQAWRAPAPSLEDAPSRCKI
                     ADRMTAGTRDKLDTDGTAIDAAADWTWTATYPSVDPARSRRAIG"
     gene            <1078491..>1079306
                     /locus_tag="CYME_CMQ415C"
                     /db_xref="GeneID:16996446"
     mRNA            <1078491..>1079306
                     /locus_tag="CYME_CMQ415C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538235.1"
                     /db_xref="GeneID:16996446"
     CDS             1078491..1079306
                     /locus_tag="CYME_CMQ415C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538292.1"
                     /db_xref="GeneID:16996446"
                     /translation="MFQVVPAIQRQVPGHQSGYSWATRLEARRRRQLRAGRFTMLWPF
                     GALEKRRRAFAELFTNPNFPPSWPYTASDFERLDESPDELFYTQPRFVTHIDDDAIAA
                     LKSFYGETLRDGTDLLDLCSSWISHLPEQYRPRQVVGLGLNDLELKKNTRMDRWVVQN
                     LNENPVFPFADDSFDYVTCVVSVDYLTKPLQVFREIRRVLRPGGMAIIAQSNRCFMQK
                     VIAIWLSTNDLEHAYIIGSYFHYAGGFENLLARDISRGRGDPMFVVTATKQRT"
     gene            complement(<1079773..>1080318)
                     /locus_tag="CYME_CMQ416C"
                     /db_xref="GeneID:16996447"
     mRNA            complement(<1079773..>1080318)
                     /locus_tag="CYME_CMQ416C"
                     /product="similar to Sm protein E"
                     /transcript_id="XM_005538236.1"
                     /db_xref="GeneID:16996447"
     CDS             complement(1079773..1080318)
                     /locus_tag="CYME_CMQ416C"
                     /codon_start=1
                     /product="similar to Sm protein E"
                     /protein_id="XP_005538293.1"
                     /db_xref="GeneID:16996447"
                     /translation="MPKDALDRRIVPEQLLATLARQQARVEVWLFENTRYSLEGTLRG
                     FDEHTNLVLVDTVEQWGSTAKHKRRTVALGTILLKGENVVLVRSLGMPTQRKEVRLGD
                     GSMACTGLEMALAKMKKCAEAVVTIHSKQYADPATPESELPKSYHVKLCGFTNGKHGY
                     EMSPQEKIEATRRHKEIGNKL"
     misc_feature    1079996..1081563
                     /note="possible transcribed region"
     gene            complement(<1082339..>1084225)
                     /locus_tag="CYME_CMQ418C"
                     /db_xref="GeneID:16996469"
     mRNA            complement(<1082339..>1084225)
                     /locus_tag="CYME_CMQ418C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538237.1"
                     /db_xref="GeneID:16996469"
     CDS             complement(1082339..1084225)
                     /locus_tag="CYME_CMQ418C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538294.1"
                     /db_xref="GeneID:16996469"
                     /translation="MNAHHNDWTPDKVLDTVREYVDAGALSECAALDLLERLPLPLLG
                     WTLEEYAVRASLEASDSDAVPSDNIFDSIRVLTKTMEKLVKLSATSARVRHLVPIEQV
                     LQLIQLGLSSRYPLVRTAALRLLCLLLERNDLPEAFCQQVADTIIERFESTNELRPEI
                     EAAQAPGPEVNAPSTTAQHASDILSLVLLSFRDDPSTEAAGLCEKILKNLVQLKPFRG
                     AVVLFSEARGAQILVQEMLSGAAGAVAHIRALSLLLEICDYSSVAEIAARRLLPTVLV
                     AKIAAPVRLDEDLLLRLNLLDVLGAFMQRSAIAAELLDQISVFDVLLRQHLAHLLAPD
                     EPASSDLAERWFIWMCGILRFVRTSAGSSRCAFHAWMDANLVEILGRFLLVHVVDGET
                     ETAHWSVQLDQVRRTTLLVHLISAVGALGLCERGMDVLLADVDTLKLTLRFIHTASVC
                     DIRVASLRALSVFLAGLDEPLSSAAVSGYGASESDLEFRQQRVLHLFTDAIRDADAVK
                     AFTNALPIVLDCARHPSEEERLAAAAVFAALSLSRIGVVALASMADFVEWLCDPTDAS
                     LEVLEAKMRVARRLVELHASAGEVAFGALKWSRIVAVVSNRSDPRAVRQRRVPAVNTA
                     TLNR"
     misc_feature    1084403..1086911
                     /note="repetitive element"
     gene            complement(<1087203..>1098083)
                     /locus_tag="CYME_CMQ420C"
                     /db_xref="GeneID:16996470"
     mRNA            complement(<1087203..>1098083)
                     /locus_tag="CYME_CMQ420C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538238.1"
                     /db_xref="GeneID:16996470"
     CDS             complement(1087203..1098083)
                     /locus_tag="CYME_CMQ420C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538295.1"
                     /db_xref="GeneID:16996470"
                     /translation="MLMASATKTAGESAQERPPDVPVVFRERVLELGELTAEIPTLFL
                     VHLQRTRAASPTEPLVVRISVEGPLAPFICFQRENANWDVPYAQQNALFHELNLTETF
                     QVPKTAETEPLPVIVQVKPELVRQAGFSFQRVHGLINLTSVPDGTLLCSLPVNGRVIR
                     SLLTFTLDSRPDATAPLQRDTGGEERATGAASPRTPTDNNSGRMDQSSGDLRHAATPV
                     NAKATQGIESGPSVEKTLLLEVPVSQTTTAKDVLLWNQSELATQFSLQIQPKSGSLTC
                     TDLESGVPLGPGPHRIGGLQYRRLRFALEATECGRFQYTVRCLNWRNPENQALLSIHC
                     LCGIQKPATLAVFRLAEQPASVAIDELDFGDVYAGSTVARDLVVQNCATDATILISMD
                     QELAARWSIVPVAPVEVPAKEARPIRIVYQPPLRSQAVIAAVDGRFVERRFPLVFWVM
                     LRTSEVPERTRAQRVAMESEATTPGSPSEVLEHVFPGPAGYTDDTGLLGSDRVCGTST
                     GSAASRVAASRFPLGDEQQEPLIDSAVSAPDAGLQSAPERASLHALSASERTMYEQQQ
                     HQQGNGAELRSDLLDGSACAPSTVPAGAAAWMPAANTSSATSGEEVVPFRSLSGRDAL
                     DDGEVLAQRKILYGRARVSESLVRVHPTEIHLGDCYVESTVTTSVQVVNLADLPAFLS
                     VRFSSTSLRVASLEPIIGPRQIYDLRIDFTPHRVNPDYSKQLTILNLRNPRDEHVVVI
                     RANCVDRFRVLYHALFYRLATERSTQVNELDYGNVVAGHAYIRAFQVRNLTDKRLVLG
                     FTCPARPHVELLADPRFERAQPHPSISEKDASEQQRQPATLPTEACLPHAALADAEAA
                     APAPAAHVVADGVQLQCSARTSGNEACTATEATEAAAPASRARTQWRNTGVETQSTEH
                     TEEAMALPGTAAAADSTTTGTRLCTPVRNASAGEHSSDASRTGASQLLQPSRHHRRRY
                     RHSVRLRQTVRRRRSQASSDSDEETLSETSDSNELGRNETSPVSLRAADIFAQLMRMP
                     PAIPSFFSTAEAEADFIRESLRPAQALVQACDAGLLRRIQQQQLEIEPNAEATLYVVI
                     QFDAADRRLRTKLRPFEERLYLHLVDYDQSRLPLTPTRLHASSLPPRELVLRGRVCIS
                     RMEVAQPHINFGGIVAGEQRSKTLLLQNVSEMPAFYAVRKSGSVDSSYLHFGSDRRGV
                     LRPFSAKEVPFVFRPSFHGAFEECVWIVNLLDPSDAHPVTMKALVHRRTHFVVRPLQL
                     DFGSVSCAVAPGAGIRRSFQLQNCSDRRRVFVIEQDAADQRTTATVWLAVDALESSMS
                     IRVQPGESRPAFLPGPGTEATETATPSESVVHSSVYDGESRAHETPDNERSACGGRVA
                     EAALAESVAASMLPQAHEQEQALFAGAGAIPGSMQTSLDTNAAIEALEQKLRIAERKG
                     RTEKVERLRAAIAQQRTHQLQDADSSTRTLTQGESVTELDAPEAHSMPPENVREASTC
                     VSGMRPRAAPTASRRAATALHAGRLVVTLAPGQVARLAVSLTSVAGVRGRRQVSLRVF
                     EQRNRDEQQCICCSMEVWDSDPAVPPTATSDDAPSNVVPEQDVMATRSSAHESACNDT
                     VSSDWNGSPDSAGRWPAFAETVPVLPSTARRVERTGSSRLIQISPLVIAFGKVSLGQT
                     VTSRLTIQNVSDRKVAFSVLEDTQVALPATLLWSPMRGTVDVHGVAQVRLSFRPDRMG
                     TLSRTLVVTAWLQPATEALVGAPASRLVHATGRSGGNSGGSGGGGGGGWVGTSPASTA
                     PVETVRVRVQGHVLPRRALYLPQLESSAVELSSIGVQREAAPSSEPLRASSTVLVWDW
                     GDLALDPEQGGVCAVRSLTIVSRSDEPLMLQVRSNLAKQILLFTDAMRQTPFPRAVRV
                     APGATVTVHVGLAPRIPILELYAGVVRELVAGLLLRAWRPDPVQSEASLDAGCAQAAL
                     VDIATVKLKARAGFVYPVCLRSLVLVLGVTGPIAVTEADRGVRGRVADSVMESTDDVQ
                     DTQAFSTEENAIATIHYVQDTHAFTAEQRRGLRQRHPIRPAPELLALWPTATLQALVD
                     LNGKQSISSGIADGVTGSGERRPGLSHLFQTAWFRFGARGRLQIRNLSNGLSLRLQLR
                     YEERSVLHAFAGDDLGRSELGSEVTVDERRPDPAVPDDAPEDEDCEQQPSLVFAQQQI
                     TIAPQSQDVLTFEWRNCRRAALLEQRVRLENLAYSRRSYDLQLVFVHRVPAVQQDSRL
                     SRLHLELNEPCLLRADTMGQVRPGNWHIRWINDDSPSSSSSSAAAAAAAITTIATPQG
                     VSFRLYVDGFPEHWPWPHVACGSDSPPLSSSSATAAAEEEEEEARMLPNLTEPRLNGV
                     FWEAVPAEVLRYQLVPSLLHERERDLLREGSLVERRALLVAQLAGRYLDSVPVSLRYG
                     CARMALVTPTIDIGTIGYAQRNAPVVVHALLRNVGAVAARWRLPFSVLPPGVEAGPPG
                     ASPVPNEQQRPALETPHLEPSAIEHRFDGTRGNVSKDAPDAWHAASLEASWRPQATWS
                     SPHPDAESETLVPPSASADVMTPPVAQDLRDAYASGTRMGVPPHEAASADVDRRGASA
                     STSATAATSQLVPTQTRMSLLHEADASALEGQLEPGEQVWVPLVVRPAALSLGAGPFE
                     LLVTIENVWQPQEHLELRIVGQFSVRLIQESSPVLLNEQGHGTLAISIPEAARGDVQV
                     TWQTSVVPTGPYRDLVLQDRASSATLRSLTLASGEKFELAVVATPKETEHERVAGCSV
                     GGAEAAAAAPSLDLGIDSEPIAWIELALRRKQDAEAGPLERIPVYQGKRSLPMQQVMV
                     PADTSDAPPPPPTTSMMMMMMMSDTRASSQSEAREASNRDDLQTRDDRVQQSPVPLAA
                     AEEPHESRTDAAALEPVVVGERQAAAPRVGHPERLPLATSPQSDMTAATLATSSCTTG
                     AAAQAGVEQEPVSASFSAEASDAATAPGLHPKDTLSAPEQPMAAIDDSETHGDVFAAA
                     AAATTTTCVDADETAPQRGPRTFGLHGCADIGEHLYELDAGVVPLGSQAIQRTIIIVQ
                     RPLQRCMPVSTSVDPESESEASASTAEHVLEYKIHRVPTHWRRARPESTEWFALDRMG
                     GILERTRPSQTICLTMKPESLGFFQEYLLFTDRQSPANLALLRVRMEVVAERADASTI
                     FETSPREIDYGAVMLHHVYRNKSIRIRNLSDQPLEFLLRHDLDPQSRSELHFSTSNLA
                     LRKVTSVWVEKASSRRVFLYLRPEPESTETDQLCGSVVTRTFHLYVSCRLVRDFEECI
                     EIRCACHAPELRVSTNDVSFTVPNLAWQPMPSMQLFIETLVPGVHHLYELRSSALFFA
                     VTEVQPGTLSIEPRLSVVAEQAPSEKYIEEHCSIYNRRRPREFFWIRLRLHVGGGSGS
                     GSAVPEFSAAPPRTRVYVLEQTVSRFLCQFAAFWAPYQRPRTPGAGTDSMHLAVTASE
                     RGAGDLVHRLRARQHGQDRDEREPLIVWLERVRRATGVVGGAAGATIAYAALLFEAHY
                     CTDELVFYALRDQSDTVLQLALTCYSYIFKWDVFQVYIRDDETVAEALAPLVKFWYGQ
                     LRHFLSFFPDSDRVERHGVRMQGPLQALRQLAATEASPATASRR"
     gene            <1099079..>1100494
                     /locus_tag="CYME_CMQ421C"
                     /db_xref="GeneID:16996465"
     mRNA            <1099079..>1100494
                     /locus_tag="CYME_CMQ421C"
                     /product="mitochondrial ribosomal protein L4 precursor"
                     /transcript_id="XM_005538239.1"
                     /db_xref="GeneID:16996465"
     CDS             1099079..1100494
                     /locus_tag="CYME_CMQ421C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L4 precursor"
                     /protein_id="XP_005538296.1"
                     /db_xref="GeneID:16996465"
                     /translation="MVLRFKGLHRGAARVPVFRFAQLATGCRSPRPPQCLSSAAGLAG
                     LHQRCFHTTVLSRQRGTPLHHVRQTFRNTPGMMHPRCRAPSDNTYRQRAAFATLFETP
                     KRLVHGDVSATPTPTIAPGSIRLASDLERDSKVLVYRSLHRFEPSCFASVSRALLDAP
                     FRPDVIHRVVLYQRAAQRRGTAHTKTRAEVSGSGRKPWAQKGTGRARAGSLRAPQFRG
                     GGVAHGPRADRIWAQRLPKKVRWLGLASALTRRFQEGRLWVLERWCNGSPQEHAPTNI
                     CLDVSDSSDTRSNASTAAADSTEDALAGTSTTRHLQPSVALVHADQLELFLRERGWRS
                     LLIIGASLRDRSSVDDADNAQSVNITNRSISFADLDPGTAEGLWDLCGRLGRDSLSEW
                     HQLERAARNLDANVLLRTSLSVGVYDLVRYPHILITVNALRELELRIRGQSRVLVQAM
                     RLGSLRYALQPSLRQGSVGKP"
     misc_feature    complement(1100756..1102816)
                     /note="possible transcribed region"
     gene            complement(<1103693..>1106656)
                     /locus_tag="CYME_CMQ423C"
                     /db_xref="GeneID:16996467"
     mRNA            complement(<1103693..>1106656)
                     /locus_tag="CYME_CMQ423C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538240.1"
                     /db_xref="GeneID:16996467"
     CDS             complement(1103693..1106656)
                     /locus_tag="CYME_CMQ423C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538297.1"
                     /db_xref="GeneID:16996467"
                     /translation="MVLVREDPATRESNAPCSGVLDSNGPQVLGASSTELFAATLSVH
                     SPGGTSSSGAVVAVSPSSTGAEAGHDTLGAPSDSQANVTAEALSFVRRSRRRGGRARK
                     KPLWRKQDSAAVAADASGTTATESLTGLAAPPKTSDSAETVWRPPPLSKRERSENVFF
                     SALNEIRNAENGAFLFLDVSHCGVSNRKAKTLGMAIREAARKRRLGGIALDMGRNPLN
                     ASALEAFVEALLGADGSPLPTQELDGLFTVLDFSECDLYDNLEKGDGDESRHLVARPL
                     LRLLRSPACSVLAHCVLDGSRGLSEESAVFLLTALAEKPLATDARAGADTLTRAPGDT
                     SALGTSTAAGAAPRRHGSTAAAPSTPRHILQIHNIYPESTIRALWETARRLENGAGTD
                     DAARHEERSSAAAGRTCLKMSLEESRLVLTLGDGTWAIYTDVPHLDAAVEEAGDNAIL
                     GDAEQRCRLTADPGRRHQSSPRAATGDSSAASSPQRPALSNRTQSTPAADTEKQPTST
                     LDALVLDAAASGDGNETTTEAAMLACTPRGNEDTPDDADGYDFYQLFEALEQIQDTDR
                     DGAARSEVNDYLESLLHGLDRLLGLDANHFSGLALETPFSPVASGAAVADRSMSWSPS
                     RPPDDGNDDDVGKSMRTTDARGPNLVSGSSMENLPTSLEPSSLCALPEQSYDPEVSSQ
                     GLPLLLRVLVANLTVLERGIWALPEPAPRENQAGLWIERPVSLARYRYLCVLQRLVQA
                     RRAAIDSALASTSALSLVMMMFLDHPWSNCVHAVLLSIVEQVSDAARWSPNEHTNAAD
                     TTPGRQLCSQLWFGEAIAGQSEASQQVSSSGSHAASESTELARCSVLEAIYRGVCADF
                     EWYQRQLLQQRKPSEAVSEPGQLWERRKQGTHLASLPYLARCLECAETLAQQDPGFAK
                     RLEADANYQQLLAFQDGRAVTYLRRIAAGRQQELCGPRPERNRSVDGSERFGSSVFID
                     WSSLLNVLRRGHYVS"
     gene            <1106994..>1108679
                     /locus_tag="CYME_CMQ424C"
                     /db_xref="GeneID:16996482"
     mRNA            <1106994..>1108679
                     /locus_tag="CYME_CMQ424C"
                     /product="nuclear poly(A) polymerase"
                     /transcript_id="XM_005538241.1"
                     /db_xref="GeneID:16996482"
     CDS             1106994..1108679
                     /locus_tag="CYME_CMQ424C"
                     /codon_start=1
                     /product="nuclear poly(A) polymerase"
                     /protein_id="XP_005538298.1"
                     /db_xref="GeneID:16996482"
                     /translation="MLGTSVARFKGVTEPVSTATPTAAELRLTRTLEECLHANNLYPS
                     REEQRQRLNVLGALNAVVVEWVRRVALAQRLSEDVVEEHGARIFTFGSYRLGVNGPGA
                     DVDTLCVVPRFVERNRYFFGLPDEQGSRAPTQVVLADMLRQDDRTEELVTVESAYVPV
                     IKIRFMGVDMDLLCAPIALMKIPKNFNILDDAVLRNVDDATQRSLNGVRVTDSILELV
                     PDVDTFRTTLRCIKFWAKRRGIYSNVLGYLGGVAWAMLVARVCQLYPNATAAVVLSAF
                     FRLYSQWQWPKPVKLCPIIRHQHAGLRQLKVWDPTDPRDRRHLMPIITPAYPSMNSTY
                     NVTHSTLRIMMEEFARGQQICADVLAAAGSDGTGVSPRDWERLLEPSDFFARYKHYLQ
                     IEITAGNMDDLKKWRGHVESRLRLLVQRLEVLPPVSVHPWPEADERGTSVFFYFGLRL
                     ETDKIAREEGTKRARIDLNSPVESWLSTPDPRDTRSVPVLHWPERTPDMLVHVTPLKR
                     AQLPESLRVQRKRPAETDPSAAAAPAALQVVTKKSRSTPDGASASLLRAPTET"
     misc_feature    complement(1109130..1110094)
                     /note="possible transcribed region"
     gene            <1110648..>1112795
                     /locus_tag="CYME_CMQ426C"
                     /db_xref="GeneID:16996484"
     mRNA            <1110648..>1112795
                     /locus_tag="CYME_CMQ426C"
                     /product="similar to DNA polymerase lambda"
                     /transcript_id="XM_005538242.1"
                     /db_xref="GeneID:16996484"
     CDS             1110648..1112795
                     /locus_tag="CYME_CMQ426C"
                     /codon_start=1
                     /product="similar to DNA polymerase lambda"
                     /protein_id="XP_005538299.1"
                     /db_xref="GeneID:16996484"
                     /translation="MPRATNRSSSAAESAADNGDTQNSGNLGSGSARAAPRLRGPGRA
                     RGAWRGVANASAATSGRVPASRSRVTRSRSGTSASPEATESTDPVATATGAAPPTPVE
                     LSAVLASVSANEYNQALAAELLELAEVYESGFASAYEPSLFQQFDERDLRRAQSLRYA
                     AWRVRQLPENCGILVLDEASLAQVLFEGQWIAFAKEPHLPVSQNGVPVHIDVHHAEAA
                     AAAATGLDTEDAPYLKLFQRVPMTRVIFFDVLPAVREFALLWGSGIARGRSPENLLEL
                     RTFRDESAAQALTLFHCVWHAKRIRAMQWYHAGCKTLEEVASRCRLTDKRFQLGILYY
                     DDFRLLVPYGEVAAITSIFASASTEIDADLSVIPVGALRRNYQECGDVDLIVTGEPET
                     LHPDGERYGSLKALIKLLRERHFITDEAVSIEVAMQRLQRIRESEAYMAAHMGLLPDE
                     RTKPYVRPDWAGIIQAPGYPSGPDGNRHSDSCTDAAYNLPALGGAMVQTASSWAGVDL
                     LSSSLPAAESMAGVTASVSEESTALMATAAKSQSPLPYWWATHLHDDELDTEDEVTWS
                     GVVRLAGKPHRRVDIYVVEKDELPWALICYTGSRAFVNALLRHARQKGLYLSARGVRK
                     LGHALGPGSGGFVALEGPAMHKERSSDAGSRAASTAMDCSDTRVEVDPMERFRNVHSE
                     RAAFEALGLRYREPTERESADDLIVAHEIPEVS"
     gene            complement(<1113995..>1114861)
                     /locus_tag="CYME_CMQ427C"
                     /db_xref="GeneID:16996485"
     mRNA            complement(<1113995..>1114861)
                     /locus_tag="CYME_CMQ427C"
                     /product="carnitine carrier Crc1p"
                     /transcript_id="XM_005538243.1"
                     /db_xref="GeneID:16996485"
     CDS             complement(1113995..1114861)
                     /locus_tag="CYME_CMQ427C"
                     /codon_start=1
                     /product="carnitine carrier Crc1p"
                     /protein_id="XP_005538300.1"
                     /db_xref="GeneID:16996485"
                     /translation="MQERKLRPGELVGIGALAGVIELCIQQPTIYFKNQIQRSAEIVF
                     RPSHWYRGLFVNAASIAPITGIQFAGTGIGRNFFAARHADAGSDTGLSNGEKIAAACF
                     GGALSATVSSPAELVMIQQQKRGTTLVSEFVNVARQGPFRLYKGFLATAIREGIYTGG
                     YLGLAPVLRAEIEARTGGPGVVAFASSGIIAGVVAASASQWADTIKTIQQADIPHPGD
                     PNETPDVGKRYRNFFQTARKVYQEKQSIRFFFSGLVPRGIRTVGAVFILNLAGDMLIK
                     VYGGLTKTVFIP"
     misc_feature    1116413..1119225
                     /note="repetitive element"
     gene            <1119242..>1122769
                     /locus_tag="CYME_CMQ429C"
                     /db_xref="GeneID:16996504"
     mRNA            <1119242..>1122769
                     /locus_tag="CYME_CMQ429C"
                     /product="centromere protein E, CENP-E protein"
                     /transcript_id="XM_005538244.1"
                     /db_xref="GeneID:16996504"
     CDS             1119242..1122769
                     /locus_tag="CYME_CMQ429C"
                     /codon_start=1
                     /product="centromere protein E, CENP-E protein"
                     /protein_id="XP_005538301.1"
                     /db_xref="GeneID:16996504"
                     /translation="MSGVELPEAETRSVLSDAIQVAVRVRPILPKEAETRGAAETWRA
                     VPHAGQVIRVGRLPTGAGGTTTCPTVFSYDFVFGKESTNVEVYEKVARPLVESALVGY
                     NGTVFAYGQTSSGKTHTMWGSEADPGVMRRAVRDLFELARRTPQREFLIRVSYLEIYN
                     ETIRDLLHSNPAVTNVRVLEDSDGRICTDAREEIVVTAEQVCELLKNGEAKRMTGATD
                     MNERSSRSHTILTLVIESRERAAEDSTSGDAEDSSSASDSAVRTATLTLVDLAGSERQ
                     KDAKSEGLRLKEGGYINKSLLTLGTVIHKLSEGGSAHVPYRDSKLTRMLQSSLGGNSR
                     TAVICAITPAAAHAEETLSTLKFATRAKSVQNRAQQNEVLDDRALLKRYQQEIASLRA
                     QLAKLQQGDLSKQGCPNDFVRALEQNAAEAERERERIRSQLEEAENRRRLYEEKLERL
                     TRLILNSPAPAPKVRSRVSVSTASLSSPHSDTNENKDVASPGAFAYEPRTPPAAEPQL
                     DQRLTRTFRTLRRRTLGGSVDGIGSDAQGLLNSPENHIVEQVRTLQRRVEALDVARWR
                     EQSASLKAVSYERERAAQLQQRLRSLESQMLRHTCAEVANEALHKAALAAVDVRLAQI
                     QQLMQSERNRMQQLHCELEHVRQVCATKQSRLEILERELGEARREIDELRQRERAGFT
                     QTQAKTFDHLRNRVADLEAKLRSQLALRQQVEASRGGVERELRKLERQNRALEKELAK
                     LREQRERIEQAKLTVAQAEQLRNASEQAQRQVQAERDALQRQLNELENAHTRLLAERD
                     TLLEYRERHQQALEQLECAQQRIADLEARSVRSADWEARCESLSGQLEDARQRIAALE
                     SQIETNAQELASLLDQATDAHLQLEAVRSQARASERLQEQVTAQVRAELNALAASHEK
                     ESAEWKRMRLDTETERDALRSQLADHKRSLEELRLECAKLESRAAKLLQETAKHIEEK
                     HRLLETVHARDRRITDLESRLRECVEGGGRYARLCRLVEKREAELTRARETLRLLEER
                     LVAEGRSAEFCDLHASAQHEAERLSFEKELARSKEKSDKMQQERQQLLLENSKLRDVV
                     KHKDRQLLSLQAKLKHAEATILSQRGNASLPEQGTVSDISMGAGAAPACVTQSAPGAQ
                     DSNNKENLGCEQDSERAAAQLFGSLDDNK"
     gene            1123113..1124904
                     /locus_tag="CYME_CMQ430T"
                     /db_xref="GeneID:16996505"
     misc_RNA        1123113..1124904
                     /locus_tag="CYME_CMQ430T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461584.1"
                     /db_xref="GeneID:16996505"
     gene            complement(1125952..1126054)
                     /locus_tag="CYME_CMQ475R"
                     /db_xref="GeneID:16996320"
     tRNA            complement(join(1125952..1125988,1126020..1126054))
                     /locus_tag="CYME_CMQ475R"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:16996320"
     gene            1126301..1127262
                     /locus_tag="CYME_CMQ431T"
                     /db_xref="GeneID:16996620"
     misc_RNA        1126301..1127262
                     /locus_tag="CYME_CMQ431T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461585.1"
                     /db_xref="GeneID:16996620"
     gene            complement(<1127100..>1128818)
                     /locus_tag="CYME_CMQ432C"
                     /db_xref="GeneID:16996496"
     mRNA            complement(<1127100..>1128818)
                     /locus_tag="CYME_CMQ432C"
                     /product="NADH dehydrogenase type II"
                     /transcript_id="XM_005538245.1"
                     /db_xref="GeneID:16996496"
     CDS             complement(1127100..1128818)
                     /locus_tag="CYME_CMQ432C"
                     /codon_start=1
                     /product="NADH dehydrogenase type II"
                     /protein_id="XP_005538302.1"
                     /db_xref="GeneID:16996496"
                     /translation="MLHAVRLGLYTIGAGTALWLGYRSVQVLNPPQPAGPPSLRPSAR
                     PRLVVCGTGWASHALLRSLDPRLCDVVLISDRNHFVYTPLLPSASVGSVELRSIVVPA
                     RELLARLQRRWWHWPQLLTESGQAVPATEWSFINARVEDVDPLTKQVHCSAVHGGARF
                     SVPYDVAVLAVGSGTNDGGFPAVRSCCHALRSAEDARAIRSALNDALEGAAEPSTSAE
                     ERHRLLQFVVVGAGPSGCEIAAELHDFLHEDARRLFPRSLLDDVCVTIVQSGATVLNG
                     FEKRIAEYATEKFRRDGIQLLLNHRVVEVTSDALTVMDKFSQEAQTLAFGVCIWTAGL
                     AMHPLIRRVAERLGAQAQSNRYALVVNHHLGVVGDPHRALYAAGDCSTLQSAATQSHL
                     DKLFQLADIDGDGRIHVYEFLRFIRIVRDEYPQLAEFVSMIEPDFHEGQSSINREQFQ
                     KWLVKVDEHSTALPPTAQVAFQQGRYLGRLLNERFRCWPAGFDELEAGLYPPFEWRNL
                     GAAAYLGNSVSVLQFPFMDPLYGNVAFWLWYGYSLLHLFSWRSRFLVMIDFVKTRVLG
                     RDISKF"
     gene            <1131125..>1131976
                     /locus_tag="CYME_CMQ433C"
                     /db_xref="GeneID:16996497"
     mRNA            <1131125..>1131976
                     /locus_tag="CYME_CMQ433C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538246.1"
                     /db_xref="GeneID:16996497"
     CDS             1131125..1131976
                     /locus_tag="CYME_CMQ433C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538303.1"
                     /db_xref="GeneID:16996497"
                     /translation="MTDVSVRFELSGLEPLFGVEPCICGSTPELGEYDPLFATSMTYD
                     ESRNVFVAWVCFLEEDYPVRYRYFLRKQVWQRANVWQVQWEGDLEPPYQQHDDEGNLV
                     EDANGGAASAGAQSPERSGWARRILPVPVSPVTTKAAVSPLPERWKQQLEEGARVLTL
                     PQAKKPFVQRDEWKPAMNDTWIELPRGVALPKRLRARISERERIRRKRANGLSSEALL
                     AAGQREAEQHRIRQLRLAGNEDEAQLADVLEARQRELELEKKGTSQANVASKRKRKTA
                     AHSCRTQ"
     gene            complement(<1132449..>1133726)
                     /locus_tag="CYME_CMQ434C"
                     /db_xref="GeneID:16996498"
     mRNA            complement(<1132449..>1133726)
                     /locus_tag="CYME_CMQ434C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538247.1"
                     /db_xref="GeneID:16996498"
     CDS             complement(1132449..1133726)
                     /locus_tag="CYME_CMQ434C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538304.1"
                     /db_xref="GeneID:16996498"
                     /translation="MRASAPPNKENEAPTQTITGSASLGSAWGRVEACPPGDALQQLE
                     QILLERKLLPTGTAVDSSKQPPILRRRYRSDGNAGAASGPGSSIATNRRAQRAFRNPL
                     GETQCDQIAASWRQRIAKDQANGTAKTPPVRKMLFGPVQAPPPATQQQQRQECAMSTP
                     SGQASSPEPTPRSAGSTSYHQRVTANFPQCTSNKEHNALQSERQEAPYASREPFGHPP
                     PATVLTDTSLLELENQIANLLESKCSAEEELSRLQLQCQRSQNENRQLRLQIARLEGA
                     LETKSEHWRTVRDELEETRRQYGALRQEHEHTQILLQNALQEKQRAQQERESLEAQLK
                     QVRHTAEAENAQREQLYERELCKLHTACARQERVIDELQRRWLRLNAMLQDLFASETD
                     EEGASPHWSTPVRDARPPYSRHDTGAERSPHRS"
     misc_feature    1134286..1135933
                     /note="possible transcribed region"
     gene            complement(<1135785..>1136954)
                     /locus_tag="CYME_CMQ436C"
                     /db_xref="GeneID:16996494"
     mRNA            complement(<1135785..>1136954)
                     /locus_tag="CYME_CMQ436C"
                     /product="glycolate oxidase, peroxysomal"
                     /transcript_id="XM_005538248.1"
                     /db_xref="GeneID:16996494"
     CDS             complement(1135785..1136954)
                     /locus_tag="CYME_CMQ436C"
                     /codon_start=1
                     /product="glycolate oxidase, peroxysomal"
                     /protein_id="XP_005538305.1"
                     /db_xref="GeneID:16996494"
                     /translation="MVEKPAVNPATQPLNLAEYHLFAKARLPAMVYGYYASGADDEQT
                     LRDNEEAFRRLRFRPRVLIDVSRVDITKQVMGIDLSFPLMVAPTAMQRMAHPEGELAT
                     ARAVARIGTVMGLSSWATTSLEDVAAHVPGLPKFFQLYVYKDRAITERLVRRAERAGF
                     RAIALTVDTPQLGRREADIRNQFQLPPHLSLANFADMKDFAQVKGGAGASGLASYVAS
                     LIDASLNWNDIAWLKSITRLPILLKGVVTAEDAQRALQYGADGIWISNHGARQLDGVT
                     ATIDCLEEVAQSVRGRIPVFIDSGVRRGTDVVKALALGADAVLIGRPIVWGLAVDGEE
                     GVYRLLSLLKDEFKLAMQLCGCQKVSDIRRDLVVRDAFAPYDVRQMLSVKMQSKL"
     gene            1137303..1139230
                     /locus_tag="CYME_CMQ437T"
                     /db_xref="GeneID:16996495"
     misc_RNA        1137303..1139230
                     /locus_tag="CYME_CMQ437T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461586.1"
                     /db_xref="GeneID:16996495"
     gene            complement(<1138369..>1139862)
                     /locus_tag="CYME_CMQ438C"
                     /db_xref="GeneID:16996536"
     mRNA            complement(<1138369..>1139862)
                     /locus_tag="CYME_CMQ438C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538249.1"
                     /db_xref="GeneID:16996536"
     CDS             complement(1138369..1139862)
                     /locus_tag="CYME_CMQ438C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538306.1"
                     /db_xref="GeneID:16996536"
                     /translation="MGAVAGSIASQRNRLRTLRDGCGARQRGRRLSVLDRSSSSDQET
                     LTVRVNFCPSLTPDDTSSMSVETEVPEDSLSISAAEDHANSSSSTAKSWRDEQSLFAS
                     ESEGLGDSEKENTPFVRFSLAGRFVPEDDALPGYLSDSESESEPDTASTVAAESFSRT
                     VSDGDEMLPRDSLRMLCEPDSYESFDNNRFAVHVCTETRKNDRSWMLSSGVAAEFTSG
                     DVDGASSSAPVVHGVDLTCGESWQRQRVTAPEPSDSFSRRCAEWSLLDVPENGLKIEH
                     HDRNSPGFATQREQARRICAPDCTIMLFDWDDTLLSSTWLSTLGFRVDDTESLPQELV
                     ANLDALEDLVIGILDDAQQYGRVCVITNAETGWVQLSAARFMPRVLQHLDSSDIRIIS
                     ARSIYESDFPHSPSDWKTQAFRAELERHPNYPANLNLLVLGDSVSERDAAHAVRRYWL
                     QDALVKTVKLVERPTLEQLRRELELVRKALPHICAFEGSFDVNLSVE"
     misc_feature    complement(1140143..1142950)
                     /note="repetitive element"
     misc_feature    complement(1142467..1144274)
                     /note="possible transcribed region"
     gene            <1143834..>1145129
                     /locus_tag="CYME_CMQ441C"
                     /db_xref="GeneID:16996538"
     mRNA            <1143834..>1145129
                     /locus_tag="CYME_CMQ441C"
                     /product="probable lipoic acid synthase, mitochondrial
                     precursor"
                     /transcript_id="XM_005538250.1"
                     /db_xref="GeneID:16996538"
     CDS             1143834..1145129
                     /locus_tag="CYME_CMQ441C"
                     /codon_start=1
                     /product="probable lipoic acid synthase, mitochondrial
                     precursor"
                     /protein_id="XP_005538307.1"
                     /db_xref="GeneID:16996538"
                     /translation="MEAPSNVVRVGPDRQSAQVALSETLNAEPREACLGFLAQTWRYR
                     TATASRSTWFVSSRFRNALPQPSRTAPNRGLKRRTVPVARASPSERSPAHADSGGTAY
                     PRVGAPQPANRPNWFRVPAVGALRPDSRFLRLRESLRARKLSTVCEEAQCPNIGECWN
                     GEHATATIMLLGDTCTRGCRFCAVKTAARPGPPDPEEPMNVAAEVASWDIDYVVLTSV
                     DRDDLPDGGAAHFARTVQYLKQLRPQSTRVSSDQDAQQMPPTKRPLFVECLVSDFAGN
                     TDAVRCLATSGLDVYAHNLETVERLQQYVRDPRANYAQSLFVLRLAKEFNPQLVTKSS
                     LMLGLGETPQEVLQAMRDLRDHQVDVVTFGQYLRPTPHHLSVVEWIHPDQFATYRKLG
                     EEMGFLYVASGPLVRSSYRAGEYMMTRLVEQRQQFATPT"
     gene            complement(<1146136..>1147317)
                     /locus_tag="CYME_CMQ442C"
                     /db_xref="GeneID:16996539"
     mRNA            complement(<1146136..>1147317)
                     /locus_tag="CYME_CMQ442C"
                     /product="similar to glycosyl transferase"
                     /transcript_id="XM_005538251.1"
                     /db_xref="GeneID:16996539"
     CDS             complement(1146136..1147317)
                     /locus_tag="CYME_CMQ442C"
                     /codon_start=1
                     /product="similar to glycosyl transferase"
                     /protein_id="XP_005538308.1"
                     /db_xref="GeneID:16996539"
                     /translation="MYANCAVSESRRLQTLSRAVIHERGTCRLFTAGQVVRLPQAVAK
                     RKRRCSVSASLSVIVPTYNRRPVLEVCLDCLEKQEDPGSPYEILVIDDASADGTADWL
                     RTAQQVEQRYPHVRLLQLERNSGPARARNHGVSVANGEVLVFVDSDVMVATGFLRAHW
                     GAHAAAPQVPSIAVGPVLHVHTLDAHERRLRFHPLFDASRAFFCTSNASVSRALFREC
                     GGFDEDFCLYGWEDLECGERLRHATQGRLRHVRLPWAADGALAFHYKPPFELNHMPRL
                     VQIEEERGIMGYMFYQKMPTVSVRMMVQYTWFHRVLWFILTWGGFWNTRTIRPVLAML
                     LALRQPDLALFLFTIVLNRITCEAVFRTAAKYRGRHFSDWRREVQTSVAMHLTCDRAA
                     G"
     gene            complement(<1149323..>1150390)
                     /locus_tag="CYME_CMQ443C"
                     /db_xref="GeneID:16996529"
     mRNA            complement(<1149323..>1150390)
                     /locus_tag="CYME_CMQ443C"
                     /product="similar to alkane 1-monooxygenase"
                     /transcript_id="XM_005538252.1"
                     /db_xref="GeneID:16996529"
     CDS             complement(1149323..1150390)
                     /locus_tag="CYME_CMQ443C"
                     /codon_start=1
                     /product="similar to alkane 1-monooxygenase"
                     /protein_id="XP_005538309.1"
                     /db_xref="GeneID:16996529"
                     /translation="MELMSVLRAPWWRFWAIYLLAGLEAWAIWRNWPWFLPFTVYVLV
                     PLLDLPERNSWKPSAETALFRLPLTLWLPVQTLVILLLSWRVARISPAWAPLQTFLWA
                     LSLGIVMALGINVAHELNHKMHVMYRLLARCLLIMAGYGPYAVEHNRGHHKNVGLAHD
                     PATARPGESFYRFLPRAVRGVVMSPRTWPDARERILLDTLAYGFILQLFAFACTLPWP
                     ATETMIETSRRSRYVHGLMVYLIGSAFGVFQLELVNYVEHYGLQRMSPEEPVTAQHSW
                     NNHHWLSGCLLFKLEYHSDHHLHAARWYSRLENRPEEWPQHPAGLPAMMLLALVPPLW
                     MAVMDPRAKRIRTATASIPRS"
     gene            <1153275..>1154192
                     /locus_tag="CYME_CMQ444C"
                     /db_xref="GeneID:16996530"
     mRNA            <1153275..>1154192
                     /locus_tag="CYME_CMQ444C"
                     /product="similar to zinc transporter ZupT"
                     /transcript_id="XM_005538253.1"
                     /db_xref="GeneID:16996530"
     CDS             1153275..1154192
                     /locus_tag="CYME_CMQ444C"
                     /codon_start=1
                     /product="similar to zinc transporter ZupT"
                     /protein_id="XP_005538310.1"
                     /db_xref="GeneID:16996530"
                     /translation="MHSNLIVAVALSTAAGLSTALGGLAVVLLPGAKSASGEHRLGRW
                     QGTTAGFMVGLSFFDLLPEVYRARNQLPLPSSVLCFVLGALVFALLERLVPEPFTETE
                     ASLAAPDGIGIRSYSSAETPSARRGPSCAPSLKAGFNAERHRQGTRAVALRSALLTTL
                     SLALHNLPEGMAVAASALSGGLRLGLPLAIGIALHNAPEGCAIAAPVYAATNSRIQAV
                     TWALIAGLVEPLGVFFLIWFRLNRRALTGLLAGVAGIMTMLSCTELLPQALRMNEQRP
                     GVVFSEFAFGMLLMLGLLSVVRWSFGVEL"
     gene            complement(<1157106..>1158077)
                     /locus_tag="CYME_CMQ445C"
                     /db_xref="GeneID:16996531"
     mRNA            complement(<1157106..>1158077)
                     /locus_tag="CYME_CMQ445C"
                     /product="60S acidic ribosomal protein P0"
                     /transcript_id="XM_005538254.1"
                     /db_xref="GeneID:16996531"
     CDS             complement(1157106..1158077)
                     /locus_tag="CYME_CMQ445C"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P0"
                     /protein_id="XP_005538311.1"
                     /db_xref="GeneID:16996531"
                     /translation="MPSKQERKGAYIVKAGQLFDTYDKILVVEIDNVGSKQLQDARRE
                     LRALDSVILCGKNTVIRKTLKDRVSRKPALEKVLHALRGNVSFVFTRGDLREVRDCIL
                     RNKVPAPAKAGQIAQCDVFVPAGPTGMPPDMTSFFQALSIPTKIERGSICIVSDVQVI
                     KQNERVSASAVALLQRMGIEPFTYGMKIRQIYEEGAMYEPSVLDITPDDLRNKVREAV
                     DTIAAISLATGYLTAPAVPHLLVRAAKDLVAASIAADYDMPQSRSLRELLSDPSKLEE
                     LVAAASIGAAGAAGTASAEDTAAASGAAETKEAAEESDEDLGFGLFD"
     misc_feature    1158412..1158986
                     /note="possible transcribed region"
     gene            <1159984..>1161474
                     /locus_tag="CYME_CMQ447C"
                     /db_xref="GeneID:16996527"
     mRNA            <1159984..>1161474
                     /locus_tag="CYME_CMQ447C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538255.1"
                     /db_xref="GeneID:16996527"
     CDS             1159984..1161474
                     /locus_tag="CYME_CMQ447C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538312.1"
                     /db_xref="GeneID:16996527"
                     /translation="MSSHSAKSFDVTGSKWVHVRGVRSGRRLEASECSVPTDSASSRA
                     RNVRKQRQRAGYVDLETSPLTPAASGSRRQTVAACGSSRRYRRFMNELYLRLSAVHYG
                     SVGGLGTEALDSPLDTWEVGVERPPTEAAWLHEFWTDMRERHAESPQMERVLRGMGDA
                     WHFWEPFRECTEEEERILLDALSSIRKSVSARHRSGEARTPEPPIPGSRQHRTARSNA
                     LESQMKALHLGNQRDNSNDIVCEVESEEENFAAGIAGHHPHARVEAAEHVFPLDEDCQ
                     VDPAPPTSQLEIADANEVSRLILAFFRLSYATRELLRRYSNDLWLLIAHHESILHEHG
                     LVPHLNQNHLQWLLSPGRCPRLSNSQGPATGLRPTRYAASVHGLADPGPDSRTLTLEA
                     SSRLHRRILMALAAYHCLDCEPVQQSSSNLADVSSGAVSQTETHTKSRLRLALNQHRA
                     ASVTVPLAHIVYQLKFCDASVDRAVRRCVEARVSDVSALPQTAVGQ"
     gene            complement(1160261..1162374)
                     /locus_tag="CYME_CMQ448T"
                     /db_xref="GeneID:16996528"
     misc_RNA        complement(1160261..1162374)
                     /locus_tag="CYME_CMQ448T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461587.1"
                     /db_xref="GeneID:16996528"
     gene            1161810..1163825
                     /locus_tag="CYME_CMQ449T"
                     /db_xref="GeneID:16996513"
     misc_RNA        1161810..1163825
                     /locus_tag="CYME_CMQ449T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461588.1"
                     /db_xref="GeneID:16996513"
     gene            complement(<1163099..>1164001)
                     /locus_tag="CYME_CMQ450C"
                     /db_xref="GeneID:16996514"
     mRNA            complement(<1163099..>1164001)
                     /locus_tag="CYME_CMQ450C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538256.1"
                     /db_xref="GeneID:16996514"
     CDS             complement(1163099..1164001)
                     /locus_tag="CYME_CMQ450C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538313.1"
                     /db_xref="GeneID:16996514"
                     /translation="MYTAHRLAGSVPETLLFVVDCVCRPEPALRPRKRRVGACLWSGL
                     GKRWPRRHSVRCTVPLVRCCSDEHRHATFFKSFRLRTPLITEPSLPCETGSAANRAVL
                     LTALLSTVYGPLLDAFHTTYGTLQYHKVNWNVHVGFQTAVGFTWWTPILFGVAGSMLA
                     RLGLQSRQTPFRPELVVRTAAGVALFTFQYWLSAYLDGSGHLGTAMIALVLSSLLPVQ
                     CWVLESSTAAEFGVMISTAMLGPFVELWLIDGLHLYHYAHPEVWCHIPLWIGAIYACG
                     SLAVQQLARCIFAIDWHLRNRKDA"
     gene            <1164000..>1164845
                     /locus_tag="CYME_CMQ451C"
                     /db_xref="GeneID:16996515"
     mRNA            <1164000..>1164845
                     /locus_tag="CYME_CMQ451C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538257.1"
                     /db_xref="GeneID:16996515"
     CDS             1164000..1164845
                     /locus_tag="CYME_CMQ451C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538314.1"
                     /db_xref="GeneID:16996515"
                     /translation="MNSRAADQLELDGLPGTPPDFYRERQRSRVERYQSPAGAPLQCS
                     VQVQTTQEHPLWTSHVWSGARALADTLCWQPELIAGKTVCELGAGAGLVSIVAFLAGA
                     DQVVATDYPDPEILNSLESNIREHTANSCSSETVKRASPKVVPYRWGDSPDSLQRCTG
                     LQRFQVVLLADLLSFHQAHDALLRSVKMLLALPANDPTAVALVTFTHHRPHLAERDLA
                     FFRLVNADGALIAEPWLSPLQMDPMFPDDPGDVCIRGQVHRWRLRWRSAASASANIPA
                     HARNE"
     gene            complement(<1165925..>1167571)
                     /locus_tag="CYME_CMQ452C"
                     /db_xref="GeneID:16996516"
     mRNA            complement(<1165925..>1167571)
                     /locus_tag="CYME_CMQ452C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538258.1"
                     /db_xref="GeneID:16996516"
     CDS             complement(1165925..1167571)
                     /locus_tag="CYME_CMQ452C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538315.1"
                     /db_xref="GeneID:16996516"
                     /translation="MSLLNQVHSGRALNRGVAFQPTFLYCGRREPAFRASCRRSASVS
                     WSRFQGLGSVKALSRVRVCPVERATRRPWTCAIRPLTEEATVDALPAWATLEQVSYYW
                     GTPDRLLNRLAISAGGLLVTSVLSNVLFNHLLTSLLNAVFFFYWVLEPAFLASRRNLA
                     LRRFPYIGLFCGTVREVYVTEAVLHRERIPSSRRTRFREVVQKRINVVAADPSGRRIT
                     ISGPFRSREHRVLSPGLDVCMLVASDVPDFRRVGGVSDACIRVQRLTSSSEARSFIPP
                     DLEVADVSDELRDLYDETGSVDDGVIEDDDFVWIGDYPFVNKEFFLELFDAALEPQAQ
                     QQQQQQRTSVMRRTPIPVDEAAVEAFARRRFRDDADDDDYDRFDTDDEDSDDFDGERS
                     YRHGQRRRPAKRKPSKVRRSGRAPRERFIGDDDDNDDAQEKPWFSDDNDNDAGSGGDL
                     GTFPGDDLDLEEDDEDDPRAWRYVRTVPARRSPMPSKPQQPNEAPDRADKQKQASDDI
                     HRDRNEHQASSTSRNRTSAGFESVPTEQTLPRDPEKSTVD"
     gene            complement(<1169497..>1172643)
                     /locus_tag="CYME_CMQ453C"
                     /db_xref="GeneID:16996558"
     mRNA            complement(<1169497..>1172643)
                     /locus_tag="CYME_CMQ453C"
                     /product="probable cryptochrome"
                     /transcript_id="XM_005538259.1"
                     /db_xref="GeneID:16996558"
     CDS             complement(1169497..1172643)
                     /locus_tag="CYME_CMQ453C"
                     /codon_start=1
                     /product="probable cryptochrome"
                     /protein_id="XP_005538316.1"
                     /db_xref="GeneID:16996558"
                     /translation="MPAYPPSETSGEECPWLALSSSPLLEAGREVNAHPPPGRTPALA
                     VAAAQGATQRPILVWYRGHDLRIDDHAAFCAAAETGMPVVPVYVWNPQLPWMSKPGRA
                     GRWRLRESLLALDREFAHRYGEDARLVVLQGSLVESIVELARETNASAVYFNRCYDIG
                     AAEVDRTLEQRLAVWNVELVSFKSELLVEPWELAQDNGEPFNEFHPFMEKWLAFPKPP
                     PPVAAPLRLQTLPGLRQRVSHVEIHELELVSDLSPEWCAQMECMWPLVGERAAWITLS
                     RFLRERYPKFGRRESRCALDGTSRLSMHVRFGEISPRQLYAAIMADIVSDAPSALSLG
                     NGIPAHSREQNGYLESPHRISATPHSMDATAIATATAAVPGYQPQRAPMFPLRVQVNR
                     PRGSSGTTYFLYDHEDDDDDDNNNNNGDEADDNDDGGRGGTDQAAPRSTRHALLNRER
                     HATAGEALAANTRTHTDAADAQQTISAVKAFLKNMCLREFAYHLLFHNPQAFEEPLLP
                     EFRAFPWRWNDQSMLEVWRSGQTGYPIIDAAIRELRTTGYLHNRIRFMIAGFLTKYLL
                     IPWQHGLRFLYDHVLDGDIACQTLGWQWTAGCHTDAFPFACIVNPITFGLREDPHGEY
                     VKRWVPELAALPTCYVHRPWRAPASVLAQAGIALGSCYAHPVVDSRTARARALDSMDL
                     MRRVFVLRQPTRSLWSLIDLQQPQLWLEQSASDSDDSGMETFSFTNGTPYALHDRFSR
                     GSTTIIEELAPTVEHNALQSLSYGNHSRRAFGIGSVHTAAALVPESRQRQRRGYAPSW
                     IERADAGASEVGAMQPGGRSSGSSSQLSVVRPEQLNEFLRWVTGPEDAAANQEQASAT
                     ANEQLRAWNDPLERVQTADIGRELSPITTSAQSVTLEPAQPQKRRRGGQRNPTRASML
                     GVAEREEILAAIALQPNQPFHCFARFLMQHYRFTPNTVFGPHTDFVRLRALKAELAAA
                     GTSCEDSTTSERSRSYERQKSRCLGHVLTVAKMKHFLRNTLGLEVTGQWDRRAHGGVR
                     GPYAYGLTRCPASDDKRR"
     gene            1173024..1176244
                     /locus_tag="CYME_CMQ454T"
                     /db_xref="GeneID:16996559"
     misc_RNA        1173024..1176244
                     /locus_tag="CYME_CMQ454T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461589.1"
                     /db_xref="GeneID:16996559"
     gene            complement(1175014..1176731)
                     /locus_tag="CYME_CMQ455T"
                     /db_xref="GeneID:16996592"
     misc_RNA        complement(1175014..1176731)
                     /locus_tag="CYME_CMQ455T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461590.1"
                     /db_xref="GeneID:16996592"
     gene            <1176885..>1178450
                     /locus_tag="CYME_CMQ456C"
                     /db_xref="GeneID:16996593"
     mRNA            <1176885..>1178450
                     /locus_tag="CYME_CMQ456C"
                     /product="probable apyrase"
                     /transcript_id="XM_005538260.1"
                     /db_xref="GeneID:16996593"
     CDS             1176885..1178450
                     /locus_tag="CYME_CMQ456C"
                     /codon_start=1
                     /product="probable apyrase"
                     /protein_id="XP_005538317.1"
                     /db_xref="GeneID:16996593"
                     /translation="MLIPQGKSFQRGSRSVSAGSLDSDSGGYGRGAVRPSERRVSRSR
                     WSEMVGSAHDRHQSGYRGSSNSLPTASSRQSSVDLETGRSLLDDADENDKERRGLWSL
                     GLGFAASSAASSLPSGSATSLSGTNGTPPSTSIVEWLRQRSLRGLLYWLLALCCIGLL
                     LDYSVNHLLHHSSFLGNHGHDYRNRDMYRPDRPWGPFVFGVITDMDRLSAVPHRSKAS
                     KSEWIAYFRRGELEYRVHDARGNRSAEGVWTIRWHEPAPGVRLTTQLSEAGRGMELSE
                     LVYWRGRYLTPCDRTGIVYEILNARLPKPYVASRYVLATGDGEHAKGFKAEWMTVQHG
                     ALFIGGHGRETTDAHNGTHVVNDDALWVKRIAPDGVAFVEHLNWTNRYERLRRAAGTA
                     FPGYLEHEAVVWSERRSQWLFLPRRFSVEPYDERANEFRGWNGYLLADENFQSIQLKH
                     LNVRVDGERGFSSVKFLPFTGDRLAIALRTIEHEDEGVYRTYLTVFQVDDGRVLLADT
                     PVGEHKYEGIEFL"
     gene            complement(<1179662..>1182190)
                     /locus_tag="CYME_CMQ457C"
                     /db_xref="GeneID:16996594"
     mRNA            complement(<1179662..>1182190)
                     /locus_tag="CYME_CMQ457C"
                     /product="Raf-related MAP kinase kinase kinase,
                     delta-type"
                     /transcript_id="XM_005538261.1"
                     /db_xref="GeneID:16996594"
     CDS             complement(1179662..1182190)
                     /locus_tag="CYME_CMQ457C"
                     /codon_start=1
                     /product="Raf-related MAP kinase kinase kinase,
                     delta-type"
                     /protein_id="XP_005538318.1"
                     /db_xref="GeneID:16996594"
                     /translation="MTNSRAVLIVFLVILALLGVCSGPASATSTLPLVEPVSLTPTLL
                     VSSLPQPSPTPSNWPRDDELLLVRLNVSASSGSVNENDMLRLETGLQQFILGHYPSVH
                     HAPPVTLTNYEPRVRIAVFMIQVPTRIASSVRIALTDWIDSGALSRAAAVNVTLVDEN
                     IPVYMAPSASPTPDTFLTGQKQARPVPTPAMPSPASNYLYMEATLYIRNLTLGEFTSL
                     YSEQLKRWMANSTNGILDASQFYLTNLYAGSVYATYTAIVPRGVEAENATQGLQNYVN
                     SGAMSGTAGVPITLVGGTVETLGVAPTTSTLQGPGSGTGGAPPWVIAVATVLPVLGAC
                     LLGSGVGVWYLRQRRREREKAANAKPASDTDVERASGRSRSSEELFRPEPVPMDEDIA
                     NDSETGDTTPTIADSQQQQQQANTVTSALGTPQQRRGAGGGDGGGAGGSSGSLRGPSS
                     PAWAPVLVGHRCTQPDPEQSLVSARRRWCIDESELQILEHIGAGGFGSVHRALWRGTE
                     VAVKRSLLDRALSAEELDEFLAECDIMANLRHPCIVQFFGAVVAPPNLCIVIELMPRG
                     SLFDLLHTPADPSRRVRLPWRRRLAMMQDAARGMTYLHACHPPIIHRDLKSMNCLVSE
                     NWRVKISDFGLSRAKHRTFLTSRIAGGTPEWTAPEVIRNEPHNEKCDVYSFGVVAWEV
                     ITRRIPFAGLQPMQVLVAVAFQGLCLSMPLVPAGKQHEDKRAYVQLVNRCLQEQPQKR
                     PSMAEVYQELVRIDRELRLRLESAGTPQYPPGRNATVSPTTGTTALEHCSAAGIADAG
                     SADPSALTGTETTTTTTGRTALVRRYSPPLSLAPLDMSKLPPAL"
     gene            1182753..1186428
                     /locus_tag="CYME_CMQ458T"
                     /db_xref="GeneID:16996595"
     misc_RNA        1182753..1186428
                     /locus_tag="CYME_CMQ458T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461591.1"
                     /db_xref="GeneID:16996595"
     gene            complement(<1185719..>1191997)
                     /locus_tag="CYME_CMQ459C"
                     /db_xref="GeneID:16996580"
     mRNA            complement(<1185719..>1191997)
                     /locus_tag="CYME_CMQ459C"
                     /product="UDP-glucose:glycoprotein glucosyltransferase,
                     precursor"
                     /transcript_id="XM_005538262.1"
                     /db_xref="GeneID:16996580"
     CDS             complement(1185719..1191997)
                     /locus_tag="CYME_CMQ459C"
                     /codon_start=1
                     /product="UDP-glucose:glycoprotein glucosyltransferase,
                     precursor"
                     /protein_id="XP_005538319.1"
                     /db_xref="GeneID:16996580"
                     /translation="MLPETPDLMRTRRRFHDYLQRACFRKHQISCVPDVDSTTTYNER
                     ASGNTRSHALTSDYTIKRPAFAPALTPGSQSSLRWQRTYQQAAREYASSPTVRTGRRK
                     HLLLHSALERKHGPWCTWLNEGPTQTQAGAIPSRGGSGCYRAVAAQACYALPARCFPH
                     ELAAEVLMRSFGRQRFSLGLWVCAVYTLIICASLCIGISQSFLPAAVRRSVKALHVDV
                     VAPWNASSLPLELLEGIRRIYSDRLFWSLLDQIADGTDLLRSANSDSERELSAIRWLR
                     TRLELAWTAAAADLTSSVEADALTAAVRQAWRSLEVLVVQRVYAARLQLHERLETDDR
                     DQLEPALNAVDSTWVLLVCGAERIPIADEAALASLGHHVDACRSRFPRNIDEVHRWNL
                     ASQRFLLPSDTVLGCVGGSAAAPHVPGDKRWTDQSGTEPLIAAILYTDVFRDDAFSAF
                     HRAVRERAQNCELVYVIRMRRAAPSRAALTADFSSDATQMMSLSGYTVELALKSSDYV
                     VLDTKQNETLWLQRNKTQHVRQRGAAGSVAIDIQDLDKDEIQATLDALLMQSLWSEAT
                     KHTGASETLEELLMDLTGSLLQGIEQLGNDLPSIGAALWKEAKAEPSFAASVAQSRAL
                     LTASAENLSRLHPELHWDNLPSVLFLNGRQVSPDASSVALCAASIAAAHLAAYRIWDM
                     MDPLKTAAIDDRERFLANITHRQSEAEASTTIVDTRLYLPALLDCTEESDSDPVQSVE
                     QLFIFRLNDIERDRKYQNWSPSFQELLQSPSAKAFPKLRRNAFRLVAFVNPGSAAGLE
                     ASAQLIQWVKNRDPVLPFQISLVLVPPHEAAYRWNASAGDTAGAPRSPWSRALGMLRS
                     LGWRRGDLQSPGELPPRRSPLEPSTDAVICRAVYYLLHVRRSRRAAASFLSELHATVQ
                     REHPLAALWMLQGLGGRSSTIALPPLPPRADQVRRVFLQTAAGMQAASPNQTSSSFDA
                     EHDYESLILHPHGKKRVLGALFGLRSGGAAAAAKVHDSSQCAMLVHAEVRTRQWLRSI
                     GLPADTSALLALNGKRIGDLAKDPVDASTVFRYLNAEVQRLAELTRAGLAPDAACVDD
                     VVYQTSSWRTSTTVTPGPYPSPRRKESATAAVLATRLVLVPAFETQLLSATSQLVSGS
                     TALQQEHIEQGLQSIALLWDALFAQQQQHTQGDAVHLLNIPYRLAVVDAADAHDDGCQ
                     PPLTVWLLLDLDTTFGCRFLHDAMRVLAEQQWTQPSHHPGAAAWPSAVRLGLFHTGLQ
                     AGPVARSLMQLWTATPANASRSSMQLDDALRRRLERICGGVEVSPASTAPTLTGTPAP
                     NWLRLLFSGGWGVDPGQLALVVNGRRYRIDRDEVWAHHAAALFKAVLQREAALMEARC
                     GSYIIRQTKPLSGRCSPVDQSHQADAVLISTILADVLDGSCRPSGGSLLVQQSPSELP
                     LDSLRRLRHLVPALRYRKAPAVPRQHTGSALRAEGLIAPFTAADASFTLVLRKLLGEA
                     LDAELDVTLNPRLQWRGDDGRLLQPRYVRSKLVTRFADALANGTSASVIFDRLAEHRI
                     HSVHLRTPATWFTTVQHAELDPDNVALVQWAPPGTPSHRSIRYELSKLIVEGFVVDRQ
                     PSTRAPGLALRLEQHGGIRHPDHCSRERRSRVETVVMEGSGYFQLALTPGIWRLVPIP
                     IPSAFGRQRDDLSIALVEAQRAPYAARLVDLQPIDASNATLLVVDDLWGQSTQSQPLL
                     LLRVAHLQRTWYERVWALVAALRTSSQVQRRERLCLPPSASSSSSSSADKRPLIHLFS
                     IASGHLYERLLRIMMLSAVRATPRYRCKFWLVGNFLSPRFRAQLPRLAHRLGFDYELV
                     WYAWPRWLRPQHEKQRLIWAYKILFLDVLFPSDVERIIFIDSDQVVRGDLGELWELAL
                     GSRAVYGFVPFCDDRPEMDAYRFWKRGFWAKHLRGQPYHISALFVVDLKRFRAHRAGD
                     TLRALYQRLSADPESLSNLDQDLPNYASVPLAEQSGTMNAAEPLVPLESLPSEWLWCE
                     TWCSEQSKARAKTIDLCNNPSTHESKLESARRIIPHWDELDTEATAAATLVDDHAWEA
                     FVAQREQSMHPTRHDELR"
     misc_feature    1191632..1192720
                     /note="possible transcribed region"
     gene            <1193861..>1194613
                     /locus_tag="CYME_CMQ461C"
                     /db_xref="GeneID:16996582"
     mRNA            <1193861..>1194613
                     /locus_tag="CYME_CMQ461C"
                     /product="chloroplast ribosome releasing factor RRF"
                     /transcript_id="XM_005538263.1"
                     /db_xref="GeneID:16996582"
     CDS             1193861..1194613
                     /locus_tag="CYME_CMQ461C"
                     /codon_start=1
                     /product="chloroplast ribosome releasing factor RRF"
                     /protein_id="XP_005538320.1"
                     /db_xref="GeneID:16996582"
                     /translation="MKSPRESVSFIAPLSVRVAQASSPASGRWERPRLLGKGAPLVPL
                     RRRPQARVHAALRLRCVEGTDSLKGIQVDCEQKMEKTIVSLRNNLAAIRTSRASPALL
                     NRIQVKYYGVDTPLLQLASISTPSSTALQIEPYDKSCLGDIERTIAESDLGLTPSNDG
                     NVIRLNVPPLTEERRKQLVKAAKEMAEESRVALRNIRRTGVDAVKKLEKGSEISKDLS
                     ADAQDELTKMIKRFEAKVDEIMRAKEKDIMTV"
     gene            complement(<1196112..>1196852)
                     /locus_tag="CYME_CMQ462C"
                     /db_xref="GeneID:16996583"
     mRNA            complement(<1196112..>1196852)
                     /locus_tag="CYME_CMQ462C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538264.1"
                     /db_xref="GeneID:16996583"
     CDS             complement(1196112..1196852)
                     /locus_tag="CYME_CMQ462C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538321.1"
                     /db_xref="GeneID:16996583"
                     /translation="MSGGAREGNGLEFYGGSSVPYSTGPSTLYQDNAVSVAPAWSTVR
                     EPQRHPSATTSWHARSASFELGRALSGASVGEDEPPLLEELGIHPEAIWRKSLQVLNP
                     LRRFEKSFADEPDMAGPLLYAFLLGMALLLRGKVHFGVIYGIAIVGCLSIYLVLNLMA
                     GRELDLYRIVSVLGYGLLPIVVLAFLVLLVPPLAFRAIMAGVAVLWCTSTASRIFTAV
                     LAIPAGNWPLVAYPVGLWYTSFALITVF"
     gene            complement(<1198774..>1199367)
                     /locus_tag="CYME_CMQ463C"
                     /db_xref="GeneID:16996571"
     mRNA            complement(<1198774..>1199367)
                     /locus_tag="CYME_CMQ463C"
                     /product="60S ribosomal protein L17"
                     /transcript_id="XM_005538265.1"
                     /db_xref="GeneID:16996571"
     CDS             complement(1198774..1199367)
                     /locus_tag="CYME_CMQ463C"
                     /codon_start=1
                     /product="60S ribosomal protein L17"
                     /protein_id="XP_005538322.1"
                     /db_xref="GeneID:16996571"
                     /translation="MGRHQYSRLPESRDNIALACGSSLRVHFKNTRETAAAIKGMRLE
                     RAKTYLQNVIAKKEIVPFVRYRYGVGRKAQVKQWGILGASGRWPKKSCEILLDLLRNA
                     EENAKAKGLDTDTLVIRHIQVNQAMKGRRRTYRAHGRITAYKSNPCHVELWLQPKQQE
                     PVPKASETGIVLRADGRSLRSAVRGRRLADGATAART"
     gene            <1199738..>1200385
                     /locus_tag="CYME_CMQ464C"
                     /db_xref="GeneID:16996572"
     mRNA            <1199738..>1200385
                     /locus_tag="CYME_CMQ464C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538266.1"
                     /db_xref="GeneID:16996572"
     CDS             1199738..1200385
                     /locus_tag="CYME_CMQ464C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538323.1"
                     /db_xref="GeneID:16996572"
                     /translation="MRDSPHWWIQLEKSLQRNRVHAFARYFQVATVRPDGRPANRTVV
                     YRGTVERGKDAAPYVTFVSDLRSGKHKDLEKCTWCEICWYMPVTREQYRITGCAEVVG
                     ASGADAFLREARKEVWCRLTPPLQAPFLAPTPGLPLRVASASKPEIKLDDAGVPDSFG
                     LVLVLATRVDYLQLAKSNGPPPHRTCYYRNIGAPDVKDANAATEVEVWEMEALQP"
     gene            complement(<1201803..>1202336)
                     /locus_tag="CYME_CMQ465C"
                     /db_xref="GeneID:16996565"
     mRNA            complement(<1201803..>1202336)
                     /locus_tag="CYME_CMQ465C"
                     /product="similar to senescence-associated protein Din1"
                     /transcript_id="XM_005538267.1"
                     /db_xref="GeneID:16996565"
     CDS             complement(1201803..1202336)
                     /locus_tag="CYME_CMQ465C"
                     /codon_start=1
                     /product="similar to senescence-associated protein Din1"
                     /protein_id="XP_005538324.1"
                     /db_xref="GeneID:16996565"
                     /translation="MFLGTLYSVSRWGRLSHESSTRIKAFTCSTHGGYTGLLRRGIVP
                     QFQRFRSFAMIVERISPEEAHRRKQCGECDLHLDVRTPEEYQEVHAPDSVLVPYMLKQ
                     GDKMVPNPNFLSEVEKLTGGNLERKLIVNCASGRRSAMAAEELSKKGYKVIADMEGGI
                     QQYLQKPHLPVNRPKSQ"
     gene            <1203848..>1204459
                     /locus_tag="CYME_CMQ466C"
                     /db_xref="GeneID:16996566"
     mRNA            <1203848..>1204459
                     /locus_tag="CYME_CMQ466C"
                     /product="similar to 4-aminobutyrate aminotransferase"
                     /transcript_id="XM_005538268.1"
                     /db_xref="GeneID:16996566"
     CDS             1203848..1204459
                     /locus_tag="CYME_CMQ466C"
                     /codon_start=1
                     /product="similar to 4-aminobutyrate aminotransferase"
                     /protein_id="XP_005538325.1"
                     /db_xref="GeneID:16996566"
                     /translation="MVCDEVQTGVGATGRFWAHEHWSEGLEKTGQGVGTGAAELAPDM
                     VTFAKKMQASGFFFKPEFLPPQAFRIYSTWSGDPLRALQASVIIDTIVADHLVERVHS
                     VGDYLIHALADLNHPLVERIRGRGTFIAFDLPSPAQRDHLRGEMRNQGVLVGSSGGQN
                     RTLTPRTHLRQASRGYTPGYSGTRSQAHALNWQGSCVAFTSAS"
     gene            1204717..1206661
                     /locus_tag="CYME_CMQ467T"
                     /db_xref="GeneID:16996567"
     misc_RNA        1204717..1206661
                     /locus_tag="CYME_CMQ467T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461592.1"
                     /db_xref="GeneID:16996567"
     gene            <1207088..>1207972
                     /locus_tag="CYME_CMQ468C"
                     /db_xref="GeneID:16996519"
     mRNA            <1207088..>1207972
                     /locus_tag="CYME_CMQ468C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538269.1"
                     /db_xref="GeneID:16996519"
     CDS             1207088..1207972
                     /locus_tag="CYME_CMQ468C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538326.1"
                     /db_xref="GeneID:16996519"
                     /translation="MIVRPTSKAVPQRQFVSALVEQVQALAAVQPAHRRLRDDRGNRF
                     YLFEGPEARPLPSVTSVLSTIAKPALTTWSRNTALEAMRDALLRKAGKSITNEILEQA
                     LQEAKQQPRALAGRAAQLGIRGHEAFGRVLSGLGASKPVTAELDQTVSNFERWWKHSG
                     YVLACSELVVRSERYGYAGQCDAIAVRLNEAVRTADESSSRPSASLAVFDWKTTSAIY
                     SEYALQAAAYAKALEEMSHGTLHVHEAWVVRFGRMDSEPCFEARQVRDISAAFLCFRA
                     ALILFNELGETLYNDKGG"
     misc_feature    complement(1211058..1214132)
                     /note="possible transcribed region"
     gene            <1212618..>1213178
                     /locus_tag="CYME_CMQ470C"
                     /db_xref="GeneID:16996521"
     mRNA            <1212618..>1213178
                     /locus_tag="CYME_CMQ470C"
                     /product="similar to thioredoxin peroxidase Dot5p"
                     /transcript_id="XM_005538270.1"
                     /db_xref="GeneID:16996521"
     CDS             1212618..1213178
                     /locus_tag="CYME_CMQ470C"
                     /codon_start=1
                     /product="similar to thioredoxin peroxidase Dot5p"
                     /protein_id="XP_005538327.1"
                     /db_xref="GeneID:16996521"
                     /translation="MPAATRNKSGKAGPASKAAVDLHPDSKPEHKTSKANSGDYRDVV
                     VKTDENQETSLRKLAATGPIVVFLVPKANTPGCNRQYESYTRNYERFTALGVRCFVLS
                     KDKPEALARWRAKYQSPVPGLSDPTQNLIGKLKARKPPANTIRSHFIFAEGTADKLAE
                     AIPVSPDKSCEIALKSLEELGIKKKA"
     gene            <1214377..>1218840
                     /locus_tag="CYME_CMQ471C"
                     /db_xref="GeneID:16996522"
     mRNA            <1214377..>1218840
                     /locus_tag="CYME_CMQ471C"
                     /product="vesicle coat complex COPII, subunit Sec24"
                     /transcript_id="XM_005538271.1"
                     /db_xref="GeneID:16996522"
     CDS             1214377..1218840
                     /locus_tag="CYME_CMQ471C"
                     /codon_start=1
                     /product="vesicle coat complex COPII, subunit Sec24"
                     /protein_id="XP_005538328.1"
                     /db_xref="GeneID:16996522"
                     /translation="MNPASRPGSLPQGEQRGVAGDGTQRRVAVTAHEAAPLPRPGTGP
                     SPADYATASASRYGAAYEQQRLSERSTFRQQQQASAESHGTGNMGQISEAQLARNVSD
                     QADQVTQRPGRSSAWSSEASSQGNGTAYTGAGAAMGAAPPPPGRQSVLPTPQQPQRSP
                     AGLSSRSGAYEATAHSESASALGQALPPQRISPERTAPPVRGNMSNTMASDALHASAA
                     DIYGSPRRFDTPSDNQGAMTTDPRAAASALASNSIPRAGVAQGLQARPMPQGTDSLSS
                     DGQHSAEGGNPTNSAHTGRAGGYVPAPLGSSAYTGRGVTAATLEAGQHMEHQRPMLIS
                     DQGRSNLSHPSGAPGDARYTPQAATSQWATTGYGVADSIAFGSNHGDSATATAVQHPS
                     GIRTGPDTARGMPSAQPVPGYRAAAPTVPHLHPSMDASMMNGASPVATATSAGHGTAA
                     GNQYTEVSQRNTVPFSSQAPAVMPRAPPGGPSGGITTTVSPPGQNRVPSFSNPLSMGT
                     SLSAGANALGSTTRSTISSGYSPVGYANRPVPGVLMPSPGDGPPTAGQFAPAMASVGP
                     AYARQGNSAVSYQAVPGNVPYPMQPIPGSGGAGPQMAGPPVPGSYANLPTGMSTAPGA
                     PYYGPPGGMVSAPVQAIPAPAAAAATPSTDFASLPRPALDPDSVMYRVWFGDALQRDL
                     LWPQQVLAGDRSAHGGGYNPGAAGAGMPFEPQINFCAFDPTWCCPIELFRPCHPSRMR
                     MSVNFFPNSAATRSKTGLPLAAIVRPLAPPLSDDPLDQVPVVNFGTNGIVRCRRCRTY
                     INFGVTFTDGGRRWRCNICQLLNDVPPEYYSPLDANGKRHDIAERAELCSASVEFVAP
                     SEYMIRPPQPPVYVFVLDVSYGSIISGAFITFVETIRSSLDLLPQDGRTRVAVLTFDT
                     QLTYCVLPPGQQGEPRFLVTPDVDDVFLPTPEDVLASLDESRPALLRLLDKLQTIYDP
                     ATLQSTATLTGNALTNGSALGSAVMGAYYIMQHWGGKMVVLGASRPTMGIAKLKDRDD
                     AYALFTDREARLLSPEEGQYKRLAVDFVRAQVSVDLFLTPPSGTYVDVASLGCLSKYT
                     GGELLYISGFEATRDGARLARALRRNLSRETGFEAVFRLRASNGVRCSRFHGRFFTRS
                     SDLLAQPNVDSDKTYVVELSFDEAQLSSRYLCAQSALLYTTSRGERRIRVHTIVAPVT
                     SIVNELYRSADVNAVVNLLARSLFEHCTMKKADAVRRLIVDQIVDILAKYRQLLSSPG
                     NVTSSQLVLPDALRCMPLYALGIIRSVLLSRDAATAMVLRLDCKAALLQAIDNGSIGT
                     LMAFAYPNCIRLEDGTGVHASAAALSGMVLIDAGFEIFIWIAQDVPPPLLVSLLGPEI
                     TSLFLAQPPPAHVPSPKALGEEVLRLPYHEPNDRGHEMRRRIHAVLEARWDAQPVVSL
                     VRQGTPAEARVLTLMTEDRTSSEMGYLEFLAAIQRQLQQRVVGSNAAAGRS"
     gene            complement(<1220715..>1221158)
                     /locus_tag="CYME_CMQ472C"
                     /db_xref="GeneID:16996608"
     mRNA            complement(<1220715..>1221158)
                     /locus_tag="CYME_CMQ472C"
                     /product="similar to chromatin accessibility complex 1"
                     /transcript_id="XM_005538272.1"
                     /db_xref="GeneID:16996608"
     CDS             complement(1220715..1221158)
                     /locus_tag="CYME_CMQ472C"
                     /codon_start=1
                     /product="similar to chromatin accessibility complex 1"
                     /protein_id="XP_005538329.1"
                     /db_xref="GeneID:16996608"
                     /translation="MDQERPPTPVTDENDVDKLVEHDASESLILPLSRVRKIIKYDSE
                     VSTVREDAVTAIARATELFLEYFLEETYREATSRTRGRVKRLNYNDFSKTVQEIEALH
                     FLAELIPPRTRFGSISAAPNRSLADASSTPVSAAVQEDGKQAAAE"
     gene            <1222065..>1224005
                     /locus_tag="CYME_CMQ473C"
                     /db_xref="GeneID:16996609"
     mRNA            <1222065..>1224005
                     /locus_tag="CYME_CMQ473C"
                     /product="transmembrane 9 superfamily protein"
                     /transcript_id="XM_005538273.1"
                     /db_xref="GeneID:16996609"
     CDS             1222065..1224005
                     /locus_tag="CYME_CMQ473C"
                     /codon_start=1
                     /product="transmembrane 9 superfamily protein"
                     /protein_id="XP_005538330.1"
                     /db_xref="GeneID:16996609"
                     /translation="MFDVTWKRLLWITVYLVIILVQTSNAVGFYIPGVAPVDYPQGAA
                     LTIKTTKLVSSKSVLPYNYYSLPFCRPKKLKKYPENLGELLSGARIYSTPFEVRMLED
                     KTCAVLCRRRLRERDANILAQRIRQEYRVLLQLDNLPVGEPIYGEGQKIGIERGYPLG
                     VADAAGTYLNNHLSFKIYYHRPSGGLKIPTKGYRIVGFEVAALSIQHSEAANSDSRKP
                     NTTLLSTCSTATGPDVNAPRQVVEPGADVFYTYDVEFSESAVAWGSRWDIYLQQPPTA
                     SSIHWFSILNSSLIVVFLAATVFMILLRTLRQDLLRYNSAADGEEADEEEYGWKLVHG
                     DVFRAPRNLNIFAVLVGSGAQLLGMLVVVLVIAMAGFLSPANRGGLVTAMVMLWLVMA
                     FPGGYVAARIYKSYRGTMPKRVTLSTAILFPGICFATFFGLNLLLWMLQSSAAVPFVT
                     LLYMFVLWFGISIPMAFLGSYLGYRKPAIDFPCRTNLIPRQIPQLPLYARTWVGMLVG
                     GLLPFGSLFLSLFFILNSVLFQRYYYFFGFLTASFFILLLTTALNSMIFVYIRLSSED
                     WRWPWYSFMVSSSTGGYVFLYSVLYLWKKHEIDGETAISCLLFVVYAAIASSFIGVAL
                     GAVGFLAALGFVRRIYLSVKLD"
     gene            complement(<1226679..>1228376)
                     /locus_tag="CYME_CMQ474C"
                     /db_xref="GeneID:16996610"
     mRNA            complement(<1226679..>1228376)
                     /locus_tag="CYME_CMQ474C"
                     /product="similar to dolichyl-phosphate-mannose:protein
                     mannosyltransferase"
                     /transcript_id="XM_005538274.1"
                     /db_xref="GeneID:16996610"
     CDS             complement(1226679..1228376)
                     /locus_tag="CYME_CMQ474C"
                     /codon_start=1
                     /product="similar to dolichyl-phosphate-mannose:protein
                     mannosyltransferase"
                     /protein_id="XP_005538331.1"
                     /db_xref="GeneID:16996610"
                     /translation="MAPAVKRRAADATAASLPASSPSAERVQAADLDVMHQGRTKVDT
                     PQHEHQGAHPRKQQASPLERLVLRSTAHVRANPDAWLTGALVLLGLWTRLYRIRWPPE
                     CVFDEVHFASFAHHYLNRTYFFDIHPPLAKLTLAAVAKLAGDVPNRDWYVDKVYPPDS
                     RYYAMRACAGVFGALLPPLGFRIARGMGMSRIAATSVGVFLLFDMLNLIEARHILTDS
                     QLIFYSALCIDAFVRLWRTPLASRARRWAAVRAGLASGAALSVKWTTLVVPGLFGLES
                     VAGAALAAEPLEWSTCAIVAATALLLYVALWYPHFQILIYNGPGGDFMSAEFQRTLIG
                     RDGYDPQARKPPFLKLVWQLNKEMLLANARILDEHQWQARWHTWPYVGRGLLYWDRWQ
                     EGTLDADGRPLRPHHAMQIYLIGNPLLFWMCLAAVLGTVAAMPFLLRLIRQRKKRGTS
                     TDAWERYLRLATFLLLGYALGILPYMPIQRSTFIYHYLPSLLFAELLFAHAVLDLPAL
                     PSVLQLPLAGIVWIVVFWCFWYFRAWVYGHIALTADDHEAMRWIKYTSSVGDNKGWH"
     misc_feature    complement(1228874..1231093)
                     /note="repetitive element"
     misc_feature    complement(1228925..1232106)
                     /note="repetitive element"
CONTIG      join(AP006499.2:1..1232258)
//
DBGET integrated database retrieval system