GenomeNet

Database: RefSeq
Entry: NC_010144
LinkDB: NC_010144
Original site: NC_010144 
LOCUS       NC_010144            1253087 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 18, complete
            genome.
ACCESSION   NC_010144
VERSION     NC_010144.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 1253087)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1253087)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006500.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1253087
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="18"
     gene            complement(<3369..>6125)
                     /locus_tag="CYME_CMR001C"
                     /db_xref="GeneID:16997042"
     mRNA            complement(<3369..>6125)
                     /locus_tag="CYME_CMR001C"
                     /product="similar to trefoil factor"
                     /transcript_id="XM_005538275.1"
                     /db_xref="GeneID:16997042"
     CDS             complement(3369..6125)
                     /locus_tag="CYME_CMR001C"
                     /codon_start=1
                     /product="similar to trefoil factor"
                     /protein_id="XP_005538332.1"
                     /db_xref="GeneID:16997042"
                     /translation="MFRALSLARGLVVAVCLLLAATFSVSVVAALSPVSTVSWTWIGG
                     ETGTGNFGRYGTLNQTSPESVPGGRAYSAAWVGSSSVVYLFGGDGNGNTTGGLLNDLW
                     KFNLTSLEWTWIGGSSEVDQPGVYGTLGVGGIANIPGSRYGSAYWQTDEQHFWLFGGF
                     GLDVNGNAGDLNDMWRYDTETGIWTWFSGNDTINANPVYGPKDVFGPFYNPGGRDGAA
                     FWLGADGLFWLFGGGTNNGLDILSDLWSFNPVTFEWAYRGGSQLVNQPGNYSAPGVAS
                     NSNAPGARSGSYTWTDFEGNLWLFGGFGFENSTALGGGDFNDLWVYNISQSVWILIAG
                     NTTINNPGSYGTLGAFSPTSYPGARDSGVSFVDSLGNLQLFGGEGLANTSESFGFLND
                     LWVFDITLGQWAWINGSQSVDALSVYGVLNESSSSVVPGGRLGPAFWNTSGTDPILFG
                     GFGYSNTSRHGYFNDVFALRETFFTPTSTPTPTSTPTPTSTPTFSATASSTATPTITA
                     TVTSTFTLTPTPTSTPVCTNEICGSPGQYTNQDACEQVGCCFNAQTNACTLKSVSAAC
                     SAVPVTQRVPCGWSYIYPDECTAIPGCCWQPTANGILAPWCYYNIDHAPQASVALQEV
                     QAPVPVCPSPGAQRQPCGNAGINQFTCYAQGCCYDSQAQNLWVQNGKQQSDFASNPYC
                     FQPEKTCAVGEFERQPCTNAVNQNQQLTNNNINSSQFVRLLNTLLYGEQHGTQRTSYS
                     PQQCLEAGCCLGLGNECFQPVTEYVCQTYGFVSNSLSGTTSNVSNSSYIACGPECCNA
                     ETQNCTYIPFSNNNNQQLQQQLQQQQQQQQVLLPSFCVCKDPTKQCGTYLIPSDNLVN
                     KMRCCRADEECINNQCVVISSTPTPSPVAATATPSATVSATASAAVSASASTSVSGSA
                     SVSA"
     misc_feature    complement(8915..10178)
                     /note="pseudo-gene of NADPH:protochlorophyllide
                     oxidoreductase"
     misc_feature    10787..14136
                     /note="repetitive element"
     gene            <14374..>14997
                     /locus_tag="CYME_CMR004C"
                     /db_xref="GeneID:16997140"
     mRNA            <14374..>14997
                     /locus_tag="CYME_CMR004C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538276.1"
                     /db_xref="GeneID:16997140"
     CDS             14374..14997
                     /locus_tag="CYME_CMR004C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538333.1"
                     /db_xref="GeneID:16997140"
                     /translation="MSLSAKTLCLFILALVVSAVGGAPAALGASCSYTCQTGNSSLTQ
                     KTVSNCDRDCALDVLCPSSTVFFSECIDSVTSLKYYQVKYPLVSSRSDDTSACPSSIE
                     ARVDTSGIMHVPSLCTTGCFPCGIPYTISSSTYDSSGNNFFTAEAHSSVFGVVPKCCS
                     LSGQISLSTGRVTYDFEAVHDVAVLLYISSVSAVCAYGTSSYHAIPA"
     misc_feature    complement(15433..16612)
                     /note="possible transcribed region"
     gene            <16698..>17609
                     /locus_tag="CYME_CMR006C"
                     /db_xref="GeneID:16997123"
     mRNA            <16698..>17609
                     /locus_tag="CYME_CMR006C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538277.1"
                     /db_xref="GeneID:16997123"
     CDS             16698..17609
                     /locus_tag="CYME_CMR006C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538334.1"
                     /db_xref="GeneID:16997123"
                     /translation="MAYGKTWIFVYNLVQFGGWSWIFLELCLCSFQFLEEKCFAGGLA
                     GSTEALFQPAKLRCAAYVLVGWWAPPPLRAFLGFANSNWQRFEFQVLRSTLKPLLVFQ
                     TLTLLELVHTVLGWVRASLATTALQICSRLFVLWFIVASFASKYEECINTGYLALLSA
                     WSATEVVRYAYFTVLSYGNMASRGLLSVHEVVPRWLTWLRYSLFLVLYPIGVSAEIWL
                     VLGALPWIRETNFLRVRMPNTFNFAFDFSIFCAIALLGYIPGLPFLYGHMLKQRKRHL
                     AAARRHATITDSPAQTTERPAHRAKLD"
     gene            complement(17092..18884)
                     /locus_tag="CYME_CMR007T"
                     /db_xref="GeneID:16997124"
     misc_RNA        complement(17092..18884)
                     /locus_tag="CYME_CMR007T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461593.1"
                     /db_xref="GeneID:16997124"
     gene            <19237..>19809
                     /locus_tag="CYME_CMR008C"
                     /db_xref="GeneID:16997125"
     mRNA            <19237..>19809
                     /locus_tag="CYME_CMR008C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538278.1"
                     /db_xref="GeneID:16997125"
     CDS             19237..19809
                     /locus_tag="CYME_CMR008C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538335.1"
                     /db_xref="GeneID:16997125"
                     /translation="MFRSLSATVGRASLLFRRTYAAQAAAVPSQVRLHLLRLGLQGHE
                     NWEQIRQRYRELARSNHPDVPGGSTENFQAIQDSYNYLSVYYGHAKPSTRHGYRAAAR
                     SQGGAPYYRSTYAEHVQRTNGSPGLFLVFPALLLVGLGSWVIIQSATGRSQRGELRAG
                     GTSQYVPENRQLILPQKPDQTLFRIHRDEK"
     gene            complement(<22716..>24773)
                     /locus_tag="CYME_CMR009C"
                     /db_xref="GeneID:16997109"
     mRNA            complement(<22716..>24773)
                     /locus_tag="CYME_CMR009C"
                     /product="probable anion transporter"
                     /transcript_id="XM_005538279.1"
                     /db_xref="GeneID:16997109"
     CDS             complement(22716..24773)
                     /locus_tag="CYME_CMR009C"
                     /codon_start=1
                     /product="probable anion transporter"
                     /protein_id="XP_005538336.1"
                     /db_xref="GeneID:16997109"
                     /translation="MVQHSVRDSLMGSSSSRATLLEAKVQQETRGVRFLAWSFITGPT
                     CRRSRQQRAAVTGAHAPLSFWQVSSRPTTTVCPKRHEVALRQRKPRRLRKLPVGGHYS
                     LCKMQLDGNRPSQTRRLQVSTAVGALAASAGSDGLSAPPWPPLTGLAHDIAKRAPHFW
                     GDWSDGLCLKSLAAILFLYFACLAPIVAFGGITAQITNGAIGVVEFLVSGSICGMIYH
                     TLAGQPLTIVGPTGLTLAFTASLYKVCASAGLPFLPTYAWVGIWTAFFLFLLAIFNAS
                     SLIRYCTRFTDDCFNALIAATFLYEAFRSIGSNFRKCGMDKTEAFMSLSLSLGTFIVG
                     RTLSEFRQSRYLRRTVREFLSDFGAAIAIFSMTLVSQLPEWGGYTLGRLQVPVKFQLA
                     GNRSWLIPIFAAPVQVRLFAIIPAILLTVLFFLDQNITVRVVNSPAHRLRKGEAYHLD
                     LLILSLITLIASLLGLPWMCAATVQSLNHVRSLAVTETYLRPGERSPRERIVSVVENR
                     LTGFMIHFALGMSLLLLPLLRRIPIAVISGLFLYMGRRMMSGNEFLRRIRLLFVDPAL
                     YPDDSPMRKIRPAIVNAFTAIQFVCLATLWTLKMIPQTTLFFPAVIGLLMVVRSFLLP
                     RFFSADALAVLDGEIVNRDADDANGTIGPEDTSEGVVVDVWDDGLRKREGIAGETYST
                     DLY"
     gene            complement(<28065..>28517)
                     /locus_tag="CYME_CMR010C"
                     /db_xref="GeneID:16997110"
     mRNA            complement(<28065..>28517)
                     /locus_tag="CYME_CMR010C"
                     /product="probable ubiquitin conjugating enzyme E2"
                     /transcript_id="XM_005538280.1"
                     /db_xref="GeneID:16997110"
     CDS             complement(28065..28517)
                     /locus_tag="CYME_CMR010C"
                     /codon_start=1
                     /product="probable ubiquitin conjugating enzyme E2"
                     /protein_id="XP_005538337.1"
                     /db_xref="GeneID:16997110"
                     /translation="MSGHLSKRILKETERLAKDPVPGISVTVHDENARYFNVILAGPE
                     GSPYEGGVFRLELFLPAEYPMQAPRARFLTKIYHPNIDRLGRVCLDILKDRWSPALQI
                     RTVLLSIQALMSEPNPEDALNNEAAELWKKDIARAKEIAQQWTLEYAK"
     gene            complement(<31175..>32332)
                     /locus_tag="CYME_CMR011C"
                     /db_xref="GeneID:16997111"
     mRNA            complement(<31175..>32332)
                     /locus_tag="CYME_CMR011C"
                     /product="probable choline kinase"
                     /transcript_id="XM_005538281.1"
                     /db_xref="GeneID:16997111"
     CDS             complement(31175..32332)
                     /locus_tag="CYME_CMR011C"
                     /codon_start=1
                     /product="probable choline kinase"
                     /protein_id="XP_005538338.1"
                     /db_xref="GeneID:16997111"
                     /translation="MVLQTLEDAGGEVKRRDVELATQAARATEAEEREVLLVLGQLFS
                     DNAWAPSCCTVERVQGGVTNRMYRCTSTVTGTAVLVRIFGSGDFFNRRRENSLYAELA
                     AAGLGPPLLGIFPRGRVEGVLTGKPLDYRTLHDKQVYSQVASALARLHCFRPSEQTLP
                     RAQAIALQWEFCERLLRKAVERHCLPVEELCNGKPTRLQNEFKELRHRLPADDIVFCH
                     NDLLGANILYDPTEQMIRFVDFEYAGYAPRAYDLGNHFNEWMGLTENCGLKPLDSFAR
                     YPTEAEQHRFAEAYLASLSAFSQSDDAIDTATSSRCRSASVSTLERDRLVAEANAFSL
                     LSHWIWSVWAFIMAADPPSETFDYVHFGRERLLLMRMHWSERLGAVDHLLH"
     gene            <33664..>35199
                     /locus_tag="CYME_CMR012C"
                     /db_xref="GeneID:16996727"
     mRNA            <33664..>35199
                     /locus_tag="CYME_CMR012C"
                     /product="UDP-sulfoquinovose synthase, chloroplast
                     precursor"
                     /transcript_id="XM_005538282.1"
                     /db_xref="GeneID:16996727"
     CDS             33664..35199
                     /locus_tag="CYME_CMR012C"
                     /codon_start=1
                     /product="UDP-sulfoquinovose synthase, chloroplast
                     precursor"
                     /protein_id="XP_005538339.1"
                     /db_xref="GeneID:16996727"
                     /translation="MTFVTLPLCASRSVVPSLKCAACRRGSRLGLGGRLRSKLRSSPG
                     SSSLRCLQPNGTPSAGHQGNKAGNVNTFGKTVLVLGGDGFCGWPTALHLSDLGYSVVI
                     VDNLSRRKIDIELECESLTPIAAPSERIAVWNALSDREIRFEFMDVAHEYWHLLELIK
                     REQPCAIVHFAEQRAAPYSMKGSRQKRYTVDNNVNGTMSVLTAVVESNLDIHVVHLGT
                     MGVYGYGSSGGKIPEGYLDVVLPSGERRSILHPAYPGSVYHASKCLDALLFQFFARND
                     GLRITDLHQGVVWGTFTQNTMRHELLMNRYDYDSDYGTVLNRFLMQAACGLPLTVYGS
                     GGQTRAFIHISDTCKCIALALANPPNRGDRVKIYNQVAETHRVRDLAALVARKTGASV
                     HQIPNPRNEASENELDVSNQNFRSLGWDPVTLEESLLEEVVGVAERYRHRIRRDKVMP
                     SSFWNREREEACRANATNSSDALAEISAAASSEWRDEVLKQLANGDDKKLERMRSALR
                     DEP"
     misc_feature    complement(35204..36480)
                     /note="possible transcribed region"
     gene            <37543..>39369
                     /locus_tag="CYME_CMR014C"
                     /db_xref="GeneID:16996729"
     mRNA            <37543..>39369
                     /locus_tag="CYME_CMR014C"
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /transcript_id="XM_005538283.1"
                     /db_xref="GeneID:16996729"
     CDS             37543..39369
                     /locus_tag="CYME_CMR014C"
                     /codon_start=1
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /protein_id="XP_005538340.1"
                     /db_xref="GeneID:16996729"
                     /translation="MFVALPSVLFTSKPSRIRTVKIEKRRTLFACDRAKAGTDGNASN
                     AAASAPKPSAASSGRSAGTAARDQVTISAQTSSSNSRTIDRSTDSSQTVQVASMFDSM
                     TKRREAARREALSIVVLGASGDLARKKTLPALFSLYYHDLLPSDFYVVGYARSNMTSE
                     AFRNTIKSSLTCRVIEGPECARKMEHFLSRCFYVSGTYHETTAFRTLDEFLVNEFEKE
                     RWNRGVPTNRLYYLAIPSNVFAEACRGIAHAHTKPPESTKGWMRVVLEKPFGRDLDTF
                     QTLHQELQLYISEEQTFRIDHYLGKELVQNVLALRFANYFLEPLWNNQHIQSIQVTFK
                     ENFGVEGRAGYFDQYGIIRDIMQNHLLQMVALFTMEQPASLNAEDIRDEKVKVLRSLE
                     TLRATDFVIGQYMGYREEDGVRPGSKTPTFAACRMNIRNRRWDGVPILVKAGKHLDER
                     LAEVRVTFRSVPGSIFSLANTLPNNELVVRVQPDEAIYLRIVSKSPGLTSRLEEARLT
                     LFYRTAWEEAHDIPDAYERLILDVIYGDKSLFIRSDELKVAWEKFTPALHELEQSDRY
                     RPVPYVAGSRGPAEADYLAARYGCVWASDLDIGGKRLQSKVP"
     gene            complement(<39974..>41527)
                     /locus_tag="CYME_CMR015C"
                     /db_xref="GeneID:16996730"
     mRNA            complement(<39974..>41527)
                     /locus_tag="CYME_CMR015C"
                     /product="sulfoquinovosyldiacylglycerol biosynthesis
                     protein"
                     /transcript_id="XM_005538284.1"
                     /db_xref="GeneID:16996730"
     CDS             complement(39974..41527)
                     /locus_tag="CYME_CMR015C"
                     /codon_start=1
                     /product="sulfoquinovosyldiacylglycerol biosynthesis
                     protein"
                     /protein_id="XP_005538341.1"
                     /db_xref="GeneID:16996730"
                     /translation="MFTGRTAAFLGVNNGDTGAFACARTLRRQSAPSNGSQLCPLEVA
                     LLRRRYAPVRLRAPGVPRTSCAFALASVATGPVYPQPTSGDDPNLVDLRRAPRRRVCL
                     VVEPTPFTHVSGYSNRFNELLRYLKEAGDEVLIITPDNSPDAPQEVFGYPVITIRGFK
                     FALYPRITLSIGFGSGMVFGRRSLLQRVREFDPDLIHLATPGFLVFAILLMARVLRKP
                     LVASYHTHLPMYAKTYGLGILIGLAWTLMRFCLNRADLTLATSPQICAELRQHGIERV
                     DLWRKGINTERFHPRFRNDDGGAMRARLTDGHPTAPLLVYIGRLGAEKNLLSLKRILT
                     CCPPGTRLAFVGDGPYAETVRRHFAGLPVVMTGQLHGDDLSRAFACADVFVMPSESET
                     LGFVVLEAMASGVPVVATAAGGIPDLIVHGETGFLYTKGNTSEAATYVCALLGDAVMR
                     KRMGDAARREAERWSWCAATAWIRNVQYNRAMNNFRFRALGGLGLPRSLSWLRWLRRQ
                     LARAFFKPA"
     misc_feature    42069..44236
                     /note="repetitive element"
     gene            <44327..>45493
                     /locus_tag="CYME_CMR017C"
                     /db_xref="GeneID:16996904"
     mRNA            <44327..>45493
                     /locus_tag="CYME_CMR017C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538285.1"
                     /db_xref="GeneID:16996904"
     CDS             44327..45493
                     /locus_tag="CYME_CMR017C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538342.1"
                     /db_xref="GeneID:16996904"
                     /translation="MLRYSFINAVWPSKSCGRVHVERHRKQKTQSVQTAQRWKLRANL
                     NRRGPDSATWDRQGGGQAERLLMEQVLQLRRELDALRAENESLRKYRVNEHLLVDADD
                     SVTTEDGRTRCGKHGERSRYLPVYSVAPEEVLSRVIPVIGPNPTIEQLDAAITLSFQV
                     RDELVNRRGLERYEDVMAGRFLVFQTSELPVKGVQRVALPGTVGSMRWASAPVGILMP
                     ASELGLESFYPNAPTDVNCLVIIEADFDSEIPADTLASPDIIRDIRDGTKDVLDRIEN
                     VWFDEQGRASRDAGFPSSLTEETETDEDEQPDENGDGPEFSPGKFYLWLEERPPQGVE
                     SGEEPAHRWHVRWYERRPDPAVDGVECVGRVITVIAPSASRRRTKTFAEEDDVF"
     gene            <48580..>56793
                     /locus_tag="CYME_CMR018C"
                     /db_xref="GeneID:16996905"
     mRNA            <48580..>56793
                     /locus_tag="CYME_CMR018C"
                     /product="phosphatidylinositol 3-kinase"
                     /transcript_id="XM_005538286.1"
                     /db_xref="GeneID:16996905"
     CDS             48580..56793
                     /locus_tag="CYME_CMR018C"
                     /codon_start=1
                     /product="phosphatidylinositol 3-kinase"
                     /protein_id="XP_005538343.1"
                     /db_xref="GeneID:16996905"
                     /translation="MSTTSSSSTGAVSASRAVASPLMNGKSGLADAAPVLTASRSTPP
                     PPPPAAAAPGTSTRARAASQGAHASERWGAANMTSLPALASGSSQLLAGSTHALVALH
                     DASIERALRRLERATGSERRYEAAQRLRMLYERKFQTMKQPEAISVLSDALAYRLQAM
                     ISSGSQRDRLAGLTGLSALIETRGEAYRTKVQRTYNGLRPILRRPPDWEAARAAADML
                     GRLSRLGGVLVNRFVEAEAVRALEYLNTNSVLLKGMAIMVLNALCEHVPASMYTSRVQ
                     LAQVVWRGLTDSRPILRLESASLLRSFLALLEQRASDDSARTCQMIIQRCLEMLISDE
                     RETTPPETHGSLLALHELVRNRFSATFLDEHISRIRKRLESLRLTRDNLIRAAILQLL
                     PDLVRLDRTLIELGMSMALENEDLVALGKLAVAVGPTAALPWMEHIFVVLRNSEVAAA
                     AKHECIALLAPIIVESEQSERLAELLEDSILTQGLSPSLVEALERVCEHVPSLRDLVH
                     GHVLRLCAETTDIACALQALQRFTFGRRPCLDDYVRQHVLPYIYGKRSLRSAAFAASL
                     HVLTAAVQSATPGRPLQPKIFETLQQLIVVVVADPDSRIRAEVLLHLAKPAYFPVFER
                     YLAQPELLRALCLALHDEDATVRERALSLVGRLSTVNPAHTLPSLRRLFMNLRIILEC
                     ESEPLQGSQEDALRLLLRLVQDAPQLIEPYTPTTAKLLVQRLQQNSTSAVAVDTSVIH
                     TLHSIACLAERGVAAELQTLLHDAMPHLLRILQHTSVEADLREAVCRALSSLARAAGA
                     TTELYTQYPSLLSTLLRMLRTETNLFVRLEIERTLGTLGAVDPDRTAPLLLDRTRYPY
                     TRLESLTEVYHQQTAPMHYAPRPTATGTGATNAFTTDTRCGLVAEEPALPGTAAAAAA
                     ATTTTTTTTLTGQALRAQLRFEAPNELETLVGRLPHPFTANEEYFPSAALDALHRILA
                     NAKLTTLHYDTVGAIVNIMSSLGMKCAPFLSVVVPRLLWMLRPRTEDTHDLAFREYVI
                     RGLASVVLSARQYIRPYAASLVALILEYWPLQVLHRSMFALMECLRVALHDEFRPFVP
                     VLLPLILPWMSLRVLKVLLVFGTHTSEYVVLVLPPVMRFLEDATRPLAARIEVLKRLP
                     RLFAMLDLSDMASQLMHPLCRMLRTSEFQWHARQLLESLLPRLGLDAAYYTLLVREML
                     LGDAASASAAATGNDDEDDDGNDDEDDDQHPTDEASARGAAASTESASTQAGAALQSS
                     SASALHRLARYRHERTALSRSESLDSLNGVPRTTSLGSLADLASGDALLAHSPDSLLD
                     STHVSLVASASMLDLQQQLQQQQQQQALLGSGASNTTTTNTNNNNNSGHNSARRHHVN
                     EKMLQKAWQVGRRTTRDDWNDWMMALASALFRESGSPSLRSCARLAEVHPPLARELFN
                     AAFLSCWTELSDPCRASLVRNLVLALSSESIPLDVLQVLLSLVEFMEHDEKPLPIDLR
                     QLAAMAFRCGAYAKALRYKEAEYMQNPASAMEGDDSLIAIYEALGQREAAMGALLDAE
                     RHQVTIRHEACYERLQQWDLALSAYERQGPAHSFANRRGRMRCMAQLGELHRMEALCN
                     DLWSEAAEQPSLRQELAEEAAQVAYQLQLWDKFTERVAYTSRDSIRGNVFRAMLAIHQ
                     GDDEAARGYIRAGRRLLDTGVTARVGEGYPRAYGDILLTQQLVELEECLMVRQRILPQ
                     RHVVEQLWNTRLYGCRFDYTTWQQTLLVRRLLLEPRHDKDVWLRFVSLCRRANRLPMA
                     NEALAMLQDEQHPDPEVTYASLKLCWSQGRHHEAYECLRRCAEQPVPSARLAARRFLK
                     LCVWGRALRAEGTSTFVSSPSSSLRWHTLMEHARRAVVSDPSWSSGWHTWAALNADAA
                     AAHSTGHRFGGAWPARPTAVAAAESNVLVRAYVLNAVNGFFRAIALGESYAEQAQDVL
                     KLLTLWFRYGAVPEIEQALLNGFAETNVDIWVDVIPQIVARLHSPVPPVQAGVRALLI
                     RIGRAHPQALVFPLAVAAKSSNARRREAAIDVLQALRLESPALVAQAELVSRELVRIA
                     VLWPEMWHEALEEASRVYFGEHNVPGMLAILSPLHDLVEAGPSTAREASFIREFGREL
                     AEAREWCRRYLASGRDSDLNQAWELYYSIFRRINKSLSSMTQLQLAEVSPALLEARNL
                     ALAVPGTREQVTIVSFAPVLNVISSKQRPRTLTIYGSDGHEYPFLLKGHEDLRQDERV
                     QQFFGLVNTLLPPEMSIVTYAVLPLSQQVGLIGWVKNCDTLHALIREYREQRKIILNV
                     EHRIMLSAAPDYDNLTLLQKVEIFEYVLANTSGNDLANIMWLRSRSAEMWLERRTNYA
                     RSLAVMSMVGYIIGLGDRHPSNMLITRDTGKVIHIDHGDCFETAMHREKYPEKVPFRL
                     TRMLVRALGVSGVEGIFRVTCESTMEILRANKPVLMAMLEIFVHDPLLVRTLQPAAAP
                     GATTTGLEATGLAAVAAGSPLHTPAVWPRQATGATAAATAATATAATATAAAATGQWG
                     TVSTFPVQEARLGERAGEEQPQPASTLVQVPRAPTRMRRVDMSGAEATAAAAAAGEAS
                     LSLRLLQGTMSLRAALRLEQSNAGTVEEVAEEGIAETPSPLTTRRPGAGSLTPRTLGN
                     GTLTTGAGAGAGAPTILPEDLLGDENRGERAVAIVQRMSQKLSGRDFDPRRVLTVAEQ
                     VERLIQQATNSENLAPAYVGWCNCW"
     gene            complement(<58157..>60457)
                     /locus_tag="CYME_CMR019C"
                     /db_xref="GeneID:16996906"
     mRNA            complement(<58157..>60457)
                     /locus_tag="CYME_CMR019C"
                     /product="similar to ribosomal processing, RNA binding,
                     nucleolar protein Nop77"
                     /transcript_id="XM_005538287.1"
                     /db_xref="GeneID:16996906"
     CDS             complement(58157..60457)
                     /locus_tag="CYME_CMR019C"
                     /codon_start=1
                     /product="similar to ribosomal processing, RNA binding,
                     nucleolar protein Nop77"
                     /protein_id="XP_005538344.1"
                     /db_xref="GeneID:16996906"
                     /translation="MKAGAAEPRLALKLSGVPRSSCRRAAVTELFGRIGPIRRCLVQP
                     KTGEAYIEYILTRDAEQALKLVHQRQLAAVAVAAASEPASNLSDSVSELVRATLQAAL
                     VPAQRGKNPLQRTTERSEPVRRPVEGALPLRTVRVRRRDAAAWSVAQETRFRSVLERF
                     GTQVWTGASTNGLSTATGALAPTYTQERERELILPTWVDARNVCGMLHDLVLEHEPST
                     DQREGLSAQIVGISTRKQCRVILRNLPFRFSLDALLERLRQVGPLVAVNVPRKAASTG
                     GASSDTCWAGYAFAEYFTRADANAAVQRLNGQSFCGRVLALDRALSRDDYRERQASTA
                     DNASDASRDSNANTEGDGRASSSEACTTKVVHASHEADTPASALPAETAAQTPVADGA
                     HAPSDRSRKRQRPAATTTTTTTRIERLEASSSDSMQPEADQAKPLHTSSGRDGEASRV
                     GAGTSEDRARAMLACTLFVRHVPLDATAAQVKALLEPYGPIRYCALVRDSITGLPRGR
                     AFVCFAERASAERVLNEASSDAPASLHESAFQLHGQRLQFSWALSRTDVAQVVTQRQQ
                     SMLTRAHHSDRRNLYLALEGVIERHQPAAAGLSESELALRERLEQAKQRKLRRNPHTF
                     VSRTLLSVHNIPRSLRIAQIKAIFAQAGASTETDAKPAVIKQVRIARERSRKQRVCAY
                     AFVEFATHDAALRALRLVNNNPNVLPAPHQGRRLIVQFAIEDERKLRILAAARAQKQH
                     SHSAPNAMSSTTRESCSRRTSPGHVC"
     misc_feature    61350..63551
                     /note="possible transcribed region"
     gene            complement(<63910..>66816)
                     /locus_tag="CYME_CMR021C"
                     /db_xref="GeneID:16996937"
     mRNA            complement(<63910..>66816)
                     /locus_tag="CYME_CMR021C"
                     /product="adaptor-related protein complex 2, beta subunit"
                     /transcript_id="XM_005538288.1"
                     /db_xref="GeneID:16996937"
     CDS             complement(63910..66816)
                     /locus_tag="CYME_CMR021C"
                     /codon_start=1
                     /product="adaptor-related protein complex 2, beta subunit"
                     /protein_id="XP_005538345.1"
                     /db_xref="GeneID:16996937"
                     /translation="MASLSSLKKRALHFFTGGKRGEVSEIREDLHASSSTVRKHALRQ
                     TIASMTVGKDMAPLFTDVVNCGQTSNLQMKKLVYLYIMYYAKNQPDLAILAVNSFVKD
                     AQDPNPLIRAIAIRTMSCIRLERIAEYLVPPLRQALTDPDPYVRKTAALAVAKLYDVN
                     PTVAIEGGFLDALRNLLQDGNAVVLSNAIAAWLDIRRRAAQRDDAARSHLSLEATHIR
                     RLLVALPDCGEWGQLTLLEALSLYDPQHAAEAKIIVERLTSRLQHANCAVVLMTIRIL
                     WRLLERFPTALSESSSGDFKTRKMLPALVSLVSSAQPPEVAYVALRILHIFMHTNSAY
                     LEKHYQSFFCDFNEPSYVKQEKIGLLMYVLNAANANAILAELQRYANDVEQNLATRAV
                     DAIGFAGLRCEAAAPAAVEALLSLARRGAPQMTERVLVAVTVLLRQYGNRFQAAAEKF
                     VQLATAPDDEHGQVALVRFEDERARVALLWLVGAYAPLIFCDVLRGSIWAAEQEAGFL
                     SETHSVQSQILSSLARLYGRARQRAASKSTPEAVSELRAAAAALEHTCQVAIAQSGRP
                     EVRARALFYRWLLDQEAPSATTSSITLSEVERLAHEEKPPAIPLHAVFNEDPALLQEF
                     QDELGSIASVLGLSSHRLAWVRSTRFETQALAHAGSDMHPERAGGVQATARVPLPATA
                     TATATATERSTSASRSVPSGNEVPLPAAPDHIPPRLLLSTEAGHGLRITGGLVRSRTS
                     SSSFDETHGMQLRLLLENIAAAQGVGDFAIQLNKNIFGVVAPPRFTTEPPILQRGDSA
                     VVVLPLTIQKEAFADQRANLVQIAIKCTPLGVLYFSDTIPVMEAIHATPRSLDRAAFL
                     DQWNRLGSAAEERFNWERAASQTVSDVRTRLRALTQTLSIMAERWLQPTDASVWQVFW
                     AAQMGLSAPMLGEMVVESTPPRVALVVRSQAPKLVISRLVEMLQHHLTGNVALA"
     misc_feature    67200..69204
                     /note="possible transcribed region"
     misc_feature    complement(67883..69561)
                     /note="possible transcribed region"
     gene            <68668..>69978
                     /locus_tag="CYME_CMR024C"
                     /db_xref="GeneID:16996968"
     mRNA            <68668..>69978
                     /locus_tag="CYME_CMR024C"
                     /product="transcription antiterminator protein, probably
                     for organellar transcription"
                     /transcript_id="XM_005538289.1"
                     /db_xref="GeneID:16996968"
     CDS             68668..69978
                     /locus_tag="CYME_CMR024C"
                     /codon_start=1
                     /product="transcription antiterminator protein, probably
                     for organellar transcription"
                     /protein_id="XP_005538346.1"
                     /db_xref="GeneID:16996968"
                     /translation="MFTEAAIPFPWRQRGTRLMACSGREFLCGLRRWNSSCNTLREPQ
                     QATVRQLLTMRGRKKSSKEAELQRDDDVTKAASGKEATAAAAAAAEGSEQAAASDAAG
                     VLRDMPAVLRERPHWYLVQTVPGLEDNVRITLEAKVRNTPSMTDKITQVIVPKLKAMQ
                     LSAGGERVEFEEKVFPCYVMVEMVLNEETWEFVRSTAYVVQFVGRDRARRSRAGGVVG
                     GRGLVQPQPLSESEVRRIFDQISVGSSIVSQELKIQAGDFVRVRQGNLAGHEGVVASV
                     SPGRGKLTVNLRWLNRDVPTEFGLEEVEKLDRKFVDLPAPPPDEESEAEPSEESAATK
                     IPRTVRRVLPEDRVEALEALARLDYDWRMLVAMERLDRVPMQALRQYCRAYGLGASGR
                     KVALIERVRQHVIEAIRKEEEQEEQEQVAENPPTPKEHSETVRE"
     gene            complement(69187..72497)
                     /locus_tag="CYME_CMR025T"
                     /db_xref="GeneID:16996969"
     misc_RNA        complement(69187..72497)
                     /locus_tag="CYME_CMR025T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461594.1"
                     /db_xref="GeneID:16996969"
     gene            <72630..>74906
                     /locus_tag="CYME_CMR026C"
                     /db_xref="GeneID:16996970"
     mRNA            <72630..>74906
                     /locus_tag="CYME_CMR026C"
                     /product="probable DNA (cytosine-5)-methyltransferase 3"
                     /transcript_id="XM_005538290.1"
                     /db_xref="GeneID:16996970"
     CDS             72630..74906
                     /locus_tag="CYME_CMR026C"
                     /codon_start=1
                     /product="probable DNA (cytosine-5)-methyltransferase 3"
                     /protein_id="XP_005538347.1"
                     /db_xref="GeneID:16996970"
                     /translation="MVEYKPISFWTNQRHHRQRPAMASLWTRAAAPLSRTQHTRVRRT
                     ARGCASGAEHQRPVFMATTAEAAAALASDITPEDFAGYECLLCQRRGALVVCSNAERY
                     TCRACVCRACFRRWGWSWERYTSASVDVPFLCPRCLVSEPILSFETGMLEEEEEEASP
                     RASEVSDTPTLREKLSMVQAFYACSRSPLFRSEDTYRNGRRRPGTKFGTTASETLSGV
                     KRSPNRVCVWRRLDAAPVARYTSDGREFFCRLGDGTHSHHPLLWCSACPAAYHAPSCL
                     SAAAAAAAAATSVTTTSLTSDEQEQQNVATTPRTGVDADRQTFWLCPFCRRQRLPWWQ
                     NSSESAPGTVLQKRHRHQRVQQRLRQPAALLEALARYCRRTWPPRVFSGPRFVVLSLF
                     DGLASARHALALLQIPPTLIRYYASEIDRDALAVAQSQYPDVLQLGPVEHLAAFDDIP
                     EQIDLLIGGSPCTSLSGLGKRKGLYHGTSALFFEFLRIKRVMKPRFYLFENVASMRCA
                     DKRRIHQLLNASRLNEASTSADQRKNSVLVELDAARVTASLRRRLYVANFPLPATDAA
                     LPDWNLRLQDVLDRDGSIAESAKAFCITTNNMQGRPGDSRFNVIAMPEQGVRRGVRIH
                     EAEKCLGFPAGYTAVLAKRSEGAMPRRWRLLGNAFAPPLIALLLRPLLEHSVIGAYLE
                     RAAVLPHLEAACREQLRGDRPEANTLVLVKVMLQRPSHAQLTGDDEGTVSCESRMRSV
                     AGAQRTNSDTCLVRGSTR"
     gene            complement(<76220..>80287)
                     /locus_tag="CYME_CMR027C"
                     /db_xref="GeneID:16996971"
     mRNA            complement(<76220..>80287)
                     /locus_tag="CYME_CMR027C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538291.1"
                     /db_xref="GeneID:16996971"
     CDS             complement(76220..80287)
                     /locus_tag="CYME_CMR027C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538348.1"
                     /db_xref="GeneID:16996971"
                     /translation="MVLALDAAQGHGFSGLRSKASSRLKTDMATSPGEGTRTGSFALP
                     SLGSKGSRTKQSSQRAERADVEQARHISGGLSPGDASSPPLLAEAASGRFSWETPHWS
                     SEPQFDQRIPASAPVSPVSLQGTRQQPSPAWVGRPATKTGLGTFEATEYVSLHTSEHR
                     GASVSDLPARFPNLPPSVRHETCLQSGSAKTTFQAPAVASAAQASLRDNPDHDQEPED
                     IEISLGCSSLMVAMIRDLLEPEDVVLPPASVTNRQHSPNLTSHTEDMERVSESLLDRG
                     WHYDRAVSPSPRYAFGRDIPSLPSSTQRHLRQERTEPGEGNHGPESSSRHRAGPFSSR
                     PSGTRRAGLSREPRPADQALRHTNSSLPSETGTPFVPTTSAASSTSISEKAQAGLAKK
                     KARGLCRFWPNCYRGESRCRFFHPADEEDAYKYLVWWLTNYPENRSELEFSSLLPTLQ
                     QRLSPIWKQQQQHQRQQQEEQMQTLDNPSPSPSTSAPVDCLGASLMSTPLAASAPFKC
                     HWSHGNDAATMQVEDWGWRRRKVPELPSTDDSDVRGALFRTGESESRDRLHLADVATL
                     LPPMMHGQGVDRIPALGKDHSQASNSASLAALSPRIRSSHAAAEQNTPSLQLPLSIVT
                     DTPCIPVDERERFSACTPGPWSSLQNVSLGTFTQRSSRESLVKPIATTQVSRQTILTP
                     VSASSDRISDAERVSRCPVSTRPFWDQTCLPKPSVAPANASPAGLRQPAVHRSAAAAA
                     AAVLSSPGVERSSAHSVAPENSPQVPLMLQGATSAVQPTVSQRLVRSENGQSGETVST
                     QCTNATTQLPSAKHESATTNHNARSDTRYTIPATVSASDAIQSETASANETAAGTATA
                     SVPTMDAVEAEEAKGSTSEAGAYRTRPAASSSPHRSVTTPGTSACSGSCNASQEPIAA
                     DAHWRRIPATNAPPSTSISLSSSSSSSLSAADASSSPGLHSVSRTRAQTRAHGAPCPV
                     HEILSGSSEFVPAGAISPAPACNVTERALIMSAAVRAPRRSTWKLLSCLRLACSAGRL
                     WRPRTAAPRSWLRRALHCRYTSALASLWYPAKCFIRILSQFRLQHDASGIRWVAILQR
                     LRSASLGTRWRRSSRRRLLQRFSQMFFSLDTGFLALYAILLPRLGRHILHQHLAMVRA
                     RALQQSAASLVVESALVEHQPSMPIGLWILHITWHFFVLSCLLGGNWPPEQLTWADHG
                     LIEWTAVVSNVLVLVTTVYSFAHGWNDVPYPRCFQWIEIDATSSIISAYVLAAFQSRT
                     SASRTVARSRQHGNEASGRLRRLRISPRLVIGENGFLKRQPVPKPWPVWTEPLFWLSL
                     LVQIVLAQWPGLGATYRTAVLLFIVLLTLSLLEKG"
     gene            complement(<81381..>84083)
                     /locus_tag="CYME_CMR028C"
                     /db_xref="GeneID:16996985"
     mRNA            complement(<81381..>84083)
                     /locus_tag="CYME_CMR028C"
                     /product="replication factor C subunit 1"
                     /transcript_id="XM_005538292.1"
                     /db_xref="GeneID:16996985"
     CDS             complement(81381..84083)
                     /locus_tag="CYME_CMR028C"
                     /codon_start=1
                     /product="replication factor C subunit 1"
                     /protein_id="XP_005538349.1"
                     /db_xref="GeneID:16996985"
                     /translation="MPGPSRKSSVSRRRVIIDDDEEDALGADWEPESASAATAQARET
                     TPRKRARQSAVEEAEARSTGLEQSPQRSLVNVDEHLVTPPRVTQARAGAPRGSSPGEN
                     VAEAETPTPSRESIRQRVWEHVQQVMSPPLRGKKAPPPRGSPDCLSGLNFCITGVMDS
                     LTREEMEDLIRANGGHVCKSVTRNLNYLVAGADPGPKKMQLAASRPSITVLDEDGVFA
                     LIRERSRDTKPPVNPQLEQALAPPPKGRRPSPPRPRSDAAVPRQETKENVPARMNAQA
                     ELWTVKYHPRQATELLANPGVLKQLEDWLRTWSQVYGAADHTSNRSSSANGSRGRITN
                     GNNKLPRAALLAGPPGIGKTSAAHAVARQCGYEPIEFNASDTRNRSSLHETVAELLRS
                     RTMHAFGQGRPHLELAGTSKGLWRNKLPAPQGQVLIMDEIDGMSSGDRGGLAELSRLI
                     RKSRVPIICICNDDSSPNLRTLKYSTLYLRFRRPMWSQIRKRLQEIAQKEGLRVDDAA
                     LEKLAEACHGDIRQMITMMQLYSGSSSERLSYMDVKQLNEFLGKTFEDQSVFQLFGLF
                     FHSPGWHLPGQTPHVDPRVDHGALESSAQLPGLSDLFETFFMDADLLPLMVQENYLLF
                     TNGKRNPTHAPYALRCMADAADAISWGDLTNDQIRRQNRWDLSNVLAFLSCILPGHAM
                     AGSQMSGRPNFPSWLGKNSTTGKMQRMLSDWVLRFQAARGPGGALGGAVDRRALVLDY
                     RPMLPYRLVVPLVLQGNDALPGVMDTMDVYSLTLEHWRSLLDELWLRPSVEVPASIKA
                     ALTRAYQQHEHPVHLVPLGRRGVPERPQDNENESVGDGNAGLLDADGAVVIDDTRGAA
                     APDTGTESETDTAADALIVQPRTTGKKKPAARRGSRKASRKLLA"
     misc_feature    83618..85193
                     /note="possible transcribed region"
     gene            <86038..>87330
                     /locus_tag="CYME_CMR030C"
                     /db_xref="GeneID:16996987"
     mRNA            <86038..>87330
                     /locus_tag="CYME_CMR030C"
                     /product="probable membrane-associated zinc
                     metalloprotease"
                     /transcript_id="XM_005538293.1"
                     /db_xref="GeneID:16996987"
     CDS             86038..87330
                     /locus_tag="CYME_CMR030C"
                     /codon_start=1
                     /product="probable membrane-associated zinc
                     metalloprotease"
                     /protein_id="XP_005538350.1"
                     /db_xref="GeneID:16996987"
                     /translation="MVEAFVWSVAAAKVPRTGRHTLGAQRQAYKPGSAELSAWRCPQR
                     RLSASKRPALVASIATEAGVNLTGVFILAGTVVIHELGHFLAARLQGIKVKGFSIGFG
                     PRLFSFRPKNSETEFAIRLLPLGGFVAFPEDYRYDEESKTIVKNDDPDLLQNRPLMQR
                     ALVIAAGVLANIALAWTLLFTSVETVGAPRMQFETGVSVPALTDMSAPAAKAGLKPGD
                     VIVAVNGQALAPGAESALEAANMLRRLAADPQHKPIELQLSDGRVVRVDPEGGRIGVQ
                     LVPNAKVSRERVPLRNAVPETNKEFVNTLRNTINGFITLFSNLKENSKELSGPLGVAS
                     IGAEIARHDASVLLQFAAVISLNLGIINALPLPALDGGQMAFLIVEAIRGKPLPRNLE
                     NAINGTALTLLLVMSGFLLIGDLERIQVLSWLMNGPSP"
     gene            complement(<88771..>89886)
                     /locus_tag="CYME_CMR031C"
                     /db_xref="GeneID:16996988"
     mRNA            complement(<88771..>89886)
                     /locus_tag="CYME_CMR031C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538294.1"
                     /db_xref="GeneID:16996988"
     CDS             complement(88771..89886)
                     /locus_tag="CYME_CMR031C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538351.1"
                     /db_xref="GeneID:16996988"
                     /translation="MQQVRTPVSAFLEQDADVNHDMGFLESVPAPAAVVLTGPVRWLR
                     LGESGIATIVGGRSWVIGALRSREPGVSEHEPRPAVTEEDERKLQRSSSSARVLQWDH
                     WCRGLHTDPITALCAELSLVGTARGTILRLPNTSADNREPARAPSYQTYELEVIMQTA
                     HSSIIGLNSKAVATDAGHLYRIDLESACFELHGMVGTGFSAFAALEHSFEVMTATLDG
                     AVRCWDLRVRADACSAASELPSALLASSISAFPRPQGSIPLCMDVDERYLVAGTDCGD
                     VLEWDRRQPASLLRADRLHEGPVLDARSVQCAGGQRKIASCGTDGRVYFGSTAADLGP
                     VVRGGPGADFANSLDIIQTERLIAFGGDAGLVYVYAI"
     gene            <91538..>93043
                     /locus_tag="CYME_CMR032C"
                     /db_xref="GeneID:16996996"
     mRNA            <91538..>93043
                     /locus_tag="CYME_CMR032C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538295.1"
                     /db_xref="GeneID:16996996"
     CDS             91538..93043
                     /locus_tag="CYME_CMR032C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538352.1"
                     /db_xref="GeneID:16996996"
                     /translation="MARRGRGAAAKSAGRAGSQPRDDTPVIGTLRPLVPFYVPDGAEG
                     AGKVNTELRSYERGKASHDSWSRNERPAVSAEASSGGAAPDNRIPVRVRRWDALQGTF
                     GPEDVHYVQVATSSLDGEQQSKAPVTLPYSSAQTLVTGQQDTARNLLTPDSILQQRTE
                     PKPHYANPACTISKELATSLVQYPNHGARERPESYTPGQAANALGAPTSHHPMQNASR
                     RHSTSASERIRYETAAPLKHHTHRNGSTSTTSHVRLDQGKRCSTVNDGMRYAGASYSA
                     TVPTPQAVPIPKFARRYLEMQTATPGPSTGASSSASTTASGHTTMLPTNIPMDLNGTY
                     SHSRSALTAAERCTLMDGTQVERCLLARSDYGEQAGSPAVLCPTASTAWAPPMHSGTG
                     HQSVDRPMPPWSVSGYQLYQNLGCEQAPSTHALRPWPASEHPLGPASLAPITTVPVSS
                     QTASSVGTTSTGHDAEDPITAQLRQVLRLASPAAVPQQQQQSKMQRSPRSR"
     gene            complement(<94950..>96332)
                     /locus_tag="CYME_CMR033C"
                     /db_xref="GeneID:16996997"
     mRNA            complement(<94950..>96332)
                     /locus_tag="CYME_CMR033C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538296.1"
                     /db_xref="GeneID:16996997"
     CDS             complement(94950..96332)
                     /locus_tag="CYME_CMR033C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538353.1"
                     /db_xref="GeneID:16996997"
                     /translation="MSEHERISSLDDDARKLLVDRHAELVKELNEVLQTKQRIRAACE
                     ARAWPRARPSRVNELRAQLAQLETRSEELTALIHHLSELMAGHDLDLLGTGTPLQDHR
                     RNSPKLTTAEPLRSGDMSADADPIEATLAGLSLAELRELSVEQSEQLNEVERQIRLWH
                     EHSHRSQNDGHTGESLARLRMLETRREKLNKCLDDIADAMLQVEEEDLWQATAEPNAI
                     SFQTRQHFKHDAAVSAGQTEPLRLHSEDTGRRDATAPAHIHADEVPTESWTAEFERED
                     NPAYTTHTSSQTMPRPQTAADDVVDPSSAQEYRSASFDDAIEQSAYRKRTHSVSPVRH
                     WEWADAADTASAAATGYTSRYANERAQLIDAGSVLPTPEHERQRQQQQQQQHPAATSR
                     MAPRYSAALVQQRVERARERLAQRGEALRNLHISSAGLQNDASAFENLSERLARKNRL
                     FGGRFWESFL"
     misc_feature    96818..98064
                     /note="possible transcribed region"
     gene            complement(96923..100688)
                     /locus_tag="CYME_CMR035T"
                     /db_xref="GeneID:16996972"
     misc_RNA        complement(96923..100688)
                     /locus_tag="CYME_CMR035T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461595.1"
                     /db_xref="GeneID:16996972"
     gene            complement(<101624..>103216)
                     /locus_tag="CYME_CMR036C"
                     /db_xref="GeneID:16996973"
     mRNA            complement(<101624..>103216)
                     /locus_tag="CYME_CMR036C"
                     /product="myo-inositol 1-phosphate synthase"
                     /transcript_id="XM_005538297.1"
                     /db_xref="GeneID:16996973"
     CDS             complement(101624..103216)
                     /locus_tag="CYME_CMR036C"
                     /codon_start=1
                     /product="myo-inositol 1-phosphate synthase"
                     /protein_id="XP_005538354.1"
                     /db_xref="GeneID:16996973"
                     /translation="MLAEEVYVQAPNVRYTPDYIEADVDYETNAVRLERNSGRAIVRP
                     LSVKYTFRTQRRVPRVGLMLVGWGGNNGSTVTGAVIANREGITWRTKHGIQTPNYFGS
                     LTQSATVRLGSLYESDGRFEEDVFVPLRALLPMVNPNDLEIGGWDISSANLAEAMRRA
                     QVLDYDLQLQLEPYMAPLKPLPSVLYGDFIAANQASRADNLIPGTNKWEHLEKIRADI
                     RAFKAERNVEKVIVLWTANTERYATVMEGVNDTAENLLHAIAASHSEISPSALFATAS
                     ILEGCSFINGSPQNTFVPGVIDLAVQRDVFIGGDDFKSGQTKLKSVLADFLIGAGIKP
                     LSIASYNHLGNNDGKNLSAPSQFRSKEISKSSVVDDMVASNGVLYRPGESPDHLVVIK
                     YVPAVGDSKRALDEYESEIFMGGRNTIVVHQTCEDSLLAAPLILDLTILAELAERIEM
                     KRADEEKFERFHPVLSLLSYFLKAPVVPEGTPVVNALARQRLCIENILRACIGLAPEN
                     EMRLEHKRRPRSLVERKLLVPN"
     gene            <105620..>108352
                     /locus_tag="CYME_CMR037C"
                     /db_xref="GeneID:16996974"
     mRNA            <105620..>108352
                     /locus_tag="CYME_CMR037C"
                     /product="probable serine rich pumilio family rna binding
                     domain pr otein"
                     /transcript_id="XM_005538298.1"
                     /db_xref="GeneID:16996974"
     CDS             105620..108352
                     /locus_tag="CYME_CMR037C"
                     /codon_start=1
                     /product="probable serine rich pumilio family rna binding
                     domain pr otein"
                     /protein_id="XP_005538355.1"
                     /db_xref="GeneID:16996974"
                     /translation="MEERRSDVFDPLPDRSHAAISWRTAEPQTPSPPLPTDFPRPVSA
                     PPDLEVPEPLLLASSGIQPNWFSIVDIRADMDYESFYDAFKAQTKLPPPLDSSVLRGD
                     FRTVQRVRSQNERREHVSMDAALEQAGHALAGLGGTGGASLTPHSLAASNRGYGEAMR
                     FTDPHGGLLTMEQVAVSSHAALGKGPASPDQMLFPGSRASQMMAGSGAPAEVLRPVAN
                     AGALLRRDDSDASVENLIFRETLKYARQLDRESSESDLSTTAERRITGSATQTTNAAI
                     YHEADRRLWQAPLVATTVLYSSTKPHPDTNDNALAQKAVGLAGTQDTDGTKNHAAATA
                     AAASAPSHISDNSAGAGRIPSGGTGCEAGERYEERSSPRSRNELAAGIQRGVPSRSQT
                     PSMAAIAAVSPPVATITPGSCAATSVVPRIPVTTSTMGAQVAQTSTLMPAWTEAVAPV
                     QSMENSGAFDIRDIRAPLPHPGAEHLPKKPWSTRGRPRRAPRNTARSSIYLGQHQAMP
                     SQELPVGLDAAASGHQPHHPELVSFKSAALAASIPTNTAPDGALSDASAPLSCFAGRM
                     ALMARDQQGGRYLQARLDVKNAADTALIFEECRPHFVELAMDPFGNYLCQKLFEHCNR
                     EQRLELIRQSASQLAQVCMDPHGTRVVQKMIELTVEPEHAALIAQAISPHCLSLMCDV
                     NGNHVIQRCLQRMDVPLRRFIYDTALTRYLEIARHRHGCCVLQRCLDHATAEQRSNLC
                     ALILNSAYELMQDPFGNYVVQYVLELKEPSYTRAIIQRIRGHLWQLSMQKFSSNVVEK
                     VFTMANERDLRSLLHELLEGPQSVESMPLQVGSEQHQRNIRPLLFDPYANYVVQRALS
                     LAPSPVFEALREAIQPHLAELRGTPFGKRIQARLSRTPLRTGSAVTSANGSKRL"
     gene            complement(<108349..>108819)
                     /locus_tag="CYME_CMR038C"
                     /db_xref="GeneID:16996975"
     mRNA            complement(<108349..>108819)
                     /locus_tag="CYME_CMR038C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538299.1"
                     /db_xref="GeneID:16996975"
     CDS             complement(108349..108819)
                     /locus_tag="CYME_CMR038C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538356.1"
                     /db_xref="GeneID:16996975"
                     /translation="MTCVDDGWKRRHPVFTAAVMIFRLPATELEVKDRYAYSKTRTRE
                     ARATQSHKRLVKPHIHEHENMLKFQRVCPCEQSGPVLFYSDMDLAAATTTTRTRTTAR
                     RRKRPKSRGFALCSWKPALPRSTVSEARPELPSDAAAPCPASARQRCKLLLCAC"
     gene            complement(109688..112627)
                     /locus_tag="CYME_CMR040T"
                     /db_xref="GeneID:16997046"
     misc_RNA        complement(109688..112627)
                     /locus_tag="CYME_CMR040T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461596.1"
                     /db_xref="GeneID:16997046"
     gene            <110410..>111039
                     /locus_tag="CYME_CMR039C"
                     /db_xref="GeneID:16997048"
     mRNA            <110410..>111039
                     /locus_tag="CYME_CMR039C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538300.1"
                     /db_xref="GeneID:16997048"
     CDS             110410..111039
                     /locus_tag="CYME_CMR039C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538357.1"
                     /db_xref="GeneID:16997048"
                     /translation="MARSGACARTHELRWNHTKVSLPASFASQYDVRGPLAVSHDGHS
                     KVSLPASFASQYDVRGPLAVSHDGHSKVSLPASFASQYDVRGPLAVSHDGHSKVSLPA
                     SFASQYDVRGPLAVSHDGHSKVSLPASFASQYDVRGPLAVSHVGHSKVSLPASIATQY
                     DVRGPLAVSHVGHSKVSLPASIASQFDVRGPLAVSHVGHSALFPKWRST"
     gene            complement(<113945..>115780)
                     /locus_tag="CYME_CMR041C"
                     /db_xref="GeneID:16997047"
     mRNA            complement(<113945..>115780)
                     /locus_tag="CYME_CMR041C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538301.1"
                     /db_xref="GeneID:16997047"
     CDS             complement(113945..115780)
                     /locus_tag="CYME_CMR041C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538358.1"
                     /db_xref="GeneID:16997047"
                     /translation="MLETASGFAAGPHLCHQRSSTRRLAARHKISRCVTALPQPRRNH
                     YYLQRRAVRCVHQQSGGYIKSSVPQSVHPVMESFRKLRTLVRRECERLAVDAGNERAG
                     QAFQTQVDALLSAVLGGGVLSEQILTVVWRYRTAIGRYLEFSMNQKQLLLERLDRFAD
                     HCEQHSRASVNDERPREPSAPAPGHPSKRQLTVTTHPDPTGTKPNLAYCAITREQLRR
                     HPCYEALPPVEALVIERPEDLTRIRQDSALWLEARRHMRVNASSAWKALGFGEPATLE
                     WLRECVPAWQFRRGGEAALEAWRQWREPGLDAETFSPASMISMEWGKMHEQNGLLTVL
                     RYLESARTADAASCYYSIVPGDGAPDRGLVPGASTATNTSFAKLVLVEAGLHMLQPAS
                     CAGIYDLDEFSALPTIAASPDALLRWRSPLHSEARTQDTQPNTLAASSDLSHDIELVE
                     VKCPCPFVPTGDMTDGPRLTDEATDRPLYRYRLVSPQRLIYANHFAQVQLQMLCTDTW
                     RAHFISWTPDAGARLFVVERDEMWLEMALITLRDFYREFQQAPPPVNFFADRATYRQL
                     LERTVAGVRQSAHQSVTLSAEEVDRLLAWEREAGYWEPVESLFLS"
     gene            complement(<118819..>119676)
                     /locus_tag="CYME_CMR042C"
                     /db_xref="GeneID:16997052"
     mRNA            complement(<118819..>119676)
                     /locus_tag="CYME_CMR042C"
                     /product="similar to carbonyl reductase"
                     /transcript_id="XM_005538302.1"
                     /db_xref="GeneID:16997052"
     CDS             complement(118819..119676)
                     /locus_tag="CYME_CMR042C"
                     /codon_start=1
                     /product="similar to carbonyl reductase"
                     /protein_id="XP_005538359.1"
                     /db_xref="GeneID:16997052"
                     /translation="MTRLAIITGSSRGIGRAIAKRLAQEEGLQVLVTARTPEAAKEAA
                     DSISKEVGSTEHPALWHALDLLQPDTVTKFRDYVKSLKRPVDILVNNAGMAYKGDAFD
                     EKVARETVGCNYYGTKLVTEALLPYIQPDGGRIVFVSSRAGNFDKITNAELRERLLGA
                     RTVEELDALAEDFVRSVGDGSYAQHGWPRQTYAVSKMLETMYAVILAQRLRSIHPHVL
                     VNAMCPGYVKTDMTSHRGVKTVEEGADTAVFLALLPREAEQEPHLYSGCFWAERQRLE
                     LRALGPVVR"
     misc_feature    complement(120265..121017)
                     /note="possible transcribed region"
     gene            <121466..>123685
                     /locus_tag="CYME_CMR044C"
                     /db_xref="GeneID:16997054"
     mRNA            <121466..>123685
                     /locus_tag="CYME_CMR044C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538303.1"
                     /db_xref="GeneID:16997054"
     CDS             121466..123685
                     /locus_tag="CYME_CMR044C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538360.1"
                     /db_xref="GeneID:16997054"
                     /translation="MRSSVVTLSGWALRNLRFAYPRNNDGVRVLKRFLGRDLASRQLI
                     PHTRFLATSADGSASLPGTQSAETLAVSAESEALRSALGLLRNHRIAEAHRVVREQLL
                     ANGPLPTEVRRKIMSAGSRSGATALVEEVLERTVSETAEPSSSVFDHNAVLRACEVAM
                     DLHRAERIFSNMPERNHYSYAIMAVIYSNAGRMRHALDMASRALGGLDLHKALEKLPS
                     QTKSTAAPADAETIPAAASASEEQSAMEAEEEPATAAEDHLEETPSTATGALTPAQKS
                     FLMSRLIDSSLRYRYNHVALNLLRVMREELRMRPRLTTISNLLVRLCNANNAQASYEL
                     LNGIRRPGIWATLRGARPIELGVLLPALGCALRNDHYALGDLAWNEIQSRYLPAERQI
                     VLGSVSAAGEKSASQSLFEVPDIFFYTRANLLARQDSKEFQSTKPEEATSSAPAAQPA
                     PGTADSSTSTEPRTEVILSERMRSCFELLRLLHHRKYQRVLGLDITVDARDTAPRIEL
                     LRGVVNSLACHVDRVDAAHFFLEHELVREAVPNTAAPQALLPGKMDLLAPLNCVIAAS
                     SQMGDLDRAFQTYETLQDHGKKHQLVPNIETFNALLLGCGKQGHWEAAKLVLEKIQEE
                     QLKATGETHEKILYVMLRARRFQEAIEYLRQNSNQPKHAEDQARAGRAPVPFTAYRMV
                     ARIALLRPDAPAVVRELQHLAAQAGYHNLDLTRIHSARAREERGASNASASGVNPSS"
     gene            complement(<124762..>125055)
                     /locus_tag="CYME_CMR045C"
                     /db_xref="GeneID:16997055"
     mRNA            complement(<124762..>125055)
                     /locus_tag="CYME_CMR045C"
                     /product="similar to protein phosphatase 1, regulatory
                     subunit 11"
                     /transcript_id="XM_005538304.1"
                     /db_xref="GeneID:16997055"
     CDS             complement(124762..125055)
                     /locus_tag="CYME_CMR045C"
                     /codon_start=1
                     /product="similar to protein phosphatase 1, regulatory
                     subunit 11"
                     /protein_id="XP_005538361.1"
                     /db_xref="GeneID:16997055"
                     /translation="MTSGNNHLTAAAATSRTELVETPVLRLRLRARPQVRSSTERHVR
                     WSDDTVDNEHACKRKSKKCCIYHKPHSIESSSDSSSSDDDDDDDDIDCGESSS"
     gene            <127514..>128719
                     /locus_tag="CYME_CMR046C"
                     /db_xref="GeneID:16997064"
     mRNA            <127514..>128719
                     /locus_tag="CYME_CMR046C"
                     /product="similar to COP9 signalosome subunit Csn12"
                     /transcript_id="XM_005538305.1"
                     /db_xref="GeneID:16997064"
     CDS             127514..128719
                     /locus_tag="CYME_CMR046C"
                     /codon_start=1
                     /product="similar to COP9 signalosome subunit Csn12"
                     /protein_id="XP_005538362.1"
                     /db_xref="GeneID:16997064"
                     /translation="MQALQQLTWGFEHRQADVVEHALEQLFNDAQSSQQAALILDQNR
                     SNNWATLVWHWSRAATTWHTVARSDASVAQIFQELKNALSSLYDEMRNENSGNWFVPI
                     AALLCRYLVQCAARVQVERSDPLRTDRDRRARLAEAETIIKRGLALMINDRSAEISES
                     KKLGALGMIVYLLRIYFALNNLRMCASLVRTVESPGFPPLDDAFPLDQRVTYHYFVGR
                     IALYEDRYVEAETHLAFAAHHCPVRYERNRKRIWTYLVPVRLLQGRLPSVRLLRKYGL
                     RVYERLREAVIYGDIRQFDDVLRRHGEFFIQSGLLFTVEKLRLIVYRNRFRVAVRLLN
                     STRIPLAALQCALTDPKPALDELECLVANLIYRGFIRGYVSHQKKYLVTSAKDAFPDI
                     ARVSPGVLR"
     gene            complement(<132032..>132877)
                     /locus_tag="CYME_CMR047C"
                     /db_xref="GeneID:16997065"
     mRNA            complement(<132032..>132877)
                     /locus_tag="CYME_CMR047C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538306.1"
                     /db_xref="GeneID:16997065"
     CDS             complement(132032..132877)
                     /locus_tag="CYME_CMR047C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538363.1"
                     /db_xref="GeneID:16997065"
                     /translation="METAPYLREPHVVLPSESVITEAVKCFNDAVDEALQPSVRESYL
                     LPESRREAVREQLRATAAALEELLRKNCVVFAQVQASFPEEEEDNEIRGKVKTLEALI
                     IEKEKYLRRLRAERCATAEQLVRAQAERLAQQVTALQAEAVFSNAQFEDLVSDNESDT
                     ELSDGRKRALEEQVLQRVETVRKLMSELLHRLPALKDKAERLREVAQSFGGVEPSETE
                     IFIKEDVSNLLSFDICTENLRPEQPNTEVETRSSRASKESAGAITRARLAATLRVSGS
                     VTRIR"
     misc_feature    133025..133874
                     /note="possible transcribed region"
     gene            <134775..>137390
                     /locus_tag="CYME_CMR049C"
                     /db_xref="GeneID:16997067"
     mRNA            <134775..>137390
                     /locus_tag="CYME_CMR049C"
                     /product="similar to nucleolar complex Nop3"
                     /transcript_id="XM_005538307.1"
                     /db_xref="GeneID:16997067"
     CDS             134775..137390
                     /locus_tag="CYME_CMR049C"
                     /codon_start=1
                     /product="similar to nucleolar complex Nop3"
                     /protein_id="XP_005538364.1"
                     /db_xref="GeneID:16997067"
                     /translation="MNRKRYRFEAGKTTDPDETPTATGAERSAKTVLRSLVKQLLPPQ
                     GKPQRKHRQRDASKASGLEGKYSPSRRKRDGDGDAASRVERAYAAMQRRLQAAQKSSK
                     RKAGRLPVRDPISGTWLVPGTDSVSERGATSNGHPQTVRLVRPGARLRSPIQEVAESP
                     QHTAPMHNVIRRASDSPQRDTLQADRDHKDDMHTTEADASDEAIAVCPETRRAFGRDA
                     ASAFETLAPKQHSFIVLIAGTCAAIAENPEQETGKLQSLPSLLRELDRFQRAVRTSPS
                     GTAWSAHATLLCIRSLTELFLDICPGYQIRIPSEPKDGVRLSKTVRKLRKYESVLLQA
                     YASFIRWLRKHLEGAGRCPDTAHSAVDGMLRQTCLQSCQELLLQLCHFNHAEDLVEML
                     VSQFGTDAATDEVLVATASELMELFESSTGSSLRTAVRLVRALCRRLRDEGIRAPAAI
                     VEPLLKVPLEALHAAPKKKRHQQHADGGNTAHPLSRRKKARMQHGALRQWMEEKQRLD
                     RQVDEQLSRDIHDLEAESTPEEMNWARRQVMAALSQAYAQCLLQLEQALQSQTNTGDT
                     AIPPGKNERSRSPGDKVTPQTKLRDRRARLKRLNNLLPRIAEGLGQIALYLNAKLLND
                     LLLTMYRIIDAAFAADTEAQSLLGLLRCVRAAYQIIIAQQIATQNADPTYLDGILFRC
                     MNPTGVVVKLPPDCRASWHRELTAAVDFGLLGSRRTLPIRRGAAFWMRLLECALHATD
                     TSWACLYVRKAESLVERYPVLRTWLASAMTVEETDTNTDTDRTILAAPIGLLPSTPRA
                     LSDHHWDALAADPDIVGAMLLADQAVVAIDAHGTRVRVRDLCAAPALGPHTQRGAASI
                     AQALLQRLRAPLPAI"
     gene            complement(<138285..>139718)
                     /locus_tag="CYME_CMR050C"
                     /db_xref="GeneID:16997068"
     mRNA            complement(<138285..>139718)
                     /locus_tag="CYME_CMR050C"
                     /product="chitobiosyldiphosphodolichol
                     beta-mannosyltransferase"
                     /transcript_id="XM_005538308.1"
                     /db_xref="GeneID:16997068"
     CDS             complement(138285..139718)
                     /locus_tag="CYME_CMR050C"
                     /codon_start=1
                     /product="chitobiosyldiphosphodolichol
                     beta-mannosyltransferase"
                     /protein_id="XP_005538365.1"
                     /db_xref="GeneID:16997068"
                     /translation="MALSTARLPEAKHDDSELVAPHAVVLVLGRLEQSPRMLAHASAL
                     AAEGFRVTLLGYGNVDDLNNAQVRVVSLSRATPTSVHAGEQTRRWRRRLSYPWRAFCA
                     LVTRLWLVRRAFDDIPPWDLLVAQNPPAFPTLMLVPWLRWHRARPGAIAVLDWHNTTH
                     SIMAINRAPGSAVALAARLEYLLGARVADAHLAVTGTLGEHILAEMALERSKLLVLPD
                     RPLRDWTQRFLSSALDTEQRYHRRRDLCRRVFHWTDEAIESAIAQVWLCSATSWSPDE
                     PMELLFQAVVLLEKKYGWSGRLFITGRGPLRSFYVERFWPQLGLTRWSLHALWLPSRD
                     DYAQLLSCADAGISMHQSSSGMDLPMKVFDMWGCGLPVIAYAYPCLEKDLPLQRLDGE
                     LDASGAPSSAMMGTAFTDLSSLVSSIIQVKRHQERYRENVMRICATDPTWQWESQYVK
                     RFLPFLAKMRADMLSAATETTTRMHRR"
     gene            complement(139748..139833)
                     /locus_tag="CYME_CMR051R"
                     /db_xref="GeneID:16996708"
     tRNA            complement(join(139748..139783,139797..139833))
                     /locus_tag="CYME_CMR051R"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:16996708"
     gene            <140184..>141212
                     /locus_tag="CYME_CMR052C"
                     /db_xref="GeneID:16997101"
     mRNA            <140184..>141212
                     /locus_tag="CYME_CMR052C"
                     /product="ferredoxin-NADP+ reductase"
                     /transcript_id="XM_005538309.1"
                     /db_xref="GeneID:16997101"
     CDS             140184..141212
                     /locus_tag="CYME_CMR052C"
                     /codon_start=1
                     /product="ferredoxin-NADP+ reductase"
                     /protein_id="XP_005538366.1"
                     /db_xref="GeneID:16997101"
                     /translation="MFAFLPSITSHRLYVSGKDGLRTSTLKTESARLQTRVGCRSRPA
                     TLRMVAAEKKVPVNLYKPNDPLIGTCIYNKKIVGDDAPGDTCHVIIHHDGKLPYLEGQ
                     SVGIIPEGTDEKGRPHKLRLYSIASTAAGDFGDYKTLSLVVKRLVYTNEKGEEVRGVC
                     SNYLNDIKPGTPVKMTGPVGKEMLMPDDPNATIIMLATGTGIAPFRAFMRKAFVEKHA
                     DYQFKGKMILYLGVPTSSSLLYRDELEEMKANAPDQVELHYAISREMKNKQGGKYYLQ
                     DAMAERGEEIWQLLQKDNTYVYMCGLKGMDSGIDAFMKDLAAKDGVDWATFKKQLKQQ
                     HRYNVEVY"
     gene            complement(<143792..>144835)
                     /locus_tag="CYME_CMR053C"
                     /db_xref="GeneID:16997102"
     mRNA            complement(<143792..>144835)
                     /locus_tag="CYME_CMR053C"
                     /product="DNA repair protein RAD51"
                     /transcript_id="XM_005538310.1"
                     /db_xref="GeneID:16997102"
     CDS             complement(143792..144835)
                     /locus_tag="CYME_CMR053C"
                     /codon_start=1
                     /product="DNA repair protein RAD51"
                     /protein_id="XP_005538367.1"
                     /db_xref="GeneID:16997102"
                     /translation="MPRRVEATATVEALEEDLVEKNEQTVAAGPTPLAALEGVQGITA
                     SDLKKLREEGGVHSVEAVVYLTMKQLTSIKGVSEAKAEKLKSAAAQLVMAGFTTATEV
                     HRIRKDLVFLTTGSKELDALLQGGIETGSITELFGEFRTGKSQLCHTLCVTCQMPVAE
                     GGAEGKALYIDTEGTFRPERIVQIAERFQLDPQDVLDNVAFARAYNTDHQMELLMQAA
                     GLMSESRYALVVVDSATALYRTDYSGRGELAARQQHMARFLRALQRLADEFGVAVVIT
                     NQVVAKPDAMMFADPRVPIGGNIIAHACQTRLYFRKGRGENRICKIYDSPSLPEAEAS
                     FAITEGGVADPVD"
     gene            <147111..>147995
                     /locus_tag="CYME_CMR054C"
                     /db_xref="GeneID:16997103"
     mRNA            <147111..>147995
                     /locus_tag="CYME_CMR054C"
                     /product="similar to phosphatidic acid phosphatase type
                     2B"
                     /transcript_id="XM_005538311.1"
                     /db_xref="GeneID:16997103"
     CDS             147111..147995
                     /locus_tag="CYME_CMR054C"
                     /codon_start=1
                     /product="similar to phosphatidic acid phosphatase type
                     2B"
                     /protein_id="XP_005538368.1"
                     /db_xref="GeneID:16997103"
                     /translation="MEREPGAPYAVGSEPVGSFPRRQVLFQDLTSTLCTFALSLAALA
                     VSIGLGFARPTVRPFFVNDANHWYPFRNETLPYFVLLLVGLVVLTPVIALYEFFVYLE
                     RESFFAALNHVLGFISAFAWSSMTTQCIKLYAGSLRPDFGSRCFGNGKFPPAAYSPGV
                     VLSNMECTVADARFLNSGRMSFVSGHTSTAMVFATYFALFLSRRARMLPETRFRWLKT
                     NLMYLGALITLLMAIFVGVSRIVDNRHFPADVVGGALVGIGFALGIFMLIESNVRILH
                     DKKYHPLSFNGFERPPVV"
     gene            complement(<148473..>149936)
                     /locus_tag="CYME_CMR055C"
                     /db_xref="GeneID:16997104"
     mRNA            complement(<148473..>149936)
                     /locus_tag="CYME_CMR055C"
                     /product="similar to cationic amino acid transporter"
                     /transcript_id="XM_005538312.1"
                     /db_xref="GeneID:16997104"
     CDS             complement(148473..149936)
                     /locus_tag="CYME_CMR055C"
                     /codon_start=1
                     /product="similar to cationic amino acid transporter"
                     /protein_id="XP_005538369.1"
                     /db_xref="GeneID:16997104"
                     /translation="MGRTPSADDAVGEGKSPGNVHLEPVDQLDARVASSMSAAKTNPP
                     RALSLLQVVGMLFLLTSGGGYGLEPIVGAAGPRWALLAMLVVPWLWALPQALMASELA
                     TLIPEDGGYVLWVEAAMGPFTGFQQGWWSFVDSLVDNALFPRLFSDYIVRVAPVLGVY
                     GSWFCGLLVLALCTIVNILGVSIVGWVAVLFTVVVISPFLLICVFGFRQTRPEAWLST
                     RPLTEVNWRLFLAALLWNWCGFDSCSTIAGEIVDVHRTFPRAMVIVLLLTMMIFTLPI
                     AAAVSTNHVWSEWRDAFWPTAANRLAGGHWLGILVSIGGMCSAAGMLSSLVATSSRAL
                     YGMTRMEMLPGGLGVLHPRFRTPWVCVLIIGLGTGCFTALPFNVLIQIDSTLYCLKVA
                     LEFIALAVLRRKWPDRDRPFRIGGGFWGLFYVTGCGLFCCMAMAVLSGLWSAISAAIT
                     VATGLILYGMLRFSRRFQRAPATRNSASPWTIEEAPA"
     gene            150478..152122
                     /locus_tag="CYME_CMR056T"
                     /db_xref="GeneID:16997098"
     misc_RNA        150478..152122
                     /locus_tag="CYME_CMR056T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461597.1"
                     /db_xref="GeneID:16997098"
     gene            complement(<152840..>154822)
                     /locus_tag="CYME_CMR057C"
                     /db_xref="GeneID:16997099"
     mRNA            complement(<152840..>154822)
                     /locus_tag="CYME_CMR057C"
                     /product="ubiquitin-specific protease"
                     /transcript_id="XM_005538313.1"
                     /db_xref="GeneID:16997099"
     CDS             complement(152840..154822)
                     /locus_tag="CYME_CMR057C"
                     /codon_start=1
                     /product="ubiquitin-specific protease"
                     /protein_id="XP_005538370.1"
                     /db_xref="GeneID:16997099"
                     /translation="MSRGRPRRGGKKGHARKKARAENRHGRGTVCETPPSPAAEPPSD
                     SEQELCIPAGLENLGNTCFFNSVLQCLARLPSLQSYFQSTKSNAIVRFEGAVTLALRL
                     FLMTLWRHERQRAQKRIFADSSTGTESDIAAGSSAPNHTNDSAALERATRRLFEEIGE
                     KCPRFKGWAQQDAHELLLALLWTIDDEEQERLRAGKSMSKTPDSAKTVEQARSFVRDI
                     FECRVEDRLEMPSSGGKPQVRHEECLALSLPILRLRQSGDARVRGGRNEEQRAGTRDM
                     CASGCSVDGKDAPKAGADARRQNLDGTDLSETEWNQSRSLMQANNRSYSEDEDYDESD
                     CRLACVSSLFDDVELDDEPACRDSASRACSATRASSTGIGVHGGLLALTCEPMHSKNS
                     VHGSSQMSEVCTRLGECIAEWARTEVIELVQSTQTSKECATTGHDAEKNSSEKLASNK
                     EQSTSCTSSALPDINTANGVRCESIPPGSQTGAGAVSTSNGFHSGDSAAAGHASETVS
                     DWEAAPLKARKWMRLENAPRCLVLHMKRFTQLDVGYVTKIDDHISFPETLSLGELSET
                     EALAPMVAADLARVRYELCGVVEHNGTLHFGHYVAYVRARRVATSNQQWFYCSDRHIR
                     SCTLDEVLQAQAYLLFYFRVSESEENNLPAAVPEKP"
     gene            156100..158003
                     /locus_tag="CYME_CMR058T"
                     /db_xref="GeneID:16997100"
     misc_RNA        156100..158003
                     /locus_tag="CYME_CMR058T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461598.1"
                     /db_xref="GeneID:16997100"
     gene            complement(<157721..>158905)
                     /locus_tag="CYME_CMR059C"
                     /db_xref="GeneID:16996943"
     mRNA            complement(<157721..>158905)
                     /locus_tag="CYME_CMR059C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538314.1"
                     /db_xref="GeneID:16996943"
     CDS             complement(157721..158905)
                     /locus_tag="CYME_CMR059C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538371.1"
                     /db_xref="GeneID:16996943"
                     /translation="MLLNDGYSLNSKVSLENARKMPRQLASGRVSTLRLRTLAALLCL
                     WLSLWTVSMWFSSVRADAPSNDAGLQQAPAVNEQRAEPETQPAPSRVPVGGSAYFFGH
                     IFVKPDPQDIGEALSGVWTVDIGVLSRQSGRKLPPSRRWPARRARLSVREVASYKPPP
                     PRGALEKWLIPDGIESGSMEFKDERGKRVPSAPFRLIRLETDAPWRGRFTFYDLKDTD
                     EADGGAMPTRESDFVEWFRFDLERLPQSGIWGPKYASVGNETLSRSAETAQDTRGSQP
                     ASSGLIYILDRNHFLLIYTDELHDELVYLSGLRGDTILPNSRMSKLGPALLIGLISIG
                     AHLAFHYLNRYAPHRRLATHAAIARAVHARDRDRMWRQQYEYARLDTPRGRAQTEEDK
                     RD"
     gene            159068..162199
                     /locus_tag="CYME_CMR060T"
                     /db_xref="GeneID:16996944"
     misc_RNA        159068..162199
                     /locus_tag="CYME_CMR060T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461599.1"
                     /db_xref="GeneID:16996944"
     gene            complement(<159601..>162492)
                     /locus_tag="CYME_CMR061C"
                     /db_xref="GeneID:16996945"
     mRNA            complement(<159601..>162492)
                     /locus_tag="CYME_CMR061C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538315.1"
                     /db_xref="GeneID:16996945"
     CDS             complement(159601..162492)
                     /locus_tag="CYME_CMR061C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538372.1"
                     /db_xref="GeneID:16996945"
                     /translation="MLGTWLGWCGVVWLASLWSPGLPRREAGVAPWENSSEDANPFNL
                     KEADPGVRPREATQSVQNEAWNCSQPARLRSVRSNTEPQLAPGEYMRRNSAIQKGRVD
                     TQFNGSTDSAVDAEHELYAKAREPAMQTGLLPTQESDAERYGRHTESFDAKPLTPSLS
                     KTHSGVIGSATPRGDQMTRKKRKFVPRAVLQGELRDDAIPIAPLPEAASSEDAFSGRQ
                     SPRHRVLQKLVTERRIRTYSTTDEESVQMLRHTSSPGTAAPAAIQVQSPCTNISPGTP
                     SRNARAPHRSGLSDFNYFWSFKKLKDGGVPKGSTALSPKKQAPSIQHLGNQATQRSAG
                     AGLAERLSAPRAASWQRAVEQAERIPKEDDVFVSDRTPRRDAERLPTADVGISQNNGS
                     VRSQASPALSAMTPLQAPTYRDRRATVLASQHLGGVPKRCGDERGCDQAESASREGFA
                     ATTVPCQAPRILTGGSQGLSQTERAKHRTSPCNAAASPQPNRQTTSQRRAFEQDLTQH
                     GVLSSRPSPSGQRSKYRSNDDATVNLLAGGLLEDPSAFTDETSTAPTRPLLHPHTRCT
                     DASHEKLSRNPQMHPNLEHEPIPADGSIPGTSTIGMQIDETPRRSASPSHSPVKQLGP
                     SFIPLTSPAAAPVWRRRAKDDGIIASRLRRVGFVPHDRSEQLSRSPFSISSQAFIGRD
                     ASSPIWGLLHRAVESISGGLPGSAPVEQRRRPRMPPHHRFAAGSRLRGIRRRRPAKPR
                     DTPTEPASESQISDLSEALGSPAGATRILAELDAAHQENEVLREHLSRMAVQLDALRS
                     QQKRAPLSPSDIREQPFATSQGPNATPHCLDAAVASLCQPPRGKQSVADATATDVQRD
                     QRTNAVRPNSATEERRFPSLASSDEHARQHRHHFGMNTSVSPCWQRERRSGNDDPGAI
                     TDPKSAAAGAARTLYGSRCKPQRAQGTHPSSQAVLYPGSSPSHSCQQQL"
     gene            <165313..>167643
                     /locus_tag="CYME_CMR062C"
                     /db_xref="GeneID:16996946"
     mRNA            <165313..>167643
                     /locus_tag="CYME_CMR062C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538316.1"
                     /db_xref="GeneID:16996946"
     CDS             165313..167643
                     /locus_tag="CYME_CMR062C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538373.1"
                     /db_xref="GeneID:16996946"
                     /translation="MGTDTNSEDSAKRFRRVRRGSATFVELNLEDLLEDPGELVCDEA
                     GCPEEVLSELQTGSEENLADDVGETQESPQVGAEEEKRKSTGSQGSRTSTDSAALRTS
                     KSGEISSMSTQDDLSTKQSATSARGLRGLPPASGRSTPSPRNQNGVRISQSHDDLATN
                     SSRGGSGWLLNVNRASRNSADRERSSHPITEAVRSKSGDNRFADIFQLPHTQRLVDHF
                     SCGLQKAIILQGTLYLFKDYVCFRSIVLAGTKIVMPIRDIVRIQRERNLLIDNAIRFT
                     LQDGSSYLFVSFLFPARVYREFKESGLFAPEVFEDRPEAERKPMTRSPRDQRSKDSAT
                     SGSASPGDQQSESKSGNSITDEEDEGSEDDEEYAHSVEQSMVIRLFAIGNLPYYPHGK
                     KHLLQSDQSEMTKVCSVTLPCNNARLFRAFFLDLKEEEALHQSIGLNQINGTNSESKA
                     NGTNSKSEIPTKAKASDSGPGNAASSESRSSESDALVFSARNNFLAFQAKLGHQDMQL
                     GEWHLDPDLGFVREFRYRKPLEPAPMSPKETWMTEHMLFYVSKQEREKLQTIYLEIKG
                     TSHDVPFGDSFVAEQLYVFRPASENGRFECELEIYGGVHFSRWNMVAGTIRKRTIAGV
                     EHTANVFVQMARELCTTSLCRRVRDLDAARYRKEIGASAKVLEKADTAREETTEDTSP
                     TASAEIKPESISLESLPLPTRYMLLPFYRIALVATSATCWDATLLSAFLILCITLLTL
                     VVFRLYLNNQQMTVELRHAEEQVQFLRSLLKNHLGP"
     misc_feature    complement(168110..171450)
                     /note="repetitive element"
     gene            complement(<172182..>173609)
                     /locus_tag="CYME_CMR064C"
                     /db_xref="GeneID:16997092"
     mRNA            complement(<172182..>173609)
                     /locus_tag="CYME_CMR064C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538317.1"
                     /db_xref="GeneID:16997092"
     CDS             complement(172182..173609)
                     /locus_tag="CYME_CMR064C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538374.1"
                     /db_xref="GeneID:16997092"
                     /translation="MQLRLPLVNVERDVSGASLYEALQGVGFAYIVADETVYTEAFQS
                     VLDAAREFFRQLTAADRSKLARGNWLAPNAGYVAVGVEALAPESGLSDPKEALNFVYG
                     ARVEPLEASLSHSLLSAKRAFDRVVLRRLVPLLVQRLGTALERHGCGPIATVFCRAHA
                     FVDLAAGHTPEHRCACPDLSRCTRSEDTGARSAAPLMKVHEHSPDAGARCSLERGEMM
                     RLSTCQEQIPAAPGGDRETRTQTSKGTVSPDLRVCMKQPALAGHTTIDRGCEIREISD
                     SDSRNLALDCAMLPPGIARGERGPPEENKAPSVLATTLRLLHYPPVPLTQVPHATCGT
                     SNERTSEIVLAGAHSDYGTFTLLYQDEVGGLQLKIGDHWVDIEHDPTRAPGLVFNAGD
                     VLSIWTRGRISSTKHRVVARPEQTARNDATKLSGRPGGARYSAERFSVALFVHPLDET
                     IVDELNARTAAQVLHERLQRTYRYE"
     gene            <174228..>174824
                     /locus_tag="CYME_CMR065C"
                     /db_xref="GeneID:16997093"
     mRNA            <174228..>174824
                     /locus_tag="CYME_CMR065C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538318.1"
                     /db_xref="GeneID:16997093"
     CDS             174228..174824
                     /locus_tag="CYME_CMR065C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538375.1"
                     /db_xref="GeneID:16997093"
                     /translation="MSLDWPPDIQLYRHLAAQSGVLLGDYILLRLQIQESSGFLGRDP
                     HAEQTVEEAVHLWERLEKSVVLLGQIVDNVHGESTLKESLVLDLRSKHSILVNLNRLW
                     DDPHPQECARVLLEAWSGSLWLDPVASILSSYRSLVESADRVSTPQRSKRLTAPTTPS
                     ARASASDLNDSSKQAPLWSYLLDDHGTRRRSGSRAHRP"
     gene            complement(<176505..>178130)
                     /locus_tag="CYME_CMR066C"
                     /db_xref="GeneID:16997094"
     mRNA            complement(<176505..>178130)
                     /locus_tag="CYME_CMR066C"
                     /product="succinate-semialdehyde dehydrogenase"
                     /transcript_id="XM_005538319.1"
                     /db_xref="GeneID:16997094"
     CDS             complement(176505..178130)
                     /locus_tag="CYME_CMR066C"
                     /codon_start=1
                     /product="succinate-semialdehyde dehydrogenase"
                     /protein_id="XP_005538376.1"
                     /db_xref="GeneID:16997094"
                     /translation="MHWCGLLQRTIHQKTKRLQRWGNVWEHRGNGFLMSSTVSHALQS
                     GKLSSALAVGVEQPSGEDLYLGHYINGQQVSSDSYYKVTDPANGQTVAFVADGDEQTI
                     GAAVQAAKSAFASWRETSPQTRAGLLRRWYDLIIEKREALGRVITRENGKPLSEAIGE
                     VRYAASFVEWFASEAPRVYGDVIPATSGPRQALVVREPLGVCAAITPWNFPSAMLTRK
                     VAPALATGNTVVARPSELTPVSAIALAELAREAGIPAGVFNVISGSRPSLFGEGLAQH
                     PDVRMLSFTGSTRVGRLLMGQCASTVKRTEMELGGLAPFIVFDDTDLDAAVAGLWAAK
                     MRNSGQTCVCPNRIYVQRAIYDAFAERLAKRVSRAKVGPGVDSGVEVGPLINQAAIDK
                     VQRHVQDAVQKGAKVLVGNRVLSELGPLFYEPTVVRDVPPDALLCREETFGPVLPLLV
                     FDDEEEVIRAANATEFGLASYVYTRDLGRAFRCAKQLESGMVGVNEGVISNAAMPFGG
                     VKQSGYGREGSKYGIDAYTNLKYILMGYGERST"
     gene            complement(<180516..>181697)
                     /locus_tag="CYME_CMR067C"
                     /db_xref="GeneID:16997002"
     mRNA            complement(<180516..>181697)
                     /locus_tag="CYME_CMR067C"
                     /product="similar to vegetatible incompatibility protein
                     HET-E-1"
                     /transcript_id="XM_005538320.1"
                     /db_xref="GeneID:16997002"
     CDS             complement(180516..181697)
                     /locus_tag="CYME_CMR067C"
                     /codon_start=1
                     /product="similar to vegetatible incompatibility protein
                     HET-E-1"
                     /protein_id="XP_005538377.1"
                     /db_xref="GeneID:16997002"
                     /translation="MQCCISGKHVPLSRLETPIPAVLGDNSVEFPSSVVRLDRETTTY
                     SIAILEADESLALLASSLADVEVLHLTSGEVKQSFSGHKAAVNDVVEVRPGLAASCSI
                     DRTIQLFDPTTCVRMETLRGHRGAVYALSADRAEERLLSASSDGTLRVWSCAACCCTH
                     TVKRVPPDGDLLHNEVYDVEFMQYTSSGLHFGIAATQRGSVELWDLGHGSTEPVSVFS
                     KDVEGEVRCVKVLANQSGNEFLSGGEDHVLRLWDARVGNKPAYEFRLHRDSIWGLATD
                     GRRAVTTSVRGRAIFWDIRLLKPESQLLGFGPFRCVSCAPSRRTYHLGNFYGYIYSVW
                     TAKIPPEPLKDFPDNVSRDEPPCMANRRFHNHTSKSSHVQEASSVPQRRQSRRQTCPI
                     T"
     misc_feature    181855..182703
                     /note="possible transcribed region"
     misc_feature    complement(182854..183945)
                     /note="possible transcribed region"
     gene            <184276..>186492
                     /locus_tag="CYME_CMR069C"
                     /db_xref="GeneID:16997004"
     mRNA            <184276..>186492
                     /locus_tag="CYME_CMR069C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538321.1"
                     /db_xref="GeneID:16997004"
     CDS             184276..186492
                     /locus_tag="CYME_CMR069C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538378.1"
                     /db_xref="GeneID:16997004"
                     /translation="MPGVGFVQMAPGRAAAAPTPQRHSVCPRAPSKREHAKLCSYALW
                     NSRKSEAAKGGRPRSRAAQTLEALQLARRQWEHQTWSVSSQSNRGRQRRRESLVLVLL
                     APGVNFRLDDNTALIDGITRASRYGSQLGVVVPTAAVERYPAMVQDLYDQVQKRGSQL
                     GVIDKERLAKLRAGLGEGFPIVIQACVGAEPFLQGLAPCPVFWSTPTKAGQEPVDAPR
                     WMPPALVSLEPLKLPLTLANGTEPTEPDFRERSVLRALREAAPSQTLPALEQCFKLPL
                     ELAVLSRVRLRFEWEKMHRPREPGHLQAWLWGGAICARLLARSPPACHAITVYDIHGN
                     HMRELRWDSQHNRFSFRGHNGDHDYEAAFWSFARRKWLWLKQSFIPEDVTADYYEFAK
                     WRVFQRLMSSTVGVFGTQALLLALGIKSGNKISQAATISWVLKDGLSRVGKMLWASQL
                     GRDMDADPKRFRFGSALLYSLGNGLEIATRIVPQSFLLVATLANTAKLCSMLTASATR
                     NAMYRSFADRNENIADITAKGEAQITIADLGGMALGIQLSKIIGTSRPKVVATYLILS
                     TIDLYAIWKELRVIEFRTLNLQRSSLVIEHYLKTGCVPTPKQVSAAERVVLPEPIPRH
                     AFVAFSKLVRDEQEAEQMIKRYGSARFLMRYGEVHWPWTCLHSSRGGIVLHRDADQQD
                     IFRAILCWNLRRLGIVQEEDEVLARADVVMEPLLKAAREAGWRTFVYPKFKHRALW"
     misc_feature    complement(188715..192439)
                     /note="possible transcribed region"
     gene            <188850..>191312
                     /locus_tag="CYME_CMR070C"
                     /db_xref="GeneID:16996714"
     mRNA            <188850..>191312
                     /locus_tag="CYME_CMR070C"
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily a-like"
                     /transcript_id="XM_005538322.1"
                     /db_xref="GeneID:16996714"
     CDS             188850..191312
                     /locus_tag="CYME_CMR070C"
                     /codon_start=1
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily a-like"
                     /protein_id="XP_005538379.1"
                     /db_xref="GeneID:16996714"
                     /translation="MGERESYASSVRRCFHGEPATRRQVLKPGSNTGRFFWACARTLR
                     SGQRCAYFVWDSHSGVYETVQAADGARTSLGDQVQADPTSKKLESTRGRVPGAASSRT
                     CGSGPFWEALRNTKRSGTSQDQLPQFSLSSDPQAGSAAIRAGSGLEKRPSKERAGTQW
                     LVEIGDGEHFHLWPQKNSEANAYMLFQLAQRVPGAVLEPSKERLRIPLSSWTATSAAV
                     AALEGSIRGHPPQRLMQNLVNLRRRLEDRNGEKQCFAEVLAHARASLASIQLWEQLLP
                     FQRTGVERAIVQGGRVLLADEMGLGKTIQAIAIAWVLRKDWPVLIVCPSSLRGAWCRE
                     WRDRLAGASLTPSDIHVLETATDAGKPLRAVNIVSYDLVGRLADAQLQRVGVLILDES
                     HYIKSVDAKRTQFLLPWLKRIPRVLLLTGTPALSRPAELFTQLHGLAPSIFSDWKEFA
                     YRYCGARSTPWKALDTSGATNLSELHRILTQTVMIRRLKAEILDQLPRKERGVAYVEP
                     AASTPEQLHAVLDELAATEQKASTGDQQAASKVKALMSKAFHLTAVAKVPAVLAQCAD
                     IWRTGHKFLLFAYHELMLDAVEGWLREQQGTWIRIDGKTQVTERQALVDRFQDDPQCR
                     VALLALTAAGAGLTLTAAHVVLFAELYWNPGTLRQAEDRVHRIGQKESVSIRYLILPR
                     SLDDRMWRSVQNKLDILHSSLDGKIDRERVNVVAGSAWNAPEPGPLDRFFKRRSQGVV
                     SSPEPGADEPTSVRSSSVPDAFEQDHVPVIESFEPEEPPEIPSSFLNSELGSGSNRTQ
                     FQREARKRTFQEIEPNNALPSS"
     gene            <194431..>194793
                     /locus_tag="CYME_CMR072C"
                     /db_xref="GeneID:16996713"
     mRNA            <194431..>194793
                     /locus_tag="CYME_CMR072C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538323.1"
                     /db_xref="GeneID:16996713"
     CDS             194431..194793
                     /locus_tag="CYME_CMR072C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538380.1"
                     /db_xref="GeneID:16996713"
                     /translation="MLRVVDVLTPERVRANRQLYTAYLRWVARYPVAKLRCQLRLNIQ
                     EAFRLRQAYFRALLRDALRSRHANETRIRQVLHNLDEQLHGEARQALDALERFRLELK
                     QLPAWSADKQVADDDRVR"
     gene            complement(<194844..>195800)
                     /locus_tag="CYME_CMR073C"
                     /db_xref="GeneID:16996715"
     mRNA            complement(<194844..>195800)
                     /locus_tag="CYME_CMR073C"
                     /product="probable mitochondrial carrier proteins; Pet8p"
                     /transcript_id="XM_005538324.1"
                     /db_xref="GeneID:16996715"
     CDS             complement(194844..195800)
                     /locus_tag="CYME_CMR073C"
                     /codon_start=1
                     /product="probable mitochondrial carrier proteins; Pet8p"
                     /protein_id="XP_005538381.1"
                     /db_xref="GeneID:16996715"
                     /translation="MRRRCLASCCRRRYSITVVMNETRTNDPKKHRTTERSLPPSESF
                     RVGLISGAAAGTIADLVLFPLDTLKTRLQVPGSRLGAQTFRGIYNGILPAIVASAPAA
                     AAFFGTYDWLKKTLTINFPQSAPPLVHMVAAVGGDLAGSFMRVPFEVVKQNLQAGYYR
                     SSVDAVSAIVSKEGIRGLYRGWGSLIAREVPFDILEFPLYEAFKKIWSRRKGRALETW
                     ESALCGSAAGGIAAACTTPLDVVKTRLMTRSASAATQQGIWGTMQQIAREEGIGTLFS
                     GTTPRILWISLGGALFFGGYEATKSLLMDRPRMTLTGTPKDP"
     misc_feature    196241..197652
                     /note="possible transcribed region"
     gene            <198141..>199310
                     /locus_tag="CYME_CMR075C"
                     /db_xref="GeneID:16996815"
     mRNA            <198141..>199310
                     /locus_tag="CYME_CMR075C"
                     /product="probable nucleotide sugar epimerase"
                     /transcript_id="XM_005538325.1"
                     /db_xref="GeneID:16996815"
     CDS             198141..199310
                     /locus_tag="CYME_CMR075C"
                     /codon_start=1
                     /product="probable nucleotide sugar epimerase"
                     /protein_id="XP_005538382.1"
                     /db_xref="GeneID:16996815"
                     /translation="MHDPVCFIQHPAARTVRHALYQRPASGALPRATRCYRCRSVVRY
                     GWLRASSEHSSERHVLVTGVAGFLGFHAALKLATRGDRITGIDNFNAYYDPSLKRDRV
                     RYLMRHAPAIRIIELDLADQKAVDELFASHRFTHVLHLAAQAGVRHSISHPHCYIQSN
                     CVGFLHILEGVRNHRPQPPVLVYASSSSVYGLETQLPFRESMTADAPASLYAATKRAN
                     ELMAFTYHHLYGIKTTGLRYFTVYGPWGRPDMAYYAFANAMHSGKPITLYRSGSAEPS
                     RDFTYVDDAIDATVAALDRAYPWEVFNVGNHRMEPLSALVTSLEEAFGIEALKQHTGL
                     QSGDVPATYADIGKAKELLDYDPKTSLREGIKKFAAWYQWYHVENRHAVEAGLGI"
     gene            complement(<201372..>202325)
                     /locus_tag="CYME_CMR076C"
                     /db_xref="GeneID:16996816"
     mRNA            complement(<201372..>202325)
                     /locus_tag="CYME_CMR076C"
                     /product="probable phosphotyrosyl phosphatase activator
                     protein"
                     /transcript_id="XM_005538326.1"
                     /db_xref="GeneID:16996816"
     CDS             complement(201372..202325)
                     /locus_tag="CYME_CMR076C"
                     /codon_start=1
                     /product="probable phosphotyrosyl phosphatase activator
                     protein"
                     /protein_id="XP_005538383.1"
                     /db_xref="GeneID:16996816"
                     /translation="MDESEPVRQIYDHKDLAEFLESSAFQDIWDFVERLNCSVRGLSG
                     DALAGPRVPATSLVTAELAALKELAAEVELLPAETGRFGNRAFRTWFSQLQERTPRFT
                     EELLVKSDQTKRYGPDLQAYFLGAFGDPMRIDYGTGHEASFLLFMFCLHRLHLFRAED
                     FPELVLSVFPAYLATTRYLQQRFTLEPAGSHGVWGLDDYVFLPFLFGSSQLIGKDTEV
                     PPVAARDRELVLELAPKYLYFDTIRFILETKRGPFAEHSPTLYDISGLENWSRINAGL
                     LRMYKAEVWSKLPVIQHIPFGILIPFRSAARTSTERLPAGS"
     gene            <203776..>208965
                     /locus_tag="CYME_CMR077C"
                     /db_xref="GeneID:16996817"
     mRNA            <203776..>208965
                     /locus_tag="CYME_CMR077C"
                     /product="ubiquitin-protein ligase E3"
                     /transcript_id="XM_005538327.1"
                     /db_xref="GeneID:16996817"
     CDS             203776..208965
                     /locus_tag="CYME_CMR077C"
                     /codon_start=1
                     /product="ubiquitin-protein ligase E3"
                     /protein_id="XP_005538384.1"
                     /db_xref="GeneID:16996817"
                     /translation="MEDEHPAPNSDRTYASDLEQGNVFGSSPSERHSFSRLDGNRAGS
                     IGDEMDSDVAVDEEDRNAGMEVLGLFSVRARSRARVRSDNRDGSDSGSALDEGVDDNS
                     DDHGDDIAGFGESDDLSGDVDSSDCGFEDDQNTDVDAAGESDLEEFPDPAEGELDSFR
                     HDVDATDDDLGEENASDADASTFGDGMDHDDDDEDEDNDDDDDDEGEDDDDDNDNVDE
                     EEDDGDDMPSDDEDAEYSQFFGVEQEMLSLMEQRGSAWMEGMPAAHLQALRRADIQAQ
                     RLMQRFRNADDDMEVFVVWRNGQEAGEILADRDEDASLPGLGIHFLNMTNEQPDWAEG
                     FGLGIAAANAMLLSDPSSEALRPYAPARLELPQPPRVESDSRSPSERNLSVAGNVLDG
                     LGSRRHSPGATLGNILLYGSGAHCQSCPRSAREALSALCRSDGLRALLASSSAVAPTA
                     LMMRRNISCGDCGLRNAADARIHDFADLVLRSPAFTENLGHGIAAAYLVSKMNPPPKE
                     SEQLWDLASLGTVLAGAHFHPLFWDGARGKSSESPLPGLYRAPPALSIRFSEDLLEAL
                     LGLPIGPLLGIDRFGTLAVTGTRQRRRDVLRLYRAFGSCSLRRGAPYDALSGLDTHAR
                     HLDTQQKRFAALHEEMRTLWRDERVRRERAQLDDEYRRLVDEEQAQASESCANGRQGE
                     PDVPMERSEQQEQEQVLPAPGTEMEAASSLTGSLLEHASAASPSHPASSGMLTGAAET
                     SDSAVVLSMQIDDLPGATQVLGPDAPEPAASGAVELSSDAEVRAPPVSDSTTDQEAGT
                     RSITESDMEHVARTVGIDPTVLVELPPDLRREVIQQNLAQIRSNPAFLSYLPVNVRQE
                     VEEAAAQLDRLRGSAAEMDNASFLATLPTALREEIYLTSDESFLQSLPPHLAAEARAV
                     RDRRRSLSSASAAAAAAAASASFLGPNDLTSGASEISALMSTPQVSARKSCGLVLVTQ
                     LDVLEKALRSPGVCCPLLANTVRLLCYEPTTRMRIIRLAWRLVECQRPDDASTAGRSA
                     ELVGSLLRFSPTIALDLVAADGDQPLMHLLQSIPKAVRFGGRHCHRLLEVLLATTSLF
                     VQLLRGQVPQRGLQLEPAQPDASMTLPVVPPVVAPGVLNDLAIALQVPDLSARSWDRL
                     LSIYEYLYGEEQNRDTVIQCLVQIAGALIEPVCAAIREEPGLRPCESFFVQTVKSVAQ
                     LVRPHLECLQVLEPVWTCLEEQLAAGAGAGPPVRLSRLIECYLQAHSIRLPDLLADLN
                     QPPVLESNPSLLARSESASTLRSSTTTTTTTTTNGVTLPESVMAIDRELASFLERHTL
                     QINQLLQLNPALFRQGFQSTLLHARFLEFENKKVFFRHVIQEQRRASRQSPVRLLVRR
                     DCVFEDSYHQLRPRSAAELRGTLTVQFVGEEGIDAGGLLREWYVILARKIFDENYALF
                     RRCVGKSAAYHINECSYINEDHLGFFKFIGRFIGKALWDGQLLDAYFARSVYKHMIGI
                     RPSYHDIEAIDPEYYASLVWMLEHNIAHVLDLTMAAELDQFGELKVVDLVPGGRHIPV
                     TEENKWEYVRLITELKMTKAVEPQLQAFLEGFHEMVPRSLIAMFSDYELELLISGLPE
                     IDTADLKMHTTYSGYRPSSPQIQWFWQAVAEMDRDDRARLVMFVTGSSKVPLGGFANL
                     PGMNGGVQRFQIHRVAGDTDRLPSAHTCFNQLDLPEYSSYEKLRERLLTAVREGNEGF
                     GFG"
     gene            complement(<210479..>217594)
                     /locus_tag="CYME_CMR078C"
                     /db_xref="GeneID:16996818"
     mRNA            complement(<210479..>217594)
                     /locus_tag="CYME_CMR078C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538328.1"
                     /db_xref="GeneID:16996818"
     CDS             complement(210479..217594)
                     /locus_tag="CYME_CMR078C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538385.1"
                     /db_xref="GeneID:16996818"
                     /translation="MEYETNDWFGFDPDQLDSWLERVWTGTQAGTAPTGTTWKVTAAA
                     PSPWLTYPLLRLASPWKGWIEQVWASIERNLRAMRALSTRDADVAEAGQTGARNGVFR
                     ELAVDLTKLGWLAAQLAPECRQSVLPFDLMQEILETDCLVLVIQALEVWWQVARVPFL
                     SEAAYAPLSADAAWLGPRLVDSLLELCRHDPVYDDLFRALRARTQAAAEPVTETVAVA
                     SCTDTSTDEQSLSGSGLEFTRWESRSSPDSSMEIESVAENAGDRVVPAALEENISAAS
                     RSCAWCRTSPLDSASEAGAYRSAFHALRTRPDTEGSSPCLDVLQWASLQDAFAPHWRA
                     SIHHERTAPEQRVQACPKASTVNAARGQRRSQRTNLRHWCRFRLEWGLLRLAVRFEAM
                     AVLLSSSGTARVSLEQLLMSEPHFWEDVIDTLRGAFFQTSQRPALANGARNAVSVELH
                     PSVRALVERASLRLLAVAAATWKWEKPLLTSMLHGRGASWLFQAVCTALQTQQETPND
                     ASSSHAERLELYLSTMSRLLRRERRLQHLDGRLQLQLVGLFQKLTGVLGAVAPASLLS
                     LWALQFWTMVFRQTRSDDSFFGLLRHEMAYVQQMLLAQLQYLIGHVSERSAAHREHER
                     YLERIRAYPWAHHDAAEALSETFGTLTLLESTWMRIAWHFLLLRYESQSNGNGTPAAA
                     SLIRNASPTLSGTMPAASTTGPTAWLPSERAQATGAHSGPATSGGNATAAAGTPAEPL
                     TLHQPVIRHLLEQVLRHPRLFGGAVWSVATQTLALAMNDDPANAAVFWEEHTIDGLLA
                     VLAAEQSTSMDLPATAEAYIAAWHALDALCIRREQLEALLQPVESTCTELAEVPTAPL
                     GQLRPGPTPSSILGRMLSCLVRVMLYRPALSRARFHSGYDLSFIRGLWKRGPTVQTIF
                     EQVVLSELQSWLRERDQHQALSASTTNDNVDESAAASAGASLEVLVVQRTEELLALDS
                     AMMFCELLRKALLATSRQSAERRVAALTRERLEELQAALWLEALRSLFVPLGLYLLSS
                     NEDRAVPSVRQLIQVTESVRRQALRAGMVIEAARVRAMLGQRLAQALPLVLNQVSPVH
                     CTRIRASSIGSQRASSSSLSTHASRNAQRAPPLFEAILESDWPQTLSLASELGTLLML
                     LALWGQQLKHKFRLRGMSGGRAAAASAATDTAVGDGTLLQAVGCLERLARFALAQCAF
                     EAVTVYPVALPAKRSLEIEVVMIEQASTAADRTSRLSNATRAVPSRPLQSPPWRSGGT
                     AQAASSPATDTMQWSSERAEQNVTEVFGVARALAIFGVNVRPFYQCVLQESELDITLA
                     DVLVGHWAACETLFTGDVWELVQRPTTAHLEPAQCIYLVGLVSSLRALLQESSLPRRT
                     ARRLLTVLYARGWPVELFRLVRQLVPPVSLDTCRALDALLDLLVVALLAEDLALGDAT
                     PSSERREATAARLAPAGDAVGVETRSRRDSDAATRMTAAAFGMSGGSSAVAATTPPPT
                     TTTTMAAAASPNDAWNAEQATRTSYLALVSVLVRRLLEHDWSQWPRLFVFRLLNLVRL
                     LLAVDASPPAPAPSSLLASGGGAAPPVAGLEAGLRWRSSERAPMHRHPDLLLDSDEAL
                     ERFVDTYGKGSSFPLRPARIDVLLPWSRRLLRLLQVGHRRQRMPQLDWISFQQQLRKW
                     VREQALHRLFSAPPETLDTALVAECWSLLPPTTWLEDKSLLSSRQMDATGTSRTRPLD
                     EHPLASLVVRAPAVAVHWIARLGFHDTSVSMLRVLAEILEASLDTCPPQDARMPAYLM
                     LYALLLRVITAHSVHEPAAGATQPTGRIAERPSYVTTVPYIPRGVLTAHLPRFLARQA
                     LGTLWQYRWKRVRLPTVLEQMLGVIRPLWDWIEAHQVAGAASAEPSQRLALLDLELSA
                     LEAVVAAAHAQVRVAAPTPAAVLQAFLRMQRHIDALRAQQQQQQQQQQQQEQQQQQVA
                     PLVARMLHAWLLLAEYVRIAFYEHDIGLVISAFDRVLREAFRESLSQSGQHQHTVTAA
                     SLNPVLERLQALHPMALSVSLMRCLRPVDATRDRRAEPRYQLNSDCPSIETVRVDGNL
                     LTLLMSHEEPGLVWALASCMSTFGAPFATALTRVLRRPSAASYRDWLVRCLAAQAPNM
                     QASVAAGAADPLSAVDWRYLSARALVVQLSAHAGEPQALALELWTEALQRWRDLQAFE
                     GVSVRSEAVLTSTATHERPQSIARLASLTTRLVVHDAHRQMATTGGSNLLLELYGSSF
                     QEPTQANTLLECLYQLAVFYGPGLLQYGPDRTGRYPLLKNGAALEAHRLRELLRSLPS
                     VKSDLFDYAPLLGALGRARLPEPVLDPESMLEPNQELSWSGAALERKRSADTDDAEET
                     ISRSPSF"
     gene            <218863..>220965
                     /locus_tag="CYME_CMR079C"
                     /db_xref="GeneID:16996819"
     mRNA            <218863..>220965
                     /locus_tag="CYME_CMR079C"
                     /product="similar to thylakoid lumen rotamase"
                     /transcript_id="XM_005538329.1"
                     /db_xref="GeneID:16996819"
     CDS             218863..220965
                     /locus_tag="CYME_CMR079C"
                     /codon_start=1
                     /product="similar to thylakoid lumen rotamase"
                     /protein_id="XP_005538386.1"
                     /db_xref="GeneID:16996819"
                     /translation="MEQHTARRGSSEHLSRSRGVRATARNATSINGNEGFYAATWNVV
                     VVCKRVPVPCASALSNLCWISQPRLWIQSHSSNRGFGASVCTQPTGENRHVRSSTHPM
                     DYWLRTRTHCRQTRRRSRNRARFRVGAEPLATPTPNRQTTLYGRCGWQWAHGSFQRVR
                     ATKFQTLGESTCRLVLATDGDGRPKRSPCHWQRMRMLGEPASKGCTAAETSRMGSLMR
                     HSLTNLRLDVPSLVDTGVRWACALVISAGVTLCGVHPDSVAVGRASAAEGASDSIADF
                     ARTVGAAQPRTSIDRFGNPLLRRYVSTDGAAVLRWSLPLPEDSPFWEIQRQLEQVDVE
                     LSLRGSFRRGLREALKSARQALAALQRERLDILLDVGREQVVVDTLRRTEQEITHLVE
                     SLEQLNALGPGSTQPTIRSVAAAVRAEASASRSGALAELARLEEASIRRVPFRIPRRY
                     DDEARLRGRALVRLYLEAPKTTAGARPARSDTGQTRGTPAPCVLQVVVDGWNAPLTSG
                     NFVRRVLAHEYDGMPLIAEEQGSFVFFSEAANDGKPADTEHLLPLEILLEGEPAPLYG
                     ESIDTAMVATQRQPPVLPVGPFGTLAMAHSTEDVNDAQRAFYIFTFDKRSLAANNPTG
                     NAFTGTVAVFGYLPDASSLQCLANLHPGYRIRTAELVYGRERYFGNAAEEARVLGPAG
                     SFPDEMRLALLERRQPET"
     misc_feature    complement(221221..222821)
                     /note="possible transcribed region"
     gene            complement(<223953..>232739)
                     /locus_tag="CYME_CMR081C"
                     /db_xref="GeneID:16996680"
     mRNA            complement(<223953..>232739)
                     /locus_tag="CYME_CMR081C"
                     /product="similar to meiotic check point regulator"
                     /transcript_id="XM_005538330.1"
                     /db_xref="GeneID:16996680"
     CDS             complement(223953..232739)
                     /locus_tag="CYME_CMR081C"
                     /codon_start=1
                     /product="similar to meiotic check point regulator"
                     /protein_id="XP_005538387.1"
                     /db_xref="GeneID:16996680"
                     /translation="MANVTIPVSVTASGCLELSQGSDRDYLYRLVDQHGIADRVWFFS
                     CSSRGGHSENLLCAPEEALVWHPKQRSRGGDASKDLTWALQWRSADLVRYTWFETDAE
                     AFAVRRGAQSFPACAVCCSDVPTSAGDRLGPMHAWAAFANFCDASAEELPPGSGRSLW
                     QPAADAEGARSFVGWCSVQDAGRLLQVFNWQDGRMHSVSFVAKGGSNSFSQGGPRRGV
                     ASLPSGLHKSAVSEQTSTLLTGVQRESTQRLTGSSSSRLYPPMTTMMMEAMPTARAVI
                     LALHALPRGLVVALADGRKLVLWHPLNEPYELEELEIQERIVFTDARYPVLVTQRCHG
                     TSRSSPTEHHTIRVYLLQDRTTGDTQNDTTFDSGPVQLALVWEQGLVDPNDTFRAACF
                     AHPWSGAGGRGVHISPLLCLLIGETLRGLELFSTPAQPRLMKSAELVFVQRGVQAMAA
                     VEALRPGMLDLLVLLGGTPKPRLRLQFGAEPVGYLRLLGKTAAPVWLANAVKCRFTLT
                     LADGQQYRVCLSRLLREPLPIMHQLWGACRRTLPAAVSMQIYLAFIEEVWRPQAAETQ
                     GTASNELEKQLDAFWRALQQPHRHQWMHQRYPERGTFCSSSSSSSSSCRNAGQRASGG
                     AAPTDASHWRSVPDLSSPKTSILKASARPAPGVLPGWLWDISASAFDEMHSSLVPERE
                     HIATGSASEAIHDSQGQLSLSPLRLATQSAPWTRGSERSCSSAASHRGDERVSTEQRT
                     AKASTATRSDAAKCTPETATTTTAAAAAAAAAAAEAPSTGRAACDARTREQPCSRCYR
                     GTPMQGSSVVTTRRAERVKGCPFCWETGPEPSGTASGECLLRLRCELQYAGAQLPETV
                     PWKSLLVAFHTLYEAFKLDQIYWQALLSVNHFLKKVALAANALRYWEYYQRDMPESCE
                     RSSVSSGTLHPASSDESLEASSLLRHSRSLDKASERSSTADPEEARICDHQHNGQGAE
                     TSLHLPVDAEVASISDQQSNQQRVESSLYLTDDSEAPLNIFDWLQDRLPLLLGIYKTD
                     RACCRPAKDMLAQFPAAFASTLSTAPSGLSAERHPLDAPLVREFVNDRHPDEFPNPVA
                     RLAQLVTFFERLEHCQQSTSSGESTGASTELSPAHAGVGPVGTAALDSTTETIVAEQS
                     AIPEVSVPLQHPCDAGLVSLHQEGIRLDARTLARLPVGIALPLQHALAGLRSEPAPQV
                     HPGAGNSDADSELAAAGVVSSAAAVAGWLPALPEPEMAMLRLQSGLSPTGAGSGSVQG
                     ATWFSATRASGAASREALGTNITSRLWLNPSVERFAAQVTSDLYASSAGPGRVAASSF
                     TKSSSNGAAPLRAWMPSSSASALAIAKHPEHHHRRHHHGTDDDDDDDDVEGALFLDDD
                     DIDIDDDDDGIDDEDVDDDGNSVALFRADPGPSRERSFPSAAGTSAATHAIPQRYDYH
                     HHHHDRRCRRRRRRQQGGRGVVHPNHLDGCELTSIIPWLRFRADRRLWQVQRLLRSAV
                     PVLLTDPDPAATAATTETTTLGSSSSSPLLSPSEVQAQLFASAQRTLAAPIGRGAFTA
                     WTGTVDDSTKTLLVPPLVLSGRLPQRSTPIQLDASVLPAAYFEWGAFHNAVAAGLRLR
                     PSSTRFPTWIRGRLVPGAPEASGGSSATRSGVPAQQELAFTAQVPVTRAWIRQQKPSR
                     PTASHAGLVLALGLHGHLRQLQVTDWYAYLLPRHELTSIALLLGLGASYGGTAHALVA
                     RLAGLHIRAFNPTGFAQPDWDVSPAVQSAAVLAMGLVFACSGRKAILEGLFVELCDGA
                     GVAMASSIAAAASTGAAAPATGSLGAGVMAASGGFAGSAAGTSNTNNTSGWPWSVRRD
                     REAHALAAGLALGLVGLPEAASEQRSAATGANVSDMVTGPATAARRYVGSLVALVTRT
                     GAGDADDAPMRLSSAKLPAREERRPVARRERRSGTAGTVHGETNAAPGTHAATANAPV
                     PHDVPGVLASGLTDGALGATTTRLQANVPGGAPTALGNEDDDDYNNGDDDGASYATTR
                     LPTRAGYDSVTGTLGRGARLESRSGLEADDSWSSVRIGAEGETEQGRASSPSLSISSS
                     FSTSSLFRAGITTSSMPAVDSGPQALLDPERIPSDASAAAVGALMALTVWYLRSNDEA
                     MARKLGPPRSGQRALWLLRPELVLLRSLAAALIRWDAMSPSWDWMLSELPAPLAAQWQ
                     ADRNREAAHRGDQPREENSTLRSQGLATGAGTSRISRWYVAVANDPVVPAETEQIESA
                     ARSSADLLGSGAPQRPAVVRLYMLLALTGQALAMALKLAGTAHPQARRILEKLLDLVD
                     LRYTASANSSAAPWLLACIDNLSIAMAVVCAGHGTHSVYRRLRRLLCRRGATGIVAGL
                     TSSGMAGATRPSTLSRTTSGETYGNHLARHLALGLVFLGGGTVALSSCHRLQTALLLA
                     ALYPRYPAAPSDNQYHLQALRHLYVLAAEARCFVTLDADTRTPCPVPVEVMMVSSTST
                     GTSNAVPVRYRDWTPCLLPALDSWHELVIRSPRYWSVSLSAEALREIEPLANTYLAYV
                     VYVRRHAGHLSYLRDPHGVKGLTCRSLPLRYLAKAPSADWMQLFATDPVLSALFRYGL
                     AFPGSPWSNASNPIPAASDDTVAPNLATEGIHRSPSTEDAFTTSTGEEAWRVSSARTA
                     SMGMHASSAHAWPPFGTRVPCVQASTAGNVVGDDQEIAFWRAALDLCLEADCTELWLL
                     LVDALDAVRRGSVLQTACQRHRHRHRHTLWVGDLVLLQHWVGAAASRMPRAQRQTPLQ
                     RLERWCCSSVASLGASLEERLFRMVEAGAAGVPDRSLLVKRCRQYVRSGWSLVPEHVL
                     YGHAVCLRWLQAPLRCALLPEYGALCQALRGIGSARGDSSIGSASAMQRRTCRASDSQ
                     RSMPMSDVHMRSMAERASADASWNEWALLVAWLPMLSEPETR"
     misc_feature    229034..229708
                     /note="possible transcribed region"
     gene            <232931..>233998
                     /locus_tag="CYME_CMR083C"
                     /db_xref="GeneID:16996682"
     mRNA            <232931..>233998
                     /locus_tag="CYME_CMR083C"
                     /product="similar to NADH:ubiquinone oxidoreductase b17.2
                     subunit"
                     /transcript_id="XM_005538331.1"
                     /db_xref="GeneID:16996682"
     CDS             232931..233998
                     /locus_tag="CYME_CMR083C"
                     /codon_start=1
                     /product="similar to NADH:ubiquinone oxidoreductase b17.2
                     subunit"
                     /protein_id="XP_005538388.1"
                     /db_xref="GeneID:16996682"
                     /translation="MSMVQRTRLRERLLSVLWMQRTSAAWNDPAGAHRSSGTLVASSF
                     LRSEFRRNAGTSATTCSAGSTVHTQRHRSTDGDNLRVNSRKPVEVTGEALRLGAGTRA
                     FPGAVHASLQQDRTFSAGTQASSAGGSQTPRAVAGAAAPTAASDSDGGAAASETAQGT
                     TRAKFEQQPLPSSAHSVSGRTLSGLAYLKALWAEYPKRGFWGTLMAIRTGRVGMYDTC
                     LVGIDEFGNRYYENRAASYMRDRWCEYRDGKNADPVCIPPEWHAWLHHFVDDPPVSAN
                     DKWVRPLFVKPPHPNYSGTSQAYAPRNSPRSPAYIGHLATSVVESWQAQTTLQRQRKP
                     RALTPAREKTSPEPDQRLDLP"
     gene            complement(<234968..>235855)
                     /locus_tag="CYME_CMR084C"
                     /db_xref="GeneID:16996683"
     mRNA            complement(<234968..>235855)
                     /locus_tag="CYME_CMR084C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538332.1"
                     /db_xref="GeneID:16996683"
     CDS             complement(234968..235855)
                     /locus_tag="CYME_CMR084C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538389.1"
                     /db_xref="GeneID:16996683"
                     /translation="MGRFCLDSLEQSELRAMDFDTLVNDTAEMDRLHDPVGFRTRELW
                     TCERRPDGRTVDEPRPTRGCGWLLGSRERGSCPVVQVSHGNSKVLVSARPATTWRVTV
                     QVPGLCYGRSCTHKAMELTEYLEKLVYPIIEQCYASEPRGYNVDVWCWELELSVLDED
                     GSLHDVFLESIQQILPRCIEARQEHHDAREGPDSTGVHTDERICSMIARLHSRTFLVV
                     HPDAPQDLDSPGVRLVVDPSALEEHTASTLVTAIFYTHEPKSQPVLYFLECRGRPLTA
                     DQLTAAIRQVSESLVPSQR"
     gene            <237593..>238666
                     /locus_tag="CYME_CMR085C"
                     /db_xref="GeneID:16996933"
     mRNA            <237593..>238666
                     /locus_tag="CYME_CMR085C"
                     /product="similar to nuclear RNA binding protein"
                     /transcript_id="XM_005538333.1"
                     /db_xref="GeneID:16996933"
     CDS             237593..238666
                     /locus_tag="CYME_CMR085C"
                     /codon_start=1
                     /product="similar to nuclear RNA binding protein"
                     /protein_id="XP_005538390.1"
                     /db_xref="GeneID:16996933"
                     /translation="MASGSNLFAVLSDETEGSQTEAARASESKEKRPGDPPSSARGSA
                     QKHFGFDRRSGTGRGREVAKKGAGGKYTFGSVEEDVRDALSGVRIASESDAAAADGTE
                     KDDVNHVGESKSSEGALLSLEEYQQRLERERAELSNKLMASKGPRRPAEEQGDEVFRN
                     AKRLDKNGVEVDADSQDGLLGSISLKEKKTRAANRSSGKGKRDTGKENLAAEFFTAPP
                     RVNRGHRASGDVVEEDNPLRAKRSTGTEAAGPSRGRGRGRGGGSRGFRGAGARHPTAP
                     HASESAVRDKHNASDNHETQEPNRGVSSRQQRTRGGSRTGAAPDSGRFRGRGRGGAAS
                     VTAPRPRAAINTTDDAAFPSLGA"
     gene            complement(<239707..>240543)
                     /locus_tag="CYME_CMR086C"
                     /db_xref="GeneID:16996934"
     mRNA            complement(<239707..>240543)
                     /locus_tag="CYME_CMR086C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538334.1"
                     /db_xref="GeneID:16996934"
     CDS             complement(239707..240543)
                     /locus_tag="CYME_CMR086C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538391.1"
                     /db_xref="GeneID:16996934"
                     /translation="MALHLKPLVLFQGSSGAPTLNSLVQRNCSGRLQAALVSRSSSSA
                     CRACQPAHKRRWLASRAHSTRKRENGVGVRPCSQLRAMSDHGDQRRGHETSRERRAHL
                     KSANDLGNGVAPEPHDTAKRNQSRERSKVRSLLLYLSFSTTFILGLIPLSLYLGPPLT
                     GLGFADSKWFYLDSAPTIAFLVGYVGFLFLDRSLTRSLLFVLGISAVLSTITLKVDEL
                     KLLKADNETAFLVFTVPLVSFFTIRYLIERSEQQREPSKEAPPATAETDQTTETRGRT
                     GK"
     gene            <240885..>242162
                     /locus_tag="CYME_CMR087C"
                     /db_xref="GeneID:16996935"
     mRNA            <240885..>242162
                     /locus_tag="CYME_CMR087C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538335.1"
                     /db_xref="GeneID:16996935"
     CDS             240885..242162
                     /locus_tag="CYME_CMR087C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538392.1"
                     /db_xref="GeneID:16996935"
                     /translation="MASQGTETANETHLTTRQTSTMHWHVWRTEVERLRRLVKEPALK
                     WPKLLVLDLNGLLVWRTPLRPRPGQRDGPIGACYQRQPDVVTKRFCIWRRPGAVSFMR
                     YVLAWFHVGIWSTAQLPNVEDILATLLTAEQRRELVFVMDQKDCTKVSRAYAPGSSSK
                     PLMLKDLERLWSRYQGFYHMDNTLLIDDDPYKASVNPVYTSVHPSPWKDPDVQGTDTF
                     LCEGGRFRAFLEALLHHDGSVRTFVANQQIIPVEQTSNDDERGATNDAQLLSDTGAVS
                     TSLGSRAGFDQELSTADPNRSTGAQSVTAKCFVGAPACAHDGESKTSEPSARDDILST
                     STGLDGPEKDAPAKTASMDALVPSFSNELSRLRIHDKNEDVGDDTRIHAQANGLAACS
                     CSMPSVSSTPADADKTSRRDSGETSPNAGAASR"
     gene            <243371..>244249
                     /locus_tag="CYME_CMR088C"
                     /db_xref="GeneID:16996953"
     mRNA            <243371..>244249
                     /locus_tag="CYME_CMR088C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538336.1"
                     /db_xref="GeneID:16996953"
     CDS             243371..244249
                     /locus_tag="CYME_CMR088C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538393.1"
                     /db_xref="GeneID:16996953"
                     /translation="MYIVCVHQRRTQPRRWFVLRASTPQVATDNLKVDTQPRRTSAAR
                     AVATQPCLVLPGLGNAASDYAELLGLLPAGSLVVPVARYDWFRNARGLMLPAYWRGTL
                     KPRQVMDWYFERLERTLLQLSYAFGDETGDWGVNLIGHSAGGWLARLYVSEFASDDLR
                     KRVRTVVTLGTPNLAPPAGVFDQTRGILAYLETQYSWKHRQHSGVRYTCVGSKAVRGR
                     LWSSNLEEMIAYASYWPVCGRGRVAGDGIVPACSSFMRGAQAILLADARHSPLTDPKN
                     WYGSPHHFECWASALV"
     gene            complement(<244666..>245643)
                     /locus_tag="CYME_CMR089C"
                     /db_xref="GeneID:16996954"
     mRNA            complement(<244666..>245643)
                     /locus_tag="CYME_CMR089C"
                     /product="similar to Raf/ATN-like protein kinase"
                     /transcript_id="XM_005538337.1"
                     /db_xref="GeneID:16996954"
     CDS             complement(244666..245643)
                     /locus_tag="CYME_CMR089C"
                     /codon_start=1
                     /product="similar to Raf/ATN-like protein kinase"
                     /protein_id="XP_005538394.1"
                     /db_xref="GeneID:16996954"
                     /translation="MTDDIEAVQLSPRERLKQKQIPWEAITLGNELGRGTETIVYEGT
                     YEKRPVAVKMLNADARRETQYTFRTELEVVLGKLDWHPNILNYYGWGVRPSDGSKFLV
                     MELFEGGPISRRRKWVSRRPQLVYRIMRDVARALAYIHAHDLIHRDLKSSNVLVDRPA
                     RVAKLSDFGVSRTQGDSEAVMTALTGTYRFMAPEVIRGERYDGRADIYSYGILFNELL
                     TGIMPYEDTYLTPVQTATAVVSKNLRPRLVKTSDKVPASVVALIERCWDLDPEKRPSA
                     EEIASFLDVLCGEAAAASPDGSLSDPDAAKSSTSFEKNPPVHPNRCRTQ"
     gene            <247405..>248241
                     /locus_tag="CYME_CMR090C"
                     /db_xref="GeneID:16996955"
     mRNA            <247405..>248241
                     /locus_tag="CYME_CMR090C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538338.1"
                     /db_xref="GeneID:16996955"
     CDS             247405..248241
                     /locus_tag="CYME_CMR090C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538395.1"
                     /db_xref="GeneID:16996955"
                     /translation="MIPVLRVATLAALARHLRPRQRLLGFDFCGPAVLVAASDRERTQ
                     AAPFGVFSRSTDGVQADATLLNQVFEQAREFDAHGQVNIGAIVVNVDSAPQDENVCIV
                     PSPPPALAEYVEALARSLDKAVDTDEERAQGLAIVYWNQAHVLRTVRAQVQDLRGVIH
                     ELELYPEREKISAAENNMEKPEPFLRLSLLRRMLFGNGEGIPSRRLRKALHRRERRHP
                     GSYHDPKREEKEAFARTFGEEHLAVHEILVDVIEELRQFSREDSSEGASVENTRESTM
                     VP"
     gene            complement(<250145..>250621)
                     /locus_tag="CYME_CMR091C"
                     /db_xref="GeneID:16997043"
     mRNA            complement(<250145..>250621)
                     /locus_tag="CYME_CMR091C"
                     /product="probable signal recognition particle targeting
                     component SRP19"
                     /transcript_id="XM_005538339.1"
                     /db_xref="GeneID:16997043"
     CDS             complement(250145..250621)
                     /locus_tag="CYME_CMR091C"
                     /codon_start=1
                     /product="probable signal recognition particle targeting
                     component SRP19"
                     /protein_id="XP_005538396.1"
                     /db_xref="GeneID:16997043"
                     /translation="MVDTAPAPGSGQWILVYPIYFSKERSRADGRRVSRRSAVSAPEA
                     AEVFRVCQEKLSFPALLEPDKKHPRDFFVAGRVKVQLPEEPSDDGALTHTAKRKAVLR
                     AIAKALQELRRTQAATGSGQKAQKLAKTAQATVPSAKNQAGTPNQPGSGARRKTKR"
     gene            <250829..>252046
                     /locus_tag="CYME_CMR092C"
                     /db_xref="GeneID:16997044"
     mRNA            <250829..>252046
                     /locus_tag="CYME_CMR092C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538340.1"
                     /db_xref="GeneID:16997044"
     CDS             250829..252046
                     /locus_tag="CYME_CMR092C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538397.1"
                     /db_xref="GeneID:16997044"
                     /translation="MAATSTFPGTGWCLQPGRRLSTAFTHDGGVLVQLRSVRRQCTCS
                     VRAALVTPPGGTPSWRPAMLRLSMQGAQDSGATTSGLYGNNEQTRSVRAPLRDAAPYS
                     AVCELAAEAGQLTDAELQRRLESIAGVPAVFPEPEKPLDIPNALEFFRLRTGEWLSKR
                     VTQHMAFRRQESGESRITAQLLEANDERVKQLCALHNFAEDAAMGGCLVTWRATLQWD
                     QEGDAHTGEAIFALVAQPGSNGRCGKILRDRGYAEVVPITGDFYMDEEDALYLVTPYE
                     GGEVSEKFVFAERDILYRFSTVKRMGGFSNATYAVETRIPYTGNGEVLDTSSIEDDDI
                     SIFGLSSVDAQQSRQEEDSRLRRFGSLRGRMGDRWESPLGKKIEIDESKLPPSLRSSP
                     QPPSSSSPSTDAD"
     gene            complement(<255103..>256590)
                     /locus_tag="CYME_CMR093C"
                     /db_xref="GeneID:16997045"
     mRNA            complement(<255103..>256590)
                     /locus_tag="CYME_CMR093C"
                     /product="cytochrome P450"
                     /transcript_id="XM_005538341.1"
                     /db_xref="GeneID:16997045"
     CDS             complement(255103..256590)
                     /locus_tag="CYME_CMR093C"
                     /codon_start=1
                     /product="cytochrome P450"
                     /protein_id="XP_005538398.1"
                     /db_xref="GeneID:16997045"
                     /translation="MFPVFIWFVIVAIAIVTFTFGVPGTLLRRQRRKQLRGDTFPVRD
                     VSAERLPPCIRGWCPYVRAGFQFAFGAAPPQSFLEAARKQHGDVFTVEMFGRRMTFLF
                     SKNGIGQFFDSAPSKVSFIRAVEPFTDGIFGLAPTYFEKILHMLLVQLREELHLDKGS
                     DRGLARHLTGFAEALRMAMRQQMASLDGQAVAHVDDLFDLCGRLIFTASFQTVFGREC
                     ANALNKDGRLYETFVAFDREFELAALPIPQFLLRSFSRARRQLLRAMQRAVRLVEPAT
                     PAGKLLAKLDSDEKVCASVLLTLLWASSANTLLSAGWLIVLSAEWCNRARPVTESMAW
                     ELVTETLRLASSGIAVRIGCEPLYVDDFRIPAGDYLCISPWLAHQDEHRGGKRFDPCR
                     YQHIEDKKALFRGRTRQLYTFGGGMYRCPGQEYALHELVLFIQIFFEFVERVELGVAG
                     DPLTSMDAYRLVGIKRPTRPFPGKLFLISSCCDLRCGDPHPSERW"
     gene            <257851..>258252
                     /locus_tag="CYME_CMR094C"
                     /db_xref="GeneID:16997112"
     mRNA            <257851..>258252
                     /locus_tag="CYME_CMR094C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538342.1"
                     /db_xref="GeneID:16997112"
     CDS             257851..258252
                     /locus_tag="CYME_CMR094C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538399.1"
                     /db_xref="GeneID:16997112"
                     /translation="MELEVRDPGGMLSLAEGKKKPSSAGHPSSEEEHLTKKMKKIGDR
                     RAKISVRRDDDETVVAQTAQVLVIFALVSLNSGNKCTDFVSRDFNAAINISRCAVLET
                     RPEELTQANFVEQPLRLEVYWAKLKTIAAGR"
     gene            complement(<260047..>261168)
                     /locus_tag="CYME_CMR095C"
                     /db_xref="GeneID:16997113"
     mRNA            complement(<260047..>261168)
                     /locus_tag="CYME_CMR095C"
                     /product="similar to proline transport helper PTH1"
                     /transcript_id="XM_005538343.1"
                     /db_xref="GeneID:16997113"
     CDS             complement(260047..261168)
                     /locus_tag="CYME_CMR095C"
                     /codon_start=1
                     /product="similar to proline transport helper PTH1"
                     /protein_id="XP_005538400.1"
                     /db_xref="GeneID:16997113"
                     /translation="MNEADREFLESLPTGKLVLAYGSGVFPQLARGRLAIQRTRDYIL
                     VVDNPAEWLLQALDRHSEHFAWYLRSLRSRPGALRWLQHLGAGMCFVPPVPLASRSAE
                     ALKYGVIAEETLLADIREWRYFYAAGRLQKPVELIILSNMARVEAEACARRVDEANKR
                     HNLVQAVRMGILLGAEADTGPRLLPVATLLEQVVGLSYSADIRMRSGLEHPNKTRNIL
                     HANMDRLLGMYTTALVQMQREGLVQRLGAGDRATRPEQALPWRPDDLLDISMLFQTDV
                     YGHRARNRLLGPLLQLPLFCNIQAEDAIRQRLRDQNSAALRKFQGPVVIEYFARALGG
                     LLRRRVLHSSVSQAVKGLITAGPSRSLQYLWGKWWRRWS"
     gene            complement(<261181..>261399)
                     /locus_tag="CYME_CMR096C"
                     /db_xref="GeneID:16997114"
     mRNA            complement(<261181..>261399)
                     /locus_tag="CYME_CMR096C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538344.1"
                     /db_xref="GeneID:16997114"
     CDS             complement(261181..261399)
                     /locus_tag="CYME_CMR096C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538401.1"
                     /db_xref="GeneID:16997114"
                     /translation="MSALFNFNSLLIVILLLICTCTYVHALQPRLLDRNKTGFTGVFW
                     KAARIGERLSPYVSLCCLAMAVSVLVSP"
     gene            261533..263397
                     /locus_tag="CYME_CMR097T"
                     /db_xref="GeneID:16997115"
     misc_RNA        261533..263397
                     /locus_tag="CYME_CMR097T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461600.1"
                     /db_xref="GeneID:16997115"
     gene            complement(<262636..>263931)
                     /locus_tag="CYME_CMR098C"
                     /db_xref="GeneID:16997116"
     mRNA            complement(<262636..>263931)
                     /locus_tag="CYME_CMR098C"
                     /product="cell division control protein 5"
                     /transcript_id="XM_005538345.1"
                     /db_xref="GeneID:16997116"
     CDS             complement(262636..263931)
                     /locus_tag="CYME_CMR098C"
                     /codon_start=1
                     /product="cell division control protein 5"
                     /protein_id="XP_005538402.1"
                     /db_xref="GeneID:16997116"
                     /translation="MTRRFHLRSSSDWSLPEELVLRAAVEVCGTNQWRRIASLLPGKT
                     ALQCQEHFYSSADPSLKGGGNWTVQEDRLLLQVGRSLVGQWQTVALLLPGRTADACAQ
                     RFAELTRVLDASSQQKESLPSPGREPASVPVEQVSGLSAPARDTSALCPLPRCESRSA
                     TGRGVTLSVSDEELLRQASVRLYGDPRKLIERFLETPSTSEQGTAPASTIIADDDACD
                     ASSILFDEEHKRVQLCLELLTSQALHQRHQLSKRSAVSCWDPAVCARLLDDPAFRKRM
                     RSLEQALCQTASTCARPENPGTPAWNAQWLELPVAISGADVERAYLETERELQQQAAQ
                     HANVSAGHCRGSRALPVAAEHRRHRAETLIREAVRELLPADTHVAVKAIPLIAPSAET
                     EALIAEALATEDFQKWYTIVQAASSAPLASTDVPSRERT"
     gene            complement(<265164..>266123)
                     /locus_tag="CYME_CMR099C"
                     /db_xref="GeneID:16997117"
     mRNA            complement(<265164..>266123)
                     /locus_tag="CYME_CMR099C"
                     /product="probable pirin"
                     /transcript_id="XM_005538346.1"
                     /db_xref="GeneID:16997117"
     CDS             complement(265164..266123)
                     /locus_tag="CYME_CMR099C"
                     /codon_start=1
                     /product="probable pirin"
                     /protein_id="XP_005538403.1"
                     /db_xref="GeneID:16997117"
                     /translation="MKIAFICLLFANKRSWATLRQHPGHQSRAHSLLRAVTGIRCMSS
                     VEKPRVLERVVAAREQQDGVGARVRRSIGTPSLGRLDPFLLLDHFHVKPPGGFPDHPH
                     RGFQTVTYMLKGKFRHRDNRGHEGVIEAGDLQWMTAGGGIVHSEMPATPDENEGLQIW
                     VNLAAKDKLVPANYQEKRSSDIPVYNDPTEHVQVKVLAGSFRGVQSDVFTLTPTELLD
                     VTLGPRTFFQHKVPSSWNACFYVVTGSLVAGSQPVDAGSVGVFEKDGDDDGVEVQSGE
                     NGCRFVLLAGQPLHEPVVQYGPIVMNTRQEIIQAFADYEAGKF"
     gene            <267375..>268271
                     /locus_tag="CYME_CMR100C"
                     /db_xref="GeneID:16996776"
     mRNA            <267375..>268271
                     /locus_tag="CYME_CMR100C"
                     /product="similar to mannose-P-dolichol utilization defect
                     1 protein"
                     /transcript_id="XM_005538347.1"
                     /db_xref="GeneID:16996776"
     CDS             267375..268271
                     /locus_tag="CYME_CMR100C"
                     /codon_start=1
                     /product="similar to mannose-P-dolichol utilization defect
                     1 protein"
                     /protein_id="XP_005538404.1"
                     /db_xref="GeneID:16996776"
                     /translation="MAFMAFGLSSWQRATDATRGAAAVCSSDAREQHSAKFVVTSGTQ
                     SLKSGPKLLGSAGTHGRPPLIAGLAAAAPLVPPYHHHQQQQQQQVVRRALPLGLLSQV
                     LGWLVIIGSSLYKVPQVVRILRVRSAKGISVTTYVCETVSTACSFCYALRQRFPFDTF
                     GESGFILIQNVMILVLMSHFDARPRRWATLAILGSITLLMGVLLSPRLAPPVVVTVAQ
                     AVSIPLLNLSRIPQIVMNAQLRTTGELSITTMLLQLLGNAARLFTTLVRLDGNLPYLL
                     SAIVALALNSILVYQYFRFYAE"
     misc_feature    complement(268258..269818)
                     /note="possible transcribed region"
     gene            <269378..>275368
                     /locus_tag="CYME_CMR103C"
                     /db_xref="GeneID:16996778"
     mRNA            <269378..>275368
                     /locus_tag="CYME_CMR103C"
                     /product="DNA polymerase zeta, catalytic subunit"
                     /transcript_id="XM_005538348.1"
                     /db_xref="GeneID:16996778"
     CDS             269378..275368
                     /locus_tag="CYME_CMR103C"
                     /codon_start=1
                     /product="DNA polymerase zeta, catalytic subunit"
                     /protein_id="XP_005538405.1"
                     /db_xref="GeneID:16996778"
                     /translation="MDEALSGAFLCVKIINIDYYLWQPEHLSSDPGWLERFTPAQRGR
                     SLPAVRIIGRTSAGSTVCLHLHNTFPRTYVPLPETVAHNPEAERRWTQRLRVALERAL
                     EQLHLQQRDQRQAPDANWSANQPGSGAATEAPSSVEDAAADRYIYDITIEWRRCIYGF
                     KANAQRFARIRYIHPAESARLVQALASGMLAAVDDGTMDPVLPARLQPYEAHLPYVLQ
                     VMADYGLAGFGCIGLCSGRFRPPLASPRDAASEDADHGMQARHSASLVDNLPPDMVWN
                     VPVKRQTDCHLEVDVWLPRDLHPAHLHGEQEPTDLERHVPSLRLIWESERRRRCLSSW
                     RQMWVPIAHCRLEREVQPMDTGLKQRLGMVVSQALRKRAGAGNRQHQERRNAIALNDE
                     TSQADDLASALAAQFGYAVESSTAERLHPESDLEDEVLWNWMEQNYRTGVGAANGQPV
                     DTSFASAYALDTSVYEDEEQPVDEVATQKECADILECSLPLNETPGLGAETAKVATSP
                     ASLVHRQDTELGLSPPCSPSVAPSRTPVPESVLASASELQPGHESEAVQAQASTTSRP
                     RQASWCLAAFHLERSNVSPANWFMIPDQHPPFPFKSEWGVAQQKPFYSAIEDKAFTTS
                     GSSVRWFPQTPLWREVACRAFSSDSAADAAGLQTWRTPLSLPPLPQHIERIERFRKRS
                     RLLGASRKVIEVRMDSYGREVRTVAVLAAAKHAVSNSVTVTEDALANARPASVGIKAE
                     TAPRSCRSPRSIELGTSPKAWRSPWTRASELVDAPESRSVAIETPASVDSVQQGAPRA
                     HREEELPALPADQAYGAASAAAPGPMEAACSSENGSASKWVSPELLSASSSADSQHTE
                     WKATSDVDAHRTTALPTQTDRNWQLHGVQASLDAYDTRVHSSSAHASEVRSTRSPVLD
                     PSPYPNSDPSLAQSSEARCTNSQVLDPLPHPDSDLTLRRPAREPLSSAAAQRCRTFSD
                     ETGAMDPLPDTVAELEDDEAQLVPLVRPASPRYDEPSEFWSDAPHAAPAFSSAAIRSL
                     RTDREKRSRGRLSDITGPSQISSGRDSSGISGEPAPLEPLALHHQYGTETFRVLAIES
                     LSINRREQRPDALQDPLAAIGLVFRGDDSDADRHIMLVNSALRTNTGDDASAALTERT
                     ALGLVPTTGYTLRPTRVVVLGSEAALLRQLALLCRHLDPDILVSYSLRDGGIGYLLQR
                     AGVLGYDLASGLSRVALGVHDPKTERQWSLSMHPWETDTASGGIRLLGRYVLDVWRIM
                     QSEVKLSNYTFYRVVEEILGRRMPRLPWSTQRDWFTRGTAADCRRALELVLFRAAWTL
                     DLLEALDILGRSAEMATSYGIDLLSVFLRGSQYRVESLMARLAHAQGYVLVSPTAAQV
                     RCQPATAFIPLVMEPEARYYSDPVLVLDFQSLYPSMIIAHNICFSTCLGRVLLDSESD
                     WCTFASGIPRVFGVLEAYSPDWIGLVEALATDATPDVEALLTVLPNQTVFVKPRVRHG
                     ILPLMLREILETRMMLKGGMEAIEKQHRTAPVPEAERLRLQAIYRMLNARQFAMKYIA
                     NVTYGYTSASFSGRMPCAEIADAIVSAGREAMERIVATVERLWGASHGARVVYGDTDS
                     IFVLVPGASREVAFQLGRAMAEQCSALFPDPVRLKLEKVYSRSLLLAKKRYVGWAYES
                     ENQLMGMLDAKGIETVRRDSCGLVQKILERALRLLFTGDQDLSPIRRYVQRQLQRVLQ
                     NRFDFRDAIFFKEVQLGRYKPGYEPPAALVALRQLDQDPAAVPAFRERVPYVVIYGEP
                     GSTLRELVVDPGQFLEARRQGRILRLNTQYYVRKQILPALERCFSLMGVDVFSWFQQV
                     PRVAYRAPHSRGVPLGAHQKSRIEHYLPGFCAVCGESCAPQTEVCRVCLTRIPDSLAI
                     VQRKLHTAQQRLFRLQELCLRCIGEGITASECRDRPGEPLSAGACLAPEQHHQHQSCW
                     TQCWYPPCAHIECALLVERDKASLTTATYMHALGELSG"
     gene            complement(270765..272657)
                     /locus_tag="CYME_CMR102T"
                     /db_xref="GeneID:16996783"
     misc_RNA        complement(270765..272657)
                     /locus_tag="CYME_CMR102T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461601.1"
                     /db_xref="GeneID:16996783"
     misc_feature    complement(273580..275329)
                     /note="possible transcribed region"
     gene            <276903..>278273
                     /locus_tag="CYME_CMR105C"
                     /db_xref="GeneID:16996784"
     mRNA            <276903..>278273
                     /locus_tag="CYME_CMR105C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538349.1"
                     /db_xref="GeneID:16996784"
     CDS             276903..278273
                     /locus_tag="CYME_CMR105C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538406.1"
                     /db_xref="GeneID:16996784"
                     /translation="MFQGPARTFIGTYGCTRYQRLRALAACRSETRAERRATQRFDAA
                     ASGARRASKLGHRRRRLVKTHGALAIQSSLIQPNNFWGVWSLLIGSATAGVWFERTRI
                     GAALSAPLLSSLLGLALVNLGILPASAPAYQTVSKVVVPLAIPLLLFNADMRRVFRET
                     GRLLKAFWIGALATVIGTFVACALVPPGAIGADNLYRAAVALNARHIGGSVNLVAVAE
                     ATRMEPALVSALLAADNIVLAIYFPLIFALSSSAARPDADAKQAVDGNRRETDLAMLS
                     LALAVAFALCFLSFGIACWLHLESFVLPLLTLMIVSLATLFPRQFQPLQTAGTILGMF
                     FMQVFFAVTGALGSIGAVIRTAPLLLLLSVVQVGVHLMVMLILGRILGISRDDLMLAS
                     NANIGGPSTAAGMAASKRWTALIVPAILIGVCGYAIATFVSLGCLPLLPYFVRVLPWA
                     SALQRP"
     gene            complement(<279075..>281519)
                     /locus_tag="CYME_CMR106C"
                     /db_xref="GeneID:16996785"
     mRNA            complement(<279075..>281519)
                     /locus_tag="CYME_CMR106C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538350.1"
                     /db_xref="GeneID:16996785"
     CDS             complement(279075..281519)
                     /locus_tag="CYME_CMR106C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538407.1"
                     /db_xref="GeneID:16996785"
                     /translation="MAARKLLFSSAKLGIRIRERLHLEDVYEDDHELRLELLTLKDVR
                     RANDLLARNYARYNSDLVAMVEHGRQCSESLIDVARLLRARGEVISEEELSQETVDKY
                     LFSRELREVLVTVGRTERDVHDAFSAFSRAVELNMIKPRRNFTKSYCYGEFRQKKLHY
                     KDVKRTFKAHQKNVDEEPGAVERFELAEARAAYEDAESQLRRYAQQLEVENDESMRQT
                     IANLVIQHHAALVRAINALEKILPLCLRHAVERGSSVLNSPMKPGSFSPTTTHSVLAD
                     AEGISTPLETTEATTTALFVARIWLLMYRLQSVQKKALHTENTAELEAHTLRTSTDSE
                     SSQLLATLQGRVTGLEDSLRRERTRAYQLIAELQRKQKRLQRFMLLYWSMLASRVQHQ
                     RHRGAGAGSAATISERSPLGQPLPMTNEPAAVQRVRRHLAALCLQAVAWQALYRRQQQ
                     SQASKADLSCLVESELLRDLVRCREQCNRTWSLLLRERERRHAFRLKMRCRLGLVPTC
                     VRFDPLVPSTGRYLFAALHRRDADDVLKQRGRVAIALDRGSLMLLTEEAELEYDYVLH
                     GASSQAQVALVVERLLKAAQPAPGQRLLFLAANREANMYTALGTMTAPGMLQRWILEY
                     FQGGHYIPLVFEGREYHTPNSLCFALERYIERHASDPVCLQVTPATVPSSRDALFVPF
                     AAVLYEATPQYSGAELQRFAPFAACIATVGESDKRATEVLRLATSVAEQVHKLATTDT
                     GEVALDTSFSDWTIPERAHEAELRTPDALVRTKQAASETTPFPDVFPTDATSIIDDGE
                     HDFNETSSLLRSYLFG"
     gene            280066..281602
                     /locus_tag="CYME_CMR107T"
                     /db_xref="GeneID:16996786"
     misc_RNA        280066..281602
                     /locus_tag="CYME_CMR107T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461602.1"
                     /db_xref="GeneID:16996786"
     gene            <283722..>285440
                     /locus_tag="CYME_CMR108C"
                     /db_xref="GeneID:16996646"
     mRNA            <283722..>285440
                     /locus_tag="CYME_CMR108C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538351.1"
                     /db_xref="GeneID:16996646"
     CDS             283722..285440
                     /locus_tag="CYME_CMR108C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538408.1"
                     /db_xref="GeneID:16996646"
                     /translation="MHMSQSLLSTITDLALNKTDTGKKGQRATTSSRISGVVHDDRRH
                     EWVVPQLRRYASATPQRLRYIEHDKSEPDIGFILSLNARESAFYSGTRTRKRCSVLVR
                     RLQFTLACASDGRSDKPRRYFRSKKVSPVNPAAIQPQTPGHETGSSRKNAFAARSQPR
                     DAPQGVFETIRRWLQKHELESSSLCIRLLDDYRHVDELLQCFWNAVEDVAGGSSADVL
                     LALPPLPSSLASALIGHLRECADVGDVFGSHVFLNAYGPDEGAPRFCLRLRKGSSAAG
                     GVGATSQDDPFWSDDEDDFLDPRFAELLRASREEDAGETSPVAVGQDAAPTGITTNDD
                     LDTRQKLQSSELSLPSDEVILAESRAWVQHMIVDAAVCPFMMSAVRGGLPAGQVRYAV
                     SHATTPERIYREFWNEVALLRRTPSKDVSTTLLVLPELVQGIEGFDAITTPLSAALEA
                     LQLDAFIQLVFFHPKYAFRDGRDRINTQGCTGGHAANYVRRSPYPMINILRTEQVQRG
                     QRGIPTELVYRRNESLMRTIGAERLEQMLHRRSWEELLQLVQDNRPYADLEEAVKRVR
                     DQFASS"
     gene            complement(<285691..>287766)
                     /locus_tag="CYME_CMR109C"
                     /db_xref="GeneID:16996647"
     mRNA            complement(<285691..>287766)
                     /locus_tag="CYME_CMR109C"
                     /product="GTP-binding protein of TypA family"
                     /transcript_id="XM_005538352.1"
                     /db_xref="GeneID:16996647"
     CDS             complement(285691..287766)
                     /locus_tag="CYME_CMR109C"
                     /codon_start=1
                     /product="GTP-binding protein of TypA family"
                     /protein_id="XP_005538409.1"
                     /db_xref="GeneID:16996647"
                     /translation="MSHKLSGFVPSGHLSLPKTIVCPNSSFWHRSTSFGRPGWRPVSF
                     RQLPRSARHTLQVRALRAQAERTTSAIPEAIARASAALKTRNDVINIAICAHVDHGKT
                     TLVDAILHHAKVFRENQTVSSLVMDSNELERERGITILSKNTAVVYRGVRINVIDTPG
                     HADFGGEVQRVLSMADAMLLVVDSVEGPRPQTRYVLREALRLGQRVLVVVNKIDRPAA
                     RPVFVVNKTFDLFVELGASDEQADFPVVYASALKRVAGYAPDQLANDMGPLFEEILRL
                     PRPRVALDAPLQLLVSNISSDDYKGILGIGRIHAGTLRKGATVRVGTPAKDEAELRTA
                     RVDEVFLFENLGRVSAESAHAGDIVMVAGVDDIRIGETICDAADPRLLPPVQIEEPTV
                     RMSLAINTTPFAGREGRFLTSRQLRERLERETRTNVALRIQDGEKADSFTICGRGALH
                     LTILIESMRREGFEMIVGAPEVIFKMDPETNTPLEPFDHVEVQIPEEYLGAVVDALAK
                     RRGEMLNLTHSQDNEQYSIVEYIVPTRGLFGLNNALLTLTRGTAIIHTSFAAYRPYVG
                     QVRLREVGSLLAHETGRVTTYGVEAAQERGQLFVAPGAEVYENQIVGENKYPEDLRVN
                     VCRVKQLTNHRSATKEVVKTLQGIRTLTLDDALEYISGENEFVEVTPQSIRMFKVLSK
                     RRSIVGAKN"
     gene            <288570..>289232
                     /locus_tag="CYME_CMR110C"
                     /db_xref="GeneID:16996648"
     mRNA            <288570..>289232
                     /locus_tag="CYME_CMR110C"
                     /product="similar to glutathione S-transferase"
                     /transcript_id="XM_005538353.1"
                     /db_xref="GeneID:16996648"
     CDS             288570..289232
                     /locus_tag="CYME_CMR110C"
                     /codon_start=1
                     /product="similar to glutathione S-transferase"
                     /protein_id="XP_005538410.1"
                     /db_xref="GeneID:16996648"
                     /translation="MFVPLARYTASARQERAFACSKAQHSRRVSMSTGKTVLYSAPNS
                     RGAMVEWYIRSIKAPVEVVNLDMGKGEHKSPEFLRVNPFGKVPALEETGPEPWSLNES
                     GAILYYLAEKYDRNFPKDAHQRAQILQWILFANATLAQTAFMESLREKQLPGLLAALD
                     QHFSKHTFAVGETFTVADVALGSYLGYIPMFFPGKVDMTPYSHLNAYMERVKERQAAA
                     SA"
     gene            complement(291443..292680)
                     /locus_tag="CYME_CMR111T"
                     /db_xref="GeneID:16996858"
     misc_RNA        complement(291443..292680)
                     /locus_tag="CYME_CMR111T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461603.1"
                     /db_xref="GeneID:16996858"
     gene            <293607..>295841
                     /locus_tag="CYME_CMR112C"
                     /db_xref="GeneID:16996859"
     mRNA            <293607..>295841
                     /locus_tag="CYME_CMR112C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538354.1"
                     /db_xref="GeneID:16996859"
     CDS             293607..295841
                     /locus_tag="CYME_CMR112C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538411.1"
                     /db_xref="GeneID:16996859"
                     /translation="MSAPVERLEEIDVAVQRAAQDFSLRELHFHALPAVYRQELEEQE
                     GAVSQRASGPRCSVGVAVSGVPAEAAARKLARDTRADILLRVTLGEPRIGSFQAISLR
                     RQRLRTNSELEVFQWLERRLEGQGHGVADPSTGSAADGGALLFRITGPEGVQHVFTGW
                     SNDWIQCTAVFHANFFDDLDMLVDVLWNPPENGTSGGQATSTSQFIGRAAIMASELVE
                     MKGVLQRPLVNDAHSVIGEFRCEYCVIKPYAGTLPPRMAQLRFSLNEGINERKKIQLI
                     GHRGAGSQKTRSRVQENTVLSFLTAIRKGLVDAIELDVQLTRDQVPVIYHDFFIRCVD
                     EDDVDESDDERFRTAWSASPVRSDRGARLNESMLNGSRVLTRSSRTPDDSAEDVHCTC
                     ETANLEYASERDSCRASAVSANSTHHVAAADATAPPSTNTLTNASTSDQPHCLRDHAR
                     ASGKANQPKSRRYGTPIYSLTYEEFKSACRSMPRSRSRGGNLRVHGTTPQREPRWSDE
                     WSDFTRVASSDGNLGYLVRHFSESSERTDDANPIAMIRDNALPSLRRVLDRVPEEITL
                     LVEIKYPTPELMRETSLPYPERNHFIDRVLEVIFQKGSLKRRIVFLSFDPDVCLMVRK
                     KQAIYPVCFLNAAGRSAMSEHSDPRALSVANGIAFAVWAGLDGMVLLCDLIFEEPGIV
                     EIIHSAGLKVYCYGSSTAEPHYCEQLIHWGVDGIIADRVGYIARALNPLFMANANPET
                     IETA"
     gene            complement(<297089..>297781)
                     /locus_tag="CYME_CMR113C"
                     /db_xref="GeneID:16996860"
     mRNA            complement(<297089..>297781)
                     /locus_tag="CYME_CMR113C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538355.1"
                     /db_xref="GeneID:16996860"
     CDS             complement(297089..297781)
                     /locus_tag="CYME_CMR113C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538412.1"
                     /db_xref="GeneID:16996860"
                     /translation="MLSRPVGESLWRLPLLAQLQRPRGRSSRWSQPRSRVASSGSGRK
                     SHRAGEHQNADQRTRERTPKDWASLVGLLNERVTGLPRLVGFRIDHVEYGRVVASLPI
                     QPSLLAANGYLHAGSIVTLADTACGYGCYISLPPNRINFATVQLSSQFLGTALSGDLE
                     VEAWLRHAGRTTQVWDAEVRTRATPETRGVVHHPIALFRCTQLLLEAKSGTNEGSDSA
                     RDNSAGPSPKFV"
     gene            <299174..>300814
                     /locus_tag="CYME_CMR114C"
                     /db_xref="GeneID:16996861"
     mRNA            <299174..>300814
                     /locus_tag="CYME_CMR114C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538356.1"
                     /db_xref="GeneID:16996861"
     CDS             299174..300814
                     /locus_tag="CYME_CMR114C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538413.1"
                     /db_xref="GeneID:16996861"
                     /translation="MMRRLWAILCITAIALVSVRPARTMPADVQVRRDVDLFHSFGRY
                     LREKLVHGREVVFDRPLVQFFQRASTQGEWFKHVLKGLEGYFPFDPNLSGQLSLFFSA
                     LVEGTWFEPQNNGTCQCCDPSNPLYAYHVHIGMTGNAGEVVISYNTQEKPPQSCLYVA
                     EEHTSNQTKFCTEDVRTTSLGSGLSPFLCTGWSGYASHVKVNGLQPGKRYTYTIPGSP
                     GNVSYTFMAPYGNTTKTTKLAYFTDIGTKGGEPVINTLLSRLDDFDYMIMPGDQSYCD
                     GYHGCFDAYMKLIQPLAAQKPYMVATGNHEGPWNFSYVRTNFYFPVSESGAAPDALWY
                     SFDEGPIHFVMMNYENYFDYPDGEWSMTQPAPISTYPGQIEWLRRDLEAFAKRREHDP
                     SLWLIMMAHRPLTCNVTDKSCNHFGPILEQDVFPLMYEYKADMYWCGHVHAYERVSPI
                     NNVTRELCSDCVRDNATLYYKPPYPVQIMNGIAGRAVADNDYFTPGVSYPPFVAQHYS
                     SINYPYGGYALVSVDNNVLNFTLYNTSGAVLDHFRIEK"
     misc_feature    complement(300124..301753)
                     /note="possible transcribed region"
     misc_feature    301417..303676
                     /note="possible transcribed region"
     gene            complement(<303529..>304989)
                     /locus_tag="CYME_CMR117C"
                     /db_xref="GeneID:16996941"
     mRNA            complement(<303529..>304989)
                     /locus_tag="CYME_CMR117C"
                     /product="4-aminobutyrate aminotransferase"
                     /transcript_id="XM_005538357.1"
                     /db_xref="GeneID:16996941"
     CDS             complement(303529..304989)
                     /locus_tag="CYME_CMR117C"
                     /codon_start=1
                     /product="4-aminobutyrate aminotransferase"
                     /protein_id="XP_005538414.1"
                     /db_xref="GeneID:16996941"
                     /translation="MPRTLSLRCIGLSHRRCRCLLSTLAREEPARPLVHTLVPGPRSL
                     ELARELQEVSEGRTVQFFHDPHKSFGNYVADVDGNLLLDAFCFIASLPLGYNHPNLVE
                     AAQSPAWLPHLAQRPALGYSAPPEWVHTLRTKILSVAPQGLANVQMTCGCGASAVENA
                     LKAAFIRKRALERGDVNPTTAELDSCMRNSEPGSPNSMAVVSFEHAFHGRLFGSLSTT
                     RSKSIHKVDIPAFGNWPVLPFPKDEQDEARCLDLVDKTLSEQRVAALIVEPILSEGGD
                     LHASPAFFRGLRELTRHYQVAMVCDEVQTGVGATGRFWAHEHWSEGLEKTGQGVGTGA
                     AELAPDMVTFAKKMQASGFFFKPEFLPPQAFRIYSTWSGDPLRALQASVIIDTIVADH
                     LVERVHSVGDYLIHALADLNHPLVERIRGRGTFIAFDLPSPAQRDHLLGEMRNQGVLV
                     GSSGDKTVRLRPALIFDKHHADILLDILARVLRHMP"
     gene            <307491..>308309
                     /locus_tag="CYME_CMR118C"
                     /db_xref="GeneID:16996942"
     mRNA            <307491..>308309
                     /locus_tag="CYME_CMR118C"
                     /product="similar to polynucleotide phosphorylase"
                     /transcript_id="XM_005538358.1"
                     /db_xref="GeneID:16996942"
     CDS             307491..308309
                     /locus_tag="CYME_CMR118C"
                     /codon_start=1
                     /product="similar to polynucleotide phosphorylase"
                     /protein_id="XP_005538415.1"
                     /db_xref="GeneID:16996942"
                     /translation="MSLEYVRDIESIMKVGDEINVRVISVDLEKKEFSLTLLPEGVDQ
                     ERKEMVMAARERRRAAAYDENPAQSAPVARRNESRRQQMLKEAVSLLSDDGAKANAAA
                     PSTEAANAATATSTDADADAEAAKEAPVPGAKRDAAQKRGAMRQWFESTPAAKDQKLF
                     IPGKVVSIEEYGAFVAIGAPTDGLVHISEISKDHVSKVEDQLKIGDEVQVRVIGVDQR
                     RGRISLSMKPYEERQPKASSAAEKRASAQPEFKTTMELAFEKVRDQLVAAGLMK"
     gene            complement(<308959..>309960)
                     /locus_tag="CYME_CMR119C"
                     /db_xref="GeneID:16996811"
     mRNA            complement(<308959..>309960)
                     /locus_tag="CYME_CMR119C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538359.1"
                     /db_xref="GeneID:16996811"
     CDS             complement(308959..309960)
                     /locus_tag="CYME_CMR119C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538416.1"
                     /db_xref="GeneID:16996811"
                     /translation="MNHSLGNTTQQVGVNGVGQRRPRPEAAFNWGFGCPQLPGLALGH
                     TPPQMAPFYLNGSMPGASCSLPPPPTPPPGHSATLLVPVAVDALPHALQSFAWVPAAA
                     DTSFAGTLQVAAPDLCLMPGTPVYWVPPVPSTGTVLRGANGGTGVVLGNGTFESAASF
                     PSWAVPLSCQSQPVEHPDRAAGRILQERGSRTHATLHAKAVGSGASLSASSCSTHCTR
                     IAEDTARDFHSDISSMSLSPELSLGGERFTNSNKLDEKSVSLGRDQRALRILRWRQKR
                     RLQIEAFRRERERHPDRRRAVAKQRPRIGGRFLPKAVELTMRQNSSDLASAPAGTQG"
     gene            complement(310534..312591)
                     /locus_tag="CYME_CMR120T"
                     /db_xref="GeneID:16996812"
     misc_RNA        complement(310534..312591)
                     /locus_tag="CYME_CMR120T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461604.1"
                     /db_xref="GeneID:16996812"
     gene            <312811..>314514
                     /locus_tag="CYME_CMR121C"
                     /db_xref="GeneID:16996813"
     mRNA            <312811..>314514
                     /locus_tag="CYME_CMR121C"
                     /product="ketol-acid reductoisomerase"
                     /transcript_id="XM_005538360.1"
                     /db_xref="GeneID:16996813"
     CDS             312811..314514
                     /locus_tag="CYME_CMR121C"
                     /codon_start=1
                     /product="ketol-acid reductoisomerase"
                     /protein_id="XP_005538417.1"
                     /db_xref="GeneID:16996813"
                     /translation="MLAFLLTGSCSTVPRSSFVACSRRGPRRAPVTAVRAEPRPARLQ
                     RVQAVAAPPAQHESELALDFHTKCFKKESIHLAGRTEYIVRGGRDVFRALPAAFAGVR
                     TVGVVGWGSQGPAQAQNLRDSFADAGVDAKVVVGLRKGSRSMEAARAAGFTEADGTLR
                     EQNEVIREADLLLLLISDAAMAESFEEIQAAMKPGATLGLSHGFLLGHLDSIGAKFRP
                     DISVILVAPKGMGPSVRRLYVQGKEKNGAGINCSFAVHQDVDGRATDLAIGWAVAIGA
                     PFAFQTTLRNEYRSDIFGERGILLGAVHGIVESLFRRYRDQGVSDEQAFIRACESITG
                     PISQKISKRGILAVYEDLNEEDRRIFADAYAASYMPAFDILLECYEDVESGNEIKSVI
                     QAVRRHTRIPMGKIDTTHMWDVGKRVRAKRGSIPIDAFTAGVYIATMMAQIDVLLEKG
                     HVLSEIINESVIESVDSLNPYMHARGVSYMVDNCSTTARLGARKWAPRFDYILMQQSY
                     VKIDGKEGGLTAADRAHFDTFLKHPIHGAIVECAKLRPSVDISLTGSGSADAARAGMF
                     E"
     gene            complement(<315305..>315916)
                     /locus_tag="CYME_CMR122C"
                     /db_xref="GeneID:16996649"
     mRNA            complement(<315305..>315916)
                     /locus_tag="CYME_CMR122C"
                     /product="60S ribosomal protein L13A"
                     /transcript_id="XM_005538361.1"
                     /db_xref="GeneID:16996649"
     CDS             complement(315305..315916)
                     /locus_tag="CYME_CMR122C"
                     /codon_start=1
                     /product="60S ribosomal protein L13A"
                     /protein_id="XP_005538418.1"
                     /db_xref="GeneID:16996649"
                     /translation="MFEGPIVIDGRGHLLGRLAAVVAKELLNGQRIIVVRCEELVISG
                     LFIRNKNKYLLFLQKRHASNPTRCGPWHYRAPSKIFWRTVRGMLPHKTARGAQALARL
                     ETFDGIPPPYDKAKRRVVPCALRILRLRPDRKWTRLGRLSAEVGWKRAAIVDKLEEKR
                     KKLAQERYERRKQENKLLEEAKARAEAKLPADLKEILVSCGYA"
     gene            <318712..>319878
                     /locus_tag="CYME_CMR123C"
                     /db_xref="GeneID:16996650"
     mRNA            <318712..>319878
                     /locus_tag="CYME_CMR123C"
                     /product="similar to histidinol-phosphate
                     aminotransferase"
                     /transcript_id="XM_005538362.1"
                     /db_xref="GeneID:16996650"
     CDS             318712..319878
                     /locus_tag="CYME_CMR123C"
                     /codon_start=1
                     /product="similar to histidinol-phosphate
                     aminotransferase"
                     /protein_id="XP_005538419.1"
                     /db_xref="GeneID:16996650"
                     /translation="MASTATHRAERLVGDEVWDPETQEVHGGQTWQRCGDAFVEDFSV
                     TTNALGAPASALGAAREALSLVHHYPAADCAEALRALSAFLGGWPTDQLLLGNGASEF
                     IDLVMRVATRAGGGVCRTGPYEAAYREYDRAARAAARRVCTWADTENGDALTLGEQVG
                     VTVIVHPNSPTGDCASLEQLEAWIRTPSPVEAPDAVFVIDESFMPFQGPQWRAQSALQ
                     LVERYPSRVLVIQSWTKLWCCPGLRLGSIAGSKAWIRELKRLQTPWSCNTMAQAFCVA
                     AAYDTAYMQSTWQLLPKWRERQEQLLKAFPLRWSVNENSPRWVPWVYVNCGSAEIAER
                     ATACAFRAGCPVRWCASFGRPTCLRLGVRAPEKQDILMSALRMEFASDGYEASS"
     gene            complement(<320484..>322742)
                     /locus_tag="CYME_CMR124C"
                     /db_xref="GeneID:16996651"
     mRNA            complement(<320484..>322742)
                     /locus_tag="CYME_CMR124C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005538363.1"
                     /db_xref="GeneID:16996651"
     CDS             complement(320484..322742)
                     /locus_tag="CYME_CMR124C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005538420.1"
                     /db_xref="GeneID:16996651"
                     /translation="MDISGSACAVAAVFPRAATCTSRFGESAHSSQLPTNRKANARMK
                     ATAKTSSGALTPQPRYWSEQEHLRFLQALELYGFKDVRSIAEHVATRTATQVRTHAQK
                     YYLRLAREAAKLVLNFVNGDVQLSNDQIWEYFILSQQVDSQTGMRIPMVAIDAARDQF
                     RSQSLLDVLQRTSVDSASSVDGKPGITTDQSAGYKEFERSVGRENETSRKKGRRRRSL
                     DESATQRRTELFLVEEQGQSEEDDPKSASVPMSSTDGRDAPDELAVLLGTDSLDIPEL
                     ASSDAYSPRSDGGRGRRSRSNSRGRSSARQKTAGDGSAGRRSRSAESQRDDAADGELK
                     HPSPKQASQALESILKEDDLQEFEYGRTWSQDALFNPHATREPETTRLGYPAPVKGIN
                     PIPSELSLHTPTPSDDHRGYVPGQQASRAGAFATADLYRPMELDMDLLQRGLEAFAQD
                     PQCEPRVKHYADLLQVQLHTRRLRGSPAGDSSGIESVPDTARESIPLWQRRSGPSSPL
                     YFSSVLSDRHVNSFSPTPETASPMITATAAVTMPIDELDLVANPGGMGGLQPSAYPVN
                     APSLLPSQSALPDRSATLSPLVRSLTPRTLSIQRNGSTQSILQLLSGKPTDELPPMAW
                     MFLSSINDTQEDRFLQMLQHVEHGAFRATDGEASTASAYPNATPVARGKGDAPRDAST
                     HSTDTDVMFIEHAPRTAPRDHTDDVSLQQSTRPLRRNERMSWGSLVRLPSNTSFLNLV
                     DPNAVPEDLDRS"
     gene            <324709..>328143
                     /locus_tag="CYME_CMR125C"
                     /db_xref="GeneID:16996765"
     mRNA            <324709..>328143
                     /locus_tag="CYME_CMR125C"
                     /product="similar to nucleoporin complex subunit"
                     /transcript_id="XM_005538364.1"
                     /db_xref="GeneID:16996765"
     CDS             324709..328143
                     /locus_tag="CYME_CMR125C"
                     /codon_start=1
                     /product="similar to nucleoporin complex subunit"
                     /protein_id="XP_005538421.1"
                     /db_xref="GeneID:16996765"
                     /translation="MMEAEESYTEWKRLLERAVALEAQLFSERTQGGFAGESFAAGVP
                     ASHEKLDPFLKPRFPPAYRNLNQLESESQRLLKQTGATEAGAESSFAGTSTEHARAHA
                     LLAQRGFDPDRIELQAKQVDLVEDVEYLEPFAETDLDTWLRLQHEWAVLELCELARHR
                     TDSAAEALWEDHAAASWEQRRKQLLSLLGSSTDALNLRDILSYTGGSVDARNLRSRTQ
                     SRARSASPSGAETSQRTPVQLDRRAREHPERQESSEPHSGFERECAALVLALVRQAPD
                     SRSQLSESAHITQWSGLDISTFLSGQVATSVVGAADLSTDLVALRFARAARKWSQVRT
                     AASWPHVSYSEACYEILCAMLGEGDLTATLTRPDSFARKQPLTHEYGPFRAPAEGMLR
                     PSRGHRLRFVCGALDWLQRQFHQRKLRLSIEREPEMAALGGKTGTLAEVRAYLRVMEA
                     GTMAVSRPTGWLTEDPFAEIYYCLRCGDIGAAVEAAKDWLSPEGKHYSGDDLPRFLTY
                     LESFEQSARRRWQAIRRANGGPGPSEAGSTSQAFELRGLRGSVKATMLSQMIHDYGLF
                     VHKSQLRSGYRDWSVAWNANAQEEQHRLVERDIFKRVCYVLIGRFNSAAPEGMELLDM
                     DYDVLFASIEDYLWMRLWTCRLSVDECDGELGFISSERSGIDEETLADERLPPEMSTL
                     ELPLDAVQEEMRQFGSAHFDPHGNRPHFYAMILLLTCQFEAALTYLVYNGVVRASASA
                     LTQDPLVDAVHLGLILNYYGALTEYVQQDSDLVLYDYAAILWRYLQREQREVSLAKAD
                     PTAAAAYLMTIRDAEQRFACLCKLVTTTREFSLLLGAMIPGTLRRRPGVIERLERTAY
                     TTRQLAGTAAEWARVAYACAESCEITGDVIHAAMLFELAGDLNRVMSILIRALCSTYL
                     DHRFYQNRLPQPVDMERQQLELAKQAQSIYEKYEHEGVLSRREEDGGHRSSDQQTSAR
                     LSRSLAVALKLARFIALVYDEAQDDSDPDSSAVSRKSVEERYEAALELQKQLGLLPFS
                     RSQLTAKVEALRPGAVYEDALVERLPVVVLTLMRVVHVLYENTKTALRTGIPHKSPAE
                     QARPSERTVLAWRSSMEQRLAELKEIASTLVTFSGMIPFMTAAETSELVRLEMTLT"
     gene            <328897..>330375
                     /locus_tag="CYME_CMR126C"
                     /db_xref="GeneID:16996766"
     mRNA            <328897..>330375
                     /locus_tag="CYME_CMR126C"
                     /product="probable sulfite oxidase"
                     /transcript_id="XM_005538365.1"
                     /db_xref="GeneID:16996766"
     CDS             328897..330375
                     /locus_tag="CYME_CMR126C"
                     /codon_start=1
                     /product="probable sulfite oxidase"
                     /protein_id="XP_005538422.1"
                     /db_xref="GeneID:16996766"
                     /translation="MERSFNGYIQYIDDYSHEPVNQRRYDLLVVQKEQPFNAEPKAPL
                     LVQHHVTPTERFYVRSHGPVPACPDSTRFRLVVDVSLALEHCQSGAQDNQKRPGQLQW
                     SLETLREKFKFTEVEACLQCAGNRRTELVDRTKRPVKGVGWHQSAIGNARWGGFLLAD
                     LLRFSLHQAGLTDDAQLAQVPCDVCIEMEGADWVPEEEYRRKHRDTPPPGYMASLPWS
                     MVMGDGSSGHAVPPVLLATHMNGAPLTADHGYPLRCVAPGIYGARSVKWLWRIGLRRG
                     HSDGYFVERDYKVFSPAVDAAYVRWDSAPPLLEVNVQCAACVPAERAWKLWTSKADRH
                     PPGTASSLVVPLWGYAFSGGGRRIIRVDISGDAGATWTVAQLIFGEKGAHHAIRAESA
                     RVADDTDEAHNLYTPGLEPFRVRPLDTERPIANDAHRYAWCRWYAKLAIQPPCEVWCR
                     AVDESANTQPDDVRACWNFRGVAHNSVYRIRVESDDGPRSRL"
     gene            complement(<331601..>332701)
                     /locus_tag="CYME_CMR127C"
                     /db_xref="GeneID:16996767"
     mRNA            complement(<331601..>332701)
                     /locus_tag="CYME_CMR127C"
                     /product="similar to putative v-snare binding protein"
                     /transcript_id="XM_005538366.1"
                     /db_xref="GeneID:16996767"
     CDS             complement(331601..332701)
                     /locus_tag="CYME_CMR127C"
                     /codon_start=1
                     /product="similar to putative v-snare binding protein"
                     /protein_id="XP_005538423.1"
                     /db_xref="GeneID:16996767"
                     /translation="MTSKRLCFVSADGERFATLEASEEALIADLLEAVLVELHPSESV
                     VEDAAVNYAFRWRGQLLPPQRTVRELALPDDELITVEPQFRNQALERAQTTAPDSVRD
                     RDAALPAPISETSALPATAGVSGLVSRSGSDWTSMPFEDELMSPELQRRIEAAIHEHN
                     IQENLAAALEHNVESFTYITPLYVRVRVTADSARNAQPVLALVDSGAQCTVMSQACAE
                     RSGLSRLIDRRFRGTAIGLGRAEFIGRVHMALMELDGEWYECSFAIVEQLNTDMLLGL
                     DTLRKHGMCIDLRENVLRERDRAVPFLSDREIAEARGLDSAPARNETDVNVQRLVAMG
                     FDEASARSALAAANGNLGLAASLLMRPGIEAP"
     gene            332425..334120
                     /locus_tag="CYME_CMR128T"
                     /db_xref="GeneID:16996772"
     misc_RNA        332425..334120
                     /locus_tag="CYME_CMR128T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461605.1"
                     /db_xref="GeneID:16996772"
     gene            <336330..>337412
                     /locus_tag="CYME_CMR129C"
                     /db_xref="GeneID:16996773"
     mRNA            <336330..>337412
                     /locus_tag="CYME_CMR129C"
                     /product="probable rRNA
                     (adenosine-N6,N6)-dimethyltransferase"
                     /transcript_id="XM_005538367.1"
                     /db_xref="GeneID:16996773"
     CDS             336330..337412
                     /locus_tag="CYME_CMR129C"
                     /codon_start=1
                     /product="probable rRNA
                     (adenosine-N6,N6)-dimethyltransferase"
                     /protein_id="XP_005538424.1"
                     /db_xref="GeneID:16996773"
                     /translation="MQPLCLEQCSLFGSAVAKVSWVRTFPITNTRGTGSFHSRNLEKI
                     CRLGNNCSREHKSATRFALQLLTDAREPRPSWRPKQSLGQNFLKDPAVAAAIVQAVRA
                     CEPLELVEIGAGTGVLTEPLLEVFPGLVALELDARAVEHVRKRLEQSERFRSEHFPEL
                     RTRIYHADFLRSDWLRETGMLTRPEPRITLVGNLPYYIVSPIFFHCIESIQRYRNAIF
                     MVQHEFAERLMAKPQCKDYGVLSVLAQLHADIQVLLRVPRSAFYPMPKVNSVVLRLDF
                     RDPLQKDCMSCGVSSDVIRLALHRLVRRAFQQRRKTLRNTLGDQVPMRWSRRRPEELH
                     PAEFLELTMILSQDAALDTGKPPVSG"
     misc_feature    complement(337854..338495)
                     /note="possible transcribed region"
     gene            <341295..>342410
                     /locus_tag="CYME_CMR130C"
                     /db_xref="GeneID:16996684"
     mRNA            <341295..>342410
                     /locus_tag="CYME_CMR130C"
                     /product="similar to 1-acylglycerol-3-phosphate
                     O-acyltransferase"
                     /transcript_id="XM_005538368.1"
                     /db_xref="GeneID:16996684"
     CDS             341295..342410
                     /locus_tag="CYME_CMR130C"
                     /codon_start=1
                     /product="similar to 1-acylglycerol-3-phosphate
                     O-acyltransferase"
                     /protein_id="XP_005538425.1"
                     /db_xref="GeneID:16996684"
                     /translation="MAATSPENNRFDSGTTTEESSELEERFLPFEREAPRGGWECPLQ
                     WLLAPLVVPLRVVLCFVILVFFYLVCVSFGPRVDKKAAEVGFVWNLPRWRAHLLRGLT
                     KRCARVVLFILGFYRIRRQHLAGYDHRIRSKVLIVSNHVSLFDILFFMADDGRSFVSK
                     HTLLQVPLIGRIAATIGCIFVNRTLHSGGQATNLVVQRQRQMWASDSSAPPRGHRSST
                     DASSLCSSPPLVLFPEGTTTNGKYLLTFKTGAFVAGLPVQPVILTYEQRCFSLAYETI
                     RGWKYFLGVFRQFYNRLSVIYMPTYIPNEEEKGNPRLFAQNVHLHMLKEMQSRYGTQL
                     SNSSYLDKVAYHRKLRQQWGEYVPVPSSSARSHSHHE"
     gene            complement(<342910..>343797)
                     /locus_tag="CYME_CMR131C"
                     /db_xref="GeneID:16996775"
     mRNA            complement(<342910..>343797)
                     /locus_tag="CYME_CMR131C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538369.1"
                     /db_xref="GeneID:16996775"
     CDS             complement(342910..343797)
                     /locus_tag="CYME_CMR131C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538426.1"
                     /db_xref="GeneID:16996775"
                     /translation="MATLLRRALYWSLRFRDALEVSLASVQISTETAGTTSLFRALFQ
                     VWRGAPAQRKVFVETVLDEMSKPASFVATLTGNSMAPTLNAHVTSPFRPGERLVIRRL
                     SRWTGSMDTVRGEVTFYRRPLAYRGDIVVVKDPEDGSRRFVRRVVALEGDELVRDEEE
                     TSQALLRLERGQYWVLRDNDNPIEEDIQLLRERALEAETASADPQANAQKADAPNVGS
                     GAALPAERLPLAQQINLLRILRRDSRDFGPVTSDHIIGRVIYAIRNEVDHGRVRNSGL
                     SMMRDDVILAVELQQLGMC"
     gene            <344658..>345323
                     /locus_tag="CYME_CMR132C"
                     /db_xref="GeneID:16996745"
     mRNA            <344658..>345323
                     /locus_tag="CYME_CMR132C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538370.1"
                     /db_xref="GeneID:16996745"
     CDS             344658..345323
                     /locus_tag="CYME_CMR132C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538427.1"
                     /db_xref="GeneID:16996745"
                     /translation="MVRNSRVTDYSGFVTACSARQALVGWHSPVRLHLGRRFRLLKSR
                     WTRCFCGHLRCRALNTLSCTHRRLAGSATCGPFAKRPGTVLTAAWLAAVPSTSRAIES
                     GSATTESVKSAAEEIGNTAAQAATTNNVDWSSQLTNWLAAIDAVLLVSATILTIIVTV
                     RDWRRRSAKKEQESKSKDSGASKNAREGDRLKAAANAPPGKLNRYQRRELRKRRNQDD
                     SSL"
     misc_feature    346033..347789
                     /note="possible transcribed region"
     misc_feature    complement(346378..346711)
                     /note="possible transcribed region"
     gene            <348189..>350423
                     /locus_tag="CYME_CMR135C"
                     /db_xref="GeneID:16996747"
     mRNA            <348189..>350423
                     /locus_tag="CYME_CMR135C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538371.1"
                     /db_xref="GeneID:16996747"
     CDS             348189..350423
                     /locus_tag="CYME_CMR135C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538428.1"
                     /db_xref="GeneID:16996747"
                     /translation="MRCTARDMRRTSALGTLASNAQRVRWQRYWCSCGCFALRVRTLC
                     DTGYAIWPYSDNCTSRWSMPRYVRLVPVILSVVWVGIAVYWTFFGGALLENYPGYRPY
                     SCKLLSTPKVEPCCSPSPTVNPSPACSPVGYRIEVQSVELFRNSSGQSAMNKLYRGCD
                     DVSCDCLYASEQQAQQALNSLDFTVNETVKCWYNGSGSIVVLVNQGFSYNIALVGLVL
                     LALGALLLCWSVLHVLGLDCKLLEIMLRCLCCGHFDEWELRRRRRLWQHTQAYGANRG
                     GLAGLMLRARTGGLLPDEIREILRKIEISHQELEDLKKRAESGVDERNTSSVDAPLEP
                     NGSPALTPVHDAACRQPSAAEGYAGAVASDPSPTVRASHPLVVGDLIDCGICLDELTA
                     PLAAEDHDWEDDVVRESQLRRRIAQAAPSAPVRSAAPQTHSAEDPSVDPGPREGAPAA
                     SPAQQAGIQSSRHARAGPTPATQRWRHLFRPISTNEQRSQTDASPSTPTTTARGAACT
                     TISGVDIEAGHGPSRTGETSSVEAVAASTMNEGAGSSSTTAAPGSIAVRTVSGSRRIV
                     LLKCGHIFHFSCMKHFLCAGGVTCPICNRNLPRDYLTDSGTVSVGHASQETTPGGTAS
                     EAGHESTRRATASAGRPADAHAASGRRWRGFWGRRRPAQQPTMPASSSAYDGRVPNES
                     ETGVSDPAVPPRAVIGWSTAPRASETTRREADYGLVMVPHVSRNPEDIRDSPRDACIQ
                     APPV"
     gene            complement(<351139..>351777)
                     /locus_tag="CYME_CMR136C"
                     /db_xref="GeneID:16996769"
     mRNA            complement(<351139..>351777)
                     /locus_tag="CYME_CMR136C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538372.1"
                     /db_xref="GeneID:16996769"
     CDS             complement(351139..351777)
                     /locus_tag="CYME_CMR136C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538429.1"
                     /db_xref="GeneID:16996769"
                     /translation="MTSGAATALVSELRDAQHLPLYRRDLLQRVVDEILEEYAQLEKG
                     IEAWRSGSSQQGSRVEDRALQGSLLVRRARLLRNKRCVLAYLVNRLRRVEQACWNRDP
                     TIYSGPSEDKGTTGRATALLSEAERTYASRYEALLAAYGSAVGLDLRSALLVPPKEEF
                     IEVRVLEDCGDFFMASSGQSAHLAKGTVHFVRRADVELLIQQGKLEHLTPKC"
     gene            <353020..>354552
                     /locus_tag="CYME_CMR137C"
                     /db_xref="GeneID:16996770"
     mRNA            <353020..>354552
                     /locus_tag="CYME_CMR137C"
                     /product="similar to developmental gene, multi-sex-combs"
                     /transcript_id="XM_005538373.1"
                     /db_xref="GeneID:16996770"
     CDS             353020..354552
                     /locus_tag="CYME_CMR137C"
                     /codon_start=1
                     /product="similar to developmental gene, multi-sex-combs"
                     /protein_id="XP_005538430.1"
                     /db_xref="GeneID:16996770"
                     /translation="MAVHKASAPVDASLEEKLRNQVEFYFSDSNLPRDKFLRARVDAD
                     PEGYVDLQLIVTFKRMKQLNATAEKVAAALAGSELVEVSPDGQRVRRKKPLPLDDTSK
                     ERSIYVKGFKPGESPAAEPPIEDVMAVFEPFGKVLSVRMRRRKVHRRPGPVPASGDGV
                     CSPNGESSTATRPENERPTASETDEQAARPTTATSQTAGDTDAEQCQKLRAGASSEHE
                     LDAERALEPSAGGQSQDLVLHDHDRDQTTVIFKGSVFVEFDSEDAVAKALQRHAEHPL
                     LVPGTQTPFTIERKDLYLKRKNAEAKEARRARKLQRTGAQTKTDAPSTKPATKRSLQQ
                     VAGDTESPSRPEDAAFDDATSPGTASDRDSAAGTDTDDGTDVSEESEENAFEPGLILR
                     IEGLGPAVDRDDLRQAFSKYGQVGWIDHTRGNEVAHVRFLEPGAAAQAATSVKPSSVL
                     GGSDVRMLVLEGAEEHAYWERIREAQRAIRETEKRKRKREEKRRLSRNKRRRFRKRSL
                     EA"
     misc_feature    complement(354602..355619)
                     /note="possible transcribed region"
     gene            <355374..>357368
                     /locus_tag="CYME_CMR139C"
                     /db_xref="GeneID:16996855"
     mRNA            <355374..>357368
                     /locus_tag="CYME_CMR139C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538374.1"
                     /db_xref="GeneID:16996855"
     CDS             355374..357368
                     /locus_tag="CYME_CMR139C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538431.1"
                     /db_xref="GeneID:16996855"
                     /translation="MRTTELPESAENEPLEWLETLMCRTLGEAFALAHGESDQGRAHA
                     LSTVHQTSVWESLVPIALKRITDGAQRVAANAEANTGLATSSGSGSSRTLAALEALST
                     LKRRQRQQHQAQHALENAVQRLYLTDSFASLETRLEQQVRALCRRLRGLDLYTDENGD
                     GVVLTLSSTTMLIDIDARTAHTRVRYVDEHGTEVDDPYAERDIRECLLRGDMDGLANR
                     LQVLLDLEELASEPSLRATMHPRTCLMTWNDALVAKTADAATLSLKACAQCNVPLASV
                     RRTDGLSLIFDVKPLALFVPEWQNATLEQVSSTSVVRKAHLRFEPVVVSVDGTVTTCV
                     RPVLLLETPLLITTSIWRRCHCPADDGTQRASVAPAPLQTSGCGVRRVSLWQLLLQRN
                     EHHRLARQHASDEQNGPRAARPEAVAFEAVPPSPARLPAASGATPTSPHGVQFAFDES
                     EPALWIHRIPLAEVDDVLRIAPLLRQQWVLLDLMESLLPSCVASISDRLREGAPCPAW
                     PMGLPASAATAAAAPAVRSMVDERWADSEASSVQTRTHDIPWNGRWRARQEHRDDRAV
                     LILDAERCPSAASSVSLFQAACEATSPGAEHADVGVTSPSPAPRRLEIVVCADGGLRV
                     FQNGEDDPRLSKLVQTSRNIPLSIAVATTGAAIRANRIVS"
     gene            complement(<359390..>361648)
                     /locus_tag="CYME_CMR140C"
                     /db_xref="GeneID:16996856"
     mRNA            complement(<359390..>361648)
                     /locus_tag="CYME_CMR140C"
                     /product="similar to selenocysteine-specific elongation
                     factor"
                     /transcript_id="XM_005538375.1"
                     /db_xref="GeneID:16996856"
     CDS             complement(359390..361648)
                     /locus_tag="CYME_CMR140C"
                     /codon_start=1
                     /product="similar to selenocysteine-specific elongation
                     factor"
                     /protein_id="XP_005538432.1"
                     /db_xref="GeneID:16996856"
                     /translation="MPGVGRSTRPGYESLARQPLVQTRRFLNINVAVMGHVDVGKTTL
                     VRFLSEILSTAALDKHPASRELGRTIDLGFSCTRLPASPVVVQLVDDEAASLENVSYE
                     GLQLTWIDCPGHASLLRTVLLGASVMDLLLLVVDASAGIQAQTLECLALAAIFTKHVV
                     VALHKCDRVRDQPAVLEERLQQLQAYVSTNRWWLPTPLATIPTWIGTDARRTAFERHQ
                     QHQHSILFPAADNDDIGGVVALAQAVQAAAEQALASGLWQERLRLQRKPYALFAVDHA
                     FEVTGQGTVLTGILLTGRLRIGEVIHAAFVGAGVASTKSRSEGTKKRLIADARSVRSI
                     QVYRSSVSEIVAGDRAALGLTPGTKSGSLAQKSKQASGNKTASHRQRAPRDAWERGLV
                     YAPANLIEFYPVEKLLMRVQRVLDMTHPGAARGDAFSIATCAEHHPAPGQVPSLSRQW
                     QLTLALTTVPGRVTHWLAAADAAGEYECLASATEADASTATCSAERTRFVVLRLERCI
                     FLPFELGRGAADARRPVPLTPFQVALLSDAHWEAATAARKARLERRAGPDGESPDLRL
                     RFVLAIEAVLSTQMPTTTHLDAGSERLASVARQIRVYRRKERIGRVERFLQDGACCLV
                     RDLFDRDLQHPERILGLRVRLELLTDSTAQPPGCPADTYRRQAVRACVSGRIVRTFGQ
                     RGKVVVQLERPVSATTSSTAQWLVRLRFRRPVSLGIPDQERAHDRHSFYQAEEEMTSV
                     CEAAVQSTSERI"
     gene            <362258..>363763
                     /locus_tag="CYME_CMR141C"
                     /db_xref="GeneID:16996857"
     mRNA            <362258..>363763
                     /locus_tag="CYME_CMR141C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538376.1"
                     /db_xref="GeneID:16996857"
     CDS             362258..363763
                     /locus_tag="CYME_CMR141C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538433.1"
                     /db_xref="GeneID:16996857"
                     /translation="MVRCVHLRRPRSCIGFVDAQLIRDHRKLTRCRSDTGGTGLRSTC
                     CTRRWCCAQAQRLPLPERSPGTILRVACVGDVHDQWSDVDAHLLDTVVQPDVVLFTGD
                     YGNENVALVRNIAAYARRRSGAATSARCVASVFGNHDAWYTASARRQAAAAADAAAAA
                     GLTRRFGVPLLETKVEGAVREQLALLREVDVGYGVRTVHLAERDIGVPLSIVGGRPFS
                     WGGPNWRYPRFYEEYFQVSSMEESAARIRACLRAEVERVWSARLERLEEERSGQATSN
                     RHPSKQDAFAPVPCLGVHQVVFLAHNGPCGLGDEPHDICGRDFGFGTAGGTGFDTSSK
                     LQGDFGCPDLADVIQSLKTKPMMAILDGEASVFIDVPLCVFGHMHEQLQWDPQGYGIR
                     QMVVESHHTVYVNAAVVPRVRAAREIAELSGQASLEPGEQPFHNFTVIDMEQRACRET
                     EAATCPAKEPDDALYRVRKVFQVWLSEKAPQTASYVTCLYESSTEYGQDPE"
     misc_feature    complement(363329..365242)
                     /note="possible transcribed region"
     gene            <365862..>368624
                     /locus_tag="CYME_CMR143C"
                     /db_xref="GeneID:16996826"
     mRNA            <365862..>368624
                     /locus_tag="CYME_CMR143C"
                     /product="ribonuclease P protein subunit POP1"
                     /transcript_id="XM_005538377.1"
                     /db_xref="GeneID:16996826"
     CDS             365862..368624
                     /locus_tag="CYME_CMR143C"
                     /codon_start=1
                     /product="ribonuclease P protein subunit POP1"
                     /protein_id="XP_005538434.1"
                     /db_xref="GeneID:16996826"
                     /translation="MKTPAAYCGIPRALDVSAYAAARLRELWRLQHVVRAEQWPNVSR
                     NRARAGRSTRRVFQLLPWHARRRTMSFSTHRVPRPFRHLAWVELSKQPAASRRSRRSK
                     LTKKEHYRRRRWTRRAYRKSAFLVRDRSEVTSPYGWLETHVWHAKRMHMFEPCWGGRL
                     AWAPCDRGLRSFWRCVSRGQSDKRWRLCNDICAIYDASWYRVIEIPEYVARHVLPGLV
                     GERTWARLCCQPVWLGLKRLENTAIWDESGRMIAAQVEWLWEPPSLPMSSESRREPAP
                     EGTQPMEIEQTASNESGHLAGHSKRRLWAMVHPLVKDAVLELLQRGVSRMLASSRHEA
                     APAEVHATTLDEPLVSGTRPKRQEGTSALRCAAQMERSPDAQEHTSTWSNTPDTVQEL
                     PDGLVRFELYGKRSTEALHRALLNANAQGRDWIAFSQLASRLVSADSVSGQSVFHLHC
                     ADPRLFYPPRVRVPGQSLSQTQADYNYDAFGTYLRAASDWKRNSSLPAAMHARTLFDT
                     TWRNELVLNGVRALPERSSTRILRWKRRLARAEAALQATHSRRPVAGTCAAVVPRTSS
                     TAPPLKKRRVEPAPAGTLSSSAALEASRVLAGEALSGLAAAQAGEHSTLLRIPVVLLH
                     RPAQARRRWDSGWDVLLPKRWAMPFWSSLCYAGARGVGLRERRYVYHESGRCHFPEDF
                     PECREAYTRWAQRDIERAAEQWKRRPPSKRVNFTLYRVPEPFGVADWLTTSLSSAGNA
                     AGAATAAVAGEELHVLRSRQALIAHDAYQTASHSEQHPVSRARYLVRVRLHPIGRAPL
                     ATNALICLPHTEDLGLDASTSHARVDAVREQRPVPVIEEPRGTHNDHQSTRQVIGRLT
                     CSQYSWSDGCVRAYGFVDVDTLNVCAGFGSASQRRAEHPVVLVRNVTSRVYRWARLEP
                     LFDEDT"
     gene            complement(<368825..>369400)
                     /locus_tag="CYME_CMR144C"
                     /db_xref="GeneID:16996827"
     mRNA            complement(<368825..>369400)
                     /locus_tag="CYME_CMR144C"
                     /product="adaptor-related protein complex 1, sigma
                     subunit"
                     /transcript_id="XM_005538378.1"
                     /db_xref="GeneID:16996827"
     CDS             complement(368825..369400)
                     /locus_tag="CYME_CMR144C"
                     /codon_start=1
                     /product="adaptor-related protein complex 1, sigma
                     subunit"
                     /protein_id="XP_005538435.1"
                     /db_xref="GeneID:16996827"
                     /translation="MTFRFLLMMSRHGKVRVAKWFESFTQAEKQRIIRDMMNLVLLRD
                     PNWSNVVDYYNAVAGQRAASSKTNGVQPTVSDAVRLHTTGQYRDRLVYRRYAALYIIL
                     CIDAESLATGEANELLALDMIHLLVECLDRYFGNVCELDLIFNFPNVYQIIDDMFMAG
                     EFQESSRDVILHSIRTSDSMAGQERDEKHRA"
     gene            <370791..>371264
                     /locus_tag="CYME_CMR145C"
                     /db_xref="GeneID:16996828"
     mRNA            <370791..>371264
                     /locus_tag="CYME_CMR145C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538379.1"
                     /db_xref="GeneID:16996828"
     CDS             370791..371264
                     /locus_tag="CYME_CMR145C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538436.1"
                     /db_xref="GeneID:16996828"
                     /translation="MTRALGQLDDTAAAPDTLRRRHARYIPQIDWSESPLEASTDSSA
                     SESDRAVRSAASVVSVGSSYGTGNGAGRTALTDSMVSELVEQWSLRRPLQASVQNSSP
                     ARRHWSEARQVEVSYFIAPELFSNRDLNLRPGTRQVGCCLSCLQRHAESQQINIP"
     misc_feature    373289..375681
                     /note="possible transcribed region"
     gene            complement(<374746..>376467)
                     /locus_tag="CYME_CMR147C"
                     /db_xref="GeneID:16996791"
     mRNA            complement(<374746..>376467)
                     /locus_tag="CYME_CMR147C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538380.1"
                     /db_xref="GeneID:16996791"
     CDS             complement(374746..376467)
                     /locus_tag="CYME_CMR147C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538437.1"
                     /db_xref="GeneID:16996791"
                     /translation="MLNSTAAVHEPLLDGTLDATTRPALLRGWRPLNPFSGVGRLPVV
                     DSEHALETGKLFSERRAIEAALASLTEAWKQVDAVFGTFPATSVTQILLLKPIDLRHP
                     FLFYMGHLPAFAWNRYNSRLLPEDALPIQPPLTLEMLSTFAKLFERGMDPDVDDPTRC
                     HWHSQVPSTAEEWPPVFQVAAYRDYIRQDLSYRLRRWSESVDDQVLPPSSCYTLLMTI
                     AEHEWMHTETLLYMLHQLNGYCMRPFWISEYRQQMQSLASADALPMDQNSSYPPLGAT
                     QRVESDGIVSLGRNPHEVIEPYLRFAWDNELPRVQRKIPRSLLVQRYPVTNLQYWYFV
                     QAGGYRELDRYWLNESDRQWCARSGRQWPQFWRALNRSGQQQSGPACYVVHPDGRLGE
                     HALGEPACVENHWPVYVTLAEARAFANWVSGALGNQRHPAATWRLPTEAEWQHLAEGA
                     YPDSALDSDESSESSADGNYGFRHWGPISTYESPNCSRWGVCDLVGNGWEWTESLFEP
                     LDRERFQPSPLYPEYSADFFDDKHFVLKGASWATGTPLVRSTFRNWYQAHYPYVFAKF
                     RLVCEEA"
     gene            complement(<377315..>377770)
                     /locus_tag="CYME_CMR148C"
                     /db_xref="GeneID:16996792"
     mRNA            complement(<377315..>377770)
                     /locus_tag="CYME_CMR148C"
                     /product="40S ribosomal protein S19"
                     /transcript_id="XM_005538381.1"
                     /db_xref="GeneID:16996792"
     CDS             complement(377315..377770)
                     /locus_tag="CYME_CMR148C"
                     /codon_start=1
                     /product="40S ribosomal protein S19"
                     /protein_id="XP_005538438.1"
                     /db_xref="GeneID:16996792"
                     /translation="MAPRSGITLKDVPADHLIRSYAAHLKQQGQVREPEWMDVVKTGT
                     LREMPPQDRDWLYVRMAALARQVYLRQNLGVGAYSRKYGGKKRNGPRPSHFATGSRGI
                     IRYCLQELERLGLVARDEEAGGRVITRKGRQDLDTQAARIYAERLAGAA"
     gene            377983..379616
                     /locus_tag="CYME_CMR149T"
                     /db_xref="GeneID:16996841"
     misc_RNA        377983..379616
                     /locus_tag="CYME_CMR149T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461606.1"
                     /db_xref="GeneID:16996841"
     gene            <379969..>380457
                     /locus_tag="CYME_CMR150C"
                     /db_xref="GeneID:16996842"
     mRNA            <379969..>380457
                     /locus_tag="CYME_CMR150C"
                     /product="60S ribosomal protein L21"
                     /transcript_id="XM_005538382.1"
                     /db_xref="GeneID:16996842"
     CDS             379969..380457
                     /locus_tag="CYME_CMR150C"
                     /codon_start=1
                     /product="60S ribosomal protein L21"
                     /protein_id="XP_005538439.1"
                     /db_xref="GeneID:16996842"
                     /translation="MVRSHGLRSNTRDKFAKPFRGHGKPLPSKYLTTYKVGEYVDIAA
                     DSSIHKGMPHKFYHGRTGRVFDVTPRSIGVEVNKEVNGRILVKRIHVRVEHVRPSRCQ
                     EAFKALVRARDAARRAARAAGEPKVIHEKRQPAGPRPARVVQVGAGGIKHLEAKPYEF
                     IC"
     gene            <381389..>381823
                     /locus_tag="CYME_CMR151C"
                     /db_xref="GeneID:16996843"
     mRNA            <381389..>381823
                     /locus_tag="CYME_CMR151C"
                     /product="cytochrome b5"
                     /transcript_id="XM_005538383.1"
                     /db_xref="GeneID:16996843"
     CDS             381389..381823
                     /locus_tag="CYME_CMR151C"
                     /codon_start=1
                     /product="cytochrome b5"
                     /protein_id="XP_005538440.1"
                     /db_xref="GeneID:16996843"
                     /translation="MSVLSFWTGLIALVLLVVLVRHQQRQRSARQPGMRPERRNEPAY
                     VASTKPVTHQAANIAVNRAETRTKTVYTTEEVSRHCTRESLWLIIDGRVYDVTSYVDH
                     HPGGDAIFRNAGRDSSAGFHGDQHPEKVNEIIPDFYIGDLKQ"
     gene            complement(<382640..>384235)
                     /locus_tag="CYME_CMR152C"
                     /db_xref="GeneID:16996844"
     mRNA            complement(<382640..>384235)
                     /locus_tag="CYME_CMR152C"
                     /product="homeobox protein"
                     /transcript_id="XM_005538384.1"
                     /db_xref="GeneID:16996844"
     CDS             complement(382640..384235)
                     /locus_tag="CYME_CMR152C"
                     /codon_start=1
                     /product="homeobox protein"
                     /protein_id="XP_005538441.1"
                     /db_xref="GeneID:16996844"
                     /translation="MTFPPNFLQGGRLSSRATTRNQRPSRHGEMQCRSQSSDTSNWLE
                     TLWQLATCRVYPQATADTASASTALLWLTIPSAVNSTADSRHPASSEARVQQAAAEKL
                     EALVEHVICNGGLLSVPSFDRTTAAEATPSIENLREWLLRGTLPRRMLRALASLATCE
                     PREATCLLLQQLQQCSEHVPLASVHVSGALVELVTALQQLIRFRLKFESCCQCLLQMH
                     ERACRAYAVSRARDENDPGTGTPGHCSTSSMPVVTEHLSASTQRFVETADSSDAARRS
                     DRNAVAASGAALGLRIPLPWHVEAFGDAANDGESFWYEDVCDVYRGALGTTDACFHGS
                     AVQRLPAGATSAANRTGYLGGIHATEFNARNPEQGILRRPLSKALPSSAVELCTPREA
                     PGLDDERSSVASQISESVDQKDLAQQQQLTIPPTRSRTARAFFRTVLARYGEGFLMEQ
                     LSTGSGTGMVGSERHKLSRHAEAILIQHYECVSIYPSAAEREQLVNSTGLTRKQICWW
                     FSNRRMREKRGRLGSKRYIQRAL"
     gene            complement(<384980..>385942)
                     /locus_tag="CYME_CMR153C"
                     /db_xref="GeneID:16996780"
     mRNA            complement(<384980..>385942)
                     /locus_tag="CYME_CMR153C"
                     /product="similar to BEL1-related homeotic protein"
                     /transcript_id="XM_005538385.1"
                     /db_xref="GeneID:16996780"
     CDS             complement(384980..385942)
                     /locus_tag="CYME_CMR153C"
                     /codon_start=1
                     /product="similar to BEL1-related homeotic protein"
                     /protein_id="XP_005538442.1"
                     /db_xref="GeneID:16996780"
                     /translation="MTYKTRKSEDIPRKWDSNQVAGSVTSAPAQPGLRFSSRESEVCD
                     WQAPSHVEHAGTGGAFDDDGDAHVEAALLFLGERALCSAPGSANSDDFQRDVICYEAG
                     ESALAGQNLTECKHSAHEADVVSIQRGRLRPCFSAGAASSSAVEPSRNGFDGRSTGRL
                     GTAETTPLPRALPIERLRICAGTSVLHEGVPCWESPRAAGVHRSTACPSSTCACPASG
                     RPTPTTHILRRDAYANRSISGDQTTPLRAALSQEPARASSRRRTPLPKHAVAVFEAWA
                     RAHWDHPYPSDAVKVQLSAQTGVSVKQVSNWFINFRKRSWHGRR"
     gene            386430..389157
                     /locus_tag="CYME_CMR154T"
                     /db_xref="GeneID:16996781"
     misc_RNA        386430..389157
                     /locus_tag="CYME_CMR154T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461607.1"
                     /db_xref="GeneID:16996781"
     gene            complement(<387176..>389116)
                     /locus_tag="CYME_CMR155C"
                     /db_xref="GeneID:16996782"
     mRNA            complement(<387176..>389116)
                     /locus_tag="CYME_CMR155C"
                     /product="similar to TATA element modulatory factor"
                     /transcript_id="XM_005538386.1"
                     /db_xref="GeneID:16996782"
     CDS             complement(387176..389116)
                     /locus_tag="CYME_CMR155C"
                     /codon_start=1
                     /product="similar to TATA element modulatory factor"
                     /protein_id="XP_005538443.1"
                     /db_xref="GeneID:16996782"
                     /translation="MRRAVADEEEWEDVAAPEITEPALSATAEVRGRSPEASHEQDSG
                     ASFDSKTLRSETDDASRAHVLAATGAEEGHSPRTDAKERDSGAGSYGSQVGPGRLPSP
                     RPSLEAAENAQELYQEAQRLSKLVYERDQQVQAQRKRIRELERLVDSERSRANSTALQ
                     LRKEEERVQECQARLQAQLAQLKQAEEQRKHCEQEHVQRSELQTLETRLHELRDEHEA
                     ELRSLTRRLAMKAQEQLEIAKSEYRDRLEVLQSQLEHVKALLERTQQEQGRRERQWRE
                     EVAQARAHVSELEQQNEELSRSVSEATKPLMRQIQVLHEQLRQRSAGEATIQERLEQQ
                     VLQIRAELEAANVARAALLEEHTRLDTRARELEWKLRDFVALGSTLREQRVAAAKVLS
                     QIRTCCAQLRRTLFTFREDWLRLQRAYESEARETAHALGGLRRRLQIERRQLMTTPSL
                     CEAVPTASQMQPGEASAVQTVRDTPTASLVAGETLDNVSAPEDAVDERHSTPGSSVSA
                     GELLLSGSLPNLVQWTEVQSHLRHRANVIRSLQTELMRREDIIQNLTSEMAQLNEKLE
                     SQAAQVKRLDDEIRRMHEREQALLELLGEKEELVQELREDIADMKGIFHEQLEELARQ
                     LESARTVACPATSTTTNPSSEV"
     misc_feature    complement(389345..391390)
                     /note="possible transcribed region"
     gene            391025..393643
                     /locus_tag="CYME_CMR157T"
                     /db_xref="GeneID:16996830"
     misc_RNA        391025..393643
                     /locus_tag="CYME_CMR157T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461608.1"
                     /db_xref="GeneID:16996830"
     gene            <392571..>393380
                     /locus_tag="CYME_CMR158C"
                     /db_xref="GeneID:16996831"
     mRNA            <392571..>393380
                     /locus_tag="CYME_CMR158C"
                     /product="mitochondrial Mn superoxide dismutase"
                     /transcript_id="XM_005538387.1"
                     /db_xref="GeneID:16996831"
     CDS             392571..393380
                     /locus_tag="CYME_CMR158C"
                     /codon_start=1
                     /product="mitochondrial Mn superoxide dismutase"
                     /protein_id="XP_005538444.1"
                     /db_xref="GeneID:16996831"
                     /translation="MWGSLRLLSRIRVRNGLPEASTGRPLINLRCRSMHSSQRDNPAT
                     QTDVAGTQRALSSVAAAVAATAGSANANIPLPDLPYDYDALEPVISAEIMRLHHTKHH
                     QGYVKNLNNALNTLHSTDHVPTLISLQPSLVFNGGGHLNHSILWTNLAPVGKGGGELP
                     DKDSPLLKAIESDFGSLNNFMSLMNTAAAGIQGSGWAWLALNRNLRRLDIITRSNQDP
                     VVGAYTPLLGIDVWEHAYYLQYKSDRAAYLKNIWQVIHWKDVMKRYEAAIA"
     gene            complement(<394633..>396498)
                     /locus_tag="CYME_CMR159C"
                     /db_xref="GeneID:16996832"
     mRNA            complement(<394633..>396498)
                     /locus_tag="CYME_CMR159C"
                     /product="similar to COP9 signalosome subunit Csn2"
                     /transcript_id="XM_005538388.1"
                     /db_xref="GeneID:16996832"
     CDS             complement(394633..396498)
                     /locus_tag="CYME_CMR159C"
                     /codon_start=1
                     /product="similar to COP9 signalosome subunit Csn2"
                     /protein_id="XP_005538445.1"
                     /db_xref="GeneID:16996832"
                     /translation="MGTPAGTPPESSWSQVRSSTPEYAVLLENLYYDGESLQERGDLS
                     GAAALYERLLSLEQPQRESEWGVRALHQLVIISVFERKDYSRAQALHERLLCYFHTAV
                     PRTLVEFVISQLLDSLASETYVPASVLERLLQATIDALDAAGVSLNNRLRFRTVVRLG
                     QLYLDTGALWRLSTLLRRLYRHAGIRLGADPALEPKSASLSGQVSAPRQPGEQLLIGA
                     LSGSQLLELFALDMQLQLVLWGKLASVPFQFPQAMEYRLRHTAQDTSPAASIGRRNRD
                     FVATMPPDSSAVPRTVGVALSPPGRPGVPIAADDGFYASRLWRLYQEAMRLKSVLKGV
                     LVSPRTLAIIRTCGGKLYLAQGCVTEAAREFYEAFRHYEEVGAPERFAVLRYLVLANL
                     LSGNTVDLFTAPELQTYGSEPHMRALGDMIHAYEKDDLVLFESSLEKDRAMIEDTFLR
                     PFTETLSSRLWQRAVLRAVHPYRAITLASLAKRLGVTREGDSIAQVEHAVVQLISDGR
                     LIGRIDQTQDVLLVSWRQRTTGLLSTDSPATGTETEFGSSATSGVPAWDDSFVNPTRY
                     SESSYPVSVADYRQIRDTDLDADRVDILLTTWSQRLKRVREQFAQLGADIPRVAS"
     gene            <397253..>398494
                     /locus_tag="CYME_CMR160C"
                     /db_xref="GeneID:16996845"
     mRNA            <397253..>398494
                     /locus_tag="CYME_CMR160C"
                     /product="similar to polyadenylation factor I complex
                     subunit FIP1"
                     /transcript_id="XM_005538389.1"
                     /db_xref="GeneID:16996845"
     CDS             397253..398494
                     /locus_tag="CYME_CMR160C"
                     /codon_start=1
                     /product="similar to polyadenylation factor I complex
                     subunit FIP1"
                     /protein_id="XP_005538446.1"
                     /db_xref="GeneID:16996845"
                     /translation="MSQQQSRGKQPNAPSATATTADNDDEVDLYSGIEFPQALAPAKQ
                     KVQPLRAAPSKGSSASERDRVEAHAPSDKRGADRLEQAERNANETSRVRAAPDPSISD
                     DLHDSDEEDDAEEEDQESSDDDVDIILGSSQPAIGEQAAKFAASWNEVAKEGRGVAEQ
                     GGTAAGLGMMNAEASLQSSALLQSMLPQPTMANVVPGKQRSLYEVELEQLDEKPWREP
                     GAVLSDYFNYGFTEETWKIYCQHQAAMRQETSVLHRQVTMNQATASRERDKPTRPGQA
                     GAGSAAISAGNARERPPRRAVEEEKPKRDVESTAKSTGKGPGTAWKVAGSSPSLLPSK
                     NVLERLAQVRQQIMSQNTGAQTPESSSKTMHRHETTSSEANSGEADRAEPTQATASDD
                     RTRKRKRVNEEPAPSIADRSR"
     gene            <399284..>401635
                     /locus_tag="CYME_CMR161C"
                     /db_xref="GeneID:16996846"
     mRNA            <399284..>401635
                     /locus_tag="CYME_CMR161C"
                     /product="WD-repeat protein"
                     /transcript_id="XM_005538390.1"
                     /db_xref="GeneID:16996846"
     CDS             399284..401635
                     /locus_tag="CYME_CMR161C"
                     /codon_start=1
                     /product="WD-repeat protein"
                     /protein_id="XP_005538447.1"
                     /db_xref="GeneID:16996846"
                     /translation="MPRLRGRGSSRSEETASHESTPTGSTAATPASEDGSGTSRSAAN
                     ESDEWSASALGAALVQGLRALLEDVSLSFQTESSGERPSQRRRSRRQHLQFQRYASSR
                     LAPNVGVNRAAIQADIAFPQALWQLDESGRERERSIEDIERMEAVLTYLSYWLGERNG
                     SRVVYGSQQRFRSPLHETDAALRPVWAIRLGSVPDALRARECTAEAVPMPGLATKSRL
                     WTEPPQLLAECHRERLEQFLHLLLPPTTESNLPLDAQYFSSFWYRFLFLEKELLRSVD
                     VRQPTAPPVHYSQPLSDGDPRAASEAAGISAATSTDTCSSFQQPWSRLYPGACSTRAP
                     GAASRSLPCGFHDAAMASLQEHYVPQFPLRKLDVYSARAYGCRFFDEGRLLVTSCQDR
                     RLRLYDTSALDVFEWCGGSPEHSLLERWERPPSEQDCRARLPVSEVIARDLRWTVTDV
                     DWSRQADGTSWLAYASITPRVYLVRLDAVEAQQALSFAAPANLVLDQSSSETGAAAGW
                     TNLLDAENSYGLGIWSVRFRPDGSELVAGASHTGHVFGDLVVYRLERQAPVASLRAHQ
                     DDVNSVAVAGANLILSAADDAYIHVWDRRDLRRPCGSFVGHTEGITHVSWRGEEVAPQ
                     LRCATDLLDQRYVVSIGKDQRCKLWDIRLLREASQVERPRPTHYDYRWNDMVNPPLDN
                     RRTLRGDNSLYTFIGMRVLSTLIRAYFSPLSTTSGRYIYTGSQDGRICLFDTVSGMPL
                     TALRGHEAAVREMSWSPRLPGVLVSAGWDGQALIWRPAGVEDH"
     gene            complement(<402939..>403976)
                     /locus_tag="CYME_CMR162C"
                     /db_xref="GeneID:16996847"
     mRNA            complement(<402939..>403976)
                     /locus_tag="CYME_CMR162C"
                     /product="similar to mitochondrial carrier protein"
                     /transcript_id="XM_005538391.1"
                     /db_xref="GeneID:16996847"
     CDS             complement(402939..403976)
                     /locus_tag="CYME_CMR162C"
                     /codon_start=1
                     /product="similar to mitochondrial carrier protein"
                     /protein_id="XP_005538448.1"
                     /db_xref="GeneID:16996847"
                     /translation="MSASGEPVTLPDSSAARMSPPSTAHEPAITDLCSWSAVAGVLAR
                     TAVQPLDTIRARVMVSSKPLSIWETLQRAGTESCARYHRRLGRFGAFVRSLYRGYTIS
                     VLVQAPAVATYLTVYEKTKFALAEFEAASRTSPHRRPLIDLSASSPWNHLCSGLAAET
                     VSAVFWTPMEVMKQRAQVATCDADATLRTLARRLWTEEGARALFRGYLLTIGVFGPYA
                     MLYFVTYERLKRWWSRFLTKSESLPSWSILASAAASGAVAAACTTPLDVLKTRLQTTR
                     LAAGERLSLWRMASALVREQGYQALLRGLGPRVLWIVPNTAITMTAFEYFKAQASSRT
                     VSTASLEGVAS"
     gene            404497..405902
                     /locus_tag="CYME_CMR163T"
                     /db_xref="GeneID:16996676"
     misc_RNA        404497..405902
                     /locus_tag="CYME_CMR163T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461609.1"
                     /db_xref="GeneID:16996676"
     misc_feature    405493..407216
                     /note="possible transcribed region"
     gene            complement(<407084..>409033)
                     /locus_tag="CYME_CMR165C"
                     /db_xref="GeneID:16996678"
     mRNA            complement(<407084..>409033)
                     /locus_tag="CYME_CMR165C"
                     /product="sigma subunit for chloroplast RNA polymerase"
                     /transcript_id="XM_005538392.1"
                     /db_xref="GeneID:16996678"
     CDS             complement(407084..409033)
                     /locus_tag="CYME_CMR165C"
                     /codon_start=1
                     /product="sigma subunit for chloroplast RNA polymerase"
                     /protein_id="XP_005538449.1"
                     /db_xref="GeneID:16996678"
                     /translation="MFTQGRTASAEARCCRLSSDGVGFVTATLGLWRVRPLKQLDLPR
                     AGQRLQHGKTCPGRGVRLVVAEPRLLRSCRCCANTNRSRDLGAEYALEKHGFVDGARK
                     LEPEANSVCAPAPLGPVARDEQREHVPKSVDSGTTPDASSGAQRTPERTGSSRRRQAR
                     AATLRVGQSTSAVPDSPLQTPLEETFVSVDNRLPVPNWEAKHPGGPGQAHMRETTSPS
                     AKTRSSKSVRPARQRQLSNADQRLSPTSLNDAVHKLPQGSRRSLSTNPSAVVNARWER
                     IQDSERAADDDGPSIRELDYSEDDPSDNEPLAWETYPETPRARSSESSTLRWYLRMIG
                     RVDMLTPEEEVSLSRQISRLLHWERKRIELHGALDRAPTDDELAEHLGVDPERFRRNL
                     AEARRAKDRMVAANLRLVVSIAKRYMRKGLPLEDLIQEGSLGLIRAAEKFDDRRGCRF
                     STYATWWVKQSVMRALADQGRIVRLPVHMHDRILAVRKAARDLSIERGCEPTEADICE
                     RLGISRKRLRELRSLAVQTISLESSVRFGNNQSGSERDRTTLADSIVHESASPEEQIE
                     LSMLREDLERSLQLLNHVEMRVVRLRYGLDSGIAKTIDEVGALVRLPREEVRAIENAA
                     FRKLRHTSGLVGLKDYISSLNTSAL"
     misc_feature    complement(409466..411809)
                     /note="repetitive element"
     gene            complement(<413679..>414908)
                     /locus_tag="CYME_CMR167C"
                     /db_xref="GeneID:16996679"
     mRNA            complement(<413679..>414908)
                     /locus_tag="CYME_CMR167C"
                     /product="methylenetetrahydrofolate dehydrogenase /
                     methenyltetrahydrofolate cyclohydrolase"
                     /transcript_id="XM_005538393.1"
                     /db_xref="GeneID:16996679"
     CDS             complement(413679..414908)
                     /locus_tag="CYME_CMR167C"
                     /codon_start=1
                     /product="methylenetetrahydrofolate dehydrogenase /
                     methenyltetrahydrofolate cyclohydrolase"
                     /protein_id="XP_005538450.1"
                     /db_xref="GeneID:16996679"
                     /translation="MGNAPRVGLRTTAPVVLQHSPSGTRYLAPGFTPQGSWFGQRCSG
                     RQRTPGSRVASAQCSRRRRYRFAAAAAEHARLPAEQRVALRLQLGSFSDTGTLKHPVQ
                     SLGPPVAMQNHSAASRLLDGKAIANQVKNEIGGRVRELSNQYGRVPGLAVIIVGSRTD
                     SQTYVRNKRKACEEVGIHSLLFALEESVSEEELTSLVRRLNADDSIDGILIQLPLPEH
                     IKSERVLQEISLEKDVDGFHPLNIGRLCLKSPLYPPLAIACTPRGCLELLDRASVKIE
                     GKHAVVLGRSNVVGLPMALLLLQRNATVTVCHSRTADIAEQVGRADIVVAAIGRANFV
                     KGSWIKPGAVVIDVGINSVPDESAPRGYRLVGDVEFDTAKERAALITPVPGGVGPMTI
                     AMLLLNTLQAFERRFKS"
     gene            <415189..>415695
                     /locus_tag="CYME_CMR168C"
                     /db_xref="GeneID:16996673"
     mRNA            <415189..>415695
                     /locus_tag="CYME_CMR168C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538394.1"
                     /db_xref="GeneID:16996673"
     CDS             415189..415695
                     /locus_tag="CYME_CMR168C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538451.1"
                     /db_xref="GeneID:16996673"
                     /translation="MVYFEHALMCGKTAVLGERRLQAFVFSAAAGRLAAGGHVPRCRG
                     RPSRGMQRFYQRATKGALGFREPVRSELALDGGGGGGQSLEALGTLPTDAESQQYLAD
                     IERLRALDPETCPTCKNAGMIQCPACNGSGLRPAKPDEVYRFFCETCLGKKLVRCPDC
                     PGRCLSCG"
     gene            complement(<416319..>418037)
                     /locus_tag="CYME_CMR169C"
                     /db_xref="GeneID:16996674"
     mRNA            complement(<416319..>418037)
                     /locus_tag="CYME_CMR169C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538395.1"
                     /db_xref="GeneID:16996674"
     CDS             complement(416319..418037)
                     /locus_tag="CYME_CMR169C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538452.1"
                     /db_xref="GeneID:16996674"
                     /translation="MASRKRLADTQLNKDSALADDDSEEQCRSADTRPAGGTNSTQWN
                     AAPTLAGRRIVRVRRTGAQALPSSEQNAGRNSAGPATQGLSSESTTRKLPVAQASSEA
                     ARSVEKSPASTRESTLTAAPVSTQEANRLSGGAPGEQVASTARPLGSEAALVHNSSGE
                     DGAAPKHPASGDAVEKRAAGTASPLPPDNVSAAVPKAAPQAVPAQTAEKRARSVSAGV
                     GSTETGSAANSETISSGAVASKAAALTADAPSSAGDSEAGQRSNKEKQADDVPKHDAE
                     KNQPLSGAAKVFAGFTFGNLSTSHSEKMTGLASFRFQDATTPALQNNASALPGSTPLF
                     PELAGGAASKGTPSRVKVPGRALESTDGRHCGEHDAYVEASEGDHKSAHETAHDDDDD
                     DDGGGGGGGDNDDDANVSEAMPSTVPDIFNNESEEEMRLQTRAKLFELVDKQWRERGR
                     GLLRLLYHPSKQTARMVMRVDGTLRVILNVPITRETPRLDEAGEAMVRFVATQNASEE
                     AADATASTAPSGTASGTVTDAPAPNAQRRAQVWCLRFAHREDRIRFGEMCATLQRVIG
                     QKEQEA"
     misc_feature    417430..418736
                     /note="possible transcribed region"
     gene            complement(418763..420277)
                     /locus_tag="CYME_CMR171T"
                     /db_xref="GeneID:16996690"
     misc_RNA        complement(418763..420277)
                     /locus_tag="CYME_CMR171T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461610.1"
                     /db_xref="GeneID:16996690"
     gene            <420245..>422734
                     /locus_tag="CYME_CMR172C"
                     /db_xref="GeneID:16996691"
     mRNA            <420245..>422734
                     /locus_tag="CYME_CMR172C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538396.1"
                     /db_xref="GeneID:16996691"
     CDS             420245..422734
                     /locus_tag="CYME_CMR172C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538453.1"
                     /db_xref="GeneID:16996691"
                     /translation="MEEAVATQRRGVKRERTVRRQRVLRLAVPTRLLPTLKRSVIEQL
                     HSQNGSMKYDGNKIEDLILRALCDFATFAGIPPAHRLAALERALPRHIAQSPRYRSSF
                     CAAWHFSASTGAQDENDQDGTLSSELAALRALILETLSEREEQQRSQRSASSDCSKAI
                     PETPPYATSACDVASTQATVETLRQSGCRITRSVQAWLTTAATTTAQQGPATDAAPSR
                     MQPVALNAHTTTSDTGQCCGTVQQLHHQRQGTARIRTRCGSSSAIPTRVPLSLAPMLL
                     RFLELQLPEAVEYHLQDLLLTELLRIDRVQYVYLPGRGLDTSRGSIRASSHAAGTERQ
                     ASSSCTRRAAPQTRTDTECPYERVRSARITEHRALLAALGLGRSVAGTVTPTSKKREE
                     ATSMIQCKEMRHERLLPRNADTMSRKQSSPLTFAEYVRRADPATSAWMGALDPLWIQA
                     AEQVVAACLVRARDPNACSEGAAPAWSTAYMQRSIWERNDSTQYRKHVQRISERYLLE
                     LDSAENRRKRGFRNHPTVYAAARRNAQPGTLSADACLARLTTATLGARSTCGSTLTEE
                     KETTMTTALQRRGSVEEAYLWTEADYDAFFTAWRRFGNSVHANRKIAQAMNEAYWARV
                     PTRKRHALTLKTRQGIGGRVTFLPTHIVYQKRLHRGWLEMHRSENELKLEQLMPAPHQ
                     TRCGLCRRDASHDDSTQTGALIGPFWEMLPDAPSTPVWMHRECLLWTPEVFETCEGTM
                     MNVRRTFRRAIRIRCAYCGRTGAATGCFLRYCRRSYHAPVCAVAAGCSLDHRHYRLLC
                     MQHTQVYAKISAKGAALFWESLEQEGISSVK"
     gene            complement(<423387..>425150)
                     /locus_tag="CYME_CMR173C"
                     /db_xref="GeneID:16996692"
     mRNA            complement(<423387..>425150)
                     /locus_tag="CYME_CMR173C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538397.1"
                     /db_xref="GeneID:16996692"
     CDS             complement(423387..425150)
                     /locus_tag="CYME_CMR173C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538454.1"
                     /db_xref="GeneID:16996692"
                     /translation="MLRTDGGKRATAEAEAFERDLNQVLRQASEQYATDILREAVTPA
                     LRCRQLDIAHAAVEEHSRAEALEQTLRTALTAVQRVLSPWAQGVLQRRQGPGGDGVSE
                     AALEPVSASGTSRSRSFGWHWPWRQKQKYAQVVRQPSAVAPAKCPPADTRAICDALAA
                     LALLDVCVMNTNIAVNRVLIRYNLPLIQQIALLPLCVDDPQQPPAPKGVTSPSAVPVE
                     CQVLVVRARQCLIHWAQVMTPLVAEIPEFQQAAAAVQRDGLSLSARYRRVRRPASTSG
                     SGAGPRPTAGTAERRPVPGTTVPASANVGAPAASVRRFYRAPMILPQAWMWAWTASMH
                     AGVFCQYGSGPTWYPTPSPVQAPPNRRDQMLNRLRAAFQETRETIDLFQAMCDSFRDA
                     PVGTSPNSETLENARSRFERVQMMRDGLASLVPRIVEPPLRQEASRLLCDAERALTEF
                     RTLCETNAFFRAALSPDGHVAQRAPAPIVPPEDGDGCTSAPMQAEPEHELLPLHENLS
                     WAALSPTAPAAEDLIDVETAHTRMESTNEVHRGVSVNEHLIDSSDDEAQDTVQHPVLQ
                     PRRASRRSEQERAPSPPLTSS"
     gene            <427604..>428692
                     /locus_tag="CYME_CMR174C"
                     /db_xref="GeneID:16996693"
     mRNA            <427604..>428692
                     /locus_tag="CYME_CMR174C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538398.1"
                     /db_xref="GeneID:16996693"
     CDS             427604..428692
                     /locus_tag="CYME_CMR174C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538455.1"
                     /db_xref="GeneID:16996693"
                     /translation="MAHNSRKRLQSDTSPPRLEQATYAQCRLSLPRCRSGTWAPRMGR
                     CSSCRNKTIYFCYVNREFICLNCVFQPRYELSVVRSYKEWIRDSSYEQPPRCPFTGAP
                     LRHGEELVRLPPPDLRVVSAAGLAAYLRGRFGPDTTPAGFRSNELPFGLVPDPQDDSA
                     VAQRLRRFLALLGYDAALAVAEPLEDKRSSPGTVSAEGGTQAASEATLLERRLPSEQR
                     PVSRPLEATTEAVSRTAPRTGSNTTIVVESHKTSEPDSTTAIAPARKQNAAGRTADND
                     SKERKIRQQKIRRFLNFLGQSAEVLPLPHPRPNRRNRRLTGLALSFGFGVGILVFLAY
                     VVRHGLFNPLALWEYVVERRQGMLSVER"
     gene            <428848..>429216
                     /locus_tag="CYME_CMR175C"
                     /db_xref="GeneID:16996667"
     mRNA            <428848..>429216
                     /locus_tag="CYME_CMR175C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538399.1"
                     /db_xref="GeneID:16996667"
     CDS             428848..429216
                     /locus_tag="CYME_CMR175C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538456.1"
                     /db_xref="GeneID:16996667"
                     /translation="MATCSRAKRKLPAYALFVKCVTAVSYVHTPASSCPERDCSALPP
                     YHSGLWAPYSGDSHDRYQSIAETMRCRLCSRGSREDSYQFMNSGMFFLSHESTMRESL
                     HAQRTEKQNCVIRSIPEAGR"
     gene            <430250..>431335
                     /locus_tag="CYME_CMR176C"
                     /db_xref="GeneID:16996668"
     mRNA            <430250..>431335
                     /locus_tag="CYME_CMR176C"
                     /product="unknown homeobox protein"
                     /transcript_id="XM_005538400.1"
                     /db_xref="GeneID:16996668"
     CDS             430250..431335
                     /locus_tag="CYME_CMR176C"
                     /codon_start=1
                     /product="unknown homeobox protein"
                     /protein_id="XP_005538457.1"
                     /db_xref="GeneID:16996668"
                     /translation="MGRALLNQVPMEAFFIFPEEVPETAGNMLTPSRTTETAEEGSRT
                     LFTVDRNAGNTGSELPLPALSDVLTATSLQVDHSLENIDEEIGCGGIPEASAVGHGIS
                     VDIDALDLYLDMRDGTQTTASERRAQVDNAEDSIASVREVSIDQPEHSRARLLSWCRR
                     TALLARNLALEYDGPYKDLVRLQAHCLANQVEQLWAESPCRHEARAPVATRHSVSASA
                     SLATASAAEPRDTLYRLPTNVVQGACDASASDSNTCSKQGTAARCKRKRRSFGGIHGY
                     QARATKHRTRASTNEYASRILKQWLLDHFLNPYPGDEEKHQLMRRTGLTYNQLNNWFI
                     NARVRLWKPLVDALACKRQRQQEQPGT"
     gene            complement(<434494..>435066)
                     /locus_tag="CYME_CMR177C"
                     /db_xref="GeneID:16996669"
     mRNA            complement(<434494..>435066)
                     /locus_tag="CYME_CMR177C"
                     /product="similar to ferredoxin"
                     /transcript_id="XM_005538401.1"
                     /db_xref="GeneID:16996669"
     CDS             complement(434494..435066)
                     /locus_tag="CYME_CMR177C"
                     /codon_start=1
                     /product="similar to ferredoxin"
                     /protein_id="XP_005538458.1"
                     /db_xref="GeneID:16996669"
                     /translation="MSQTRPMFVAGCQPWLVGQTTSSHRSWKQLTGMFATRWETVRAL
                     PRRPACWAHKQLGVRRAALRKLRATASLNEKAGADGAIEITVEYQDRTEVVRCQPGQS
                     ILEAVEASGLWTEVPSSCRAGVCTTCAAWLLSGDVEDPFAALDANIRKEGFILTCSST
                     PKADAGPVRIRLGAYDQVYEMQYGRFEKAA"
     gene            <435421..>435651
                     /locus_tag="CYME_CMR178C"
                     /db_xref="GeneID:16996655"
     mRNA            <435421..>435651
                     /locus_tag="CYME_CMR178C"
                     /product="cytochrome c reductase ubiquinone-binding
                     protein"
                     /transcript_id="XM_005538402.1"
                     /db_xref="GeneID:16996655"
     CDS             435421..435651
                     /locus_tag="CYME_CMR178C"
                     /codon_start=1
                     /product="cytochrome c reductase ubiquinone-binding
                     protein"
                     /protein_id="XP_005538459.1"
                     /db_xref="GeneID:16996655"
                     /translation="MPAKPNIRLRGQIEYFVSPYEQRIFADWFDPKLVLTKLQRKVSE
                     NAKDVLPAFFVLVGTIYLGDKLHEEEAKRHRF"
     gene            complement(<435817..>436470)
                     /locus_tag="CYME_CMR179C"
                     /db_xref="GeneID:16996656"
     mRNA            complement(<435817..>436470)
                     /locus_tag="CYME_CMR179C"
                     /product="mitochondrial ribosomal protein L12 precursor"
                     /transcript_id="XM_005538403.1"
                     /db_xref="GeneID:16996656"
     CDS             complement(435817..436470)
                     /locus_tag="CYME_CMR179C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L12 precursor"
                     /protein_id="XP_005538460.1"
                     /db_xref="GeneID:16996656"
                     /translation="MPGTRLAKAAQCVRYLAPTLFCGRRSTQLCLSWRHDGRRWSTVS
                     AQAAPHVKTQPNVTESGDARHDPVDERVGRLADEILSLNLLQAKQLSDVLRSRLGIEG
                     TPALGGGALTPAALAAMQQAMFTAGNAAAGAQAAATGSAEKTEEKSEFDVVLEKYDAA
                     KKIQVIKEVRSALGLGLKEAKELVEAAPKVIKSAVPKNEAEALVDRLKQFGATLALK"
     gene            <437665..>439575
                     /locus_tag="CYME_CMR180C"
                     /db_xref="GeneID:16996657"
     mRNA            <437665..>439575
                     /locus_tag="CYME_CMR180C"
                     /product="ATP-binding subunit of unknown ABC transporter"
                     /transcript_id="XM_005538404.1"
                     /db_xref="GeneID:16996657"
     CDS             437665..439575
                     /locus_tag="CYME_CMR180C"
                     /codon_start=1
                     /product="ATP-binding subunit of unknown ABC transporter"
                     /protein_id="XP_005538461.1"
                     /db_xref="GeneID:16996657"
                     /translation="MNGTRVFQREHLRSSTEQIASAVGPPGGIPANARRLQTLRLQRV
                     AATAPGAEPDTGERRQLFAQFMATSVLCGFRSRVLRSPGTSVTRHGSSAEPAFLLARH
                     AAFLGAQAVTRRANTCERDRDSLQPLPGRYLQGSKRTCVRRRCGRERLPPPCHCQSAA
                     FDDAQAPGGESWRPQRPRRDEPKQQQQSAHETTARENKPRASERIPPTESPPPDKARL
                     DRAHNNESSRHAGDGNEHGIVDTVPYGCRSSLPERRPDREAAPDDAAIQDNTNGTEDT
                     VVEDASSVDAVGQAKSHVSPSIRESHRALITSPQRAAMSLVSGFATALAYVTSRVVDR
                     ALGPGTAASVQSFLSHDPSRLHPELADPSAAYEIEFEDVCKSFEARPVLKGLNLRIRR
                     GEAVGIMGRSGCGKSTTLRLIAGFELPDSGSVRIRGWTRDEPIQYELGPIKIGMVFQH
                     AALFDSLTVFENVAFELEHNTDLEDDEIEKAVDIILSRLGLRDTRDLLPNQLSGGMRK
                     RVSLARSLVSDLGKGAKPLPDVLLYDEPTAGLDPIACTRIENLIREVRETVPTCIVVS
                     HQLSTIQRTVDRVVLLHGGRIRWDGPVSDLGHTDNPFVRQLLSGDENGPMSGPEFDPD
                     SSLYVPEDIQDA"
     gene            complement(<439989..>441374)
                     /locus_tag="CYME_CMR181C"
                     /db_xref="GeneID:16996652"
     mRNA            complement(<439989..>441374)
                     /locus_tag="CYME_CMR181C"
                     /product="similar to small conductance mechanosensitive
                     ion channel"
                     /transcript_id="XM_005538405.1"
                     /db_xref="GeneID:16996652"
     CDS             complement(439989..441374)
                     /locus_tag="CYME_CMR181C"
                     /codon_start=1
                     /product="similar to small conductance mechanosensitive
                     ion channel"
                     /protein_id="XP_005538462.1"
                     /db_xref="GeneID:16996652"
                     /translation="MEKLATQTLSFVPLQGNPFSGVGYHTHRIFSRDARLKLCRWKKR
                     ALPAVSVLPRGVGRLLLAHAGQHQRQALSSLWQAHLSTHVHNLDIGSILETPVSLGGK
                     SRLVAAFTLSDLLVILILLVAYRRMVRILARSVLQPAGARLPDKWLTRKLIPADEHGL
                     VRWIESTERAVGLFLTLRLGVMACQFGLVLGARLGITIWPKLPYVISRLATIGYFAFV
                     LDTFYNWFLYEREDLSLSQIFVLGRLGTVLIYAVAFLVFVETTGLPLRSILAFGGIGG
                     LAVGLATQELAKNFISGIMLALGAPFAPGESVQLNTLGVSGQVRQIGFYKTELIGADG
                     RPIWIPNAQLLNERLTNNSRITNRRINLRFGLRYQDIDKIGRIVERVREMLAEVPEIA
                     AYRESISVFFTEFAEYSLPIQLSCIVNVTDGRRFLEIQQQVLIELNRIVKSELADFAL
                     PTRAIEYLPPR"
     gene            <441879..>442547
                     /locus_tag="CYME_CMR182C"
                     /db_xref="GeneID:16996653"
     mRNA            <441879..>442547
                     /locus_tag="CYME_CMR182C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538406.1"
                     /db_xref="GeneID:16996653"
     CDS             441879..442547
                     /locus_tag="CYME_CMR182C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538463.1"
                     /db_xref="GeneID:16996653"
                     /translation="MSAASKKKYFEDIAGGSTKPTDVLESGPTAPSAGSDRKLATVAA
                     KETDRQFSAASSPMETTKPAQPAASAVSAREATTNGLSNAKTVGAAADTDRPTQTAAA
                     AAPTTTAKQAAQPTRPSAPTAVENAAAQTKPEKEAKPAAASTKPESSSSSSKRLLTIG
                     EKAYELWQSGNSQDSEKNWNDAIYQLACQRAHEIWLETGCEDSEANFHKAREEVIANG
                     GLYV"
     gene            complement(<442841..>446224)
                     /locus_tag="CYME_CMR183C"
                     /db_xref="GeneID:16996654"
     mRNA            complement(<442841..>446224)
                     /locus_tag="CYME_CMR183C"
                     /product="WNK-like protein kinase"
                     /transcript_id="XM_005538407.1"
                     /db_xref="GeneID:16996654"
     CDS             complement(442841..446224)
                     /locus_tag="CYME_CMR183C"
                     /codon_start=1
                     /product="WNK-like protein kinase"
                     /protein_id="XP_005538464.1"
                     /db_xref="GeneID:16996654"
                     /translation="MMGDDEQGEPSSVNGPFVSRRAELWDPVMPARRAVPADAGAAVP
                     SAAACFDSTEAAPVLLGVCSETTVTQEQSAPPVLSPVNGGQPGAGAMISGAAAGGMHR
                     SGEAASAPAGIVTAPSAQSPSTEDNDDCFEERSPDGRFLRFPEVLGTGAYKTVYKGFD
                     TDNGIEVAWNKLNIQRLTNQDTERVMNEVNILRSIQHPNIINLFAGWEVRDERGRVRG
                     AHFITELMTSGTLKQYIAKVKMIKVKVIRKWCRNVLEAIHYLHSCTPPIMHRDLKCDN
                     IFINGNIGEVKIGDLGLSSVKDRASKCGYTVIGTPEFMAPELYDENYSEKIDIYAFGM
                     CMLEMVSTEYPYAECENAGQIFKKVLNGVLPEALSRMVECDLKRVILQCLASESQRPT
                     ALQLLNHPLFADWESDDGSLSNVDLMVSPNSGRSRSSLEVPRSMTQFPDGDTNAAKQS
                     LTSNLSPSPSSTTVSRLSMEHAPSRARARNGDQTTPDAEAHSIVEHPATGKATSAGNI
                     TVNYIIAGRASHNASPTISALHDQSPNAKDSSAVAGEERTKDAICGLLGVQQADAAAG
                     ALHQGPGRRRIFEGVDIDEAAAAPPTRPIVRVIGRADESFRSILPAESGSISGTDTSA
                     VPDSQHALSVDVTSVDATNRSGVNDRKLVYSGILVLSVRIPVSGAVKRITFAMDPYRE
                     SAEQVAREMVEELNLDEAQAENIAQAIDRQLDLHLQPTATAGLPRTKPLPVETVSSIP
                     TIRVVTTPLERLQEPPESEASPNLVSVPGAPAPTALRSSASPPVERTPAQTISGLSTI
                     TEISNSDTRAVHTAPKPSERAGNDRREAAQGLPPGAPLGTPDCVAQVLRSSVAPTAPP
                     LRPASSVPNAAGVPVVVVMETPPSDARENLSTDQTRCVHASEVDTCHAASFLEGASVL
                     YRPAQSAGAILDEGACLQTPVYESSALQPATSSDSAITNDMPAAGPSRRATSEPASEV
                     PLSGLHVVTVDESFMKSFVGKSSRTDECAPELTRDASWTHAHDDPRLTGSERITRADS
                     FSYDYDKVVDAKSTRSPSPLPTSPSARSSPSPSPSPPLDVHDLVQAMYGQMPALKRHS
                     SSVAQVAGLVPVTSIDATSSTTDATGHRGQRRAPDRGQG"
     gene            446635..449212
                     /locus_tag="CYME_CMR184T"
                     /db_xref="GeneID:16996663"
     misc_RNA        446635..449212
                     /locus_tag="CYME_CMR184T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461611.1"
                     /db_xref="GeneID:16996663"
     gene            complement(<449435..>451786)
                     /locus_tag="CYME_CMR185C"
                     /db_xref="GeneID:16996664"
     mRNA            complement(<449435..>451786)
                     /locus_tag="CYME_CMR185C"
                     /product="mitochondrial division protein Mda1"
                     /transcript_id="XM_005538408.1"
                     /db_xref="GeneID:16996664"
     CDS             complement(449435..451786)
                     /locus_tag="CYME_CMR185C"
                     /codon_start=1
                     /product="mitochondrial division protein Mda1"
                     /protein_id="XP_005538465.1"
                     /db_xref="GeneID:16996664"
                     /translation="MFEALSGMGIWTNSAARAEGTRARTKSKQATKEDKKVAATVTRN
                     KVHGPGEGTSRPLRERTNQQSENLQALDPVAAFQKFRGSVEPSANEGKPPERGAARLR
                     PGATREPLGRNADRALAVKNAVHNTRTPQGAHAGIDHSDEQVSEAPDRDGRSDRQAAS
                     TLIGADGASSVEPASPFGHQDEEADSPGWLGAAKNLASTKDDQVSPLTRILQSQGASD
                     VPPHVTEEKVRGLLENAPEESDRHQGPLAAPSPLQRRLMRMSPNMHIVSLENIARLYL
                     ELQADREYLIRESEKCYRARAATVQDLREVEAALAELLTKKHALEEKLESLGERDELS
                     RLLLGNLDEKVTVIGSESVAFEERIRQLKGSGVAQAVERALKERRGRSSFLPSATSAP
                     PELKTENPPQSSDEAAADMPTGARLGAVANESRHSSSGARGSERDSLTPRLCIRTLYG
                     HTGQVLAADVHEEADIIVSASADRTLRIWDLSVCMSLDESFVDSKDPFGSRKDTLHGH
                     EGWVHALDIHPTGTLLVSGSADRTARLWKLYDAEESASSPLTSLPHTRRHRCLHVFAG
                     GHRGAIMAIQMDDARVITGSTDRTLCCWDLETRARVLRMEGHEAGITALQFWRYGLAT
                     ASADGTVKMWDMRTGRCHRTLPVTQSGDGEATQASVTCLQFDESRLITGSSDECVRVW
                     DLRTAKCRQVLETGSSINALRFDRDRLYVGCADQVVRAYDMHQLLEPAQGRPSMLRRA
                     FFGHTGAVNCLALSEYGLVSGAADQTLRLWNTRWHEDWHMTPE"
     misc_feature    452032..454100
                     /note="possible transcribed region"
     misc_feature    complement(453187..455335)
                     /note="possible transcribed region"
     gene            <455077..>455826
                     /locus_tag="CYME_CMR188C"
                     /db_xref="GeneID:16996658"
     mRNA            <455077..>455826
                     /locus_tag="CYME_CMR188C"
                     /product="NADH dehydrogenase I flavoprotein 24kDa subunit"
                     /transcript_id="XM_005538409.1"
                     /db_xref="GeneID:16996658"
     CDS             455077..455826
                     /locus_tag="CYME_CMR188C"
                     /codon_start=1
                     /product="NADH dehydrogenase I flavoprotein 24kDa subunit"
                     /protein_id="XP_005538466.1"
                     /db_xref="GeneID:16996658"
                     /translation="MAPFPRVGALGIVRQWFSHVRRGSGGYFEWNPRRALAGRSNVHR
                     DSEGNSEFTTFDFSEDNYKKIAEILKRYPVNYKQSAVIPVLDLAQRECGGWLPLAAMN
                     KVAQVLGMQPMRVYEIATFYTMFNTVPIGKYNVQVCTTTPCMLRGAYDILRACEEESG
                     ARAGGDSPDGLFHIMEVECLGACANAPMMQINDDYYEDLTPQSAKAVLKSFRDGNPLK
                     PGPQVARKSSMGIQGKTTLLEEPPGPSCRDL"
     gene            complement(460139..461826)
                     /locus_tag="CYME_CMR189T"
                     /db_xref="GeneID:16996659"
     misc_RNA        complement(460139..461826)
                     /locus_tag="CYME_CMR189T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461612.1"
                     /db_xref="GeneID:16996659"
     gene            <461178..>461819
                     /locus_tag="CYME_CMR190C"
                     /db_xref="GeneID:16996660"
     mRNA            <461178..>461819
                     /locus_tag="CYME_CMR190C"
                     /product="probable ER lumen protein retaining receptor"
                     /transcript_id="XM_005538410.1"
                     /db_xref="GeneID:16996660"
     CDS             461178..461819
                     /locus_tag="CYME_CMR190C"
                     /codon_start=1
                     /product="probable ER lumen protein retaining receptor"
                     /protein_id="XP_005538467.1"
                     /db_xref="GeneID:16996660"
                     /translation="MNLFRLCGDLSHVVSIVLLLLKIRATRSCVGISLKTQFLYLVVF
                     VTRYLDLFVTFISLYNSVMKVAFISTTAYILYLMFFKFKHTYDKDHDTFRIQFLIAFA
                     AALAFVTPHRYSLLEVLWTFSLWLESVAILPQLYMLQTTGECENLTSHYIFALGLYRA
                     LYAVNWVYRYSTEPGYWQPVTWIAGILQTALYGDFFYYYVASRRRGKRLKLPT"
     gene            complement(<462204..>464030)
                     /locus_tag="CYME_CMR191C"
                     /db_xref="GeneID:16996661"
     mRNA            complement(<462204..>464030)
                     /locus_tag="CYME_CMR191C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538411.1"
                     /db_xref="GeneID:16996661"
     CDS             complement(462204..464030)
                     /locus_tag="CYME_CMR191C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538468.1"
                     /db_xref="GeneID:16996661"
                     /translation="MEVPAIGAQLFEANRQYYRALLPSHISYHLDEAGREFLYDSRLD
                     RTRWLWERRKLPNPAAADAGRSLTVYVNCVDGRRAPAPPIFRPGAKQDGDGSGKSLSK
                     TETTCLAAGGLAEAVTQRERTGSRDNRLQAQPAGPKLQATAPKVSEKAGISLGNHAFF
                     PKAMTGTRVPDRRGIADMPQRPAAHPLGMTPLQAASALSGNDAAIYPLENQLGNHHLR
                     AGWDPVSPDTLLRHQSGSPMHTPSAHAEASRRRARAERFREHLKCGQRLEASQLIVSK
                     DNSRASLQQTDAHAHRLVGTSAVLEKTYLRLTKEAQADQVRPLSVLETAFAQLMSRWE
                     HGSIDYTFLREQLKAIRQDMQVQGLGAEHRLAFDVYETHARLAIFHDDVAELSQCLSM
                     LKSLFQASRSEYRSNQREFLSYSVLLALYTGSLLDVRLILRDEDLLGDAAAETVAESS
                     AARDTIDLWSTTVQLVLALARHDYFSFMRIRKRLPPTARHLVSWFDTRIVQQVLNAVQ
                     TAYRPSVPLGFIEELVDLNPEDSSIPERRSPHRASVKQHRNSTLHPERCSSLEQILTL
                     SGAQVSADGQALICNRRPPAQTQIKPQSAPANAPSPRNLSSE"
     gene            complement(464099..466291)
                     /locus_tag="CYME_CMR192T"
                     /db_xref="GeneID:16996662"
     misc_RNA        complement(464099..466291)
                     /locus_tag="CYME_CMR192T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461613.1"
                     /db_xref="GeneID:16996662"
     gene            <466685..>467764
                     /locus_tag="CYME_CMR509C"
                     /db_xref="GeneID:16996694"
     mRNA            <466685..>467764
                     /locus_tag="CYME_CMR509C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538412.1"
                     /db_xref="GeneID:16996694"
     CDS             466685..467764
                     /locus_tag="CYME_CMR509C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538469.1"
                     /db_xref="GeneID:16996694"
                     /translation="MSLSVTEWCAEAGSRGVHEPSASAVGEAGTASCSYRADETLATQ
                     LITERCAVPGESHAPVDGTNDPESVNATASSDEGRNRKLSLISTSCGSDYGEQGELQE
                     PLAGSGDAGLLQGVCERCRAVHDRSYGSGRFCSVQCARKVAAKAKWERHRSQRRATVP
                     HETSKGSTYKQVTERPGKEHPHKRWRTCALSRTHQDAGRQALIASDALLQRTRSPHIL
                     GRLYPATAPGIYLPYSWTHLDALLHQQPKHGLHEPEAVQQGELGSNGWPLPGHACTAA
                     AAAATATATVSRGIGQVPLPPFSVAFRRHCAQSTQHLCRSVQPLHCREQNLPSFEKVL
                     RFAKAMPSIWSVQTTYLRDPFRYTI"
     gene            complement(<468800..>470293)
                     /locus_tag="CYME_CMR193C"
                     /db_xref="GeneID:16996685"
     mRNA            complement(<468800..>470293)
                     /locus_tag="CYME_CMR193C"
                     /product="similar to ribosomal protein S6 kinase"
                     /transcript_id="XM_005538413.1"
                     /db_xref="GeneID:16996685"
     CDS             complement(468800..470293)
                     /locus_tag="CYME_CMR193C"
                     /codon_start=1
                     /product="similar to ribosomal protein S6 kinase"
                     /protein_id="XP_005538470.1"
                     /db_xref="GeneID:16996685"
                     /translation="MGNQPSSSEARHSRSSGELARIQRKLAGQSARSAPRKPKTSSHE
                     SLRDQAYRGTGLEAGGTRKPLEAPTPVVISQPGATGTAAGGKPRAERPCCAARDLSQA
                     AYGLNASSPPQKSSMIFGQARVTREDFMPLKTLGRGSFAKVLLVRKRDTGELFAMKIL
                     SKKAIMARNQIEHTMAERLILGNVQHPYIVALRYAFQTEDQLYLVLDYCSGGELFFHL
                     KREGRFPESTVRVYIAEITLALEYLHARNIIYRDLKPENVLLDREGHVLLADFGLSKL
                     LQDNQDKAMTYVGTVEYLAPEVITAQGHSFAVDWWAMGTLMAELISGLPPFYSTNVNL
                     MMERILKAELRLPEYVSPEARSLIAGLLTRDPSKRLGSGANGAAAIKRHPFFSGLDWD
                     ALMQRKIPAPFQPVRSDAPLDSTENFDTSFTDEAPTFDTSAEEERVRAKLLQKAAHER
                     MQATASLPPANRSATDALNVLDGNLIPWTKTPGKVFEGFTYVPHHGT"
     gene            complement(<471208..>472188)
                     /locus_tag="CYME_CMR194C"
                     /db_xref="GeneID:16996695"
     mRNA            complement(<471208..>472188)
                     /locus_tag="CYME_CMR194C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538414.1"
                     /db_xref="GeneID:16996695"
     CDS             complement(471208..472188)
                     /locus_tag="CYME_CMR194C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538471.1"
                     /db_xref="GeneID:16996695"
                     /translation="MLAGEAFERAEPHLASGISRLLLSQWDQAQEDRERLRDNRYAIE
                     RMLRPRRTRHACSELDIHLATVDGDGWDCGYRNLQMLLSALVKGLVQTTHNATYSASG
                     QGPPATPWRTGQVPNVLAIQEALEIAWSCGFDEMDRSHFYEPLRGSRQWIGTSDAAAL
                     LRYWGIDVRLVDSDPQFQSERESRHQSLMRWALQYYVRRCARAGGCIVCRQSGRSTAR
                     ASDGDVSNARAVHAGSKRNDWIPPLFFQYAGHSVTVIGVEIDLRRNESCLLLIDPSQG
                     VSCGRPRIRAWTLQDLQAVQYQVLYIHECVFLDERTPMKQRQKLSSLRLV"
     misc_feature    472476..473477
                     /note="possible transcribed region"
     gene            complement(<475031..>475585)
                     /locus_tag="CYME_CMR196C"
                     /db_xref="GeneID:16996716"
     mRNA            complement(<475031..>475585)
                     /locus_tag="CYME_CMR196C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538415.1"
                     /db_xref="GeneID:16996716"
     CDS             complement(475031..475585)
                     /locus_tag="CYME_CMR196C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538472.1"
                     /db_xref="GeneID:16996716"
                     /translation="MTGTGFASVVAQRHAVQWLLRWRHGGTETRVARQLPHQWLQHAA
                     ASRSRRQQRCLCARASGSSDGDEPKTSPQVSAVRVDRSLVERTARLANLEYSEEELEA
                     LVPAFQGMLQFVETLRLAESADESEAESTVWTPTSARSWRDLRPDVVTEFGDREAIRA
                     QFPAREHDLLRVPRVIGGDGDESQ"
     gene            <476036..>476389
                     /locus_tag="CYME_CMR197C"
                     /db_xref="GeneID:16996717"
     mRNA            <476036..>476389
                     /locus_tag="CYME_CMR197C"
                     /product="RNA polymerase I, III common subunit"
                     /transcript_id="XM_005538416.1"
                     /db_xref="GeneID:16996717"
     CDS             476036..476389
                     /locus_tag="CYME_CMR197C"
                     /codon_start=1
                     /product="RNA polymerase I, III common subunit"
                     /protein_id="XP_005538473.1"
                     /db_xref="GeneID:16996717"
                     /translation="MTSAAAGNHSPHSGDASLELDGKDVHIQENADRTELVLTLRGEG
                     HTLGNALRYMLTREPGVQQVGYTIPHPSEDCLKLYVVSKPGSRALDSVKLALFHLTQL
                     CDIVGEKYEEAFMKT"
     gene            complement(<477653..>478756)
                     /locus_tag="CYME_CMR198C"
                     /db_xref="GeneID:16996718"
     mRNA            complement(<477653..>478756)
                     /locus_tag="CYME_CMR198C"
                     /product="3'(2'), 5'-bisphosphate nucleotidase"
                     /transcript_id="XM_005538417.1"
                     /db_xref="GeneID:16996718"
     CDS             complement(477653..478756)
                     /locus_tag="CYME_CMR198C"
                     /codon_start=1
                     /product="3'(2'), 5'-bisphosphate nucleotidase"
                     /protein_id="XP_005538474.1"
                     /db_xref="GeneID:16996718"
                     /translation="MSWSLFVGHRLRHELECAVDVVGRASRMAREIQRHYCDAGASTN
                     QATTVAKADASPVTIADLAVQALILGELHAVFPQDRFVAEETSGSIRDAAMEHGIRSW
                     LAQHARHGVEERVRASIDLGADAGGAQGRIWVLDPVDGTKGFLRNQQFCIALALLVDG
                     SAELGVLGCPNLSAAQEAERVVSTYTQGAADEKCLTIVNGPDGCVFFAARGAGAFMKS
                     LVQDPGQALPRQIHVNGNADPSWAIMAESVERGHSSHTLTGKIIRILGIRQRLGVDSQ
                     CKYGLLSRGEACVFLRFPRVDYVENIWDHAAGAVVLKEAGGLVTDAFGNELDFSRGRK
                     LLNVRGIVATNGHMHPAVLAAVRHVLAEEEACG"
     gene            <479991..>481937
                     /locus_tag="CYME_CMR199C"
                     /db_xref="GeneID:16996719"
     mRNA            <479991..>481937
                     /locus_tag="CYME_CMR199C"
                     /product="similar to transitional endoplasmic reticulum
                     ATPase"
                     /transcript_id="XM_005538418.1"
                     /db_xref="GeneID:16996719"
     CDS             479991..481937
                     /locus_tag="CYME_CMR199C"
                     /codon_start=1
                     /product="similar to transitional endoplasmic reticulum
                     ATPase"
                     /protein_id="XP_005538475.1"
                     /db_xref="GeneID:16996719"
                     /translation="MHWVILTADRTAAQSSTSGGRCLERTLRTTDPLPLNSSLIKHLL
                     RKQSPDPRAKRFVLRSPFENHSIALRVLRRSDTSPASWDEVDVVYLAPELVLDRVVSD
                     EAAAVLRCDPSITHLKRALCTQRALTPPAPVLLVDCFGPGVYVHDALCWLQRADDTRA
                     WMEPALILRLQAATLWSSGSDAMELLSSLERLLNEPAFHATPALLVVDDVDIVVEQHA
                     FNGVLVHLETIRDETPVPLLLVRYLDRTTEPAPAVESLLGERGLHVEVSQPFENPAQW
                     RDLCEVNKASATCDFGPNHVEHATWQQKMSAEIPMSPANMLYGGYIPWPQPQHQHQQP
                     PQTSCSISEHDDHADQVYIVPRRSWHELSRLIAIMNSRSWPSTDTIAVRPTGALLYGP
                     PGCGKTALLRQMMAVFRTSDFEFVTAADVSRALVGESERLLGARFTGRARGMRLGMLV
                     FDEADALFPGRHVPNAGLKHLSGALLEHLDKLRRSDHRLLVFLATNRPWQLDRSLFLG
                     DKFDCLLYLGPPGPSCRAQLLRRLKLLPAGTTCDGDLLVARTAGFSYADLLSIRSRMQ
                     RTHKSALETVSTIQPSVSREERMRFEHWNTMLQSYGVEILEPSSEEALDPLPWDAQAE
                     DARVRQVASEVAYRGVCEQRTHSY"
     gene            complement(<483455..>486103)
                     /locus_tag="CYME_CMR200C"
                     /db_xref="GeneID:16996697"
     mRNA            complement(<483455..>486103)
                     /locus_tag="CYME_CMR200C"
                     /product="similar to Golgi associated retrograde protein
                     complex component VPS53"
                     /transcript_id="XM_005538419.1"
                     /db_xref="GeneID:16996697"
     CDS             complement(483455..486103)
                     /locus_tag="CYME_CMR200C"
                     /codon_start=1
                     /product="similar to Golgi associated retrograde protein
                     complex component VPS53"
                     /protein_id="XP_005538476.1"
                     /db_xref="GeneID:16996697"
                     /translation="MTAQELSASNVLSRLSHEDAAVAQTATEAADSSLPDDVPEEPGA
                     EPVTTYINRHFPSLDTLDQLETHLDELRTKLRALDAELVHAVRHQLHVRRQGAAVIKH
                     AQERSKLLDAALAEVERSMRTAAETLTESAEQFRPIANVRHNLLQARAHLKAFVRLAK
                     ALRDMESTMAAQDMTETAEHVRQAREALAELHTLPAIPLLDELQQRYRSLEQHLSRMV
                     VALFGETSDTSQRAEYRAGCILADALENGTREAVLNAFVVRRVRLYEEVFGARDSDLT
                     PIETFERSFAWIRRELRSLDEHWSAVFPESWRVPMALSGALSDALRRIAHRDLEEGKV
                     DVAQLLRALQITLEFEAEMVRRLNTPLTWNLSSVFEPYMGAYVTLENQRLREAIDGAL
                     EKETWLVPALGQRAAAAAAAAAPEYPDESIVLPSAKTLFIEIKRCMKRCGVLTTSQTY
                     FNLHKAFKKHLRDYASAMERELLRIRSTATTTTTTTTTSNSSTSTNSNSKSTTSTAAV
                     SADAGITESQEQVLTSVCSLSLTAEYCARTTEQLAETIRQAVDAAFTDSIRMNEERDE
                     FRAIAGRAGKVLVALTCAWALEPALHTLQAQRWSQVTAVGDVSPAVTALVTKLERVSR
                     HVGRQLLPLFFRFYLDKLSGSVLERFTETLFRCKPLSDAAAQQLLLDTQFLKEGLLKL
                     IDCRSPSVERDDPWFSSYQRYVRSECGRAETMLKVRLASDDSAVDAFEALMPEAEPSA
                     LRQILEWKGLPPLEAARQVVQYAERTGDPVLVHKARSEMEHLDTSGHRAANLQRQSKA
                     LFERSTTTSALVVDNAMAGRSVPPGSFSDTSTSLRGDASKPSTEVRAFLNRLGERLRE
                     VRLGDKLESTLDAVGRSRDRRRRSNS"
     gene            <487342..>487572
                     /locus_tag="CYME_CMR201C"
                     /db_xref="GeneID:16996698"
     mRNA            <487342..>487572
                     /locus_tag="CYME_CMR201C"
                     /product="probable mitochondrial ribosomal protein S21"
                     /transcript_id="XM_005538420.1"
                     /db_xref="GeneID:16996698"
     CDS             487342..487572
                     /locus_tag="CYME_CMR201C"
                     /codon_start=1
                     /product="probable mitochondrial ribosomal protein S21"
                     /protein_id="XP_005538477.1"
                     /db_xref="GeneID:16996698"
                     /translation="MALTVRVLKGHNELAFRLLKRKLADVGLTKELRRRLTYEKPSEK
                     RRRIEHEEERRQARRALQHNLRFILSRMARGF"
     misc_feature    complement(487416..488646)
                     /note="possible transcribed region"
     gene            complement(<489843..>493766)
                     /locus_tag="CYME_CMR203C"
                     /db_xref="GeneID:16996700"
     mRNA            complement(<489843..>493766)
                     /locus_tag="CYME_CMR203C"
                     /product="vesicle coat complex COPII, subunit Sec31"
                     /transcript_id="XM_005538421.1"
                     /db_xref="GeneID:16996700"
     CDS             complement(489843..493766)
                     /locus_tag="CYME_CMR203C"
                     /codon_start=1
                     /product="vesicle coat complex COPII, subunit Sec31"
                     /protein_id="XP_005538478.1"
                     /db_xref="GeneID:16996700"
                     /translation="MGILGEVHRLGVAAWAPSESLCGSWLAVAGLADPGARCRAQLEV
                     YDVLGGAAAQRAITSVKSQDGSELRARGIFETSEGDGNDAFRSLGAAAGFAALRRVGG
                     CELSIGVRQLAWGAAGRGAYSSKGLCAAGLDNGTVQLWDVEALEAPESNASTALVFGQ
                     STQQQQQQQQQQQHHGPVTALDFNPFVPTLLASGGPENLVLIWDLNEPRTPAVHATAS
                     NETDATGAAPGVQTAALLGAPSQVGCLQWNNRVQHILAAGLGNGNTVIWDLKQQRPVL
                     GFSDPTARTRVSALAWNPEVATQIAVASDDDRNDVVKVWDLRNVHAPLRELHGHQRGV
                     TALSWCRQDPALVLSAGKDGRVLCWNPLVGTASVDADVVFELPLSANWSFALQWSPAI
                     PGLFFTCDLGGLVTVFSTADRVMAGAGAQSYAGSRDQQLAPTDRLLRESFGNAVFEGQ
                     QYAGVDPAADGYQTSQLSVLNYAPKWMRPPCRAVFGFGAQLAYVVEQPPAGFVLQLEY
                     ALEDLGYVAEQAIRLVQPGYDLYQHCVERAERASSADDAQVWRTLAALFVYDSRRALV
                     EVLCGPNLVPSTPQMLEANAHIVGLAASVPPLQLHRVAPVLTEAQVAEAEAAAAVAQG
                     SVVDAASAAAAAVAAAQLQHLSPARAQTRDWTKAETTPVPAPWDASAPWEQTPHQDTG
                     TESVLDAPSSGAAAATEHDTSAAWPASNESGWSTAGAGAGAASPEHANAAAEQTSLRA
                     LLIRGQLSTAAERCFEQGQEAEALLLASCAGPVTWTRTLSASIHRAGIQDATTKAILS
                     SLVLGRFDELISHASDTDWRDLLALLLLQGTYADIVTGCTRLAERLHSHDTTAALVCA
                     LCAGDVPLATRLWMEAGFRGYELLERMLILRQALGFGAPSGAATAVPLAAEALQVVEQ
                     IATALVERGAVQLASAFLQELGVDGELTDRVKQFLGYAASGFDKQSRQPGASQRPVWT
                     AAMQAAPHMSSAAKPPQLTFTSTTSGYPNANDALRSGTLSAAPAPAPAPAPGGVGASI
                     RSGGTRPAANGYLPPATAPMTAPPVDTRARLPAVATSAAATAATDLSSAHWKSSETHA
                     TWMKQLDAAPVQTAYERSAGVSSAAWLPNKHPPGTSASATWHTAGDTAGAEARQAVHA
                     VAAGPPTLTSKALAGNTSQADRLNAVSSPATSASGSVDRAGDVSVLAVDVAGMPAVPR
                     QVALTLQRIYDECAKRAISSIERKKIQDIDRKLGVLLTRLKRGEITGDALAKLHRLCQ
                     ELEQHRLNEANVIHTELTREHYDGNSIWIMALKRLLEVAARVGIA"
     gene            complement(<495610..>496089)
                     /locus_tag="CYME_CMR204C"
                     /db_xref="GeneID:16996701"
     mRNA            complement(<495610..>496089)
                     /locus_tag="CYME_CMR204C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538422.1"
                     /db_xref="GeneID:16996701"
     CDS             complement(495610..496089)
                     /locus_tag="CYME_CMR204C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538479.1"
                     /db_xref="GeneID:16996701"
                     /translation="MLKDPLALFLRRVVFRFVDAPPVHLKLRSLPRPRPLPLFFLFLC
                     SYMLLTGGITYDIIVGPPSIGQRRDPRTGVLVPVAVAQGQLTSQYVIEGIFASLTHGL
                     GVVGLVILDQTHKSRIFGAGERGFGYVLGFSCTAIAMVLQRVLMSIKLPNYLRFPDD"
     gene            complement(<497092..>499074)
                     /locus_tag="CYME_CMR205C"
                     /db_xref="GeneID:16996702"
     mRNA            complement(<497092..>499074)
                     /locus_tag="CYME_CMR205C"
                     /product="asparagine--tRNA ligase, chloroplast precursor"
                     /transcript_id="XM_005538423.1"
                     /db_xref="GeneID:16996702"
     CDS             complement(497092..499074)
                     /locus_tag="CYME_CMR205C"
                     /codon_start=1
                     /product="asparagine--tRNA ligase, chloroplast precursor"
                     /protein_id="XP_005538480.1"
                     /db_xref="GeneID:16996702"
                     /translation="MGFHRYFTAHGNKKNQRERREKAHHRRTLAYGNALSVKKHGGAP
                     IVDRRHHQRAGHSRTHRRHALHVHHALGAGACARNVDTVSTTRLKQVLNSGVQNLSRM
                     LAFLGTTTVSSSRRSRVQQFCGHLSGSRVSVFASGFLSRDPSQLQRSRHERVNGTLVR
                     AYARQRLALTRLCVTSTPAQTSTVGTLDEHKAPPAEKQRVRIQRLFEEAAHFLQPANS
                     FVVIKGWVRTARDQKQFAFVQVNDGSNVSGIQVVVDSSVPSFDKVASLATGCSIAVSG
                     YVRKSPGAKQPIEVQATSVELLGPVASNYPLQKKRHSFEFLRTIAHLRPRTNSFAAVA
                     RVRSALAAATHAFFQSRGFIYLHSPIITASDCEGAGEMFRVTTLPPGATEEQADFFGQ
                     RASLTVSGQLSAEAYACAMGDVYTFGPTFRAENSNTKRHLAEFWMIEPEMAFASRDDA
                     MKNAEEYVKHGVSFLLETRMEDLQFFDQFIEKGLVRKLEQVRDLAFARVSYTEAIEIL
                     SKATEKFEFTPEWGSDLQTEHERYLAERHFQRPVFVFNYPACIKAFYMRVNDTEPTTD
                     GRRTVAAFDLLVPGIGELIGGSQREERYDVLCSRMQELGLSEEQYWWYLDLRRYGTVP
                     HAGYGLGFERYVQFCTGMENIRDVIPFPRYPGHCEF"
     gene            complement(500266..503683)
                     /locus_tag="CYME_CMR206R"
                     /db_xref="GeneID:16996703"
     rRNA            complement(500266..503683)
                     /locus_tag="CYME_CMR206R"
                     /product="28S ribosomal RNA"
                     /transcript_id="XR_002461614.1"
                     /db_xref="GeneID:16996703"
     gene            complement(505482..505635)
                     /locus_tag="CYME_CMR207R"
                     /db_xref="GeneID:16996704"
     rRNA            complement(505482..505635)
                     /locus_tag="CYME_CMR207R"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_002461615.1"
                     /db_xref="GeneID:16996704"
     gene            complement(506489..508279)
                     /locus_tag="CYME_CMR208R"
                     /db_xref="GeneID:16996705"
     rRNA            complement(506489..508279)
                     /locus_tag="CYME_CMR208R"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_002461616.1"
                     /db_xref="GeneID:16996705"
     misc_feature    complement(513085..516165)
                     /note="repetitive element"
     gene            <516742..>517506
                     /locus_tag="CYME_CMR210C"
                     /db_xref="GeneID:16996706"
     mRNA            <516742..>517506
                     /locus_tag="CYME_CMR210C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538424.1"
                     /db_xref="GeneID:16996706"
     CDS             516742..517506
                     /locus_tag="CYME_CMR210C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538481.1"
                     /db_xref="GeneID:16996706"
                     /translation="MMPESATLRRVACTRCLSPRCLLLCSLTLLFFLLRRMTVDIHIL
                     KELDGQHRALSNRCLKPLIHFPELHALFQLSYGIASIVKRLAILGRECIRPAEISDGS
                     CKPGNGQAFEPEQGLQRVCTKLLPLIPTWRQAIVNEWTSATTTTYGTPSRLYERGQPA
                     SEAGLELRLVDHCHATLDLGPVALDRRTRVLARSVGKRTAPETAPLLQFSRAVFGLSC
                     CDDLMRSNESTHRLATLVRDRIPDAAVVCCIASSEK"
     gene            complement(<519773..>520942)
                     /locus_tag="CYME_CMR211C"
                     /db_xref="GeneID:16996707"
     mRNA            complement(<519773..>520942)
                     /locus_tag="CYME_CMR211C"
                     /product="similar to dnaJ-like protein Jem1p"
                     /transcript_id="XM_005538425.1"
                     /db_xref="GeneID:16996707"
     CDS             complement(519773..520942)
                     /locus_tag="CYME_CMR211C"
                     /codon_start=1
                     /product="similar to dnaJ-like protein Jem1p"
                     /protein_id="XP_005538482.1"
                     /db_xref="GeneID:16996707"
                     /translation="MRDQGYFLTPFDLRENLCGPEKDTLVSHERPRLHQRSAERCCSA
                     AVATGVVARVAQPASSPAGAWRQPRRNPVGDRARSAAVERASRTVRVRWTCVHQLRIQ
                     ILGASSDPWYRMATKEASAGARPVSGPASGSTRPPQADLGHVSEAASASGPRRDGTLL
                     QSGENSSAVSSEKVSKPSSALAVGAFLIFGAYAAGVVGFRYSRFAVGKEIHRGWGNYQ
                     RYSRERLEREILERLQRAAQHNWAEKEARRREAFMAAEERARRELFRRYLEWERRFRG
                     GVQSEAFSREEQPETPPRAAPGTHYATLGVSPSATSSEIRKAYLERAKALHPDSQHST
                     LREAVQGSADADRKRPLTAEERHSAFQKVVEAYQVLSNPESRRKYDSDVLSSWRR"
     gene            <520859..>523654
                     /locus_tag="CYME_CMR212C"
                     /db_xref="GeneID:16996752"
     mRNA            <520859..>523654
                     /locus_tag="CYME_CMR212C"
                     /product="similar to vacuolar assembly protein Vps41"
                     /transcript_id="XM_005538426.1"
                     /db_xref="GeneID:16996752"
     CDS             520859..523654
                     /locus_tag="CYME_CMR212C"
                     /codon_start=1
                     /product="similar to vacuolar assembly protein Vps41"
                     /protein_id="XP_005538483.1"
                     /db_xref="GeneID:16996752"
                     /translation="MRDERVFFWTAKVLPQVERSQKIPLITHVVSSGASLYLAGTEAD
                     QTAAVYRLRLTEGRWRVEGKWCLLAPNSGVKAKTPRLADLCVNDADTVLAAVCVDGWL
                     YVERAQDIGGKRLRAHRAHDQLRAVALDPNYDTSLPRSSLRVVVGGDQGELALYGESW
                     LGLSQTAVLYRSREAITNIAWHAHFISWATLSGTVRVYDSDRHAGVCSVEPPASLGQQ
                     TLPPRARLQRTRLFWTSGRQLCISWWYRGANEDLEHDAQEQDPEACVAIRVLSFNENP
                     PEEATNAILVQTQWSCCRSLFQNGFQLRLVAPCSENSADLLFVSSRMRARPAEDSDSG
                     MPSDAEALERLDEDANFAAGTLELCMQLYAYQQTESEEKKEGSRFVLANEQLVAFEWP
                     PAATSAAAPVQLPRSRLLSAWSRKACALFMLYAEAAVSTEATEAPWLPVIVQVRPCNI
                     VEQVRWLHAQHADASAVLALARLAVQTDAQALSAEELASLADAFLEAHWEHCSAAGTP
                     TAEHDEIAARIPEALEWWNAPTWLWEKWIRRLLAVGRGALLVSVIPTQSPVLERQVYD
                     IIFHQLIDKPEPGMLYAAQNWPLEIFSVDELIEALERRLQQVRTAPDASSRRAMLIMT
                     ESLSALYTRSGRTEKTLFLILEQDGTAVFSYIRKHRLFAAARQCLGALFALDAAEAAR
                     TLAMASPLELSIDDVLGALEPADSLNAMLYLEEVFRQAPDLLHVPEHHERLLELLVKH
                     APERILALLQSEDCFCRPQVARSILARAETPDRQFLRERALLHALQGDLLEALKILLE
                     GEMEGDALELARQQASDAAPWGFLAAHMRDPQRLLLVRECALSRSQVLMTIGERRLAG
                     EAIKLETPVIREAYYHLEEQRQCSHAVSELLKQRIHKLEQAYASALFDDLVLPPTVAT
                     DLKGHLSVSERNVVELS"
     gene            complement(<523651..>523983)
                     /locus_tag="CYME_CMR213C"
                     /db_xref="GeneID:16996753"
     mRNA            complement(<523651..>523983)
                     /locus_tag="CYME_CMR213C"
                     /product="mitochondrial intermembrane space complex
                     subunit Tim9"
                     /transcript_id="XM_005538427.1"
                     /db_xref="GeneID:16996753"
     CDS             complement(523651..523983)
                     /locus_tag="CYME_CMR213C"
                     /codon_start=1
                     /product="mitochondrial intermembrane space complex
                     subunit Tim9"
                     /protein_id="XP_005538484.1"
                     /db_xref="GeneID:16996753"
                     /translation="MQASTAGLSAEDERRMMAVLQELQIQDSMRLYNELVYLCFNNCV
                     DSFRSSKLEAKEEACVTKCAQKFLKLAARAGQRFAEQQQQFLGGGSDGGAGGSSSSSS
                     SDGSALSR"
     misc_feature    524223..525119
                     /note="possible transcribed region"
     gene            <525540..>526904
                     /locus_tag="CYME_CMR215C"
                     /db_xref="GeneID:16996748"
     mRNA            <525540..>526904
                     /locus_tag="CYME_CMR215C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538428.1"
                     /db_xref="GeneID:16996748"
     CDS             525540..526904
                     /locus_tag="CYME_CMR215C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538485.1"
                     /db_xref="GeneID:16996748"
                     /translation="MFTGYYVAADWKRKAQRQRQCWKRRFTTTWRRGALTPDCQQRTA
                     AASRCAQSAAIRAIICMVSREEPVRDLVSDASDSTRTRSAGPAIGAAEKRKASRASAL
                     DPYQTTSARSGSANALLDAVPWLALHLATVLWGTQHAVIKQLVDGGFDASVLNMERFG
                     IAASVSVAAAAGLHILDSWNTSRRPGRRKAQQFPQNWRFWRRILETWSGALELGLWMF
                     LGYACQSIGLTDTSASRSSFLLYLNVKIVPFLAAVLLRRRIPRVTWLAATIALFGTLM
                     LSFDGAPPNAGDAWSVAAAVASAMFILRLERVASQMPPATMNALSLTTVTILATLWSA
                     FRFDDSGRPVFDWAMLGSAAQHITDPAILYLGLAATALSGLLQAFGQEHISAERAAII
                     YALDPVYAAAFAYLLLGETLGPRGILGAAIVFIAALLSQGAIRSWLSDRLETRAENGK
                     LNDS"
     gene            complement(<527151..>528212)
                     /locus_tag="CYME_CMR216C"
                     /db_xref="GeneID:16996749"
     mRNA            complement(<527151..>528212)
                     /locus_tag="CYME_CMR216C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538429.1"
                     /db_xref="GeneID:16996749"
     CDS             complement(527151..528212)
                     /locus_tag="CYME_CMR216C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538486.1"
                     /db_xref="GeneID:16996749"
                     /translation="MPLVEDAAEAAEEAFKRYPFDTDEAWQRFRRAAEVTAPSAEVEE
                     RLRRAFFRRYIDPSLPLKPQSSRAVPADAAAGERTQFARTYSNDWRQRTWKCVQACRQ
                     AAWAGFQRSGASDLGPVLDLCILVAATGTFWMGTGPLVGWTWVGVFLSLAWTCYQSWQ
                     RLPREWPGRVRLERALASADLIPRLFFVSVGVQLHHPVALRLAMASLITTFVYDRLLP
                     LFESATASAQVLRWFLAPTKQRHLAAYLRQHESRARLLAAYAEAALFIFLLASIFTPQ
                     RSFLAVLVLYRYLQLRYLSCPFTRLVWQHIEMQLDMWSTWLPPTLRELYGRAKTVLMQ
                     MVGATRLQTPTASTSTRHH"
     gene            complement(<530037..>530951)
                     /locus_tag="CYME_CMR217C"
                     /db_xref="GeneID:16996750"
     mRNA            complement(<530037..>530951)
                     /locus_tag="CYME_CMR217C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538430.1"
                     /db_xref="GeneID:16996750"
     CDS             complement(530037..530951)
                     /locus_tag="CYME_CMR217C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538487.1"
                     /db_xref="GeneID:16996750"
                     /translation="MLHATRDALKRCSGALWSWSAAQVRQLQPLSRQACAMRCVCGTR
                     SVYRLPLHQTSCSRDCGARSLRGTAEDERVSGQLDSLLWSRLVQTVSAKDSEQDAAVA
                     RDPDNVGSSTPPPPPPPPPLSSVPLWRQLKIRWHLLQLQRVWPPPVFSPDEFLKGAQF
                     AFQRVCAALIEKDIDALGDAVSDQVAKALRETIEAYERENMNVTMQVEQVGGAQIVNT
                     YGRYDFERRLFVDIDVEFVACFSTIWKKPDGSLLKHEQNVWRKPVWCFEALLAERIDS
                     PSSGLGSIGMPQMRIAPEPEWQLVHILN"
     gene            <533181..>535265
                     /locus_tag="CYME_CMR218C"
                     /db_xref="GeneID:16996751"
     mRNA            <533181..>535265
                     /locus_tag="CYME_CMR218C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538431.1"
                     /db_xref="GeneID:16996751"
     CDS             533181..535265
                     /locus_tag="CYME_CMR218C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538488.1"
                     /db_xref="GeneID:16996751"
                     /translation="MRACWRAVWSFGVLAACLRGEQRHREAAFAWLCAAQSAEAESAL
                     GWPLPRATTTQPLDWLTRPSLGSLLDSAPANQVLLRFWAARELFDYLVTLQHAGLLRC
                     SEGRGFAWKPGARFELLEGALVERQFREACIQEDVACLRTILVRLQVTLQHEQTLRAA
                     LLRPVQRLSAEVLLLHVHSMHVSAAVMIGDSAGARQAIRDAIRILEGPDADGALQQTV
                     DLTAWRTHFWLEWIRLVSVESGLQAALAECDVAEAAGADPECIHRSRQEIVFAVSLTH
                     EKRCPAAPDEGLPLQLDKRVKAQPEEIAGAGMPETLKRFWMIGLSLLHEHCSFMLAPS
                     AVSALSSSAETLSVSNSMDAAKMRREHDLPCSACPAESDSVPVHTVSVEKRSSWRSLP
                     TWQTDPDYDSLAELDEDIGRQQVRKTPIRIGFAEALAVASTAAWSARASLQSYELVKC
                     AESLLVLAQATHWLYRLTLTMPSFWFWSSLGRIATRAAAEWLLGRAADLRALLKQSSG
                     WTELHRRAGSSSLSRFLTLHVLETFEQSTDAKPSRTLSHDLRNAVLSLQENNIIVAKT
                     LLEPWLDTVESPASYEHALACFLYAQTLSMLGIYEEKASLYLELAERASMAGNYRILS
                     YAIDQLRARTGNHYALETTNAGTAGSLLRSREQAEQEIWSFLEQNPAICEQLAGALQM
                     ASTLVERDTSTP"
     gene            <539907..>540584
                     /locus_tag="CYME_CMR219C"
                     /db_xref="GeneID:16996742"
     mRNA            <539907..>540584
                     /locus_tag="CYME_CMR219C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538432.1"
                     /db_xref="GeneID:16996742"
     CDS             539907..540584
                     /locus_tag="CYME_CMR219C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538489.1"
                     /db_xref="GeneID:16996742"
                     /translation="MSDATAFREELSFLESGTRVLQEQFIEIESLWSQVGALERCVCD
                     STLYVRKWLRELAAHCPVADEATLTALFERVNEAARVSSGGSGTASAVAVGTTVPKDP
                     RDSGLLAARSGPAAKESLREAGQRAASSALKVCSKAERDRKEVRKLLSKLENQRLRTD
                     PQLEAVLMLLWRNRPAGLYVHDLMQETRLSRMRLNTFLHALVKSGLVQKQARKGLIYS
                     LCREHCG"
     gene            <541666..>542919
                     /locus_tag="CYME_CMR220C"
                     /db_xref="GeneID:16996743"
     mRNA            <541666..>542919
                     /locus_tag="CYME_CMR220C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538433.1"
                     /db_xref="GeneID:16996743"
     CDS             541666..542919
                     /locus_tag="CYME_CMR220C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538490.1"
                     /db_xref="GeneID:16996743"
                     /translation="METPLLRALVRRIRTLGPLTVSEYMQTCALHPQYGYYQTGKDKI
                     GRKGDFVTAPEVSPIFGELVALWFMVQWRDWLQSPRQIRLIELGPGTGTLMKNMLQTA
                     RQFPEFYRALHVQLLEAGRPFQARQQSMLQAYVQERKVSWLDALDLDGFDASAGSDSG
                     PVMFLAHEFLDALPVHHFVRCQRIQQQQQQQQQQQQQQQQQPVAWSERLVDIVDGGET
                     NSPRLRFVQSRGITPAAALWTSHPLLRPMLEHEQLTAIEVPTGAMAVIERICRIMSQR
                     GGVALVVDYAKAAEPPLACTLRAVRQHRFEDPLVAPGEADITVDVDFDLLAKVAQATA
                     PALQVHVLSQREFLLRMGLQVRLQVVARKHQDAASRLFAACQRLIAPEAMGHVYQVMG
                     IASSIPNGNRAPYDVLFPFHARPST"
     gene            complement(<544267..>546015)
                     /locus_tag="CYME_CMR221C"
                     /db_xref="GeneID:16996744"
     mRNA            complement(<544267..>546015)
                     /locus_tag="CYME_CMR221C"
                     /product="similar to dolichyl-phosphate-mannose--protein
                     mannosyltransferase"
                     /transcript_id="XM_005538434.1"
                     /db_xref="GeneID:16996744"
     CDS             complement(544267..546015)
                     /locus_tag="CYME_CMR221C"
                     /codon_start=1
                     /product="similar to dolichyl-phosphate-mannose--protein
                     mannosyltransferase"
                     /protein_id="XP_005538491.1"
                     /db_xref="GeneID:16996744"
                     /translation="MHRHESAQQLPKNSRSGAQGTPDLSKARGKHIAMRPPLNRTTET
                     ASGSRGASLVEGDSSLRSNAEPYAALLDGVVLVLLTIFAALTRFWRLSEPKAVVFDEF
                     HFGKFVEAYFTGEYFFDIHPPLGKLLLALGAYLHGYNASFSYDQIGAEYPDKSYVGAR
                     TVAAVFGTLLVPLMYLVARELSLHVAASVLAAAWVLLEVATTIESRHILTDSQLLFFL
                     LLHFYCVLRLWRTRDGTRARWRWLYWSGISAGLALSIKWTALATPALAGVVSVFGSRA
                     LLRSQKRIPLWQCVFVGLLALALYTSFFWIHFRLLPRSGSGDAFMLPDFRAKLIGSPE
                     YNAAAAPVPFFRKFVYLNKEMLRANAQVPGRHHWESKWWSWPLNLRGILYWIQTKRAP
                     WAENPKTTRSAPAEANQHGTGVTPRSQYPVIEARVYLILNPVIAWSVLCSLLFFGFLL
                     AQNFIAGLGGFGDRAPRRLQTAELPKKQRRSQQKLYALGTYLFTGWLLNLLPYIGVKR
                     AAFLYHYLPGLLYGILLTALLVDRAPLARTGHYQLVTIGVLLAAAAFIYFSPWIYGLY
                     LTIEEQQKRRWLRGWN"
     gene            <547234..>548043
                     /locus_tag="CYME_CMR222C"
                     /db_xref="GeneID:16996720"
     mRNA            <547234..>548043
                     /locus_tag="CYME_CMR222C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538435.1"
                     /db_xref="GeneID:16996720"
     CDS             547234..548043
                     /locus_tag="CYME_CMR222C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538492.1"
                     /db_xref="GeneID:16996720"
                     /translation="MTNAFSEELALEAAGLDAIFGKDFKAEETTTGHVRWSVPLSHNG
                     VELELAFLLDSAYPLDSEPQVRVTCKEGLSLRAVRELEGHLQKVAAENRGSPSAYLLY
                     TAAQDWIDTHDRREAAEAISATIASTRLSAREPDSAGTGTTFETKAESFTQLVEHETL
                     EHATIDRTLGTPVTPETFAAWKQEFDKYLLENGILDIANNADIELDASQGGWKGNSRR
                     KPTGRELFTMHREMFVDDFEESDQCESTASGACDTQGSELAEHVDASLFLS"
     gene            complement(548398..551163)
                     /locus_tag="CYME_CMR223T"
                     /db_xref="GeneID:16996721"
     misc_RNA        complement(548398..551163)
                     /locus_tag="CYME_CMR223T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461617.1"
                     /db_xref="GeneID:16996721"
     gene            <553520..>558979
                     /locus_tag="CYME_CMR224C"
                     /db_xref="GeneID:16996722"
     mRNA            <553520..>558979
                     /locus_tag="CYME_CMR224C"
                     /product="RNA polymerase II largest subunit"
                     /transcript_id="XM_005538436.1"
                     /db_xref="GeneID:16996722"
     CDS             553520..558979
                     /locus_tag="CYME_CMR224C"
                     /codon_start=1
                     /product="RNA polymerase II largest subunit"
                     /protein_id="XP_005538493.1"
                     /db_xref="GeneID:16996722"
                     /translation="MDYDLQTFSSAELKAVGAVQFGLLSPDELRRLSVVRVEYDVAFE
                     RGVPKAGGVLDPRLGAIDRNFPCATCEGSSIDCPGHFGHIELVKPVFNVLMLSTVLKT
                     LRCVCYYCSRLLVDGSDSRMLRAARIKDPVKRFQAVFQLCNGTRVCGGGADSSEEQLM
                     LPAAVLEARERIGKPREGCGNLQPHVTRDGLRILAEFPDAEAFAAERKQELAAERVQQ
                     IFRHIRDEDLELLGFHPRFSRPEWMVLSVLPVPPPHVRPSIQMDAVSRGEDDLTFKLG
                     DIIKANNALQRLEAEGAPAHVIREQYVLLQFHVATFMNNDLPGMPRATLRSGRPLKSI
                     AQRLKGKEGRVRNNLMGKRVNFSARTVITADPQLALDEVGVPRSVAMTLTYPEVVTPY
                     NIDRLWEAVRNGPNAYPGALFVIRNDGKRIALQFVRRSADIVLEPGCVVERHLLNGDL
                     VLFNRQPSLHRMSIMGHRVRILPYSTFRMNLSATSPYNADFDGDEMNLHVPQSEEVRA
                     EIKELMAVPKNIVSPQANRPVMGIVQDSLLGCMLFTLRDTFLEEDTVFNLLLHLPHFD
                     GRIPAPAILKPRPLWTGKQIFSLLLPDGVNLERLSNGHPDHERTIMTPSDTRVLIQNG
                     ELITGIVDKRTVGSSAGSLIHVTWKESGPERTSQLISDIQLLINYWLMQNGMSIGIGD
                     CIADAHTMAAINRTIQEAKDEVRQLIRLAQEGRLERQPGKTMLESFEACVNRVLNSAR
                     DKAGGFAQESLLPSNNIKRMVSAGSKGSFINVSQIVACVGQQNVEGKRIPYGFRRRTL
                     PHFVVDDLSPEARGFVENSYLRGLTPEEVFFHAMGGREGLIDTAVKTAETGYIQRRLM
                     KAMEDIRIEYDGTVRNSLGDVMQFLYGDDAADGAMLEVQELRLVRASNQEMEALFRLD
                     VYDRDFGLGYIEPDLIDAVRTDPEVALELEEEYQQLLADREQLCAVFPTGEAKWPLMV
                     NVQRLIQNCRSIFGIQHDTLSDLHPRQIIQGVRVLLQRCVVVPGDDELSREAQRNAVL
                     LFAAHVRAELATKRVLQIHRLNSKAFAWLLGEIETRFVRARATPGEMVGAVAAQSLGE
                     PATQMTLNTFHFAGVSAKNVTLGVPRLKELINVARQAKTPSVTVYLKSGKDKELANIV
                     QSELEQCRLRDVVESSAIYFDPDPANTVVEADREWVRDYFDLPDEMDRPERLSPWLLR
                     IVLSTEMMIDKRLRLSDVARRLRAEFGGDLSVVYSDDNAEQLVMHIRMAGDEYEKGAL
                     GVPILGESERLDDTLNLLGPGDMTAGGNQSLEALDSGTVEEQDDVFLKRIELALLEDM
                     QLKGIPGIRKVFLRQTQRVLFDPEAGSFRSAPEWVLDTEGTALLAVLSHPDVDARRTI
                     SNEITEVLQVLGIEAARQALYNEMYAVLSFDGSSVGYRHLALLVEVMTCRGMLIPVSR
                     FGINRLETGPLMRCTFEETVEILATAATFGVRDACEGVSQAVILGQRAKVGTGAFSLT
                     LDESVLNQAETETSVAAVRDAHVGGVFAKAYAAADVDADHWTPAYTPGATPGMASDGF
                     AAPWTPSLNLASPYGSFSPAVGFSPATSTYVGGDAMKDAGRYGLGGTSPFASFSASAT
                     TPNWAPSPAGGGTGTLGAFSPSSPAYSPTSPRLVSPTSPAYSPTSPAYSPTSPAYSPT
                     SPAYSPTSPAYSPTSPAYSPTSPAYSPSSPNVAYSPSSPNVAYSPSSPNVAYSPSSPN
                     VAYSPSSPNVAYSPSSPNVAYSPSSPNVAYSPSSPNVAYSPSSPNVAYSPSSPVAYSP
                     SSPNVAYSPSSPNVAYSPSSPAFSPSSPVYSPKNK"
     gene            complement(<559623..>560972)
                     /locus_tag="CYME_CMR225C"
                     /db_xref="GeneID:16996755"
     mRNA            complement(<559623..>560972)
                     /locus_tag="CYME_CMR225C"
                     /product="probable pyruvate dehydrogenase kinase"
                     /transcript_id="XM_005538437.1"
                     /db_xref="GeneID:16996755"
     CDS             complement(559623..560972)
                     /locus_tag="CYME_CMR225C"
                     /codon_start=1
                     /product="probable pyruvate dehydrogenase kinase"
                     /protein_id="XP_005538494.1"
                     /db_xref="GeneID:16996755"
                     /translation="MAIWRKQGLAWAVLRLGSGLWPSATRGWTSAQRLAPAASLRTSA
                     EDPSIPSWLASGCPPSQPDVAYTPLEAKPLLLRLPSSREEALELIPRYARRSATPVSL
                     RQLLEFGRHPTPKKLLLAAQLMHRELAIRLAHRVVELQSLPYGLSEMRSVKRVCELYE
                     NSFADILMHPRPEREGEEERRFTELLRRIRDRHSDVVRQIACGVLELKQSCGMGADDI
                     HISSFLDRFYTSRIGIRVLISQQVSMSLERSRQGYVGIIHIRCRPAHVAADAADAARA
                     LAYRHYGEEPPEVVILGKTDLEFPYIEGHLYHVLFELLKNSIRATMEHHMGRESFPPI
                     KVIIADGYEDVTLKIADEGGGISRSSLPKIWTYMFTTATVPPEALIQPEYGPGSHVHG
                     ARGASMDPLAGFGYGLPLSRLYARYFGGELSIASMEGFGTDAYVHLAKLGNRLEALV"
     gene            <561489..>562151
                     /locus_tag="CYME_CMR226C"
                     /db_xref="GeneID:16996756"
     mRNA            <561489..>562151
                     /locus_tag="CYME_CMR226C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538438.1"
                     /db_xref="GeneID:16996756"
     CDS             561489..562151
                     /locus_tag="CYME_CMR226C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538495.1"
                     /db_xref="GeneID:16996756"
                     /translation="MSEHGAEHGSQGAAAPETQRSISGRLLGLRFMQRALERTQPEHR
                     DHLRTTGTLPHQTSGKARHSVEKKAQQPANEERRLLVVCDYEYSVAAEDLKLSQYATA
                     RQRYGFETTAVFFEEEATTGLVLARTESSPNNVDETLRQAPGSTPRHPDTRHGDERFR
                     ELAHDGRARRRLDGSRVAKRSAPSSLAEASFCSVRGHQRKPCRFSKLTRSSQQGATTR
                     RR"
     gene            complement(<566525..>568741)
                     /locus_tag="CYME_CMR227C"
                     /db_xref="GeneID:16996757"
     mRNA            complement(<566525..>568741)
                     /locus_tag="CYME_CMR227C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538439.1"
                     /db_xref="GeneID:16996757"
     CDS             complement(566525..568741)
                     /locus_tag="CYME_CMR227C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538496.1"
                     /db_xref="GeneID:16996757"
                     /translation="MGAQGQDNRIPATGERTWCVRGTTMDSTKRGLTLGSVASVNPER
                     CAPQSFVAARVRQQAEIKTPALERCLSRTSIETLSTQGQEGEPRPHVWRGTLPATVGA
                     ASLCGSSCLGTSHAGAGEVSDAKTLGHDGSIPKAVQHRRTTRAEDECFEPLPRAESLR
                     RAAPSLRRFVQHLRIMDRTAEELLRQLDRARPENWSLSAAVGNFTSETGLQSKWGWRT
                     ELVSWLMDLCVTLGMEPGVGEFAFFMIQKVFMIDTTGLCTLINADATGERDLKDESES
                     TQLARRRRLLDVLHLVGAAATRLAAARSLMKTKALGDALGEVFSIERSQLESAEAFLL
                     ERFQWPRKYVGLDAYIFRICEWIRRVLDEHRFHVLHHSCRCLAPVWSEDESSLLETCL
                     FLLEACRPVILRIYLSTERAMSPSAAAAAAEAEAAQMELEGRLPDMHGSPATWLASGK
                     VTAAHRVDIRELVGTNAARRDARERPYAAMHPRYFCAALLIFLSDLLQNTDHGSTEIP
                     LELRATEQDSCSVEQEHGSQGADELLLGTHPGLWSDPDETTENRVPCAALNVLLGALM
                     PTDTWGQSLVSGWLTVLQESDLRTVLEALHVDAPAHSPNGVRPLEQTSPLGAPDNVTR
                     TSHDGHETRRRLRTVSDKNVDSAREKYLETDEWLWRRFSHESEGTGVASQRSRLLHIP
                     NGRLERMERASTHSSTLQAMLPPSLELDEFSSAVAGIRVFSSASLRQRRGRRSRSL"
     misc_feature    complement(570074..571424)
                     /note="repetitive element"
     gene            <572150..>573604
                     /locus_tag="CYME_CMR229C"
                     /db_xref="GeneID:16996758"
     mRNA            <572150..>573604
                     /locus_tag="CYME_CMR229C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538440.1"
                     /db_xref="GeneID:16996758"
     CDS             572150..573604
                     /locus_tag="CYME_CMR229C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538497.1"
                     /db_xref="GeneID:16996758"
                     /translation="MWECIAPTAYAVDWNTALGDVLQTPEEVEFLSTLACSRERLQVA
                     LRHWKQLSLRERSLCGTRQKHANSEAHLPAAEEKPVDESANKALLKNLKETLFATAGP
                     VEVRSALYQLEAYIPCLQRLTSLFQEQRTVEHFAHNRHASESCRFAWKSGMAERRTVQ
                     RESLLRFEILFTLFYWSMAKIRTGHEILDEFSSNAEGQTREAVENEAVRLFREASGVL
                     KYLSEKLSPGLLVDMDSSEFVCEVHPCVASALSRIAMGEAYLLALTRAESRQLSPETL
                     LRLSVGVTETFALARAQLQGLCDGTNKAAAGHKRLAYSPEPGYRAVAELGEALGRTRC
                     FYYQALIFEAGTSPREISGKRGAVIRLLEHASLEIEKRRVGRLLRDGAFRFLVPPMRA
                     PTVQHWQNLISIKLEKSRRDNDLVYMEPVPDSIPNITATEALYPFYAVEYSFTDLNQT
                     QLDASSSLDASLNGSPRAGAQQNGTNESIGGTFR"
     gene            complement(574186..575996)
                     /locus_tag="CYME_CMR230T"
                     /db_xref="GeneID:16996759"
     misc_RNA        complement(574186..575996)
                     /locus_tag="CYME_CMR230T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461618.1"
                     /db_xref="GeneID:16996759"
     gene            <576527..>577720
                     /locus_tag="CYME_CMR231C"
                     /db_xref="GeneID:16996760"
     mRNA            <576527..>577720
                     /locus_tag="CYME_CMR231C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538441.1"
                     /db_xref="GeneID:16996760"
     CDS             576527..577720
                     /locus_tag="CYME_CMR231C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538498.1"
                     /db_xref="GeneID:16996760"
                     /translation="MASYDPFALKASGCEQKKPPAWFELGKSLLTLTFAAGADQEPYS
                     PDSFWINAGSETSSTRVKRSRPVEAVSTTSAGTSDDVRAAGRSETDRQVPVQEPRNEP
                     KGPGCFFPPPIDDRVLCVCAFIARNFTGPDIEIEAKLGTVIDLSTRERAVLPGCATAA
                     CLQAEVNNVLRFESKVSFDAFKRLNEVLNRTVASAVRHRGPLVRHSRSRQTDLRFSSG
                     YRETRPWSRSEGEAESGTNATQGNDKTPASFMFKTRLETLHILFPSHPYDVRVNAARE
                     QQLTPAEAVRLGDARGVLESERLKDRLSYRCGELSIDITVVHLPRESLMTYEVEVELI
                     FDNRADQCAELVQVCTDYRQRLESAAPLAPPMGPSPPALLVTIAETLFNTLVALNNVL
                     ASITN"
     gene            complement(<577796..>578431)
                     /locus_tag="CYME_CMR232C"
                     /db_xref="GeneID:16996761"
     mRNA            complement(<577796..>578431)
                     /locus_tag="CYME_CMR232C"
                     /product="RNA polymerase I, II, III common subunit"
                     /transcript_id="XM_005538442.1"
                     /db_xref="GeneID:16996761"
     CDS             complement(577796..578431)
                     /locus_tag="CYME_CMR232C"
                     /codon_start=1
                     /product="RNA polymerase I, II, III common subunit"
                     /protein_id="XP_005538499.1"
                     /db_xref="GeneID:16996761"
                     /translation="MATDIQADETRRLHRIRRTILEMLRDRGYLVLPTKTDLELPLEE
                     FAHKFDAAGRARESLTMLRQHRNDRSNQIYVFFPKEEKVGVKPIREYCLRLETENVLR
                     AIIVVQTGLTPIAKQAVAELQPRFHLELFQEAELLVNITRHQLVPKHEVLTAEQKKTL
                     LKRYQLKDTQLPRILQSDPVARYFGVTRGQVLKITRNSETAGRYVTYRLVV"
     gene            complement(<579816..>581117)
                     /locus_tag="CYME_CMR233C"
                     /db_xref="GeneID:16996762"
     mRNA            complement(<579816..>581117)
                     /locus_tag="CYME_CMR233C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538443.1"
                     /db_xref="GeneID:16996762"
     CDS             complement(579816..581117)
                     /locus_tag="CYME_CMR233C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538500.1"
                     /db_xref="GeneID:16996762"
                     /translation="MAATTGSAASWRWLLRLGLVSLLVFQRWTALGLSRPFWEFSVYS
                     EDGVTNQTVLKQRYDAINYSLQIWPQQYPGLRAQTVTCNFSFINESTQFLKDQATRET
                     ELFYVTQSFVSTQAGVRPFYASGSYQLASTQAVQEYLFKPVNSDSLQCWVYLRSANRF
                     YLGTDGKPPPDEYDLPTVVLRAAAIVLGFTGLIRANAVNQPAFLVDDNNDEASTFFDI
                     FLYGSPERGHDGFLPLVSLGAFVHHQDLVPRFVTSDELYFASTSVLSELPSLYAPSKY
                     TPEQSIYFLRPSVSDHYSLKRTCSPVCAANDSAFFVETADPADALLYPTLAPGIAIHS
                     LGNRTLQMLLCTNDGCDLGESNGWPLYGIVLFVIATLTASVLLAWLLVQLIRCWALRW
                     EKKADVMIDEMMTPADLAEAEAEVAFEFGVDDLNQEYKSRH"
     misc_feature    581385..582578
                     /note="possible transcribed region"
     misc_feature    complement(582335..583698)
                     /note="possible transcribed region"
     gene            <583932..>586424
                     /locus_tag="CYME_CMR234C"
                     /db_xref="GeneID:16996687"
     mRNA            <583932..>586424
                     /locus_tag="CYME_CMR234C"
                     /product="DNA replication licensing factor MCM7"
                     /transcript_id="XM_005538444.1"
                     /db_xref="GeneID:16996687"
     CDS             583932..586424
                     /locus_tag="CYME_CMR234C"
                     /codon_start=1
                     /product="DNA replication licensing factor MCM7"
                     /protein_id="XP_005538501.1"
                     /db_xref="GeneID:16996687"
                     /translation="MATELAYRLPFDSLNLGSNPQQSLRALGGSQPSDSRGGAGRSRS
                     SPANTYSTDVEVLVHFFQTFVDDREANPSLGSDSLDRDADGTRHTAAGSEAAEEPAAL
                     GERQNLRGVAPKYLRHLQKIVDRDSKILAVELDDLFTAHEETLAMRIQLNTKRYIEIL
                     SQAADAIIATLRPSRLLALDTLDLLMQQREQNEQENRLEDQELFGNAGAGAGAADEDP
                     YKRIPPLLARRYQVQLVPASEDKPFRIRDVRAEHVGRLVQVSGIVTRVLDVRPLVQVA
                     IYVCDACGTEYYQPIPGRQYMPLFFCSKQECMRSATGGGRLIPQYRAFKYSKFQEIRI
                     QEPAHDVPVGSIPRTLTVLLQGELSNACAAGDHITVAGIFLPTLVSGFRAFKQGLLSD
                     TYLEATFIRQQKRDYKDYQREIARNQLIQARIAELASTAGVYDRLARSIAPEIYGHED
                     VKKALLLQLVGAPTRELADGMRLRGDIHVCLMGDPGVAKSQLLRYICNVAPRGVYTTG
                     KGSSGVGLTAAVLRDSNTGDVTLEGGALVMADCGIACIDEFDKMDEIDRTYIHEVMEQ
                     QTVSIAKAGITTSLNARAAVLAAANPVQGRYNRRRSAAENINMPAALLSRFDLLFLML
                     DAPDQDKDLALARHVTYVHRTGEAPELGFEPASPDLLRAYVAQARQCVPVVPSELTAY
                     VVEHYVALRADDKQRRWLPRGHTTARTLLSILRLAQALARLRFSNLVSREDIDEAVRL
                     LNCSKASLDDPSEAGGHRNLHELDATTRIYLLIRDHAADRGERSVPIADILEQALQQG
                     FTSQQFYTALSEYEDINIWSVDSNRTRITFTV"
     gene            complement(585220..588296)
                     /locus_tag="CYME_CMR235T"
                     /db_xref="GeneID:16996764"
     misc_RNA        complement(585220..588296)
                     /locus_tag="CYME_CMR235T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461619.1"
                     /db_xref="GeneID:16996764"
     gene            <587947..>588750
                     /locus_tag="CYME_CMR236C"
                     /db_xref="GeneID:16996787"
     mRNA            <587947..>588750
                     /locus_tag="CYME_CMR236C"
                     /product="probable tRNA-specific adenosine-34 deaminase
                     subunit TAD3"
                     /transcript_id="XM_005538445.1"
                     /db_xref="GeneID:16996787"
     CDS             587947..588750
                     /locus_tag="CYME_CMR236C"
                     /codon_start=1
                     /product="probable tRNA-specific adenosine-34 deaminase
                     subunit TAD3"
                     /protein_id="XP_005538502.1"
                     /db_xref="GeneID:16996787"
                     /translation="MSLEPERHVEVWVIQAIPRHAEQLLRYLSSSVPLGRELAHLKRG
                     HRDSTGAVNVLLALVSADDPEVPNRNAHAVLERLGVAREWVHTATLRRCVVPAVAPRT
                     GLQSQHWSRTLWPVIYRPEAPEPPILAETEVGTALELLERLEHETQGTDVNAALVVRW
                     PLPSAPAQVICSVQGPHAPLRCIDEASRIFRDRDNGEEHPHYMLTGLDLFTVREPCVC
                     CAMAATHSRIRRLFFIHPDASFGGILRVGVHRLKALNHRYEAYQRQLAS"
     gene            complement(<590069..>591184)
                     /locus_tag="CYME_CMR237C"
                     /db_xref="GeneID:16996788"
     mRNA            complement(<590069..>591184)
                     /locus_tag="CYME_CMR237C"
                     /product="threonine 3-dehydrogenas"
                     /transcript_id="XM_005538446.1"
                     /db_xref="GeneID:16996788"
     CDS             complement(590069..591184)
                     /locus_tag="CYME_CMR237C"
                     /codon_start=1
                     /product="threonine 3-dehydrogenas"
                     /protein_id="XP_005538503.1"
                     /db_xref="GeneID:16996788"
                     /translation="MSVGRFMRALVKKAPKAGLEWVENQPVPPVGPNDVLIRVTHASI
                     CGTDLHIYKYDAWAQRTIPIPLVVGHEYVGRVAALGDQVAQKVPLRVGDRVTGEGHVT
                     CGFCRNCRAGRQHLCRNTLGVGVNRDGAFADYVAVPARNVVRLPDRIPDIWGAVMDPL
                     GNAVHTALANDLVGEDVLITGAGPIGMMAAGICRHVGARHIVVTDVRDERLSLAQKCG
                     ATLAINTSQGKPATGLGMEDDSKHTEHLLRDAMKQLGMTEGFDVGLEMSGVPSAFRSM
                     LATMNHGGRIALLGIPSESFPINWDDVVFKGLSIKGIYGREMFETWYRMINMLVGGLM
                     ERIQPVLTHRFPAHEYEEAFKVAGSGTAGKVVLEWEK"
     gene            <592381..>593490
                     /locus_tag="CYME_CMR238C"
                     /db_xref="GeneID:16996789"
     mRNA            <592381..>593490
                     /locus_tag="CYME_CMR238C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538447.1"
                     /db_xref="GeneID:16996789"
     CDS             592381..593490
                     /locus_tag="CYME_CMR238C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538504.1"
                     /db_xref="GeneID:16996789"
                     /translation="MFVHGKALNAVSVRQNGRVVCLAERPRGSGGTARIKPAWAGTDE
                     LLSKLTNLLIQTPWVYRILKKQAKAVMVRTAASRGIDWSGCAAALEEAGVSKYFAPRT
                     DLVYPAYYTKPFHAYDEGNLCWLAAYEVEPATYAMALRVWPQERELSWRDAQRRLRHC
                     FLDQVTRFMADPGDLRIDRVRFTLDVGCGAGISTRFLAEYLARNIPRDDALRVLGIDP
                     SPYFLAVANLRNEKANALDVQRLPPNVRIEYQQALGESLPLADSVVDLVTLQFVLHEL
                     PRDAAESVFRELVRVTRDRGCIAMVDNNPRSPVIQNLPPALFTLMKSTEPHSDDYYTF
                     DVEACLRQIPGIERVQVTACDPRHRAILCRVRKST"
     misc_feature    complement(592628..594445)
                     /note="possible transcribed region"
     gene            <595029..>596702
                     /locus_tag="CYME_CMR240C"
                     /db_xref="GeneID:16996849"
     mRNA            <595029..>596702
                     /locus_tag="CYME_CMR240C"
                     /product="amidophoribosyltransferase"
                     /transcript_id="XM_005538448.1"
                     /db_xref="GeneID:16996849"
     CDS             595029..596702
                     /locus_tag="CYME_CMR240C"
                     /codon_start=1
                     /product="amidophoribosyltransferase"
                     /protein_id="XP_005538505.1"
                     /db_xref="GeneID:16996849"
                     /translation="MYITLGTFITPNALFVPKASFEAQAFARGRLDGRWHPAVTRIAL
                     RGNRALRQQQVARRSASRWFMGFHDECGVVGVMTPLHKPASDVPARLAYFALHALQHR
                     GQEGAGIVLWEPDSSDAQVSTKGQLREIKGLGLVSEVFTDAILGASRAVAALGHVRYS
                     TAGEKNIRNVQPFTVKMRHGQIAIAHNGNLTNAEALKRELEARGTIFNTSSDTEVILH
                     LMAQSVQGGSADARTRLTDALGRVDGAYSLCVLTAGQLIAVRDPRGFRPLMLGRISET
                     SPATTTGSPPDASMTTWIICSESCALDMVGAETVREIEPGELVVIDRASGNLQSFFPF
                     PRQQRRACIFEHIYFSKVTSNVFGRSVYLSRFRFGELLAQAAPVEKGADYVVPVPDSG
                     IAAALGFSAASGIPFQMGISRSHYVGRTFIQPTQEIRNAGVMLKLTAVRSLIEGKRVV
                     VVDDSIVRGTTSRKIVHMLREAGASEIHLRIACPPIIGSCYYGVDTPNREELLSWRIP
                     DSHKACEWIGADSLGFLSLESLRSFLADESGDYCYGCFNGQYPVLPVDA"
     gene            complement(596273..597935)
                     /locus_tag="CYME_CMR241T"
                     /db_xref="GeneID:16996850"
     misc_RNA        complement(596273..597935)
                     /locus_tag="CYME_CMR241T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461620.1"
                     /db_xref="GeneID:16996850"
     gene            complement(597907..597977)
                     /locus_tag="CYME_CMR242R"
                     /db_xref="GeneID:16996851"
     tRNA            complement(597907..597977)
                     /locus_tag="CYME_CMR242R"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:16996851"
     gene            598107..599806
                     /locus_tag="CYME_CMR243T"
                     /db_xref="GeneID:16996833"
     misc_RNA        598107..599806
                     /locus_tag="CYME_CMR243T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461621.1"
                     /db_xref="GeneID:16996833"
     gene            complement(<598897..>600087)
                     /locus_tag="CYME_CMR244C"
                     /db_xref="GeneID:16996834"
     mRNA            complement(<598897..>600087)
                     /locus_tag="CYME_CMR244C"
                     /product="probable dehydrogenase"
                     /transcript_id="XM_005538449.1"
                     /db_xref="GeneID:16996834"
     CDS             complement(598897..600087)
                     /locus_tag="CYME_CMR244C"
                     /codon_start=1
                     /product="probable dehydrogenase"
                     /protein_id="XP_005538506.1"
                     /db_xref="GeneID:16996834"
                     /translation="MHRLNTVSNRRASLDPGAETANALRLALWLRLAHRSMLRYTRSQ
                     TGMEAVAQFRGGPVRIGIIGAGRIGRVHCAALARMSNLAQVVVIADFIEQAAQAAAKE
                     FRIPRAVKDWQEVVQSPEVDAVIICSPSDTHYEIIVAAARAGKQIFCEKPIDYDLERI
                     DNALSEVKRAGVQMQIGFQRRFDANFRRVREAVASGEIGEPYSLHIISRDPAPPPLAY
                     LKQSGGLFFDMMTHDFDMARFTMGSEIVEVVAAAGANLVDPQIGEQAGDIDTAIVTLR
                     FANGAIGTIECCRKAAYGYDQRIEIHGSKGNVSTANNFPNNATLQDGASVRRDLPLNF
                     FMDRYRDAYALEMETFVRCIMEGKAVPVTGEDGRMPVVLAYAARKSMKERRAVRIGEF
                     MSKL"
     gene            <601522..>603969
                     /locus_tag="CYME_CMR245C"
                     /db_xref="GeneID:16996835"
     mRNA            <601522..>603969
                     /locus_tag="CYME_CMR245C"
                     /product="LAMMER-like dual specificity kinase"
                     /transcript_id="XM_005538450.1"
                     /db_xref="GeneID:16996835"
     CDS             601522..603969
                     /locus_tag="CYME_CMR245C"
                     /codon_start=1
                     /product="LAMMER-like dual specificity kinase"
                     /protein_id="XP_005538507.1"
                     /db_xref="GeneID:16996835"
                     /translation="MRRLRADDDVDKPPGQHKATADDVTTQMWNETERITRSPRTTGA
                     VSSRAESRDSGSRVRRTALKGANAGASYGPGTGQQTRYYTRARSREANSLAAEATFTG
                     SSLTVYSSGEGSVNQLTATASGSGVGSGSGQGSGANSGQGSGADSGSGSGAGGTGSSS
                     ISNDATGCSRSGSGGSAGSQGRGDHGTEDTPVSMQRAHSTEGYLHRVPSNGRPRNLAE
                     QMELVERPDTSALQLRGPRTHALPIGSPAQLQLQANLREQANPNATAVEPAPLDTMQR
                     RAAAFAQPERTNTSRQAQQQGFARSRRGVFSDASSGRMQFPSDVSAGAQHASGMHGHH
                     GIASQALAQAAPAVAVTEAQRLRALSSMDAHESLPSWRAATPRAPDAQTVLSAETRTA
                     ADECVSVSTSSFERQRESALENPPPSPLMMIAAQVVAPRLPPDLGLALQPDDPNGHVQ
                     YSVGEGLGPTADFPNGRYQILAPLGSGTFGKVVSCWDRVTEQLVAVKVIRAVRKYAEA
                     ARMEIDILLELGRKDPTSRFHCVRMLSYFTHVSQQGNAHVCLVFEHLGPSLFDVLMRN
                     HFRPLPVPILRAVARQLLEAITFLHEHNQIVHTDIKPENVLIVPSSYYPNRQITEHVQ
                     VRLIDFGSASRLDKVSVRHAIVSTRHYRAPEIILGTGWSFACDIWSFGALLVECYTGQ
                     TLFQSHDDLEHLQLMQKLLQHENGEVIVPPPRPSPSSTSMGSQRRREALKLFRDGRLN
                     WPEGIDEQSANSLARQKSIRRVARMPELHSIFRPEHACLLHLIRCCLTIDPLKRWRPS
                     ELLRHPFFMSYSTEATP"
     gene            complement(<604944..>606563)
                     /locus_tag="CYME_CMR246C"
                     /db_xref="GeneID:16996836"
     mRNA            complement(<604944..>606563)
                     /locus_tag="CYME_CMR246C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538451.1"
                     /db_xref="GeneID:16996836"
     CDS             complement(604944..606563)
                     /locus_tag="CYME_CMR246C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538508.1"
                     /db_xref="GeneID:16996836"
                     /translation="MRPQVQVPVLFDTRLTTTRWPSVRSALAVASALIALQQVNWVPA
                     LDKQALVPVAQQLGTGSSAEAPDASGTQLIKRFTDQLYAFAMEKWRILRDRNRPASAG
                     CITSTRTLGQRCEALGRGCLTVLILKYLERRLDQDIYLLPGSLTGLVLLVGLLGVVEH
                     AWSARALVGLERFVKPALAFLAEWMPLFFAPPLVALPARLYTGGASKRELLALAGVIV
                     SGFLAGLWTTAAVTRSLMRWQSRERASTPLAENRASDLAPETSCSSRERAGAFADPVL
                     FGLSSLLAILCIAPAQYWRDRLLLAVVTALSYRLGTRAVPKPWQRVLHPVLTCAGLTA
                     VVASGLELSESVNADASWYKRLERYPFIAGNWFMQLLGPSLIALSFRLYRARALLSRQ
                     WLPLVGGSAFSAIFSLVWTAVASRILGLRTPALRAALFPRSITMPLAIASSKRLQADT
                     SITVASVLISGILGASLGSMILRPGPEMPALARGVALGSVSHGLGTAALTSSGDSTAA
                     SAAVIALGLVGTLTTLLLSSPLMASFRPSGQ"
     misc_feature    606623..608659
                     /note="possible transcribed region"
     gene            complement(<607955..>610210)
                     /locus_tag="CYME_CMR248C"
                     /db_xref="GeneID:16996806"
     mRNA            complement(<607955..>610210)
                     /locus_tag="CYME_CMR248C"
                     /product="probable mitochondrial mRNA processing protein
                     PET127"
                     /transcript_id="XM_005538452.1"
                     /db_xref="GeneID:16996806"
     CDS             complement(607955..610210)
                     /locus_tag="CYME_CMR248C"
                     /codon_start=1
                     /product="probable mitochondrial mRNA processing protein
                     PET127"
                     /protein_id="XP_005538509.1"
                     /db_xref="GeneID:16996806"
                     /translation="MLGCLRGFASKHATRSGRVLRLDTLGNAGARHTGGASALEERTS
                     ASCAPSRGLYTACFPGAVAMTTATCVRWANDHRRLIHSKRWPRNPVRRSVSNRFDRAA
                     AALDLLPAAEVGSAAEKLLERVLSEVPTAVAATQVAVAAQSTPQVAVEVPAAQRKPTP
                     VATGTRNDPATALLSSALTPGPPKGYVYRTRPVPVPFSERRRSETLARLPTTLEAAER
                     QAARELERLWRNAPPELIASDRQWKLLLPPHNSFALTPASNARLPNVSVPTLAHDLSR
                     VVEDGGVHPLLCPETQRYNFDPYLRLIRQPAEIAWENIPPYVPASRDDALREVARLEG
                     ASYLASTSSITGVLTALYHLVSSFRGTTLEGLSEFFQRQPRHFTRHAHKPVSVLLQPL
                     DGMIAIDACKGIVNRESILMDLGHSMERMLTMEPGAFCRKFLRPQAQLLTDEAISPMP
                     DQAFNYSRCGDFVLRAQIDCRHPRTDEPFDLKTRAAAPIRWDLDNYRDYLEYRITHLR
                     GPMYSYEREFYDMIRSVFIKYCFQLRVGRMVGAFVTYHNTRECFGFEFVPLSEMEQYV
                     FGNTHWAREAFSAVMGLFQQILAHTAAHWHDALQRDHDSLKLTIDPGRQRGRARVYVQ
                     RLRCHDGGTPDPLDAMSLVQSGLSATDMGAVELAERLFGSGASTTEASSPTKGLLVEE
                     DLACFDMFLLPFVNEQSVTGEAVQVDQGDKYQALFAFTPFQRPPCLASYLTSLRRSYG
                     IDEMPRFRVCD"
     gene            610354..612451
                     /locus_tag="CYME_CMR249T"
                     /db_xref="GeneID:16996807"
     misc_RNA        610354..612451
                     /locus_tag="CYME_CMR249T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461622.1"
                     /db_xref="GeneID:16996807"
     gene            complement(611091..612496)
                     /locus_tag="CYME_CMR250T"
                     /db_xref="GeneID:16996808"
     misc_RNA        complement(611091..612496)
                     /locus_tag="CYME_CMR250T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461623.1"
                     /db_xref="GeneID:16996808"
     gene            <612856..>614343
                     /locus_tag="CYME_CMR251C"
                     /db_xref="GeneID:16996809"
     mRNA            <612856..>614343
                     /locus_tag="CYME_CMR251C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538453.1"
                     /db_xref="GeneID:16996809"
     CDS             612856..614343
                     /locus_tag="CYME_CMR251C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538510.1"
                     /db_xref="GeneID:16996809"
                     /translation="MQLPETPMWQQVLQRVLTELETLRIVHTCRSASLYEDDRIWTLI
                     PAHFREQISDSTSAVLQQEGAALADALLVPFVHTPESTTFLEQKDDLKTTLELAYQRL
                     PRRKALQVRKLAPRMGQLLDQLVCFADHNEEHLQLVEVGCGRGLVSQTLSVALGAQRG
                     RHCLDILGIEQDPRLCALFRRRWARAPQQVEAARCAVRHARIECAADIARHACLAREL
                     CDNVTHRSVILALHGCGALSAYALRTLDSERCTLQPEAVICIGCCYHKLRCRDAVAEL
                     VPDEAACVEFPLSRWLSQLEGFTFSALAYGGDALMNRSSLYLASTDATALRNPNAMHA
                     QKILRQHHYRAMLQVVLSSLATAGDAELRRRAQMLLEAERDPRWALLRRMGKRIDQFN
                     DFAAYARDGLECLQLPFDPELVQEIAAKYDTPLHRHRCFVFWTLCGRLAPLLEALVLL
                     DRVVYAQECGYHAWIEAAFPAEASPRNRAIIAVRRQVADRCARAA"
     gene            complement(<615131..>616483)
                     /locus_tag="CYME_CMR252C"
                     /db_xref="GeneID:16996810"
     mRNA            complement(<615131..>616483)
                     /locus_tag="CYME_CMR252C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538454.1"
                     /db_xref="GeneID:16996810"
     CDS             complement(615131..616483)
                     /locus_tag="CYME_CMR252C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538511.1"
                     /db_xref="GeneID:16996810"
                     /translation="MRLVHRRARPGDSVCFVWPALGTLRRYLDVAQHPTNATQTIAVW
                     RRRCWGSCCFQPDNRGQVPRNAQRHCTRGGQDNETRSRFTGWHAHELEVKGSVWQRRL
                     PSVGVFASRDASRWRQYLETLGAALVGTLSAPCYASGSTVARESLQVVHGNALVTRDL
                     AAAVFALIGSYAWLKIWDWLATNGYIESTLSRKIVHITSVPLFMLSWPLFAENHVAAG
                     AVPAGVSLQSWSTFLSMAARSSQGIAAMVPAILSVRLLLAGLGLSQDTLVNALARQKA
                     AMQKWIREHADEDGASEQSMTANASMVVQGDRSEALKGPLYYCLATTVCTFLFWRGPS
                     PVGILALIQMCVGDGMADLIGRRWRTPKWPLPRGGGSQKTIGGTTVFIVSAFLVSCLY
                     IAIFHAWGYVDIGIAAAAARIAMLTVCCAVVELVAPGDDNITVPLSACLIGSLLFPGN
                     "
     gene            <617430..>619442
                     /locus_tag="CYME_CMR253C"
                     /db_xref="GeneID:16996803"
     mRNA            <617430..>619442
                     /locus_tag="CYME_CMR253C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538455.1"
                     /db_xref="GeneID:16996803"
     CDS             617430..619442
                     /locus_tag="CYME_CMR253C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538512.1"
                     /db_xref="GeneID:16996803"
                     /translation="MENFKTQRLGGQGSQQTSGETGTATTGRRRTVRRKRGTSGATVR
                     RPVRAKGAHDVQHPAAASSSESTAHRDSWHGPEDEHPKGVLGATQSTKKTVVTYETKL
                     AASFEEHQSPARVPVGPAQTPTNEAGSASGTMPLSPQQTTVTLGTPKGDPMARALARC
                     KSPERRGPRTPRTIEPALSGERIGENARAEQVPKAPHRDAFYEKGAASVAHEHSETSV
                     PAEAPSTTDLSTQSTISVVSQAEGPKKRVRKKQRHGQEPKNGRMSASRQKHAHASTDG
                     GAPEAATSSLLSRTALTVSPSRGKTEHAAESIKKETAIRGATASKVQEDNRRSAFASS
                     DKVGQEEKDSAERRPTRLGHVSKKSVATGANAPIADTKSVSPPLHQLSATDKERFHAP
                     ETGFASTTSRRESQTASELQKHQMSMKDAHASSERNEPSRKKRAAALLQPAALETDAQ
                     SGTKHSSPYRTAASAPTIETRQKTKRPVDSKPALEPAMPLKRPASEPAGVDTDPRHHR
                     SAEATVAQLPAERRGTRRVPAKRDATTEAQPAPPSLDHDAAERLGDIRFNDQWNLFFD
                     HDKGRFYPVHFAIHPNAADAAAMHAEIENNATLQQELRELVFTICRLPVLPPRCILTP
                     SMLVEIVLEDRADLRGLLAGKYALWRGDVPVLPDKFWYTFLIQKLL"
     gene            complement(<619822..>620403)
                     /locus_tag="CYME_CMR254C"
                     /db_xref="GeneID:16996804"
     mRNA            complement(<619822..>620403)
                     /locus_tag="CYME_CMR254C"
                     /product="cytidine deaminase"
                     /transcript_id="XM_005538456.1"
                     /db_xref="GeneID:16996804"
     CDS             complement(619822..620403)
                     /locus_tag="CYME_CMR254C"
                     /codon_start=1
                     /product="cytidine deaminase"
                     /protein_id="XP_005538513.1"
                     /db_xref="GeneID:16996804"
                     /translation="MGSGLLRFDQLTELQQVTVQTALEAASRAYAPYSKFPVGAAVAT
                     SDGVVASGCNVENASYGLSMCAERVAVGNLYASCTSSWTARGRTDQVRIVCVAVCAPR
                     VRGVQGDSVGVCYPCGACRQVLAEHAAPEAELVLVSLHTNTWEDVADASASGAQRCRY
                     LVSSLEALLPCSFRKEQLPIGDSKSVPPAPDNT"
     gene            <622362..>623366
                     /locus_tag="CYME_CMR255C"
                     /db_xref="GeneID:16996805"
     mRNA            <622362..>623366
                     /locus_tag="CYME_CMR255C"
                     /product="probable inorganic pyrophosphatase precursor"
                     /transcript_id="XM_005538457.1"
                     /db_xref="GeneID:16996805"
     CDS             622362..623366
                     /locus_tag="CYME_CMR255C"
                     /codon_start=1
                     /product="probable inorganic pyrophosphatase precursor"
                     /protein_id="XP_005538514.1"
                     /db_xref="GeneID:16996805"
                     /translation="MGAMERTPGAFITTWSSRLNVSVRSFRGAPAANTLDVRRGNSER
                     ERFILAQPPLRPARRVQPIRDWRDQRPATVKEQRSRALSTVASLSVGDVTLEHVGAEG
                     TTSYRVYLRVARGDRLERISPWHDLPLFPRGNAETLLFVNEIPKGTRAKMEIAKDEPQ
                     NPIKQDTKKGALRFYEYGPSLINYGALPQTWEDPAVVHTESGCSGDNDPLDVIEIGSQ
                     AMPTGAVYEVKPLGMLGLIDSGELDWKLIAIRTEDPKAALIQGLSDMEEHFPNLLHQV
                     REWFRLYKTAEGKGENTYAYNGKALDVSFALQIVREAHENWRKLKSGERANTEQLALS
                     "
     gene            complement(<623590..>624624)
                     /locus_tag="CYME_CMR256C"
                     /db_xref="GeneID:16996796"
     mRNA            complement(<623590..>624624)
                     /locus_tag="CYME_CMR256C"
                     /product="spermine synthase"
                     /transcript_id="XM_005538458.1"
                     /db_xref="GeneID:16996796"
     CDS             complement(623590..624624)
                     /locus_tag="CYME_CMR256C"
                     /codon_start=1
                     /product="spermine synthase"
                     /protein_id="XP_005538515.1"
                     /db_xref="GeneID:16996796"
                     /translation="MPGAQVKADLWFSEYITPFDVYQHGVRRVDVVESTAYQDLVIAD
                     IGTYGKALFLDGKLQCTSGDEALYHEPLCHVPCLLHGSPKNVLILGGGDGGAARELLK
                     WDTIQRIDIVDIDDQVIQACKKHLSVIHHGSLHDPRVKVHATDAWAFVQKSTDQYDVI
                     LSDLTDPLEHGPSLALFTREFFLAVKGRLHHDGVFVTQAGPTSLNESPMHPRIVKTLQ
                     AVFASVYPFQAFIPSYGSPQGFAVASDKPLVVHGDAAVEAVERLITERLGEAALRTLD
                     GISFTGLFCLPKDVREQIKREKIVYSLKQGGFAPDTLPGARANDDDDDGNDDGNDRNK
                     AVDSSVSLNR"
     gene            <626705..>629656
                     /locus_tag="CYME_CMR257C"
                     /db_xref="GeneID:16996797"
     mRNA            <626705..>629656
                     /locus_tag="CYME_CMR257C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538459.1"
                     /db_xref="GeneID:16996797"
     CDS             626705..629656
                     /locus_tag="CYME_CMR257C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538516.1"
                     /db_xref="GeneID:16996797"
                     /translation="MLPRWLKRLQIKWRNKVAGRPTSKLGATAGSKCQVQQPMAPAGC
                     CVAVPSTPRSTTTRLSTDDYSVSEASSQFKPQLLEDWVIDLSAEPLRLSGAAEHPCGG
                     LFEKGLHRSLAVDALWQQAVESDRTPARTCAQYDAVRYLPVDGTTDVLLPQTHARDWA
                     YAPPADAKQPRSALLARRRWTEGNLIVGRRLQPLVGVQGSGSDGRYVFLAPAVSTEMQ
                     QQQQQQQRPSPADGNAAAHHLVGSERIPTEILSEDPLDLVEMLALALDRQQVEANCGQ
                     QAERSVHETGYETSDTRHQHRQASLHASEASPHSSDGTLHDAEAGAAACAPVGDAFRM
                     DNISTAFVADNEQELPVESSELTRAPLSRRALVRTVRSVAEYIHAVLLRWTSDDHADG
                     GGGLSAAPRELDELTTAGIVELLEILLWNEGVIILNDTDGLTAAVYGASALADLALCA
                     PYETLVGSASVLECLRQTIAAQERYRFGRPPSPLSQLLLREAWRCLRNITGNTRVANR
                     LVFLAQDAERNKEPSLIELALLLSDNAAIPAAIAVEAWACIRNWCAAAVEPVDPSQPS
                     SSSTTTTTTTTTTNVPRRQPMTSNPWACFMLLEKSEHGATLWRLATRHAALLETSTSD
                     DACFQHRQALEQLWALISVMLTTLNEHQWKYLDGIGLLEAVEHVLQMPWQFERDPFSI
                     ESAVPADSLLDTNARTVPLLVRQYALRCVRLLTERETGLRTWLQYTRKWSIIRPSESV
                     PLLAIIVKHLTCTQMSERPAYYALAIQAGEVLTTLCRYGSVRGDLLQTPGLVHGLVGQ
                     LAAQSLDLLAQNPQQAAAVPAVGAERTPAATHALPRNQSWVQDRVYQPEAFQQQLMLV
                     CLQALTDLAALPQASPAILSALEHYGGLRFLLDSCQVLGLHPAIRSSVRNLLLALRSL
                     LTESNTTRSPDVFDIESVIQDISRTATFLCGFSSRTRLALELFAVQQRLSKASLSRSV
                     SSSALLLQRRT"
     gene            complement(628230..629545)
                     /locus_tag="CYME_CMR258T"
                     /db_xref="GeneID:16996798"
     misc_RNA        complement(628230..629545)
                     /locus_tag="CYME_CMR258T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461624.1"
                     /db_xref="GeneID:16996798"
     gene            complement(<630807..>634187)
                     /locus_tag="CYME_CMR259C"
                     /db_xref="GeneID:16996838"
     mRNA            complement(<630807..>634187)
                     /locus_tag="CYME_CMR259C"
                     /product="probable DNA repair protein RAD5"
                     /transcript_id="XM_005538460.1"
                     /db_xref="GeneID:16996838"
     CDS             complement(630807..634187)
                     /locus_tag="CYME_CMR259C"
                     /codon_start=1
                     /product="probable DNA repair protein RAD5"
                     /protein_id="XP_005538517.1"
                     /db_xref="GeneID:16996838"
                     /translation="MDRMQTQIGNRHASTPFQSQVGAASSARKRYRGGEAQRRPNSQA
                     SHETGAKSRQQHAAERAYSPSATSWEAKTGRLSDGVGSSRRTPAVGREVFDSPTPESE
                     PASSCASPQDPVEDMDSLEPWIQKQLVALRAEHGGGTTRWPKYLGSILVPVRATATLE
                     PMAVTSGAELVLKVSPIMSNGTGSLGRHNRNRQRQRLRFAVRVCTAEHGREFGRLEPL
                     EALDLPTCLGALQSANLIIARARAVDCPLHIRFACVFIAEVAIFAAKSMFSFAAPGER
                     SGRRPAGFDADQEDALTHWIAQLFHSLTGSGTDTNETTALSSDTITHTKARIEAPGER
                     GSASVTKCLRTEAFRPEDAVQWILAAAENVHVDAPPVPVPPLLASTLRPYQQSALNWM
                     VARERAPSHTPSSDDTQQTWREQRLPDGTRYFQHRVSGRVSLQPPMTSPAVAGGILAD
                     EMGLGKTVEAISLMLANPRPPQEQTRLDRQAALFTKHPERVTTESHRENESDTKAGGR
                     RAANAAAAAQTRRSLVDSCCGGTLIVCPMSILSQWCAELNTHVADDADFIVHIYYAND
                     RETDPLVLARFQVVITTYGTLYSTWKSTQQTESAEARGLYALRWHRLILDEAHVIKNP
                     SSGCSRAVLDLRSRYRWALTGTPLQNNLEDIYPLLRFLAVEPWSDASLWKRYIARPFE
                     SGQAAKMQAALSLLSSILQPLMLRRTKRTLDEHTGAPILELPAKQTEVVYVDLSAAER
                     QLYDAVYKASRARFSTFLADNQITFYLTTVFEMLMRIRQLCDHPLLIMSCPARDLHIL
                     QDVQKFMQRLTEGRGSDQATTYLETLAGQLQQSLHDERSIESSTNTKPLCPICLESID
                     DAVALRNCAHVFCRDCILTLLLSNRHGNAQCPVCRKGCSFADVMSTPRRSRFRVDLER
                     GFFLSTKLARLVNDLVEAVQAFERDPVRHGKCVVFSQWTGMLDLIERALQAWNHEHAR
                     TLFQVGRLDGTLSQSRRTAVLEAFATMNPSTSAATATGRMNVLLASLRAGGVGLNLTA
                     ASSVFLVDPWWNPYVEEQAMDRVHRMGQTRTVQIRRYIVRDSVEERMLLLQDKKRSMV
                     EDALGSSGTENQSSRLADLLLLFSLDAGGATGSRSKRL"
     misc_feature    complement(635681..638282)
                     /note="possible transcribed region"
     gene            <636116..>636433
                     /locus_tag="CYME_CMR260C"
                     /db_xref="GeneID:16996821"
     mRNA            <636116..>636433
                     /locus_tag="CYME_CMR260C"
                     /product="similar to enhancer of rudimentaryp1 homolog"
                     /transcript_id="XM_005538461.1"
                     /db_xref="GeneID:16996821"
     CDS             636116..636433
                     /locus_tag="CYME_CMR260C"
                     /codon_start=1
                     /product="similar to enhancer of rudimentaryp1 homolog"
                     /protein_id="XP_005538518.1"
                     /db_xref="GeneID:16996821"
                     /translation="MTHTVLLLQPAAAKTTRTYYDYESIAELVDGLCHLYEQRVRAQN
                     PGMQQVEYGLGDLNRFIDELFDCGVLTYDEATRSYKPHNKAWLKEQCYRLLKARAKPA
                     NAA"
     gene            <637889..>640624
                     /locus_tag="CYME_CMR262C"
                     /db_xref="GeneID:16996840"
     mRNA            <637889..>640624
                     /locus_tag="CYME_CMR262C"
                     /product="similar to conserved oligomeric Golgi complex
                     component COG2"
                     /transcript_id="XM_005538462.1"
                     /db_xref="GeneID:16996840"
     CDS             637889..640624
                     /locus_tag="CYME_CMR262C"
                     /codon_start=1
                     /product="similar to conserved oligomeric Golgi complex
                     component COG2"
                     /protein_id="XP_005538519.1"
                     /db_xref="GeneID:16996840"
                     /translation="MRASSDKRSVAVIEALRHWGIPLNPRTGTYTPELADADARSGAF
                     VSDSSTQARVDADQGNDNTESAVDNRRIREASDWLQQLRPAVPLRLVHQNLQSVAEEI
                     RAKLTAWIEQDLGRRSSFQAEYNGDDALALETPQTAPARAGCAQPDASASGELGTLLE
                     IIQHCRQKTRFAWETLQGVYQEQCSRRDQVCTRIQQAYWATRRRWHAERLERITELAC
                     QVEEALASVDPYPPVSAAEEKSPDKATGIRDDTARTPTDESADAQTEAWHRLYIAAKQ
                     LGECFQLQEMLREDVSTADTQPMPHEPDTSPLSCEMLAGLIHTQLEQLQKRLATTLRS
                     KLVATLTSTSAGGVPEAVHWERFRELAQAYQDARLALAFESDFREAVVRPLVQRLMKE
                     ANVNTSTAPETMDTGESALIRCWQSVIAQLEQVVAVFITPAARIAMQVTGVPPATKRR
                     PSAILYLDLLGRGFWPVIADEIREAFVTKLSPADAELFHRAYCLMQRFAAHVRRARAA
                     VVPEAADLVIRHEATTAFWRCWNLAAYFQVRSTGLIERLEHVLQLSPEPVTTLDARSA
                     LCELWHADPVAWACFQRWHAQGVRCWQTLYTVAAIQVLWSGSVFVSALVSESLRLTLR
                     LIARLVVWLEQGSAAGGPFTAAECAWMMDDLHILQRQLPAAFETLWRDRVSELDEVFA
                     SPHDAGAARALPVAETFTQALEWLVNRTVPGLEQRVTALILEQCTEKMQPLRGLLAAY
                     RMMSNKPMPSRATPFIHAVLLPLDSFLKELTNPWQQQQQQQRNEVMPFTAAALQQWRR
                     RWATHIAVAVIHRYLDTGFEVVRSIEQAEAALRRLHLHDVERAADPDADRTETERTKI
                     LQQMRLDVRWLMDQLKDQQRYGGVDILLEPATPAPETPPELVRCQCRIQELLGTK"
     gene            complement(<640931..>645049)
                     /locus_tag="CYME_CMR264C"
                     /db_xref="GeneID:16996822"
     mRNA            complement(<640931..>645049)
                     /locus_tag="CYME_CMR264C"
                     /product="UV-damaged DNA binding protein"
                     /transcript_id="XM_005538463.1"
                     /db_xref="GeneID:16996822"
     CDS             complement(640931..645049)
                     /locus_tag="CYME_CMR264C"
                     /codon_start=1
                     /product="UV-damaged DNA binding protein"
                     /protein_id="XP_005538520.1"
                     /db_xref="GeneID:16996822"
                     /translation="MSTDSLEPVSVSESVAGAPAIEESAQLPLEESIGCGLYVVTAAQ
                     PSIVTHARVARFISPDQPSVLLVRLNRIEVYEVSTDSTKSHESALVAYANLPVFGRIA
                     ALEVLPGVGLCERATARGTRVASPVGALQPSERLSSLNLHGGTPRSGSKRARTSSRHK
                     VEAPLKPVPETARTVQVLPSDAGDQSTDAVFILTERLDFAVIKYDTRLQGVATLVAGS
                     LASKLGRRCPLGEFVALDPSARCLAVYAYDGLLKVVPGSLMGEAFEVRLDVVQVQSME
                     FLIGTEHPTLAIIHTDYLHNRHLVSYEILLGRQDVREGPIAQQYLDASAELIIPVPPA
                     PNDSANDGACGGFVVACDTSLALHPGRSGVAKQVIHFHGGQFAPMRCFCPISGIGGSS
                     KSASVEANRQDHFETGLEMLAAAGYHAHYLLGDRDGFLYVLSVGAEVGMRLECVCESS
                     VASAIAYLGSDLVFVGSALGDSQLVRLLPSQTESPELVQTTLFATASASSHERRESRA
                     ERAECQLWFGQVVQCYTNIGPIQDLLVTGDDSFSDGHIITCSGVSRMGSLRIIRNGIG
                     FVEHAAVELDGIKALFTLPSLTSPEWDEFLVVSFTAETRVLRLAAHDELVEVESLAVD
                     EATILAMRLPAEQLALWVTASYVGLVDLTLLERPAVAWTPPSSEQITNAVFDELHKLV
                     LVSTSNAQLYVLQQRKTSLVPVGSQTLPAEVACIHAAYGIVALGTWAESRIRLFRLHE
                     DTGNRWELECIRESALPSTSVPRSVLLTYLDDHGGLMADHGGRAHLCLLVAVGDGRLF
                     AFNVSQPDAKRSGPEPEDLSKCELQLQHPRQLRLGSRPAALNNLQLHGMRYVFAACGR
                     ASVIHAHHGTLFCGNVNLRDVTRAVRFHTKGFPDSIAVATEQGLALGGIEHIQQLHIR
                     RHDLREQPRRIAHLRGYICLLTVSIVFGEERHHVRLLNDETLETITSHDLAMNEHGLS
                     LVAIPERDVFVVGTAYVLPSEMEPSRGRILVFSREELLLLNELYTPGAVYTMSALADP
                     SDRTCRFPASAARFLAAGVNNVVILYDWGQSGHGDDYELREVARHLGHVLVLRLEARG
                     DQLLVGDLMKSLCVLQLVLPEGETSDGASPCLKAVAWDYETAWITACAFLNEDTYLAA
                     DNSYNLLSLQRNPHETRSEFRHALNRAGAFHLGDLVNVFRRGKLVTEASGNEEAGTGN
                     GHSTIDTESTRDVARASTGTTTADNVSRQTLLFATTAGAIGIIVPLDPAQHRMLSRVE
                     KALRSLTDHPAEAGAADNGHERVRRSPLTSIRLGVEGFAHADWRTPLSERALNSLHSM
                     TCFDLPRRGFVDGDLVERFRELEPTEMEFVAAQVGASIEHIKLLVDDLARLH"
     misc_feature    640988..642731
                     /note="possible transcribed region"
     gene            <645672..>646667
                     /locus_tag="CYME_CMR265C"
                     /db_xref="GeneID:16996823"
     mRNA            <645672..>646667
                     /locus_tag="CYME_CMR265C"
                     /product="retroelement"
                     /transcript_id="XM_005538464.1"
                     /db_xref="GeneID:16996823"
     CDS             645672..646667
                     /locus_tag="CYME_CMR265C"
                     /codon_start=1
                     /product="retroelement"
                     /protein_id="XP_005538521.1"
                     /db_xref="GeneID:16996823"
                     /translation="MKLLCAIPKKRTQIGLVERKFFAPEQAGFRSHEECMSHALTLAE
                     VVQRRSISGQQPIYVCFIDFQKVFDTAPHEALFLNMERAGVSGKCLAFFRALYVDSWM
                     HIRLGDGSRILSIRICHGLRQSDPTSPLLFNIFINDLLNNCRQYGLEVPWIDCGEPGE
                     ERPHGNRLAGRLFADDVVLLAPAPETLAASMQQVSAWADRWEMSIGASKCGVMVIHGD
                     SQRIRSRSWRLQNQEIPIVEKYRYLGVCLTPTLDEKAHVDEMIAKMHRGTAIARPFPS
                     DPSICIAIRTRALRMCIIQPATWGTEWCGMKHPNVSRLQTAANRAMRLVGVGCSM"
     gene            complement(<647257..>647715)
                     /locus_tag="CYME_CMR266C"
                     /db_xref="GeneID:16996871"
     mRNA            complement(<647257..>647715)
                     /locus_tag="CYME_CMR266C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538465.1"
                     /db_xref="GeneID:16996871"
     CDS             complement(647257..647715)
                     /locus_tag="CYME_CMR266C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538522.1"
                     /db_xref="GeneID:16996871"
                     /translation="MRVQLGDCTVLLSRGGCTLEVSFTWYGVGCRHGCVLELAADTGL
                     SSRHNASEKVDSGDECWRPSLRFVFVSRMRCRFATQAFDPQLALGSCTSAGPELWSRS
                     QDLPLRGWHVHLVPASERRGSIRGQFIARATAIASHLWSSSIEIQRSRCL"
     gene            <648067..>649872
                     /locus_tag="CYME_CMR267C"
                     /db_xref="GeneID:16996872"
     mRNA            <648067..>649872
                     /locus_tag="CYME_CMR267C"
                     /product="similar to U3 snoRNP-associated 55-kDa protein
                     RRP9"
                     /transcript_id="XM_005538466.1"
                     /db_xref="GeneID:16996872"
     CDS             648067..649872
                     /locus_tag="CYME_CMR267C"
                     /codon_start=1
                     /product="similar to U3 snoRNP-associated 55-kDa protein
                     RRP9"
                     /protein_id="XP_005538523.1"
                     /db_xref="GeneID:16996872"
                     /translation="MRHRRRKLPGSGHQAERRAPGRLPRFVVDAVADDESIASSEAED
                     ENAVLGESVALDGLESKKLRSLSGLRGSSTADLDPSLEQAADAESASSSEAEVSEQSR
                     RLHLAKAYLERIGAARFTEDDLHQRADEDSLEARDATALGDASDDDTDSASDAWNEVL
                     YREAQQLRGQYYASEMAFDDVESMLPAEPTLTAFGHKRPPTCITFLPDGEVLGPPRYA
                     ITGGKDGALLLWDIERGAKSIVSASATSSAGSAAKPEILCVAASRDGRLVASGSRDAS
                     IRIYDLRQRNISDDSPSIPILSLVHVARGHRGAVSGLAFFRDVFRKHAGPGVSIGVDR
                     NSTEESLFSASFDRTLRFWSIERSKAAPQSILDSGPDAEAGLYDGRNMSPWSVHYVDS
                     YYGHEEEATSLCCAAWGRLLSGGRDRTVRSWKVYDDTQLVYRAPRTAGAQIGTSIDCV
                     AWVSPTTFVSGADDGSLSLWSTAKKKPVHKILDAHKNPVCPWICSVVSPEAANLVCSG
                     SADGCVRLWRVRMQASVKASAKSAKRHGSLPESLEALGTLPFAASGFCNGIDCVLQKR
                     TLYITAAVGQEHRFGKWYVDRSLRNGLAFWRIPLA"
     gene            <650846..>651928
                     /locus_tag="CYME_CMR268C"
                     /db_xref="GeneID:16996873"
     mRNA            <650846..>651928
                     /locus_tag="CYME_CMR268C"
                     /product="similar to heat shock protein Hsp33"
                     /transcript_id="XM_005538467.1"
                     /db_xref="GeneID:16996873"
     CDS             650846..651928
                     /locus_tag="CYME_CMR268C"
                     /codon_start=1
                     /product="similar to heat shock protein Hsp33"
                     /protein_id="XP_005538524.1"
                     /db_xref="GeneID:16996873"
                     /translation="MFLSAVNCQRLEKTANDYLGSSRTLHRRAVDRRAGANAPTRWHT
                     CPHRFHLAAVTERRRARHLNEAIAGDELVTCLSKDRNVVVKAIRASGLVRTASELHEA
                     TPVAAAALGRSLLAALLLASGKKDLETVQMEFRGDGPLRAVVAIADGRGHVRGYVGDP
                     QVQLPPTAAGKLDVGRAVGRGFLAVVRNHSTWSEPYRGITEIQTGEIGDDVLHYLVRS
                     EQIPSALALGVFVQGGHVQAAGGYLVQLLPESTPETLDRVEENVLQLNKRGTPTQLIR
                     DGMDAVDIVQQLMVDIDETSLRRVQPQYSCSCDASRVRRMVALLPRDEIESILREQNR
                     LEAKCEFCGSYYELSSDETRALLRDA"
     gene            complement(<653330..>654457)
                     /locus_tag="CYME_CMR269C"
                     /db_xref="GeneID:16996865"
     mRNA            complement(<653330..>654457)
                     /locus_tag="CYME_CMR269C"
                     /product="eukaryotic translation initiation factor eIF-2B
                     alpha subunit"
                     /transcript_id="XM_005538468.1"
                     /db_xref="GeneID:16996865"
     CDS             complement(653330..654457)
                     /locus_tag="CYME_CMR269C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-2B
                     alpha subunit"
                     /protein_id="XP_005538525.1"
                     /db_xref="GeneID:16996865"
                     /translation="MANTEPYDTFRWVPVHEHGQDEDGYLLVLDQREIPHQVSYVRLV
                     DYREVAEAIRDMVVRGAPAIGAVAAYGYVLGIKSGEPEDQVYHTLYASRPTAVNLQWS
                     LDALRQLQTTNWRRLLWKANELVASERLMNNKIAAYGAEEILKRWKQRHHEGCKDETL
                     RVLHHCNTGSLATAGGGTALGVIRKLAALHGKVHVHVNETRPRLQGARLTCWELRQWG
                     IPYELSVDAAAPFLMAQGRIQFVTVGADRIAADGAVANKIGTLMIAIAAQHYGIPFYV
                     CAPCSTIDLKTPTGAAMIIEERSATEVLNPSGKSSDQWLAPVDTPVYNPAFDITPPEL
                     ITGGIVTELGILRVRDQAGAGIGLAEQLQQLEQRQKQISVE"
     gene            <654700..>656256
                     /locus_tag="CYME_CMR270C"
                     /db_xref="GeneID:16996866"
     mRNA            <654700..>656256
                     /locus_tag="CYME_CMR270C"
                     /product="similar to actin-related protein Arp4"
                     /transcript_id="XM_005538469.1"
                     /db_xref="GeneID:16996866"
     CDS             654700..656256
                     /locus_tag="CYME_CMR270C"
                     /codon_start=1
                     /product="similar to actin-related protein Arp4"
                     /protein_id="XP_005538526.1"
                     /db_xref="GeneID:16996866"
                     /translation="MFASPQTVPAIVLDVGSRTTKAGFAGADLPQSLFPSIVGSYISE
                     GGSLEGTPAKPLANTVFAGYENLLGTAERVRFLELRTAFDDDGIIQDWAAYEGLLDYT
                     FHQLRASPEEYALLLVEASHNPKRPREELCQVLFEKYGVPAVYFGRSAALACVAAGRH
                     TGVVLDCGASGVTATPVVEGNVMKQAILRSRVAGGNALTRAAAELLGGFDAVRPAYAF
                     RRRALGRGTNKRDAADPEAATEELAAAASTDGSSSSEEADDRVDLIGGRTPDTESAAS
                     VAEGRMEFRIEPLDVHGVTRSYDEYARIEVVEDFKHHVCCVNREPSSVEDVAEDGTAS
                     NAVSWETRKADDEGLAGQPADPDIPPIRYELPDGTLVSIGAERYRPAEILFKTLPHAR
                     TIKEDRPFLAYIRERERGPSSSKGLAGMVADTIQRCEGAQHREMYAGVILTGGSSVLP
                     GLSDRLQTELYFYHSRSKMHAAANPMERKYMAWTGGSILATFMDFQQNWFSRAEYLES
                     GVSLVQKRCP"
     gene            complement(<658444..>659970)
                     /locus_tag="CYME_CMR271C"
                     /db_xref="GeneID:16996867"
     mRNA            complement(<658444..>659970)
                     /locus_tag="CYME_CMR271C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538470.1"
                     /db_xref="GeneID:16996867"
     CDS             complement(658444..659970)
                     /locus_tag="CYME_CMR271C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538527.1"
                     /db_xref="GeneID:16996867"
                     /translation="MASAVSSDANGSSVAAGETGLAQAVRQRRHAVRVKQQREERARQ
                     LREAELEKERERRRRTGAQRQALSLQKHSRLMQRRDREGFWGQDAHGLLDKKRLRELQ
                     HRLINQTPPFGTLEFCEYRKLQEDALIALIDRRVAPAAAQAERRRWARALRARPASMN
                     SKRCCIVAENAADDMGSSGMAGMSLHLRAPENTEDYEFFTRLLAWRKLMQLSDARREV
                     NLRYQQLRVALDHEMTLLEQDYAAARQHLVRIALTMNAAKQAEIESRLVALASSNRAA
                     ASKSGLTDARILNNGSAAAAADATTITTTTAISGNAEGQAGNETKFQVPSLQLSRLLR
                     GGQGPAMRTRRGRNSGPNIGYLGTSDLESVHGDPSAPAASTKTNTATAAAAAAGNGQG
                     AAPAEAPAIISAADADIWVPITTPGMMLSESVRALAMPPVRTPAGWLRKSSLLKLVAG
                     SALLPEVPDSTADEQPRIRVALDGAEIQRDLRQVVNAARSLERLKRHMEEEEEEDERA
                     "
     gene            <661264..>662019
                     /locus_tag="CYME_CMR272C"
                     /db_xref="GeneID:16996852"
     mRNA            <661264..>662019
                     /locus_tag="CYME_CMR272C"
                     /product="probable cyclophilin B; CYPB"
                     /transcript_id="XM_005538471.1"
                     /db_xref="GeneID:16996852"
     CDS             661264..662019
                     /locus_tag="CYME_CMR272C"
                     /codon_start=1
                     /product="probable cyclophilin B; CYPB"
                     /protein_id="XP_005538528.1"
                     /db_xref="GeneID:16996852"
                     /translation="MRGLSGFVGSFQGVRASNQQQRCLKFEWSSNRSVLGFSQRGIAR
                     RVADAGLGRRQQQQQQQQQQQQQRQPQRLLRLFSAAAPADTSITHRVFFDFSIGGEPA
                     GRVVFGLYGKQVPKTVENFRALATGEKGFGYQGSLAHRVIPGFVIQFGDFTRGDGTGG
                     KSIYGERFEDENFAIPHETGALSMANAGPNTNGSQVFIVLDGRTTQHLNGRHVVFGKV
                     VEGMDVVRKIEENPTGRGDRPQRAVKIEACGTL"
     gene            complement(<663196..>665808)
                     /locus_tag="CYME_CMR273C"
                     /db_xref="GeneID:16996853"
     mRNA            complement(<663196..>665808)
                     /locus_tag="CYME_CMR273C"
                     /product="probable vesicle transport related protein SLY1"
                     /transcript_id="XM_005538472.1"
                     /db_xref="GeneID:16996853"
     CDS             complement(663196..665808)
                     /locus_tag="CYME_CMR273C"
                     /codon_start=1
                     /product="probable vesicle transport related protein SLY1"
                     /protein_id="XP_005538529.1"
                     /db_xref="GeneID:16996853"
                     /translation="MLKSLFRLLALHSLREHHIWMTGTRQTEKPAHIYCSSAVKVLYI
                     ISLMTASFLLLVNVESLPRAAGALDCGGIAAAAIPAYAQTHGGVDGRRLPPCLLPAGS
                     QPQEATMLTRAEPSRHSDLATQLKSLAKTWFSLRDRQKAVLCEALGNPLRGAEAATGH
                     SAANGALHGQLNPGYDAAAATVDDLDAEDVYRDFWKVLVIDQTAREVLAPVLKVPTLR
                     TCGVTLHLNLESSRQVIPEVPAVYLIQPNHENIQTIVRDCAADRYAHCSIYFLSAISR
                     DELERLAEALARARRIESVTRVVDLYCGFVCLKRNLFSMPPSIARRSFRRLFSAQADE
                     QAIQETIATIVDSLFAVCVTLRCVPYIRCLRRGASERVALQLCAKIWEYMHTPGGAAL
                     FREHSEAGLPPLRRPLLALLDRDVDLAIMLHHGWTYEALIHELLPFELSRVSMPATKP
                     GTERTQYDLDDEADPFWAENASLPFPQVAEHIETALTAYRAQVQEINARSGGGSNVQK
                     LLAETADETQLEAYMQATGTSTREIADAVAELPRLTRWKRQLDMHTNIASALLEQIKA
                     RKLDLLFQLEDSLLERPSSVQSNSLDRIIGEADLLAKPPSSTASADASSLSQRARDCL
                     RLLLMYQILSPSGIPQTKLAEYCHVLDICGCQTSALSYVMRQRAATPRQLDPAATHRD
                     GNSPSPARKSSSRMIDRLTTATGGGREIFESLVTRIYEHGHKGLTQLASTVKGLIPTT
                     RSGIVASIVDSWMRNASPDDDLDSASRGAEHEHPGAAAERAASLLLDPLAARDGHCTN
                     KASSLPRGSFTEAIVFMVGGGNFIEWENLTTRIHDDRQIIYGTTEMLSPEAFLDDLTA
                     AAAAATNVSGSHAP"
     gene            <666240..>667580
                     /locus_tag="CYME_CMR274C"
                     /db_xref="GeneID:16996854"
     mRNA            <666240..>667580
                     /locus_tag="CYME_CMR274C"
                     /product="similar to DNA topoisomerase VI subunit A"
                     /transcript_id="XM_005538473.1"
                     /db_xref="GeneID:16996854"
     CDS             666240..667580
                     /locus_tag="CYME_CMR274C"
                     /codon_start=1
                     /product="similar to DNA topoisomerase VI subunit A"
                     /protein_id="XP_005538530.1"
                     /db_xref="GeneID:16996854"
                     /translation="MRTGPQISAAAVTKWTCWQRQRQLERMAVWIVASLAAPGAKQVR
                     EARYEHRPRFSTEAVPLWKLTMLLVRLYHSSWHAGSRESTYLRELFYRLVPVFDSQQE
                     LTQYLDRLLAAARISRFSLGIIAESRGWVFFGSGIQLQKRSIENERPRYVQSEAANAR
                     LCTPHRGLMPIPDDIVLDPGAYQLVVEPRQDLVVVILIVEKFGVFRCLVDEGFASILP
                     VLTILVTGGGQPSLATRALVAQIARCLEAHHAAFRSTNAPHTYPRFDIYVITDYDPYG
                     LCIARQYRRSLAAALPQFTADSKFTRLPRWIGPRACHLFRARSSRANCELLRAKSEAD
                     QSPLMRGPMPSQRALVLARNIFAEAVLQGDSLVAEELHHMIGSQLYTDPSMLKLARNL
                     PWIDGCPGAAGDGIGTHDLHTLVLLLGPGGFARDFLPRLILETRQEELRKSLGL"
     gene            complement(<667631..>667945)
                     /locus_tag="CYME_CMR275C"
                     /db_xref="GeneID:16996868"
     mRNA            complement(<667631..>667945)
                     /locus_tag="CYME_CMR275C"
                     /product="transcriptional regulator bolA"
                     /transcript_id="XM_005538474.1"
                     /db_xref="GeneID:16996868"
     CDS             complement(667631..667945)
                     /locus_tag="CYME_CMR275C"
                     /codon_start=1
                     /product="transcriptional regulator bolA"
                     /protein_id="XP_005538531.1"
                     /db_xref="GeneID:16996868"
                     /translation="MRAAMRTLAPVRERIESKLRSALQPQVLRVVDESDLHEGHASKP
                     AHGETHFRVAIVSAQFVGLSLRERHRRVYQILEQELAESVHALQLETRTPAEASDLLA
                     SK"
     misc_feature    668662..669310
                     /note="possible transcribed region"
     gene            complement(<669293..>670552)
                     /locus_tag="CYME_CMR276C"
                     /db_xref="GeneID:16996688"
     mRNA            complement(<669293..>670552)
                     /locus_tag="CYME_CMR276C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538475.1"
                     /db_xref="GeneID:16996688"
     CDS             complement(669293..670552)
                     /locus_tag="CYME_CMR276C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538532.1"
                     /db_xref="GeneID:16996688"
                     /translation="MITRSRSKRYQSEDGCPVSSQDTLELGSADRLTVEIQTPGRGQR
                     ERRGAHSRGDPTGTSSACVTPQQTIKVLGLESPGLPSAEFGLGVHSGPTCAGGVESVP
                     LTARAARELRRLGFDVPSPLPSRTSKGTPHVRATKACHMDSELTPASLQKPIATAMPA
                     VTLDTPDSARSLCAERSSENAGTSAACTGAASERITELERTLWQAAKRNDEQRSPLCT
                     RYAGCPYDDIEKLEKPRIGASSVVVAMNAQESREATEETHSVQPARSVSSHDAFEDDA
                     ALARPAQENEPSRSEAREPDARHQRQGSPQQNKTKISAGRISVNGGACNSPNVSEFTR
                     VCPPSVSPLKSGIADSTQRSRSKRVPKMNGLRQESAFACGKSPGTSITLVLHHQFRAS
                     AYAPWRLRWRRRFGRRRRYHGRWLIVY"
     gene            <671749..>672546
                     /locus_tag="CYME_CMR277C"
                     /db_xref="GeneID:16996870"
     mRNA            <671749..>672546
                     /locus_tag="CYME_CMR277C"
                     /product="lipoate-protein ligase B"
                     /transcript_id="XM_005538476.1"
                     /db_xref="GeneID:16996870"
     CDS             671749..672546
                     /locus_tag="CYME_CMR277C"
                     /codon_start=1
                     /product="lipoate-protein ligase B"
                     /protein_id="XP_005538533.1"
                     /db_xref="GeneID:16996870"
                     /translation="MRTKCILRTLQAATVQAVPKYEPRECWFYDFGDRLLPYEPVHRW
                     QQQLRAIRLGRSGEAPATTLRFPDAFMLLTHTPVYTLGTAASPGDLGSALQEASCAVV
                     RTERGGKVTYHGPGQVTGYAVMNLRRYRCDLRWYVSLLEEVVIRCLRDFGIPGERRSD
                     HHGVWVAGGTRKIAFIGVSVSRWVTCHGFALNVNREVLPPFRRIVACGLDGNTVTCMQ
                     DLLPHPNTCSAEQVRNSLATHFSELFDVALKPYASSAASGTDSRSGT"
     gene            <673413..>673988
                     /locus_tag="CYME_CMR278C"
                     /db_xref="GeneID:16996887"
     mRNA            <673413..>673988
                     /locus_tag="CYME_CMR278C"
                     /product="probable ferredoxin"
                     /transcript_id="XM_005538477.1"
                     /db_xref="GeneID:16996887"
     CDS             673413..673988
                     /locus_tag="CYME_CMR278C"
                     /codon_start=1
                     /product="probable ferredoxin"
                     /protein_id="XP_005538534.1"
                     /db_xref="GeneID:16996887"
                     /translation="MKRTAFAPGLPLNRRRLVRTAPRATGAGTARKPAQRPLVAGTTA
                     SNGAAPVRGIATRKRRGGALPGDPAAPKHNVTILNYRDDESLTLAVPEDRYIWWYFRE
                     NGYELPSSCLNGCCTTCAAKIVRGSLEQPEALGLTREFRDKGYCLLCVSYPRSALVLV
                     LQSEDEVYEQQWATTFESGGKRWGGLIPEED"
     misc_feature    complement(674240..674581)
                     /note="pseudo-gene of apurinic endonuclease-redox protein"
     gene            complement(<675041..>675994)
                     /locus_tag="CYME_CMR280C"
                     /db_xref="GeneID:16996889"
     mRNA            complement(<675041..>675994)
                     /locus_tag="CYME_CMR280C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538478.1"
                     /db_xref="GeneID:16996889"
     CDS             complement(675041..675994)
                     /locus_tag="CYME_CMR280C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538535.1"
                     /db_xref="GeneID:16996889"
                     /translation="MDRDTFCRDGVVTDDVADVSWRPGQRSVSTTTELDAQPDVDTAS
                     DSHAKALTPAGTEARKRCSQCENQHEAVYKCPVCQRRLCSLDCYRGHREAGCSGRLET
                     TRYAFIPRTDYDLKQLLRDYAFLEDLELRQQSHKRYVQQILSGGGSVPRLRGPTAAED
                     HARRRRLAAVQRAATKRGIRLQLLPEVFSKHRRNTSMYRSAADCIEWRIECFVSVAAQ
                     APNDSVLALDRCPEHVTMAEALERLQIRRFVADTEHFSVYLKSDRANQPRVPIPKMED
                     VRIADVVRAAECLIEFPTLEVVADEQTNGQHPAEQPVSNVQ"
     gene            677292..678872
                     /locus_tag="CYME_CMR281T"
                     /db_xref="GeneID:16996890"
     misc_RNA        677292..678872
                     /locus_tag="CYME_CMR281T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461625.1"
                     /db_xref="GeneID:16996890"
     gene            complement(<678348..>681554)
                     /locus_tag="CYME_CMR282C"
                     /db_xref="GeneID:16996883"
     mRNA            complement(<678348..>681554)
                     /locus_tag="CYME_CMR282C"
                     /product="glycine dehydrogenase, mitochondrial precursor"
                     /transcript_id="XM_005538479.1"
                     /db_xref="GeneID:16996883"
     CDS             complement(678348..681554)
                     /locus_tag="CYME_CMR282C"
                     /codon_start=1
                     /product="glycine dehydrogenase, mitochondrial precursor"
                     /protein_id="XP_005538536.1"
                     /db_xref="GeneID:16996883"
                     /translation="MFRLLLTRVSGSVTRRRALGADTQRWLNSARSRYHTGNSVVGAP
                     VRGVGVAGAYHSLRSALSWRLQAEFRRGASSSAFAPLDLFYKRHTGSGNPEANEKMLQ
                     VLGVKSIEELMDQTIPKSIRTTRKLSVGPKRAESEVLAELRQIAKQNELRRNFIGCGY
                     YGTIMPPVIQRNILENPAWYTQYTPYQAEVAQGRLESLLNFQTMVGDLTGLPIANASL
                     LDEGTAAAEAMSMCAAVSKRKKLRFFVDKDVHPQTIAVMKVRAEPMDIELVVDNWQQV
                     QWDGADLCGALVQYPATDGTIHDYTSFVENAHAHGTRVVVASDLLALTMLRPPGEWGA
                     DIAVGSAQRFGVPMGYGGPSAAFFACRDDLKRLMPGRIIGISRDAQGKPALRMALQTR
                     EQHIRRDKATSNVCTAQALLANISAMYGLYHGPDGLRAIANRVQRFARTFAAAVGVGV
                     SEKAAIFDTVRIDYPTTEAAQAVLARCDAAKLNVRSLGPRSISVSFDETHTRDDLQEL
                     VSAFRGPQRPCSGEELEQIAASLPPSGFGGLEPNLAQAFERTTAYMTHPVFHEYRTEH
                     KMLRYIHQLAAKDLSLVHSMIPLGSCTMKLNATSEMIPVSWPEFSLPHPFTPPEQLRG
                     YQRLFADLERDLADITGFAAVSLQPNSGAQGEYAGLMTFLAYHKARGQHQRKVCIVPT
                     SAHGTNPASAKMAGMRIIPVGTDAQGNIDIAELRARAEQHRDQLAAAMITYPSTHGVF
                     EEGIKEICDIIHTNGGLVYIDGANLNAQMGLTSPAEIGGDACHLNLHKTLTIPHGGGG
                     PGVGAIAVTEALAPFLPSHPVRPVASAHPDTAIGPIAAAPYGSASILPIVWMFVKMMG
                     SDGLREASEQAILNANYMAARLSPAYPILYRGKHGRCAHEFILDLRPFKLSAGVTESD
                     VAKRLQDYGFHSPTMSWPVAGTLMIEPTESESIDELDRFCDAMLMIREEIRQIEQGRW
                     DPQHNPLKYAPHTAEVVSADTWDRPYPREIGAFPASWLYARGKFWPRTSRIDDVYGDR
                     NLVCSCPPVPEMMHPSTTGSAARSGTDEGRVRTAVASS"
     misc_feature    682111..684170
                     /note="possible transcribed region"
     gene            complement(<684625..>687039)
                     /locus_tag="CYME_CMR284C"
                     /db_xref="GeneID:16996885"
     mRNA            complement(<684625..>687039)
                     /locus_tag="CYME_CMR284C"
                     /product="similar to arsenite translocating ATPase"
                     /transcript_id="XM_005538480.1"
                     /db_xref="GeneID:16996885"
     CDS             complement(684625..687039)
                     /locus_tag="CYME_CMR284C"
                     /codon_start=1
                     /product="similar to arsenite translocating ATPase"
                     /protein_id="XP_005538537.1"
                     /db_xref="GeneID:16996885"
                     /translation="MEHQRLPGFVGLSIPVAALNDQVLLRSTRLAGTQQAVLCVARVD
                     AGHWTLSRGWALRTNALVVTEALPSGEARTWLRTRGFPGAALTRKTLTRKQNNESRSG
                     RERVAHAGREQVSCSSLANALDVSESPLAHLLRTDTTTRICLFTGKGGTGKTTTSAAV
                     AHRLASAGLRTLVVSTDPAHSLGDALGVDLGTEAASLDELVLIEPASQGRSSVRGQVQ
                     RVAPNLDALEIDITAAAEEFKALISTQRLIDLNKLGLADVQELLDTVPPGADEFVALS
                     LILDLLERYDRVVIDTAPSGHTLRLLSFPDFLDSFLGKLLQLRGKLGVILNTVSGSVN
                     RKQWEEAASKIGTFQQRMQQLGSLLRDEKSTEIVVVTIATELAVRESLRLIDELTHKR
                     SLSVSAVIVNMVLQPSAKGAYIHSMQSAQQEFLERLHQRLGATHGYDIVQVPIFDTEI
                     RTVYGARAFAACLSPLWSDEKPRLRKVVLTAAKGGCGKTTTAGAIGVHLADTGQRTIV
                     VSTDPAHSLGDLFDVKAPSGSYLNDVTLIAENLSILEVDAERALIEFRETLESLRSAK
                     ILGLDLDIGDLGNLFDALPPGIDELVALSRVVNLISSEYDHIVIDTAPTGHTLRLLAF
                     PDFLDGLLGRILRLKSKLDGITQFFSGLGGRSDRTEPELTPAQRLSRFREQLMELRDL
                     LHDPERSEVVLVTRPTYLNVVETERLAQALARQRIASHRLVINQVVPPTLRDLERFVH
                     RLVREHGQQTERLQQALPSQTRRSGVSPLIVVPYFDREVRGEAGRSDGGLELFARYLF
                     RDSASD"
     gene            complement(<688458..>688904)
                     /locus_tag="CYME_CMR285C"
                     /db_xref="GeneID:16996886"
     mRNA            complement(<688458..>688904)
                     /locus_tag="CYME_CMR285C"
                     /product="mitochondrial ribosomal protein L18"
                     /transcript_id="XM_005538481.1"
                     /db_xref="GeneID:16996886"
     CDS             complement(688458..688904)
                     /locus_tag="CYME_CMR285C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L18"
                     /protein_id="XP_005538538.1"
                     /db_xref="GeneID:16996886"
                     /translation="MSTQRSGKLWYQARGFAKRVRHWEALPHRVILTLTSRHVKAQVV
                     NWRKGTVDAEASSLQEPIRLGNAPELASETSSETVSGECAQAELVGYQSASTEAARRV
                     GLVLGKRACAAGIRQAQWSQPGRFHGKIRAFYEALCSTGFKLKTER"
     gene            complement(<689650..>690474)
                     /locus_tag="CYME_CMR286C"
                     /db_xref="GeneID:16996880"
     mRNA            complement(<689650..>690474)
                     /locus_tag="CYME_CMR286C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538482.1"
                     /db_xref="GeneID:16996880"
     CDS             complement(689650..690474)
                     /locus_tag="CYME_CMR286C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538539.1"
                     /db_xref="GeneID:16996880"
                     /translation="MANSKYEYIKAFESRDEIIPDVFFAVRVDGRVFRKFAERHGLEK
                     PVDERLVTLLNETAGHVMQAFSGQVGIAYGHSDEYSFIFRRDATIFGRRTSKLLSVTV
                     SLFTSAFVCGWAGHLGGSTPLRDTPSFDARLVVLPSFRHVRDYLAWRQVDCHVNCQYN
                     TAFWLLVQKDKLSLDDAHKTLRGTDTGMKNEIMWQRGVNYNNLPQVHRKGTVLVWDRA
                     LDVPDDRALPKPEAVCADRVAGARRIICLHCDLIRAPDDDLLLFGSLQNPDAEALR"
     gene            <692155..>692925
                     /locus_tag="CYME_CMR287C"
                     /db_xref="GeneID:16996881"
     mRNA            <692155..>692925
                     /locus_tag="CYME_CMR287C"
                     /product="60S ribosomal protein L8"
                     /transcript_id="XM_005538483.1"
                     /db_xref="GeneID:16996881"
     CDS             692155..692925
                     /locus_tag="CYME_CMR287C"
                     /codon_start=1
                     /product="60S ribosomal protein L8"
                     /protein_id="XP_005538540.1"
                     /db_xref="GeneID:16996881"
                     /translation="MGRVIRGQRRGAGGIFKAHTSKRKGPVKLRPVDFAERNGYIRGL
                     VTAIEHDPGRGAPVAIVEFQDPYRYKKRKERILAVEGMYTGMSVYFGKKAVLAVGNTL
                     PLSSMPEGTIVCNLETKEGDRGTLARASGMYAVVVNHLENGKTRVRLPSGARRLVSSS
                     CRATVGVVAGGGRTAKPILKAGRAYYKYKAKRNEWPRVRGVAMNPVDHPHGGGNHQHV
                     GHPTTVARGSVPGQKVGLIAARRTGRISGTRETRVKEE"
     gene            complement(<693356..>694474)
                     /locus_tag="CYME_CMR288C"
                     /db_xref="GeneID:16996882"
     mRNA            complement(<693356..>694474)
                     /locus_tag="CYME_CMR288C"
                     /product="probable molybdopterin synthase Cnx2"
                     /transcript_id="XM_005538484.1"
                     /db_xref="GeneID:16996882"
     CDS             complement(693356..694474)
                     /locus_tag="CYME_CMR288C"
                     /codon_start=1
                     /product="probable molybdopterin synthase Cnx2"
                     /protein_id="XP_005538541.1"
                     /db_xref="GeneID:16996882"
                     /translation="MSLVMRPITDSFGRVHNYLRLSLTERCNLRCQYCMPATGVPNLA
                     PSAECLTASEIAALAEHLVRQRGIRKLRLTGGEPLVRKDVEQVLDALAPLSAASSTNA
                     AVGTGSGGSPVVALSMTTNAVLLERHLPTLQRCGMRSVNISLDTLRPERFTILTRRSG
                     EIFLPRVLRAIRRAVQAGLDVKVNCVVMRGINDDELLDFCEYFASMETVLRPGRLQAV
                     RFIEFMPFSGNGWESNRFVPYAEMLQRLRGRFEPESREQVQRSLDPHDTTKYWAYRGD
                     GDSALRVGFITSMSNHFCAGCNRLRVTATGHLRTCLFGRTEYGLRHLIQRGDWQELDA
                     VIDAAVARKAFAHGGARDPLRDLPRRTENDRPMTAIGG"
     gene            <696715..>697621
                     /locus_tag="CYME_CMR289C"
                     /db_xref="GeneID:16996877"
     mRNA            join(<696715..697225,697296..>697621)
                     /locus_tag="CYME_CMR289C"
                     /product="NADH dehydrogenase I iron-sulfur protein 75kDa
                     subunit"
                     /transcript_id="XM_005538485.1"
                     /db_xref="GeneID:16996877"
     CDS             join(696715..697225,697296..697621)
                     /locus_tag="CYME_CMR289C"
                     /codon_start=1
                     /product="NADH dehydrogenase I iron-sulfur protein 75kDa
                     subunit"
                     /protein_id="XP_005538542.1"
                     /db_xref="GeneID:16996877"
                     /translation="MYSLTKLSRQLWKLERTSVRSFFVERAFTLGTRSTRGRLSTSAS
                     VSSSAQPATAAATAPEPPKPPPKPDHVRLKIDGREVEVPRASTVIQACQAAGVNIPHF
                     CYHERLSVAGNCRMCLVEVEKMPKLAISCALPVMDGMSIITDSPRVKKSREAVLEFLL
                     KSHPLDCPICDQGGECQLQELSMVFGSDRGRYYEYKRTVDDKYWGPLIKTVMTRCIHC
                     TRCVRFAEEVAGVADIGTAGRGESTEITMYLPEKFFQSELSGNVIDLCPVGALTRKRY
                     EH"
     gene            complement(<698334..>699140)
                     /locus_tag="CYME_CMR290C"
                     /db_xref="GeneID:16996878"
     mRNA            complement(<698334..>699140)
                     /locus_tag="CYME_CMR290C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538486.1"
                     /db_xref="GeneID:16996878"
     CDS             complement(698334..699140)
                     /locus_tag="CYME_CMR290C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538543.1"
                     /db_xref="GeneID:16996878"
                     /translation="MQFSRETPSLAQTIYTPNGMRSSVSVTVREIRDVEVGMFPRRLF
                     VRVWLDTSFQLRMNEETEFATNVVTFRRKSRGPQRFCLESGQCNAFTLPDFVIVCDIC
                     EMRHGFCCTETSEVVSRVRIPLSRIKFDTSGRSELWYSFHYPLKKGRARAGRFAGRIL
                     VAIQYDVDTVRDTVTTGALSPRSRAVTPSPQLAYPCDASALWTAMENGKWVPPGPALV
                     GEPRGAPGTDGPLALHPTWATSVNPNGSTVSQPLGLMDGPKHRPISTLTS"
     gene            complement(<701239..>703302)
                     /locus_tag="CYME_CMR291C"
                     /db_xref="GeneID:16996879"
     mRNA            complement(<701239..>703302)
                     /locus_tag="CYME_CMR291C"
                     /product="ATP-binding cassette, sub-family G, member 2"
                     /transcript_id="XM_005538487.1"
                     /db_xref="GeneID:16996879"
     CDS             complement(701239..703302)
                     /locus_tag="CYME_CMR291C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family G, member 2"
                     /protein_id="XP_005538544.1"
                     /db_xref="GeneID:16996879"
                     /translation="MGDVYENGTGDEEAGATAAHRNEEINATGNRDSYVPFDPLKSHV
                     DDEFAEFSTDAGQGSFFEGQRMESKSVEVSLIQQHTFSMNWHDLCLSVRLKTGGPFKR
                     SKETVVKPILKGITGYARPGQVLAIMGGSGAGKTALLSMLGGRIPVGEYEISGELRIN
                     GHERDVNMFRRYTGFVEQDARVFADLTVREQIEFSAQCRLPASMPIEKKMRRVEQVIT
                     ELGLANATNTLIGNAVQRGVSGGERKRVNIGIELVTNPPLLLLDEPTTGLDSFQAQAV
                     MLTMLRLARRGRTIIATIHQPRSQIFQMFDYLLLLSEGHQIYFGPAKDMVPYFAALKY
                     PCPAYFNPADFALDLISLNARSKTLEKQTRARISYLANRFLEHKSEASLPLDDPLGAI
                     GDLHTKVTRKGVSLFSSQGEPNYAEPWPVQFGLLVKRSFKLMVREKGTNFARFFQTII
                     FSVVLGLIWLNTGRNSSDLNAVPGVLFFLLINQAFGASFGVVFLFPLERGIVLRERLS
                     RFYRVSAYFLAKSVAELPRLVVLAILFACITYWMVGLQPHPSSFFIFVVLVLLTAHTA
                     ESLTLMASASASSPQTAAAIAPVLIVLSLLFGGFFIGPDVIPVWLRWLRFVSFIYYGF
                     AAVMDNEFGYIPRSNTNNPLVTYNINSFGIGGNIGFLIMLDVAYRAIAFVFLLYNKPR
                     LQKSI"
     misc_feature    701797..703014
                     /note="possible transcribed region"
     gene            <705339..>706031
                     /locus_tag="CYME_CMR293C"
                     /db_xref="GeneID:16996919"
     mRNA            <705339..>706031
                     /locus_tag="CYME_CMR293C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538488.1"
                     /db_xref="GeneID:16996919"
     CDS             705339..706031
                     /locus_tag="CYME_CMR293C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538545.1"
                     /db_xref="GeneID:16996919"
                     /translation="MQRYVTTILSVLLLCGLLFSAPGAIRAEIELSLVELPLDLHHSM
                     PNYPSGNFPAPSPLLPHPPVYDENRTATLMLTGAQVQNSNNAGQNDFGVGGEITFSSG
                     IKYATVFPNEAPGTFKVVNATELLSNISFAYFVYYKHPLAQYASLNFPASNPVASLYQ
                     PNQRSPNYTAGAVVIKQSNVMPSSHGSIYVSFNVYDPQNTSRVPNIPSSLLDMGVLSI
                     LDVPCSGAGIEC"
     misc_feature    complement(706267..706637)
                     /note="possible transcribed region"
     gene            <706615..>707667
                     /locus_tag="CYME_CMR295C"
                     /db_xref="GeneID:16996910"
     mRNA            <706615..>707667
                     /locus_tag="CYME_CMR295C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538489.1"
                     /db_xref="GeneID:16996910"
     CDS             706615..707667
                     /locus_tag="CYME_CMR295C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538546.1"
                     /db_xref="GeneID:16996910"
                     /translation="MCLRVPVLVFGTSCSAHTRKHRQIRRCLCNPNRVSFGCATRAAA
                     ACSAHADTCTLDTQFGHYRGPGSGPCQTGISTLCVALDRCQCESSCAIAFVLISRSAR
                     VSYKDSVHCACTMSRRHALGSVVLLVLLLVGIRCCISAAVWPRSEIDTALLEEVLGSV
                     RVTESHDHESMEGVPSPLPSTPPVYDMNRTATVVITGTQVVNSNGAGEGPYAYGLGIS
                     FLSGIRYATVYPNNDPGSFRLINATALLKNNSFLYFIYYKSPIAQYSAENSAGRATVA
                     DLYTENQTNPDFVSAAVMIKRLRTTTGNHGEFSATFSVFDPHNTSALPNIPNSLLDFG
                     VLGIQNVPCENAGISC"
     gene            complement(708453..711884)
                     /locus_tag="CYME_CMR297T"
                     /db_xref="GeneID:16996911"
     misc_RNA        complement(708453..711884)
                     /locus_tag="CYME_CMR297T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461626.1"
                     /db_xref="GeneID:16996911"
     gene            <709457..>710170
                     /locus_tag="CYME_CMR296C"
                     /db_xref="GeneID:16996913"
     mRNA            <709457..>710170
                     /locus_tag="CYME_CMR296C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538490.1"
                     /db_xref="GeneID:16996913"
     CDS             709457..710170
                     /locus_tag="CYME_CMR296C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538547.1"
                     /db_xref="GeneID:16996913"
                     /translation="MALSCFCAKRTFQSFDRTPLPEYEENKRKVNAIESSLGRLIRDL
                     EAVQSNWVRLGDVLKAFASDLSGALPESSSENVKDTSEKLAKSSEEVGNELRQTLTAE
                     KASPSSKILSYLKEFRKRLAECKQKSSKMENLAKDYDARRAVVDDKEKANTPEPKLQR
                     VRDLMYEAEMKFREAEKNVLQLQKSIIDDAPFAFEAAMVGLATILADRSRLLQEKGTT
                     FRTIRDAQLDAVLKRIDST"
     gene            <712219..>713628
                     /locus_tag="CYME_CMR298C"
                     /db_xref="GeneID:16996912"
     mRNA            <712219..>713628
                     /locus_tag="CYME_CMR298C"
                     /product="heat shock protein DnaJ"
                     /transcript_id="XM_005538491.1"
                     /db_xref="GeneID:16996912"
     CDS             712219..713628
                     /locus_tag="CYME_CMR298C"
                     /codon_start=1
                     /product="heat shock protein DnaJ"
                     /protein_id="XP_005538548.1"
                     /db_xref="GeneID:16996912"
                     /translation="MAPRSGFVPVTGERLLWRSRGSLGGVPSRGLPPDNPIRSGGWGA
                     FCSRRFSERACPARILRCTPARNRASSRRGVLSLRAEEDYYARLGVSRNAAADEIRRA
                     FRQKARMLHPDVNKAPNAKEEFQKLSEAYEVLSDENLRKRYDMFGEAGVKGAAASSGG
                     GPTGFADFADLGGLGDIFDQFFGGAASGRARARRSGPEPGEDLRLDLEIDFEKAIFGG
                     EEKIRISHLETCETCSGSGMRPGSSPRMCTMCGGAGVVTQVARTPLGAFQSTQTCPNC
                     RGAGEVVDEYCGTCGGRGRVQTQKQLMLTIPAGVDDGSRLRVRSEGDAGTRGGPPGDL
                     YVYIKVRPHPEFRREDLDIYSEFTVSYLDAILGRRIRVNTIHGPVEVSLPPGTQPGTV
                     LRIADKGVPKLGSPTRRGHHYLTIKVSIPKQLSDAERKLIEELDRLRKEDAHQNGSAS
                     GTDDKKRGGIFGGFGPKMK"
     misc_feature    complement(716030..716981)
                     /note="possible transcried region"
     gene            <717273..>719084
                     /locus_tag="CYME_CMR299C"
                     /db_xref="GeneID:16996689"
     mRNA            <717273..>719084
                     /locus_tag="CYME_CMR299C"
                     /product="stress-induced phosphoprotein STI1"
                     /transcript_id="XM_005538492.1"
                     /db_xref="GeneID:16996689"
     CDS             717273..719084
                     /locus_tag="CYME_CMR299C"
                     /codon_start=1
                     /product="stress-induced phosphoprotein STI1"
                     /protein_id="XP_005538549.1"
                     /db_xref="GeneID:16996689"
                     /translation="MVEPGADGDAALAEQRKQQGNEAFAARDFDAAVRYFSEAIELDP
                     SNNVLYSNRSAAYASMGAYEEALADAERCIELAPQWPKGYSRRGAALAGLGEFDQAEE
                     AYRQGLSIDPDNAALKKGLDELAQLRQRGPDSGAGAAGGFPAELLRALATNPRARELL
                     QDPSILSALQGLNDPSKLMEVLRNPKIQEIFNLISGTQGQASQQSSSSSIFGTDAGGR
                     DIEGAPGHEQGTDETLNASAPGDNVEAASEAPRAGPEQAVANGDTAMNAADSDDDGDA
                     DKSSRAEAEREKELGNAAYKQRKFEEALKHYRRAQELNPRELVYILNEAAVYFEMKDY
                     QKTIELCQWAIDRNQEENLGADFPVIAKAYARIASAYDRLGDFDAAIKAYEKSLVEHH
                     DPRVAMKLQDCRRRKKKHEEEAYIDEEKSQKAREEGNAAFKAADFPKAIEWYTEAHRR
                     NPRDPVPLSNRAAAYIKLGEIPSALRDIDKALELDPKFVRAYVRKGQAHMLMKEYHKA
                     LDAYEKGLELDPNNAELREGYAKVLVAIQSTDHDPARAERAMSDPEIQSILMDPQMGI
                     LLKNMESDPSAVQSAMSNPGVARKIRKLIAAGIIRTA"
     misc_feature    719487..723706
                     /note="retroelement, dead"
     gene            <724033..>725316
                     /locus_tag="CYME_CMR301C"
                     /db_xref="GeneID:16996908"
     mRNA            <724033..>725316
                     /locus_tag="CYME_CMR301C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538493.1"
                     /db_xref="GeneID:16996908"
     CDS             724033..725316
                     /locus_tag="CYME_CMR301C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538550.1"
                     /db_xref="GeneID:16996908"
                     /translation="MSSRGLQTGEVGCDTLASDAPDEPASTSSSSPSSFTRPRRNVAH
                     AHKNAAKGKVLAPGRFHELFRKYLHKFRGKACYIDPEMPASWARAARRAVYAYGARLQ
                     PYFDAALYCVITHRAPGDCSPTLERARRWRIHLLHCTDGRVQRWIRVGEYAAEWALAG
                     LRASADVHCIGTADGKENTPAPVASRWRRRGVSSVPAVKPDILKLPRASGPEACLAPS
                     NDPHRSRCTGTPLQWPSQHALVCTEVLTLTPTASNALSISGVERIAEAGASAITPIAT
                     AASVLRSARETSTCLEQGGAAMSAEEPMHSGYCELCSTRFQHYAVHLKSSEHSRRSRR
                     IDWRPLDALAMAIYTERLRERSSLARAIAASVPVSPISSRDSSVISDMSSSLGAASFI
                     AKQQAGGKGSESPTGPLLYAAAASEDSVRNRLLVG"
     gene            <727003..>727797
                     /locus_tag="CYME_CMR302C"
                     /db_xref="GeneID:16996909"
     mRNA            <727003..>727797
                     /locus_tag="CYME_CMR302C"
                     /product="20S core proteasome subunit alpha 3"
                     /transcript_id="XM_005538494.1"
                     /db_xref="GeneID:16996909"
     CDS             727003..727797
                     /locus_tag="CYME_CMR302C"
                     /codon_start=1
                     /product="20S core proteasome subunit alpha 3"
                     /protein_id="XP_005538551.1"
                     /db_xref="GeneID:16996909"
                     /translation="MSRRYDQRVTTFSPEGRLYQVEYALEAISHAGACLGILCSDGVV
                     LAAERRNLSKLLDKRGRITRASEKMYEIDNHIGCAVAGITADANALIQKARLFAQRYL
                     YTYNEPVPVEYLVQQIADAKQSYTQFGGLRPYGVSFLFAGWDRHLGYQLYNSDPSGNY
                     GGWKAIAIGQHHAAANSMLRQEYPENPEAMPTMKDGMRLAAKVFAKTIDLSILDVEKL
                     EFTRVCPLDACTNANILFHNVSDEELKSAFEEVKRELAQASGTENT"
     misc_feature    complement(728266..730110)
                     /note="possible transcribed region"
     gene            <729378..>730406
                     /locus_tag="CYME_CMR304C"
                     /db_xref="GeneID:16996901"
     mRNA            <729378..>730406
                     /locus_tag="CYME_CMR304C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538495.1"
                     /db_xref="GeneID:16996901"
     CDS             729378..730406
                     /locus_tag="CYME_CMR304C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538552.1"
                     /db_xref="GeneID:16996901"
                     /translation="MFVSSGNAFVPSGKPLTRAASQRRGARHKNQVCCKLPLGKSRLW
                     NRLLECFSLPPETSFRKAVRCLGLTNSLVITCWCCLHATVVAPALAVNGLVDHPLTQP
                     LRNKYYLVRAGESIADARGMVESNPVDKTSIAKSGLTARGAQQARAAAEQLVKKLGFC
                     QQTSQCWIWPSMTLNAYETGEIIGDKAALGHERIVPEFSYLDKRGLGVYNGSISSDVI
                     PRLHAQDRADAQYRPPAGDDGTPPESIFDVFIRVRQLLSKLETQYGTQGADVVIVAPD
                     TYTLSVLECVMNGEPLERFEQHLFAPGEVHFVANPKVFPIRDETLPHERVNWANIESV
                     RHGSASGG"
     gene            complement(<730698..>731960)
                     /locus_tag="CYME_CMR305C"
                     /db_xref="GeneID:16996902"
     mRNA            complement(<730698..>731960)
                     /locus_tag="CYME_CMR305C"
                     /product="similar to pleiotropic regulator 1"
                     /transcript_id="XM_005538496.1"
                     /db_xref="GeneID:16996902"
     CDS             complement(730698..731960)
                     /locus_tag="CYME_CMR305C"
                     /codon_start=1
                     /product="similar to pleiotropic regulator 1"
                     /protein_id="XP_005538553.1"
                     /db_xref="GeneID:16996902"
                     /translation="MSDAASNERRLRELVQWNSVFTQRLFGEPGRSALRPQRPKAGAD
                     VPDWLTKLRGTLSTQPATAAGVHEPPRTGPGVVVQAAATWALSPATRSTWYPWTLYRQ
                     VWVENSWPVALDVASDNVTFAAGVWDRSIRLFDLASGLVVHTFRSESQLLGPVRVLRF
                     AESAPHLLYSGAADKRVLAWDTRTGRIALRLVGHRASVDALAVHPRLTHVLFSGSADE
                     MIRVWDTRVGGQCSVHELGGHRGGVRSLVGRALEPQLLSASDDCTIRSWDIVKGVAAG
                     VCTRHAKPVIGLSSCWLETDLTESELERLVSVSADGARMWKLPAVQLVDEIPGPAPTL
                     STAAVSEDGQLVCGDLDGQLHWWNAAQRCWQSQSAAPQATSGVTCSVGARVPAVVLCI
                     AFDRSATRLLTGCHDGAIRMWRLHDEYR"
     gene            complement(<732653..>736657)
                     /locus_tag="CYME_CMR306C"
                     /db_xref="GeneID:16996903"
     mRNA            complement(<732653..>736657)
                     /locus_tag="CYME_CMR306C"
                     /product="phospholipid-transporting ATPase IA"
                     /transcript_id="XM_005538497.1"
                     /db_xref="GeneID:16996903"
     CDS             complement(732653..736657)
                     /locus_tag="CYME_CMR306C"
                     /codon_start=1
                     /product="phospholipid-transporting ATPase IA"
                     /protein_id="XP_005538554.1"
                     /db_xref="GeneID:16996903"
                     /translation="MRFEASASRDRDSASSASGNDSLNGTTVGVGGGAGAFTPAAAST
                     ASSATQPWWRRAAAGLVQFLKDPDLRPLFERQRSTEPRVVRLNNPTFNAKQRFMSNYI
                     STTQYELWTFVPVFLVRQLLRPANFYFLIVGILYLISSITPVFTAGRYATLAALAFLI
                     FITAVKELAEDLKRYREDRRVNATLVEVLNSGNAASDAESHVKAWRDVQVGDLVVVRR
                     DEGVPADLIALSSSTPDGTCFVETRAIDGETNLKVKSCIPLNRDLFTPKQLRTLIGEF
                     HCEAPNPRLYEFEGRARIEVPDETGLPTGEVVECAVSRDHLLQRGIVLRNTDWVIGIA
                     VYTGKETKLMMNLKREAHKVGRIEKTITRFILALICIQFFIALILTILNGVWAHRHLH
                     PSQTWYLDERYSVGNVVLRFFTFFLTISNFVPISLYVTMEIVRGLQSIFIVVDDHMYC
                     WETRTRARCRNSTLNDELGQITHVFTDKTGTMTQNIMEFAKAYVDGEEITQRRRDHEN
                     DLEFFRLLALCNTVAPSRDDTTGQIEYHAPSPDERALVIAAHYSGVTLYDRNALSMIL
                     LEDEQPVTYAVLHVLEFTSERKRMSIVVRKPDGRIRLYTKGADSVMCARARSTDTKAE
                     QALAGIQQAVHRFALAGLRTLVVGYRDLDEDLYAEWAKRYTEASSSMENRASQVEALA
                     DEIERDLTLLGVSAIIDYLQRDVPDTLRSLYFAGIKVWMLTGDKQETAINVGLSSGLL
                     GRNMDIVVLSPGDAADIDAQLDCAEARWRALEVDGVSAIAKALVVGGDVLDVALQGSL
                     RRKLVRVSEYARCVIACRMTPKQKAELVRCMRENNPHATTLAIGDGANDVGMIQVAHV
                     GVGIAGREGMEAALASDFSIGEFRFLKRLVLVHGRWFYKRNSKLVVYMIYKNAALASF
                     EIWFATKSAFSGAQFFNPWLGAMYNVFLTSIPVIVLATLDQEVSAAYTLFYPEIYRSG
                     QRNTSGRWRVFAYWFFTALCQSVVMFYLTFYARADGPGNGGQMLGKSIFEMTCFTELV
                     VVVHLQLALYQARWTLFSFCLYFFSATLWFWLGPAFCARTFTVDLDLAAMLYWNAMRI
                     FSEPLLWLIIILCVIICETPPLLIHHWNRMYFPSPKVIVQELEWFGVLHRKRTPHPTQ
                     AYDVEPKFVQLTRRAANQREYEAVPMTYSGDTFTHESLPGGGMPWNRSPRSLGAGARS
                     HAPSSGHVSRLSDVDLTIRERSRRRFYSTDVSAVNLRTQRTGRAQSLMGAQFDNHLGL
                     SGNNLLNAGASLVDARTQSTLREAPQQQQQQQQHPFFAENIIREDNDDGDDDVDDDDD
                     DDDAGGVHAPPTTL"
     misc_feature    737894..739858
                     /note="possible transcribed region"
     gene            complement(<739059..>740711)
                     /locus_tag="CYME_CMR308C"
                     /db_xref="GeneID:16996928"
     mRNA            complement(<739059..>740711)
                     /locus_tag="CYME_CMR308C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538498.1"
                     /db_xref="GeneID:16996928"
     CDS             complement(739059..740711)
                     /locus_tag="CYME_CMR308C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538555.1"
                     /db_xref="GeneID:16996928"
                     /translation="MSGALLPAFIVDLRLPHLCTEFSKHRRPNTLHRQHAGCRPCWRH
                     VQTVRLRRTLRAETKPPSPPNHDESNMILKRPPHPPISFYVALLERAYRRPDPCFSQL
                     FEDNVFLDKLVEYVAKENASGDPKRRIEPMDDAEVDRILSEWDAYHKAAAAKLERIME
                     TASKGVKFIREDVDYSIPPDKFLEQHPELKHDMYWPAGDRPGYEFAVNQPRQPFPPIE
                     FDPDYILERDAFFQALPRELSEAILEELGRRIGPTRKWAYNDTSGLRFFQTIYFTDPI
                     FTDDYVPWQGTGPEFDHVQEFPDMTWETQQKLSGNRVLDAERERATCAFVRRFYDDFG
                     VSVSKQASLLNASVAWFFEALRIARPRPGDVFVHWDCGDGRWVLAAITAFDFGCGRGI
                     VVMPDGLEESSEAQERLDAIQRIMQQVEDATFAAARAKAAADEAAWRAAYNMVDEPYD
                     PMNDEIREARKIAAKPDESIKFTSVMIETNGKMLWDADVLLCPRIGMLDLARVKVGCR
                     IISMDEPAAAGLDRRELRFLGPHVYERVWEPWMEATAPSSAT"
     gene            complement(<741415..>742797)
                     /locus_tag="CYME_CMR309C"
                     /db_xref="GeneID:16996929"
     mRNA            complement(<741415..>742797)
                     /locus_tag="CYME_CMR309C"
                     /product="probable mitochondrial iron transporter Mrs3"
                     /transcript_id="XM_005538499.1"
                     /db_xref="GeneID:16996929"
     CDS             complement(741415..742797)
                     /locus_tag="CYME_CMR309C"
                     /codon_start=1
                     /product="probable mitochondrial iron transporter Mrs3"
                     /protein_id="XP_005538556.1"
                     /db_xref="GeneID:16996929"
                     /translation="MASWRSGAGTTLPVSWPRNASGSSPSLSTEVETGTPAAASKLDR
                     HQTVHAERSPTISLRESAFSVEPVSSAAVAQSTCPRKPQTFAEPPAPSPKNAVGSETS
                     VPHEQIERRAPVVHACAGDALGRTTSTRARLQDNLPLALQHMLAGGAAGLAEHICLYP
                     VDLVKTRMQSYHGQAGFASYTIISAVRAIWRDEGGLRALWRGVGAVALSAGPAHAVYF
                     ATYEALRARFVSLAAIRGSGSVPEVAWTTERRGGLSEPVAVAAAGALATVFSDGLMAP
                     FDVVKQRMQIERHYRSVWDTLLRVYREQGGFRALYAGYSTALVMNVPFSATYFSVYEA
                     CREALSLLISSEDMTTRQQSPSNGFARHGVHFVSGAIAGAAAAGMTNPLDVVRTRLQT
                     QGEAGARRYRNMWVAFRAVALEEGARGLWAGLVPRMLFHAPAGAIAWTTFELVKRAFG
                     LDSTLDAFVD"
     gene            742975..745556
                     /locus_tag="CYME_CMR310T"
                     /db_xref="GeneID:16996914"
     misc_RNA        742975..745556
                     /locus_tag="CYME_CMR310T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461627.1"
                     /db_xref="GeneID:16996914"
     gene            complement(<746093..>747730)
                     /locus_tag="CYME_CMR311C"
                     /db_xref="GeneID:16996915"
     mRNA            complement(<746093..>747730)
                     /locus_tag="CYME_CMR311C"
                     /product="probable multidrug resistance protein"
                     /transcript_id="XM_005538500.1"
                     /db_xref="GeneID:16996915"
     CDS             complement(746093..747730)
                     /locus_tag="CYME_CMR311C"
                     /codon_start=1
                     /product="probable multidrug resistance protein"
                     /protein_id="XP_005538557.1"
                     /db_xref="GeneID:16996915"
                     /translation="MEQGTVTSLAFCSLGVAAAGRLQRRAPGCAACARGYWGSGCRQP
                     VKSARNVRLSTQRRRLVCCANESERPLSVADKTEQLLSALKAVVDPDLGQDIVTLGFV
                     KNIQFGGDEHYGTVSFDVELTTPACPIKERFREECTRLAESLPFVTRANVRLTAQTPS
                     AAAPEAGGSRDPLSQVSNIVLVTSAKGGVAKSTTAVNLAFVLARLGARVGILDADIYG
                     PSLPIMVNPEHNEKRIRLTPDGLMVPLTRAGVKLMSFGYINSDPAMLRGPMVSSLLTQ
                     LIQQTDWGSLDYLLVDLPPGTGDIQITLGQVLKATAAVVVTTPQRLAFADVVKGIQLL
                     DKMAVPPIAVVESMAYFVAPDTGKRYDLFGKGHSARISREFGIRSTFQVPLWPEINAA
                     GDTGTPVTLTLPETSEIFQCYRRIAENIVQECARVRFGAVPIPQARWDADHREIVVQL
                     QDHMEERIQPAALRRACRCAACVDECTGKQLLDPNSVDDNIYPMQMMNVGNYALAVNW
                     SDGHQSIMPWERFLAGYRSGSRGRRIAETAALDSITA"
     gene            complement(<748970..>749692)
                     /locus_tag="CYME_CMR312C"
                     /db_xref="GeneID:16996916"
     mRNA            complement(<748970..>749692)
                     /locus_tag="CYME_CMR312C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538501.1"
                     /db_xref="GeneID:16996916"
     CDS             complement(748970..749692)
                     /locus_tag="CYME_CMR312C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538558.1"
                     /db_xref="GeneID:16996916"
                     /translation="MFCGLAGFSGKYGRSPCRGLRTSALAVRQSLLAAAGRHSRHRGR
                     SSVPKLTCRGGNVDEPRDQDNDLSGSILPRGALFGGFLSYGVGKKRTRSDRVPQNPEI
                     PCACGSGRTYRNCCMPFHTNSKAPAEAEELLRARYSAFAYRLPGFIMRTTSKTNPDYT
                     DDWNRWEADILEFCDLYRFPGMEVLDEKTASPDVSFIQFRANLIYEGALGFFIERSRF
                     VKERGKWMYASGKLVEAEMPPR"
     gene            complement(<751192..>753219)
                     /locus_tag="CYME_CMR313C"
                     /db_xref="GeneID:16996917"
     mRNA            complement(<751192..>753219)
                     /locus_tag="CYME_CMR313C"
                     /product="probabale oligoendopeptidase F"
                     /transcript_id="XM_005538502.1"
                     /db_xref="GeneID:16996917"
     CDS             complement(751192..753219)
                     /locus_tag="CYME_CMR313C"
                     /codon_start=1
                     /product="probabale oligoendopeptidase F"
                     /protein_id="XP_005538559.1"
                     /db_xref="GeneID:16996917"
                     /translation="MRYRPSFIVQSTSLLRSQQRWGKCCRRTRSPRWMPGTTSMSISP
                     VHQSLCRTAGAVRVLLSPAPVATRETATIGVPERDQVPESDQWDLSRLYADKSEWERD
                     FTACSGPWEKLLSFRGRVTQSPETVRQALEEYLRIARVIERVYTYAHLLHDEDLRNEA
                     AKSMYARAVDLHTRYAEQTSFLEPELVEVPNDYLEPGKGLEPYKHYLERIRRQKAHTL
                     SASEEALLAASTKATSASARAFSAMNDADFDFGFVQDGQGNSIALSHGSYGTLMRSKD
                     RTLRRNAFTTLHGKYRSFENTLAELLSGAVETHVFHAKARRYRSALEAALTPNAIPTK
                     VYENLLDTIRKHGLHHHHRYVALRRRLLGVDREDDGRIHMYDMYAPLIPDVDLAMPYE
                     DAVKSVLASLAPLGDEYLRVASAGLGERRWVDRYENKGKRSGAYSSGCYDSEPYILHN
                     YDPANINDAFTLAHELGHSMHSHFSRQHQPYHYADYSIFVAEVASTFNEELYSRYLFR
                     TKANSRAEKAYLVNRSLEDLRGTLFRQAMFADFELRIHRMAEEGHPLTPATLRQTYRT
                     LNEEWFGTDGVCIDEAIEWELFRIPHFYYNFYVYQYATGISAALALAERVLSGGTAER
                     DAYFAFLRAGSSVDPIDALRIAGVDMTSPEPVQAALRRFGALVDELDQLTR"
     gene            <756262..>757977
                     /locus_tag="CYME_CMR314C"
                     /db_xref="GeneID:16996921"
     mRNA            <756262..>757977
                     /locus_tag="CYME_CMR314C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538503.1"
                     /db_xref="GeneID:16996921"
     CDS             756262..757977
                     /locus_tag="CYME_CMR314C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538560.1"
                     /db_xref="GeneID:16996921"
                     /translation="MTAASPGVSVPPWYGNDTETRDRILSKLRMARRRPASRDHWQFV
                     VKRLRLWLGSADGKQVRPPCMLILDLYPNGALRAHKFPPNAVKDGRLATAWEMLEFLL
                     DEVLTPQRENAASLRPASISFTNRNIARALADPVRFLVCEQVTQDLHALVSRAGSAAA
                     EADCWSPPVLAEADGVREFMQRFAQNLIAKGKGASSTASEAPGLIQGLLAGGERRDGR
                     PDNRYILQALPLSKCELLVGQYYCLAYALFHRKPWDELPESWLFRVESICVEQVMQRP
                     VAERWRRHVRFLAVLGGETPGFVGLPSVRAARKRYAASMRRLKKETEEGSSTVSEAES
                     LDAPLYLPSEAVSSVSADSIPDVVLCAFTGQIISGPNANRCSRCKSAYYIDEEAQRAD
                     WSRHATECDAIAQLSASAAAVSLRPGAPECPQISRPFWRYAELVHIYMEESSLTFDDL
                     DAIEEYAWPVARDARNGWPVPFVTVGGHALPRPSVERPNLEELSWMIAVMEWMLEHQG
                     IARLRSGMQMGRWQNDSISSSAAAGQQSAQHVVLLSVEPVEDMKQTAISRYCAEPSAS
                     TAAIG"
     gene            complement(<761595..>761963)
                     /locus_tag="CYME_CMR315C"
                     /db_xref="GeneID:16996922"
     mRNA            complement(<761595..>761963)
                     /locus_tag="CYME_CMR315C"
                     /product="CP12 protein, chloroplast precursor"
                     /transcript_id="XM_005538504.1"
                     /db_xref="GeneID:16996922"
     CDS             complement(761595..761963)
                     /locus_tag="CYME_CMR315C"
                     /codon_start=1
                     /product="CP12 protein, chloroplast precursor"
                     /protein_id="XP_005538561.1"
                     /db_xref="GeneID:16996922"
                     /translation="MKAAFLIVPSNATHFSSVSVSKTRATFAVRRTFLRTRKTTRVAA
                     LRMANEKLNTQIQEAIKNAEDAAKKYGKASKEAKVAWDFVEELEAERSHQAANKQSED
                     PLEKYCNEVPEADECRVYED"
     gene            <763242..>764375
                     /locus_tag="CYME_CMR316C"
                     /db_xref="GeneID:16996923"
     mRNA            <763242..>764375
                     /locus_tag="CYME_CMR316C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538505.1"
                     /db_xref="GeneID:16996923"
     CDS             763242..764375
                     /locus_tag="CYME_CMR316C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538562.1"
                     /db_xref="GeneID:16996923"
                     /translation="MSRTANVPVGSGSNNQHCENALSRVQWRTRNGSRATRVPAFILG
                     LARVLSTDPAPRTVDWAADGQRILVLDRDRFTERYVRPGGALRVSSWASFLRVMTYFE
                     FARLLDTEEHDIICFKHATITRTFMEQLAASSTDRPSCDNMPKSRCSREARSSSIRAA
                     PSTLIVQEPIEALNANVIPAAADSNVLHASRLSGALSIERKRVRRSTSPRPLETYDTV
                     NEHVNAPVIHVDPNDYPRALNPLTEPNHWELRNDGGEDDCWSLRTTDADIPPVLATMS
                     DRNGRLLDCGTQTTSRCYSNVGSFGEALRLRAWTTSSPPHEHPSSDDMSIYKAHLIQV
                     ESCLASIRSELHNIVHAVEWLREHHANICSFMHAPGQSSSKSA"
     gene            <768075..>769361
                     /locus_tag="CYME_CMR317C"
                     /db_xref="GeneID:16996924"
     mRNA            <768075..>769361
                     /locus_tag="CYME_CMR317C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538506.1"
                     /db_xref="GeneID:16996924"
     CDS             768075..769361
                     /locus_tag="CYME_CMR317C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538563.1"
                     /db_xref="GeneID:16996924"
                     /translation="MSNNDDLASAAVGQDDHSNLVERLWQHLDGAAAEDLTLASQRAL
                     TGEDGSRIGRVASEILGKSSLPPEYMQRTLANFVDTIYLSQRRKRPRRIRVVRPKIAR
                     SSGANETPAPAMARASAGTSWRIRRPQNPETVGVPAMLESDVDLDGKGSAPLNADRSV
                     ANARQSRNYRLQVLRRRRQSESGSMRKNRQPAPTRAQNPNNHDNCASKRIDPEESAKT
                     RWTPKYAVSNLAACLRTLHSILSESDSSQSPLPDLSPPDAALSFESSTDSSIVSGTLQ
                     SAVEIESVTLMDTDRWDGYTARAMMPHRDPIGEFECSRDAKDSSSCRRSQHSSSPLPV
                     LSAQVSPVTVDSTDWSSSQSKRQLSRCNLAIALDAVCESKARSECFTHAGRRKAPQSA
                     KNRSGAENCIASGQVLTARSRLQARLKNRRTSKASY"
     gene            complement(<770252..>770737)
                     /locus_tag="CYME_CMR318C"
                     /db_xref="GeneID:16996925"
     mRNA            complement(<770252..>770737)
                     /locus_tag="CYME_CMR318C"
                     /product="similar to nifU-like iron-sulfur cluster protein
                     Isu1"
                     /transcript_id="XM_005538507.1"
                     /db_xref="GeneID:16996925"
     CDS             complement(770252..770737)
                     /locus_tag="CYME_CMR318C"
                     /codon_start=1
                     /product="similar to nifU-like iron-sulfur cluster protein
                     Isu1"
                     /protein_id="XP_005538564.1"
                     /db_xref="GeneID:16996925"
                     /translation="MFWRLAQQVRFARPRLTRSYDQKVIEHFEKPKNVGSLDRNAPDV
                     GVGLVGAPACGDVMKLAIRVDPTTGTIVESVFKTFGCGSAIASSSYATELIKGKRLED
                     AVKVTNRQIASELKLPPVKLHCSMLAEDAIRAAVSDYQKKQAQQVSQSATQAATAATG
                     N"
     gene            <771093..>771650
                     /locus_tag="CYME_CMR319C"
                     /db_xref="GeneID:16996926"
     mRNA            <771093..>771650
                     /locus_tag="CYME_CMR319C"
                     /product="unknown globin-like protein"
                     /transcript_id="XM_005538508.1"
                     /db_xref="GeneID:16996926"
     CDS             771093..771650
                     /locus_tag="CYME_CMR319C"
                     /codon_start=1
                     /product="unknown globin-like protein"
                     /protein_id="XP_005538565.1"
                     /db_xref="GeneID:16996926"
                     /translation="MFAYYTLNGNVSKVHARSLWSRARRRPRQPFTRLQVGGHRLECA
                     AHEPQQESIAIVQSTWSQAVQQRERLGQVFYDRLFALYPELQPMFRSDPALQRIRLVD
                     MVDAGVKLLNSRRDLEQALRDLGKRHVKYGTQEEQYPIVGENLLHALESILGSKHFSE
                     DMRKAWLDVYAYWSSVMLEGAREAQ"
     gene            <772756..>773226
                     /locus_tag="CYME_CMR320C"
                     /db_xref="GeneID:16996950"
     mRNA            <772756..>773226
                     /locus_tag="CYME_CMR320C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538509.1"
                     /db_xref="GeneID:16996950"
     CDS             772756..773226
                     /locus_tag="CYME_CMR320C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538566.1"
                     /db_xref="GeneID:16996950"
                     /translation="MFVTGSIWCWRKQCTQLSCARVAPEKPTTGFARRGARRRLGCQA
                     LVAKSDLTGWKDWLSGGWPGGEAGFFKWLDSGGEDDVPYLEPDKQPRASKSGARSSSN
                     NAAARSDAAAPRSNSTAASTPPQGGRVVTKLVTNPITGRITLEYVVEDDENNTK"
     gene            774060..775806
                     /locus_tag="CYME_CMR321T"
                     /db_xref="GeneID:16996951"
     misc_RNA        774060..775806
                     /locus_tag="CYME_CMR321T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461628.1"
                     /db_xref="GeneID:16996951"
     gene            complement(<778162..>779073)
                     /locus_tag="CYME_CMR322C"
                     /db_xref="GeneID:16996952"
     mRNA            complement(<778162..>779073)
                     /locus_tag="CYME_CMR322C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538510.1"
                     /db_xref="GeneID:16996952"
     CDS             complement(778162..779073)
                     /locus_tag="CYME_CMR322C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538567.1"
                     /db_xref="GeneID:16996952"
                     /translation="MSSRYSSFARVVLLVWAFCAVTTGVFAWNQQCSTQQQCVQYGNQ
                     CTGYQKVCLQPIQQCKQYAQECVKQEQQCVQYQTVQKPVQVCAQYAQECVEYTSSCEQ
                     QQQQQQISAVAQQQQQQQQQQKQQVAPQKPAPAPAPQKQQVSAAVQEKKGWNGAMRRW
                     QQTPVCKQVCAKYQQNKNKCLKYTTQYQTEQVCAQYENKCTQYQQGKCEQYEQGCAQY
                     GQKCTGYQQVCQQYQNVQVCQQAQQEQVQATQIVQQQQQQEQQKQQYAKFQKGQQQKQ
                     QYAQVKKGQQQQQQQQYYTGGNMQWWG"
     gene            complement(<782683..>782976)
                     /locus_tag="CYME_CMR323C"
                     /db_xref="GeneID:16996947"
     mRNA            complement(<782683..>782976)
                     /locus_tag="CYME_CMR323C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538511.1"
                     /db_xref="GeneID:16996947"
     CDS             complement(782683..782976)
                     /locus_tag="CYME_CMR323C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538568.1"
                     /db_xref="GeneID:16996947"
                     /translation="MSTCTTPLFQGPYDCMSKYGLAQKIFLAPLTREGNSGRPRRLRW
                     SLVHPVLRACSKSTSKSIQRQRKPISIRPRVKGTGKRSVRKRSGNVKKRIGLK"
     gene            <783618..>784676
                     /locus_tag="CYME_CMR324C"
                     /db_xref="GeneID:16996948"
     mRNA            <783618..>784676
                     /locus_tag="CYME_CMR324C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538512.1"
                     /db_xref="GeneID:16996948"
     CDS             783618..784676
                     /locus_tag="CYME_CMR324C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538569.1"
                     /db_xref="GeneID:16996948"
                     /translation="MEVQAPESAREQPAETRPSQRLAVLFNSFATRDKQKVVNDRVNA
                     AALLSALESGNESAAAVVPAIVEQLTGGAIRTTPLEHGHGWLVRPSKPILPQSVYVPL
                     RSFSSKYRSRSSVSPNGQLPETLKFFFSIGVVVYCERCTVRVTEPTTGAPVKHEPVEY
                     IGLAAFEAATPDRHDSIPDDAGRSGTEVCLQIARHCERHAANEIPVAPRDVVLFAGTY
                     DSSIWKRETHGPKEHLSRPVRRVPCITNPILCLLGRDIDAVICSGLDGENEPTRCAAR
                     HLCERVFDRRLSSQRWSDTRCRYCTRRLFEKSSRTRRPELNAGIVPRAGSQLRRLERC
                     HIRKIAQERDRTLSTSRR"
     misc_feature    786792..789305
                     /note="repetitive element"
     gene            <789365..>789964
                     /locus_tag="CYME_CMR326C"
                     /db_xref="GeneID:16996949"
     mRNA            <789365..>789964
                     /locus_tag="CYME_CMR326C"
                     /product="similar to inner mitochondrial membrane
                     peptidase Imp2p"
                     /transcript_id="XM_005538513.1"
                     /db_xref="GeneID:16996949"
     CDS             789365..789964
                     /locus_tag="CYME_CMR326C"
                     /codon_start=1
                     /product="similar to inner mitochondrial membrane
                     peptidase Imp2p"
                     /protein_id="XP_005538570.1"
                     /db_xref="GeneID:16996949"
                     /translation="MPFSSRFFRQLVRGVSYVPVVYVVHDLVGTIVPVRGASMQPTLN
                     PGAAAGELPPGQVSGSQDVVLVSRLLRAVWNVRRGDIVVLRSPDAGPQKRLVKRVAAL
                     EGDRVYNHRTGKFVEVPPGHCWLVGDNRTVSRDSASHYGPVPLGLLEGRAVAVIWPPR
                     RWQVLATSPSTGLWLDTRNSEGDQLPAKKQVLAKSATTK"
     gene            <793223..>795091
                     /locus_tag="CYME_CMR327C"
                     /db_xref="GeneID:16996930"
     mRNA            <793223..>795091
                     /locus_tag="CYME_CMR327C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538514.1"
                     /db_xref="GeneID:16996930"
     CDS             793223..795091
                     /locus_tag="CYME_CMR327C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538571.1"
                     /db_xref="GeneID:16996930"
                     /translation="MNMRLLYLAAIVVVLAATLLQSAAAMDYYQKDMKQKKQCYTVEK
                     CVKQERKCIQYEKVCTQPQKKCIQHELICVQQENQCKQYEPEYQNVKVCVAYEKECVQ
                     WNYKDECQQEYVQQNNYFWGMRWSNEKKKEPVKKQCKKVQNGCAQWQENKNKCAQYGE
                     QQQKIGQKCSDYVQVCTKTKPGKCIQYQETCNNYQQQCAQWANVCQQYKKEIVCPEPK
                     KEPQKKVKQEQYVKKDNYVWRMYDQKKKYDQKNVEQQQKNEWFQQQNEKKQYYWQPQK
                     TQYYKKNDYKKNVYNDQKQYYWEPQKTQYYKKNDYKKNVYNDQKQYYWEPQKTQYYKK
                     NDYKKNVYNDQKQYYWEPQKTQYYKKNDYYQKKDNYVWRMYDQKKKYDQKNVEQQQKN
                     EWFQQQNEKKQYYWQPQKTQYYKKNDYKQNVYNDQKQYYWEPQKTQYYKKNDYKKNVY
                     NDQKQYYWEPQKTQYYKKNDYKKNVYNDQKQYYWEPQKTQYYKKNDYYQKKDNYVWRM
                     YDQKKKYDQKNVEQQQKNEWFQQQNEKKQYYWQPQKTQYYKKNDYKKNVYNDQKQYYW
                     EPQKTQYYKKNDYKKNVYNDQKQYYWEPQKTQYYKKNYNLYGKKENPYVPQYYYWE"
     gene            <796204..>797133
                     /locus_tag="CYME_CMR328C"
                     /db_xref="GeneID:16996931"
     mRNA            <796204..>797133
                     /locus_tag="CYME_CMR328C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538515.1"
                     /db_xref="GeneID:16996931"
     CDS             796204..797133
                     /locus_tag="CYME_CMR328C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538572.1"
                     /db_xref="GeneID:16996931"
                     /translation="MIKKTVLCFAVALVLCIVAPMKGAQAWYNTVAQQEQCYQKQVCT
                     QYDNQCTGYSNVCLQWGEQCKQYEQVCTSWETKCLAYEDVYKTTQVCAQYAQTCAQWN
                     YKEDCQQVKQEQKQYYTAVETPVAKQDYKKKQDYVKKQEDQQKKDQYIWGQNGWRWYN
                     QEQQQKQQVQVKKVIETPIATQTCKKVQAGCARWQQDTSKCEQWTTNKQKIGVRCANS
                     AQVCSNYTQGKCAQSEQVCLSYGQKCTGYQQVCKSYGWQWVCQQVQATEQYQQKQVYG
                     QKEVYGQQQKQKYQKDQKQYQDQQNYWQKQYMW"
     gene            complement(<799609..>801309)
                     /locus_tag="CYME_CMR329C"
                     /db_xref="GeneID:16996932"
     mRNA            complement(<799609..>801309)
                     /locus_tag="CYME_CMR329C"
                     /product="similar to 67 kDa integral membrane protein;
                     Rft1p"
                     /transcript_id="XM_005538516.1"
                     /db_xref="GeneID:16996932"
     CDS             complement(799609..801309)
                     /locus_tag="CYME_CMR329C"
                     /codon_start=1
                     /product="similar to 67 kDa integral membrane protein;
                     Rft1p"
                     /protein_id="XP_005538573.1"
                     /db_xref="GeneID:16996932"
                     /translation="MEKAGTTGEPKPLQRSRRHASADRMSGSQVAIETASANVRSTIL
                     WSLLSKVISFALRTLLARRFGPAAIAFSDVYLGLSVAVALWPAREVVRRVVLQRPEFA
                     QRRFWFWMNIFWCVIVFVGNDAAFRKRASAKISSGPVDMAYAFVGAGALLEASIGEWL
                     HVQCLLHGDAGALAGRARADGLAALAQHLSAVSIAYVTGDDALGAALGWFAQSFVRVV
                     VLAHSWLSFQRRLGSRKRRRQADQRRDTDSRRLWLHASFHAALKFLASDAENVFLAFS
                     TRLTAEQIGAYKITGNLASMVLRLFFFPLEESVCVLAARTASENDPAQLVEAYRFAQD
                     ARLCAILLAILLSVVGPVYVPLFLEIVYGKRWLRTAAIHGAPVARLLAWHLRSLVAAA
                     LFGTTDALLTTAVLPLLSSGMLLTHTVCNAVVSIGFVAGVRWAAIHTGDPLLLIANNA
                     ITLLVRAALATAMVRIALHHADGRDTTRASCAPWPSGKVLLATTIWASTAHLLVSRTL
                     VGARTWIPSGSLSLWTLLMSMLWIWAVLSSHRDALRRVLIGSRAKTQTRASLAKVALD
                     "
     gene            <801864..>802268
                     /locus_tag="CYME_CMR330C"
                     /db_xref="GeneID:16996964"
     mRNA            <801864..>802268
                     /locus_tag="CYME_CMR330C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538517.1"
                     /db_xref="GeneID:16996964"
     CDS             801864..802268
                     /locus_tag="CYME_CMR330C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538574.1"
                     /db_xref="GeneID:16996964"
                     /translation="MQQCELDHVALNATDVDRLLKFYAGLFGWCTERVDEWREGKVPF
                     PSLRVNARTIIDLFPSSESMTLKQSSDTHLNHFCIAVDLSTFRAVQSKAQELGAEAAG
                     GPRQLWGARGMAVSQYYKDPEGNLFEVRCYEA"
     gene            complement(<803126..>803833)
                     /locus_tag="CYME_CMR331C"
                     /db_xref="GeneID:16996965"
     mRNA            complement(<803126..>803833)
                     /locus_tag="CYME_CMR331C"
                     /product="26S proteasome non-ATPase regulatory subunit 9"
                     /transcript_id="XM_005538518.1"
                     /db_xref="GeneID:16996965"
     CDS             complement(803126..803833)
                     /locus_tag="CYME_CMR331C"
                     /codon_start=1
                     /product="26S proteasome non-ATPase regulatory subunit 9"
                     /protein_id="XP_005538575.1"
                     /db_xref="GeneID:16996965"
                     /translation="MTSDSVQRLRALALQKEEIEREIERLVSCLEVTPAGVRGPLVDE
                     DGFPRSDCDVYQIRQYRQRLVCLQTDYRLIMREIERLLPEVLTSGPTHAQTARSTASV
                     SRVVESAPAVRTASSREHRPGDNQPAQRSEWTGTSLGQSNLRPFAKVVQVEAGSPAAQ
                     GGLQEGDLVVRVASCTDWETLAVTVSEHRAQPVVFSIVRGLRTSEADCSITTHDIVVV
                     PTPWAGAGLLGARFERY"
     misc_feature    804719..807143
                     /note="repetitive element"
     gene            <807203..>807802
                     /locus_tag="CYME_CMR333C"
                     /db_xref="GeneID:16996966"
     mRNA            <807203..>807802
                     /locus_tag="CYME_CMR333C"
                     /product="similar to inner mitochondrial membrane
                     peptidase Imp2p"
                     /transcript_id="XM_005538519.1"
                     /db_xref="GeneID:16996966"
     CDS             807203..807802
                     /locus_tag="CYME_CMR333C"
                     /codon_start=1
                     /product="similar to inner mitochondrial membrane
                     peptidase Imp2p"
                     /protein_id="XP_005538576.1"
                     /db_xref="GeneID:16996966"
                     /translation="MTFSSRFFRQLIRGVSYVPVVYVVHDLVGTIVPVRGASMQPTLN
                     PGAAAGELPPGQVSGSQDVVLVSRLLRAVWNVRRGDIVVLRSPDAGPQKRLVKRVAAL
                     EGDRVYNHRTGKFVEVPPGHCWLVGDNRTVSRDSASHYGPVPLGLLEGRAVAVIWPPR
                     RWQVLATSPSTGLWLDTRNSEGDQLPAKKQVLAKSATTK"
     misc_feature    complement(809591..810305)
                     /note="possible transcribed region"
     gene            <810784..>817203
                     /locus_tag="CYME_CMR335C"
                     /db_xref="GeneID:16996961"
     mRNA            <810784..>817203
                     /locus_tag="CYME_CMR335C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538520.1"
                     /db_xref="GeneID:16996961"
     CDS             810784..817203
                     /locus_tag="CYME_CMR335C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538577.1"
                     /db_xref="GeneID:16996961"
                     /translation="MSQLRESSPVHYLVPRQPAFVEAELRAEGTRLLFLLHRSRQQLE
                     TLWSERSTELLSGSSPKHEIERLDRRFYTELRKLDRLVSRFHLLGGLLPAALHRELTW
                     LFLNLCLGDAAITLRDLDVRSVCAERLSATLLQRDRYEAQVVRLAQEAAGVSAPWSGS
                     TSGERWRKLTQPLAAFEGIFCALDRILRAYHFDDDVSSASVDLVPPCSNDIEADALSL
                     HGAVHSPQSRSIHVRALLGLVEVIRPLFASCAERIWWDHYRPRIVAAAEQHAPEARRQ
                     LYLEAILCTKLLPTELESDADTSGCTWVRDAFEHGYNAGAFSDAQWSGSTFTEWDTLW
                     LELWSRVARDLLPMTQRHAWQESLSKQPQERQQSAREKEQLLLPSIASLSQKIFESLG
                     MPLADFAYARPEDHGFPESMRFAVGSNVPERRIRACTELMVRYIGSGVDPYATNECIL
                     TGLRRLLALTDIAIHPNRGGVWAPRFGAFVETLATAMFERVSQQQIHGDSALYDRIAD
                     CPQESEHQLSTACVSRIVEMLSETLERALLSANRALASRAQHSLRLMLRMLAPTSDSA
                     SSAPHLSLSCTRWARALFESVVLDTFEQESKASRRATAVGVAMILLPYLLPPQDGAPD
                     GRDDELESQVASRESVENRLVLLLDYILEGTSASDAPFAEAAYHFCLRLLDLVHPFMQ
                     TEQHASVEVGVFLSRSAYTFLIEEWLYRFAERIFDVLDALEDRDASSPAPSLQVFENL
                     IMRMSEVLQSYEGDTDAADSLWHRLFIEKVLEERLTGHRALDNATKEWSAVVRALVAS
                     TDKAPVRRRHALMDRLLAAAAADADAAAALTTTSSTTTTTPPTLQAWRLGLLGQACRR
                     YADASELALRYGDRIAVLIQRACCAVAERSVYKAGGKLLRGLMQGLTDSWPVAVRAKQ
                     VPVAERWQRVRTLWHQGCSLSLCIQQISWQHIEIQWHEPCPDAVQYAWSLFAQNLRAI
                     EAFLGDASASIDTNKAKAAARWLFALRRGARWLLSGKRMRSGLDSIGDEMIDNAFNAE
                     DAFDTLDEDLPGAFTDSNDAEPVSDSPRKSPDWTALNGNASGFLDLLPSNATQLLEQW
                     QALVLRIVLAADPDTLQRDALRPLEIGHQGFSIDDAGAQRAGRGRARRRFALRAVNES
                     AVDVSGWALLEAPPWSLQAFALAALESRRSLAARAGSFAICCGSIAAAHDDAFPKPLL
                     KVLLSERGVLSDFPGVGRRARALLLPACRFLSLYSLRALVLRPILHELDAAAAIDDKV
                     LLRQQRTRLESVFLLLDALSPRLASEARLFRELVATVLRTACRGTWMTNLASVYAFAM
                     RLLFKVALRVRRLAMLSSTPPRDERCATLPSIDAGHQLSEGAFASMLLCVAQRGAYPE
                     PCANVAALTGATQQLAWPTRAVAAWLLIQYDLVREAHWRALGVRDSFSDSVAVSWRRA
                     LDAAMSLANDAHHAALRRLGTLLVCRLSACSIARSNALDASWRSAEQVQALLYAMYLD
                     AKGPLSLFISSASSPTDAAAAAAANEGDVLSSLTAAVAQQWTGAAAAAGSIAAGALAD
                     VILDAAAASWELLSGGPVWPSIRDGCLGSSLMVSRQPGEHWTFAMLTRVRCLERLHGL
                     MDASERQRVQWYRESAPDLSMLHGTQVVDGDGAADDRLRKLEHEILVATASRDLDRLA
                     QCIEKCPSQLVWRSLIVPALRYLADQPLYSEAELADKHPLIDMVMRLASARVRRAPNA
                     WNALLDETVPHTDATAVVRTLHCLEALGRVAPPASLRYELLMGRLSGVERDAAASLLA
                     VWVANHRSLLTEMLERWRLYVAGLEAAFTSGGVPAQGALPDRLFAARDTLISFLERLC
                     SWRLHDVAAFFQQQPISVIDWCLAQLGTALVFSDDLRGDVSGMPGSTGSAATLGQRES
                     LAQHARNTWYLLAQTRALVLFQRTLYAVAEARRDPRLWPFREAALQAVRLAMNDHPFA
                     LVEGATATAAGTSASTPALQWIDELLPFLNDTEVAVRKVAAQALAAWSRWFVPHASDH
                     DDERMLHEPVIRTYWCEANDRIDDQGRALVLAALIQYHPYNVRPRWMSDVLHALVRLT
                     EVRSSNRASLHHSTARRREAAQVARQCLQAFRHMHHAQWTREQQQLEPSVREQLADLW
                     LGSAYVV"
     misc_feature    complement(813907..817231)
                     /note="possible transcribed region"
     gene            complement(<818193..>820397)
                     /locus_tag="CYME_CMR337C"
                     /db_xref="GeneID:16996963"
     mRNA            complement(<818193..>820397)
                     /locus_tag="CYME_CMR337C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538521.1"
                     /db_xref="GeneID:16996963"
     CDS             complement(818193..820397)
                     /locus_tag="CYME_CMR337C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538578.1"
                     /db_xref="GeneID:16996963"
                     /translation="MATLGTLHTGTGVGVATCVTPTSTECDFAGSFSKAWKGRCERGE
                     YNEAGGNISRSASAISRLSPDAASADREVGWLRDAEDKTCAWSGRDESPTASLLQPCV
                     EVSKTKQSVSGGRAVKLTETALQTSRMTGRAPGRFCESATEDIDLNDVLGVLVDALDP
                     DYSSPGTEISADASNFGQISEVAFSVSSASDMHSIHETAQMDALPMLHIGIGDEALGC
                     DDRFMQTWDRGIKSAHKSSEATEDSDLLTMIEQQSDRIRRLECELEKSRSEVAALQRM
                     LEKYLRGESASTPDVHHHIAGVFSPLTPAYVATFEPSRKFLDKERTQAEKLRHIVSGS
                     GFTAGVGQSGTQNLISAPTAAIDGEDCSVFEDSQGFGVCDRRLLPGIVDAVVSRSSSA
                     RNLVALDEGAQITDSDKHQTGKAASFASGTTGNVPETRLGNQCAFAPFHDGTFLFPSR
                     QAAEACSAAREVFGPAAEALEKMNYRQQMAAAARQRSRREFSEMTGPEGSSSVGTNGA
                     PSLAQSAGSELNLTTKRRSRRGERHARPLGTTRYWADVEHELFLLGCKKFGPKNFAAI
                     AGIVKSRSPKQVRTHLQKYQLKLLREARRMEKVDGGAALAQLKNVCDMAFTKAQLRAL
                     GADESVISQQSLRHIRKAEQLLQSRKKAATSAALGSDHLSEEETESSSPSRSSSLSLS
                     LSSSSTVPTCPPPGSPTAPVQPASAANADASTESTLPVSTSNDEEAPASSTA"
     gene            820918..822583
                     /locus_tag="CYME_CMR338T"
                     /db_xref="GeneID:16996956"
     misc_RNA        820918..822583
                     /locus_tag="CYME_CMR338T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461629.1"
                     /db_xref="GeneID:16996956"
     gene            <823029..>824420
                     /locus_tag="CYME_CMR339C"
                     /db_xref="GeneID:16996957"
     mRNA            <823029..>824420
                     /locus_tag="CYME_CMR339C"
                     /product="threonine synthase"
                     /transcript_id="XM_005538522.1"
                     /db_xref="GeneID:16996957"
     CDS             823029..824420
                     /locus_tag="CYME_CMR339C"
                     /codon_start=1
                     /product="threonine synthase"
                     /protein_id="XP_005538579.1"
                     /db_xref="GeneID:16996957"
                     /translation="MTVPAEVAEAFHADYVPFGADRDATLAQERYSLDQIIYRSKRTN
                     GLLEVEHNMEALRQVSAAEWKALFDLRSGRTVFPFGSGVWSKKEWVLPSIPDGDVVSM
                     FEGNSNLFWAERFGKEVLGMDDLWVKQCGNSHTGSFKDLGMTVLVSQVNHMIKSNKAK
                     IKAVGCASTGDTSAALAAYCAAAGIPSVVFLPADKITISQLVQPIANGSIVLSIETDF
                     DGCMKLIQEVVEQYPIYLANSMNSLRLEGQKTVSIEIAQQFDWQVPDWVIVPGGNLGN
                     VYAFYKGFAMMRDLGLTDRLPRLVVAQSANANPLYLAYKAGGYKGDWSAYAPVTAKKT
                     VASAIQIGDPVSIHRAIRAIDETNGLVEQATEEELLDAAAQADRTGMFNCPHTGVALA
                     VLMKLRERGIIGVKDRTVVVSTAHGLKFTDSKVAYHERKIQNIASRYANDVHRVPASA
                     GHVIDLLRARGVV"
     gene            <827831..>828733
                     /locus_tag="CYME_CMR340C"
                     /db_xref="GeneID:16996958"
     mRNA            <827831..>828733
                     /locus_tag="CYME_CMR340C"
                     /product="similar to procollagen N-endopeptidase"
                     /transcript_id="XM_005538523.1"
                     /db_xref="GeneID:16996958"
     CDS             827831..828733
                     /locus_tag="CYME_CMR340C"
                     /codon_start=1
                     /product="similar to procollagen N-endopeptidase"
                     /protein_id="XP_005538580.1"
                     /db_xref="GeneID:16996958"
                     /translation="MGATSVAPQPAAALPLHQHTHTCLAVDSASFGAVSGTAAAARNI
                     ARAYRLPAGRSRGRGFFAPLRAASRTRTPEPVLRNMGGSLSGMQKIDRKVFDMRLTAK
                     RLGRLAVKHQRLAEQEKERTRKALSSGNLEAARTHAESSIRNNKQSNAYLKLQARMDA
                     VAARIESSQNLRLATGNITAVSTHLSRAVERMDLEEIASRLAQFERIMEDMDVRSTYV
                     DETMRTVADVGAPREEVDRLIQRVADEYGLELADALASPGLTALDATRVRRADEERRR
                     QRRLDEEERARLEARFAKLSAPAP"
     gene            complement(<829484..>830620)
                     /locus_tag="CYME_CMR341C"
                     /db_xref="GeneID:16996959"
     mRNA            complement(<829484..>830620)
                     /locus_tag="CYME_CMR341C"
                     /product="similar to surfeit locus protein 4"
                     /transcript_id="XM_005538524.1"
                     /db_xref="GeneID:16996959"
     CDS             complement(829484..830620)
                     /locus_tag="CYME_CMR341C"
                     /codon_start=1
                     /product="similar to surfeit locus protein 4"
                     /protein_id="XP_005538581.1"
                     /db_xref="GeneID:16996959"
                     /translation="MEGIYPTQGGVYGGPRYGAPHGAVPSAEQQPMYAGDAAVGPSPV
                     QSSSGPGWTGAAGPVTSATSGSPLRGAAAAAVQNLSTHFGRSGRIGKGSISMITRVLL
                     VATFLEDALRVLSDLGGQARFLRHFYGVPVWAGTLFLLGMVCLSVSASLAIIAAGRAR
                     TTGKAFQRDRALLSLQERASYVLIVHILVQQALYGRDAPATGGNVSFLVRNICLAGSF
                     LMVAANARIKKGLSALPGGLLGGFSRPASSGTASGSALLSSQKVFEYMQLTARIMLVL
                     LPIDFLSSLGFLGTLLAVPVMVAVLAGYRTRISGSILIAFYAAHNLLMSAFWKVNDRS
                     PFGQYARDVKQYEFVQTISIMAGVLMLVFEGPGALSFDQQQREI"
     misc_feature    831487..834836
                     /note="repetitive element"
     misc_feature    complement(834639..835157)
                     /note="possible transcribed region"
     gene            <834834..>836021
                     /locus_tag="CYME_CMR344C"
                     /db_xref="GeneID:16996990"
     mRNA            <834834..>836021
                     /locus_tag="CYME_CMR344C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538525.1"
                     /db_xref="GeneID:16996990"
     CDS             834834..836021
                     /locus_tag="CYME_CMR344C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538582.1"
                     /db_xref="GeneID:16996990"
                     /translation="MPVVVLCGLPRAGKSALAKRIAEAAPPHLKPVTILSDRGIEDYA
                     EPQREKTARSRLRAALERAPYRERLVIVDACNLVSGFRYELWCVTRVPAGKRQESIPH
                     VTVLIRSKADVSEVSCAHSPPGYQRSTADRPSAAAVGPTRLVVEPELTSPERIGHEPQ
                     AKSARSANADALRSVLNGRCEVAGPRQQPQADSDVAANIARVRERFEWPDPQGQRWDR
                     PLFTMSLKERVCSYETPDGCTFFEETQWVASIYDWISGGTARKDFKTTSRMTIATRQT
                     RVQSADSYFESEIRKIEDAIIQVLCAGDEGEHQHPGTVYTYDKCPLRLPESYLRRIFL
                     LANQSSRLYTVSQDLRAHRHLFVRRYQKRRVEQDSSASVQEFIRSLEGYLELRDQQRR
                     SEH"
     gene            complement(836562..838374)
                     /locus_tag="CYME_CMR345T"
                     /db_xref="GeneID:16996991"
     misc_RNA        complement(836562..838374)
                     /locus_tag="CYME_CMR345T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461630.1"
                     /db_xref="GeneID:16996991"
     gene            <838609..>840492
                     /locus_tag="CYME_CMR346C"
                     /db_xref="GeneID:16996976"
     mRNA            <838609..>840492
                     /locus_tag="CYME_CMR346C"
                     /product="probabale Lipopolysaccharide
                     glycosyltransferase"
                     /transcript_id="XM_005538526.1"
                     /db_xref="GeneID:16996976"
     CDS             838609..840492
                     /locus_tag="CYME_CMR346C"
                     /codon_start=1
                     /product="probabale Lipopolysaccharide
                     glycosyltransferase"
                     /protein_id="XP_005538583.1"
                     /db_xref="GeneID:16996976"
                     /translation="MSNPNRSSTLGGARQGGGLDSSRRRGNNAVRGGSQNVASAVGAQ
                     RSGSTTESARVVADSSEASSEPAPFVGAHQPTEAPKRDSEAGTADEARRAASANAATM
                     ASPDDLARDMEMARINTISLKRVESEPEVAPLKLMDQLIFSTEDGYRQAELELLASGR
                     STGEAAESPITLPDVQAGSFGERPMDKARDAVSETPTEAQSYLREEAAVSPRTSSSER
                     EREESNCGPKCPKRYRIALFAWESLYSVAVGGVAPHVTELAAGLERRGHEVHVFVRSG
                     AGQAPYERIDGVYVHRCSFDLSPDFVKECENMCNSFMHAMYEVECFMNAHFDVIHCHD
                     WLTGFALTNAKHILGRPVCIFTIHSTEYGRSGNNHYGGQSARIRDIEQAAISAADRII
                     CVSGVLCDEVKAVYSFDWNKLRCVHNGINALRYDGNLWDPGEVRARYAVGPLDPMVLF
                     VGRMAVQKGPDLLVEAAPFILKARSDTKFVMVGDGYMKPSLEARCHQLGVAHAFRWTG
                     TMGGAPLVEVFKACDVVCVPSRNEPFGIVVLEAWASGKPVVVTKNGGPREFVTHEVEG
                     YQIDTSPDSIAWGICKCFENFDHSRFMGEQGRKKAQREFSWDRIAELTNNVYDELLLT
                     RPY"
     misc_feature    complement(841846..842891)
                     /note="possible transcribed region"
     misc_feature    842125..844435
                     /note="possible transcribed region"
     gene            complement(<843639..>845324)
                     /locus_tag="CYME_CMR349C"
                     /db_xref="GeneID:16996979"
     mRNA            complement(<843639..>845324)
                     /locus_tag="CYME_CMR349C"
                     /product="actin interacting protein"
                     /transcript_id="XM_005538527.1"
                     /db_xref="GeneID:16996979"
     CDS             complement(843639..845324)
                     /locus_tag="CYME_CMR349C"
                     /codon_start=1
                     /product="actin interacting protein"
                     /protein_id="XP_005538584.1"
                     /db_xref="GeneID:16996979"
                     /translation="MLTQFLLHRVRSVLDKPTLGPVRTFGGGNRSTSPVDVLRTTLTF
                     GQFGLFRRPHNTGTKFIRELQGNYAKLTEKDIATLVELARSAEPQPPPTTPATAATVS
                     ITSPDQLRSYNTDWTGEFHGNASLCLRPSTVAGVASILAYCHERNLAVTPQGGNTGLV
                     GGSVPVFDEIILSLSRMNRILEFDEEHSTITVEAGVTLGRAEQHCRERGFCFPLDLGA
                     KDSCQIGGNLSTNAGGSRYVRYGSLHGTVLGLEAVLADGTILDLGVGRKVRKDNTGYD
                     LKHLFIGAEGTLGIITKATLSCSPAPTGTQVALAGLPGPFEQVRWWLREARRSLNAHL
                     CAFEFMDNDAMTLLRAHGDGFGVPLQGSHAFYVLIECGTAADTEHRALSPLETYLDAM
                     TRADPRVDVIMAQDLSQSAHLWGLRESLPELVRRSGPSILKYDLSLPLPSFYGTVEAV
                     RERLRQHKLDARTFSWGHVADGNLHLNVSSEHPRDMLRSTLEPWLYDVVQQHGGSGSA
                     EHGIGVLKTRLLERGKRPEVLQLMRRFKALLDPKGILNPYKMVDAGDAGCRRP"
     gene            <848863..>849555
                     /locus_tag="CYME_CMR350C"
                     /db_xref="GeneID:16996980"
     mRNA            join(<848863..848945,849073..849248,849353..>849555)
                     /locus_tag="CYME_CMR350C"
                     /product="similar to CCAAT-binding transcription factor
                     subunit A"
                     /transcript_id="XM_005538528.1"
                     /db_xref="GeneID:16996980"
     CDS             join(848863..848945,849073..849248,849353..849555)
                     /locus_tag="CYME_CMR350C"
                     /codon_start=1
                     /product="similar to CCAAT-binding transcription factor
                     subunit A"
                     /protein_id="XP_005538585.1"
                     /db_xref="GeneID:16996980"
                     /translation="MSTTGSAAPAEGPDNDTGTSTHGHEQERYLPIANISRCMKGALP
                     ESSKVSREAKELVQEATSEFISFITSESSDKCMRERRKTICGEDILYAMRTLGFEEYI
                     PPLMAYLERYRTLEQSRRNEKQAPGTSEGTDGEDSESDGGGIDDSAKDDTS"
     gene            complement(849791..851837)
                     /locus_tag="CYME_CMR352T"
                     /db_xref="GeneID:16996992"
     misc_RNA        complement(849791..851837)
                     /locus_tag="CYME_CMR352T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461631.1"
                     /db_xref="GeneID:16996992"
     gene            <850302..>850979
                     /locus_tag="CYME_CMR351C"
                     /db_xref="GeneID:16996994"
     mRNA            <850302..>850979
                     /locus_tag="CYME_CMR351C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538529.1"
                     /db_xref="GeneID:16996994"
     CDS             850302..850979
                     /locus_tag="CYME_CMR351C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538586.1"
                     /db_xref="GeneID:16996994"
                     /translation="MAFIAGTLPFGREVLNAGTQTSAACWCHSSGDRSRSRRSSALVA
                     RCAASGQTFTRRRFCRDFAFASLSLISVLGSSRCQVASAATAPEAALVQVCRAYDALD
                     ELVRLIEQSQDTRSLRQTIRIIVKQSNLKQSIKSAANGRLPAGPIRDAALREGLDALE
                     YLSQVTAYYNPVSKVPTLEMRSFAIESVKAAKQRLQAYLDAFPPDEVERARRTVFVQD
                     VAAYESM"
     gene            <852084..>854891
                     /locus_tag="CYME_CMR353C"
                     /db_xref="GeneID:16996993"
     mRNA            <852084..>854891
                     /locus_tag="CYME_CMR353C"
                     /product="similar to respiratory burst oxidase protein"
                     /transcript_id="XM_005538530.1"
                     /db_xref="GeneID:16996993"
     CDS             852084..854891
                     /locus_tag="CYME_CMR353C"
                     /codon_start=1
                     /product="similar to respiratory burst oxidase protein"
                     /protein_id="XP_005538587.1"
                     /db_xref="GeneID:16996993"
                     /translation="MQRRAAVDAQECHDTRFSPNSGGAFGRAPNLAAAAAIQSTPRHR
                     RLSHVRIALVPRSFCFLDEVWMKPSLPPVPLGACAITTMRPRNRIRAQLDLWNERVGE
                     SGLFFSLLVAYWCSQAWFFVYGVKYALSLALPSDWSRYMLIFGRGFGYVATFNALLLP
                     ITVNRTLTNILYRLPLYDIFSVARWLPDLHAIIARWFTIAGWIHGILLSVAYGVGTLP
                     FRGGFLPFSNTIPTTMVFVTGCALMAFLLAIVLLSLGSVRRRVYRVFWASHVPLAILT
                     YAALVFHGLRGGRLWSVYFFGLPVVLYILDRLYHSFAAAFTPHRVLSVELSHKNSNVV
                     RLVLERRGRKFVAGQYFKLAWKFHVCSHLAVAGEWHPFTVASSPLLDKDRIIFFIAAT
                     GKWTNALRALALQQHQQQHDENLEHASSTSPTPKSLATEAMPHAVDKSSITTCLPINR
                     RWILLSGPYGAPAQSHQNFAHQLLIGTGVGASPMFSIVQELCGRATPCDNNNNKDASL
                     ECSDVSTGGDLENGTLASVSDTTSPTRESTDLPNFEKLKASTTANDSSSEVVPSVQAL
                     PPVLAARLGTLRGDTFLDRFSAAVLSNLWLFSILWICLADLTVSICASAFSHIVAFIG
                     SLALFVVILTMICLTVIADMRLSVNPPRWHYVLLLRGILLLLWFAVALTNAVLCSLLI
                     VEYFLASNDRMASISKSSEWLFVMVVTPVHITIFVLLLFFFFLPRSWTWRTTVTAKVF
                     RRCLQGSWDHQQRSNKVVSDARNAEWNAFSHIRTVTFVWVVRYVEDLWFLEKLYELAS
                     QQDASDPCRPRLRIHVHITRLGHDDADPVSSRLPANCGEILQFHCGRPDFGEYVAELV
                     NEDHDTTTPLAGRGKPGAPASIRRFQRTRAFSNKVHHGIFFCGGRSVVRSVHQSIRAV
                     AAARAARGLPQRNVFFMKENF"
     gene            complement(<856737..>857846)
                     /locus_tag="CYME_CMR354C"
                     /db_xref="GeneID:16996995"
     mRNA            complement(<856737..>857846)
                     /locus_tag="CYME_CMR354C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538531.1"
                     /db_xref="GeneID:16996995"
     CDS             complement(856737..857846)
                     /locus_tag="CYME_CMR354C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538588.1"
                     /db_xref="GeneID:16996995"
                     /translation="MAKQLASVLSYASWFRSARLGMSSFELLARGSGCFVHGDSEGAS
                     FAHAVVSAHVAAPQRFRHYFPQGWLQYVRDIDCRHVLEFRTLDGALRLAWPVHRIGPG
                     GATLDRDVPAALEDADASLRIRNTHLLPSSTCVPATSAGAHQSGIAGAPSIAPVEVLV
                     MATHQRTSADLQLPREHAPGDPSMVVFHPAGHDVAMLRIRDPQAMIASLGAEPHSYGM
                     RISTEQCASPAPGVQVQLSGWEQSQGQGPEELDAFGKAALYYTERRAVLCDLHPSLRI
                     STHLGEACAGRHMIESNERLEWGLCGAPVVEVSTLSSKAAANAEDADPRLIGILEGRC
                     KWSSSHKADTDLGRFGILICARHIRALLLATRSRA"
     gene            <860359..>861885
                     /locus_tag="CYME_CMR355C"
                     /db_xref="GeneID:16997023"
     mRNA            <860359..>861885
                     /locus_tag="CYME_CMR355C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538532.1"
                     /db_xref="GeneID:16997023"
     CDS             860359..861885
                     /locus_tag="CYME_CMR355C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538589.1"
                     /db_xref="GeneID:16997023"
                     /translation="MHRTYPGALDSVSRWLQQQSRMVPAEQGSQLRAFINFNQSDAAR
                     LQQVYEEKLVQRLAAEQRLQQVRQQLASAQARLLQLAAAAPAIESDADPAAQTRRVYR
                     FFRDAQTAVYGDEKPARRSRYRPEPVRSEQAAPASTSPLAVDPTLERVSSVSNQSHSS
                     GSMPDADDARAPYASASLAAKVTEPPPSIHCAIIARAITAYRKRREAPRQPNLSDCLP
                     PATIRIAAPGGGGGAQEPTISNIHIGDWVWVISYLDRNHGLWRCLVRPPRYRGQGRLG
                     VFATRSPHRPNAIGISLVQVFDMQPAVSSASNEAATVDLIVRGCDLLNATPILGIEPY
                     QRALHDQPRARVGWLSTETALTMPIWDDLLASEAARVPVRVLSDVVRDKLQWLVAHLP
                     AVDIEARLRAVAFAQQQQQQQQQKHEHAAAKTGSSINCWLPPGDNGRDTLCLGAYRLR
                     YRYDEASGTFYVLDIQSGLRAAVLQSPDERQTDPEVAEHWAFCERFECFPASTPAPTP
                     "
     gene            complement(<862228..>863703)
                     /locus_tag="CYME_CMR356C"
                     /db_xref="GeneID:16997024"
     mRNA            complement(<862228..>863703)
                     /locus_tag="CYME_CMR356C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538533.1"
                     /db_xref="GeneID:16997024"
     CDS             complement(862228..863703)
                     /locus_tag="CYME_CMR356C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538590.1"
                     /db_xref="GeneID:16997024"
                     /translation="MSHEFRAQLTEDSFRQAAARRAHWLPTLYAKPWQPQQQQQQQQQ
                     QQSWTSWELAAKGTLNESSLRVTTQLLPVALGSASAGGSVDASLVLVVLIGDLAGRVW
                     LGRWPLHLQSLSDTSSPAAPAADAPVTLSLLREGGAGRVTALVRAHLPSTAAPESTAA
                     TGLGNGKFFSLAGFADGTVTLLEAHMQLGDAFPQEAHPRQRVWKPAPLFVTSCSSTAT
                     ALPAITGISFLPAHVRVPAFVACDAAASLGLAVMDAAEPCGFRILEQVHVAGAASGSA
                     LASQPLLSSVDVHPDGALVALAATWSGPAFWDIRTAKVFGLDSGPLASPASTTLGHRQ
                     VLVRWHPNGWHVASATASGIVAIWDVRQCGFHGATKTSSGSLGTGQGSPLYWIPAHSG
                     ALSGLAFGMLPGSHEMSSSGESPRAFLVSSGFDGSIRFWDARTYALTADWPISRNGQR
                     PSLGAWTAAPTTAEPNDTVRVIASDGRSVLCGFRPVHRLYA"
     misc_feature    863458..864041
                     /note="possible transcribed region"
     gene            complement(<866685..>868736)
                     /locus_tag="CYME_CMR358C"
                     /db_xref="GeneID:16997013"
     mRNA            complement(<866685..>868736)
                     /locus_tag="CYME_CMR358C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538534.1"
                     /db_xref="GeneID:16997013"
     CDS             complement(866685..868736)
                     /locus_tag="CYME_CMR358C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538591.1"
                     /db_xref="GeneID:16997013"
                     /translation="MARKMPGAQACGRNAPPAAPWIRKSPHRRTQRWRESHSNRAFGI
                     RPSAQACGRNAPPAAPWIRKSPHRRTQRWRESHSNRAFGIRPSAQACAAPSETELGYI
                     SGATLQRSALALGNTEHIQCVWSAYRMWGEKQRADAVVENDVLIEYYDDPAEINRAFE
                     SQTAVGKQSSGARDARRAAVPEPYSDESAAPPSESRLKSFSSCARSSLERVRNVLHYS
                     DTTTIGAGIGVLVWFGWRQAVRSARKRAQQRAPDVQHGLERRLFLAILGHGLGMRYLN
                     EKMNPALSGSIARLAPKLYEETSPLGSDSLITPDGTPLKTGSDFPHDKTQYRALLATR
                     QTEHVMRNAFDQVSASRPLRRDRADNESEVSPATPMEKPRPFLRAPRVQARPNGRAPC
                     AFVTVCSSGTYVLPAVVLASTLQQYHAGIPMICLVVSTAVDKWHREVLSRAGWDVRSC
                     SSFLSDLEWQGFLSSRDLSNRELKRPFSRRAVRHGTASHAASRFTDAHDQWERSTFDK
                     LNIWELVDFEKLIYLDADTIVLGALHELFRYEELAAVKSGCGLFNSGVMVIHPGLHTY
                     QALRNCLLYEEWRSAYTRGYPFPYGDQPLLNYFFKDTFTELPVAFNTTCQRRFRSRQT
                     RVLHFNGPMKPWHVDRSSWFAAQCFWKQQRWRLWYQEYDHALSSFRANADPPEEQCFW
                     A"
     gene            complement(<870747..>871082)
                     /locus_tag="CYME_CMR359C"
                     /db_xref="GeneID:16997014"
     mRNA            complement(<870747..>871082)
                     /locus_tag="CYME_CMR359C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538535.1"
                     /db_xref="GeneID:16997014"
     CDS             complement(870747..871082)
                     /locus_tag="CYME_CMR359C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538592.1"
                     /db_xref="GeneID:16997014"
                     /translation="MPHIHDMNSTANARHFHIPTGASSGMCKNTVNNVRVVHGMRRLT
                     ASLKAGCRGSTRSRTIGCLCEMAFLRAPAQQVSNQTDLLFGIWHALSASPKPVSFSDR
                     QYGEPPDSV"
     gene            <872051..>872560
                     /locus_tag="CYME_CMR360C"
                     /db_xref="GeneID:16997015"
     mRNA            <872051..>872560
                     /locus_tag="CYME_CMR360C"
                     /product="probable DNA polymerase epsilon, subunit C"
                     /transcript_id="XM_005538536.1"
                     /db_xref="GeneID:16997015"
     CDS             872051..872560
                     /locus_tag="CYME_CMR360C"
                     /codon_start=1
                     /product="probable DNA polymerase epsilon, subunit C"
                     /protein_id="XP_005538593.1"
                     /db_xref="GeneID:16997015"
                     /translation="MSHLQIEIDESLRFPAATLKKIIRRKLDKLLSDELVPREDGASE
                     ARRVQLDKDAQLAFSAAATVFVSYITAISTAVGAERKRTTLNMDDVIEALRRTEFEDF
                     AVEVEQFVQNWRMLNERRKAQARQARVERKRKEPENSDVENDDGAYASDMPQEDTEDP
                     EEDDLIEGT"
     gene            complement(<873751..>874266)
                     /locus_tag="CYME_CMR361C"
                     /db_xref="GeneID:16997010"
     mRNA            complement(<873751..>874266)
                     /locus_tag="CYME_CMR361C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538537.1"
                     /db_xref="GeneID:16997010"
     CDS             complement(873751..874266)
                     /locus_tag="CYME_CMR361C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538594.1"
                     /db_xref="GeneID:16997010"
                     /translation="MPTATYAALIHADLDVLWGLLLDKLQSDEQFMPGLERAEIVPLS
                     VAEDPTGVARFRQQHDRRLYFSDGRLVEERVTIDEERKNILLELRNDARYTGYVSTVL
                     LPCPFPEATSGAHVLVRTMDWRAKRSLTDDEIEEGELLATKIRESTLRLKHEVESLRW
                     SLDDSKDPDDE"
     gene            <875837..>878785
                     /locus_tag="CYME_CMR362C"
                     /db_xref="GeneID:16997011"
     mRNA            <875837..>878785
                     /locus_tag="CYME_CMR362C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538538.1"
                     /db_xref="GeneID:16997011"
     CDS             875837..878785
                     /locus_tag="CYME_CMR362C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538595.1"
                     /db_xref="GeneID:16997011"
                     /translation="MSNTNEKVGQKGEHNAKLHKRAVKHASAVVRVPCACRGVLALVL
                     VLLLFCIAFFVTIHAWYAVPRALSASASDSLFSGERAREHLVQLAGPAVVGSRRAEAN
                     AAFIERKLSAMIRSGGCSTTCERLNAADDLTKTLGLRALVERQWGNGSFEMDFSQLGE
                     QSITNAYTNISNIILRLEPLVATNDTATSASAFVCPKSIVVNSHYDTAPGSPGASDAL
                     APIAVMLELVRLILYTNRQYYVAHGTPWLRAPLVFLFNGAEEAILLGSHAFVSGHPTI
                     NSTAMLLNLESAGAGIGPELLFRYDTRSPWLMKLYADAVPHPHTGSYVQDIFERNLIP
                     AETDYRMFSETAGVTGVDLAFHLHGYTYHTRYDMPSRVDVGSIQHMGDNVWALLRMAA
                     HERAESVCSEVSVPRHPEDGARKDPEPLAFFDILSAKVFYFNHRKAYRVYMAMAGILV
                     LLIWQPSRCFTRRNRRAGATAEPALDDATPSQFRAVLAVLLGAATGFLTALALASIMS
                     FLLPGPKPPMIWYGRHMLVLPCLYGAPAVAIALVVAGRLLDPKHAAHHIAMPENPIPR
                     FERIERAVAVYFMALALLLGFWIELTMVYLWAFQASVHILGSIIAWPWRHTSRPMVYV
                     FLRFFCFAVATQLIHLPPVLMTLETFAPLMGMAGSGARVEFAVAALTAYLAIHWGYML
                     WLPLLSIRKAWMRGALRLALAVFLVGGVALLVPHWLGAVPYSPQAPKRLVVQHMCAQQ
                     PLQVHVEQRARASAPAQMASAPQVCLVGIAGLDPYPLERVLPKARFQHCEPNRFTWGY
                     RSKRSIFANVAPLEKLVHHAGIQCPEDSFGAGVLESVAMPRLLVKEDALVECVPPAHL
                     PRAEAADNATLVCRALTLEIRALRAHWSALVFDAAVRQWSLTADAPNQGQTRRHFIRH
                     VAGHGTPHIWNMSLIVERNNTEPAVVFDVMATRYGENRSELSPSLWSNALPDWTAPVY
                     MTSKFATYVV"
     gene            complement(<879200..>879997)
                     /locus_tag="CYME_CMR363C"
                     /db_xref="GeneID:16997012"
     mRNA            complement(<879200..>879997)
                     /locus_tag="CYME_CMR363C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538539.1"
                     /db_xref="GeneID:16997012"
     CDS             complement(879200..879997)
                     /locus_tag="CYME_CMR363C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538596.1"
                     /db_xref="GeneID:16997012"
                     /translation="MPAPPTLAQLCTDALARNCSCLAELHGAELFDGQLATILQGARP
                     RDLRRLARCNGLPLYDSLEHSTSERTVQASFGVVVLTGSDWVDSDLDDAVDDQKEAWT
                     LVTARGAAQLSASMRLSLNLALEQRWKQLYFSRARVEGVPSSSPNAIAASATLGLPSG
                     AVSWSAAYAQQERETRRQLRLACARLRHRRIEMEQERASKRIRVLPLHTVTSQRASLV
                     ELQSERLSETSSIALTSRHKLNETSTRTRLVARFRHCSPSFRKLSGT"
     gene            880729..882228
                     /locus_tag="CYME_CMR364T"
                     /db_xref="GeneID:16997016"
     misc_RNA        880729..882228
                     /locus_tag="CYME_CMR364T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461632.1"
                     /db_xref="GeneID:16997016"
     misc_feature    complement(882067..883734)
                     /note="possible transcribed region"
     misc_feature    883249..884859
                     /note="possible transcribed region"
     gene            complement(<883946..>885862)
                     /locus_tag="CYME_CMR366C"
                     /db_xref="GeneID:16997018"
     mRNA            complement(<883946..>885862)
                     /locus_tag="CYME_CMR366C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538540.1"
                     /db_xref="GeneID:16997018"
     CDS             complement(883946..885862)
                     /locus_tag="CYME_CMR366C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538597.1"
                     /db_xref="GeneID:16997018"
                     /translation="MEPNSRAPGTSKTLHSHGEIESSAERVVLSEIASDASCHKRTYK
                     KTELRRAIIRSVCHQSKEDGAEGLPLQPPAGERLSEQADRLRLGMPRRLLMRDRSGKA
                     SRALPTGCESTSARYRAELAGTLESSSEASAAQPAKWSPAKSFQTMVRHLSGGVGARM
                     DSHGCNVWLLQSDEGHSQGTSLSPQAVDCSRENQSSPIPLPSANCVQIPAEEPAVCPH
                     EPTTSDTLSGPASERKSPMQVDNYLETAPGTERRSKRIHRRKESGDTEQRDLFRFPEQ
                     NPGAVSITLGDLRLLQPGGYLNDNVIEFWLKFLERYRIPPYRMEQLHFMSTFFYKKIT
                     SVPQRSRSDASLAEELYDYIALRWFISRGVDLFTKRMLFIPIHHEFHWSVAVVCNLDA
                     FANGWHSELDCECRHKPCILYLDSMRSASPGGMTKSVRSFLTTYARVRAATMCSTGVG
                     TTRKVRLCSAGGTERSTGVRSADSEFGSTDSAGHLAMHPQSAHPEKMTAGDDLRGVRP
                     AAAHDSPESPLRTVSTAGDQRDADERSGDSFVFDGENLPLLKPKVPLQENGMDCGIYM
                     LMYIEHLAWSSPESYQLEYLNACTSKLFAASDADAYRLVIERVIRGLASAHGIENLPE
                     YDVEDVDLLDAEDV"
     gene            complement(885973..887606)
                     /locus_tag="CYME_CMR367T"
                     /db_xref="GeneID:16997019"
     misc_RNA        complement(885973..887606)
                     /locus_tag="CYME_CMR367T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461633.1"
                     /db_xref="GeneID:16997019"
     gene            <887921..>888586
                     /locus_tag="CYME_CMR368C"
                     /db_xref="GeneID:16997006"
     mRNA            <887921..>888586
                     /locus_tag="CYME_CMR368C"
                     /product="unknown amidotransferase"
                     /transcript_id="XM_005538541.1"
                     /db_xref="GeneID:16997006"
     CDS             887921..888586
                     /locus_tag="CYME_CMR368C"
                     /codon_start=1
                     /product="unknown amidotransferase"
                     /protein_id="XP_005538598.1"
                     /db_xref="GeneID:16997006"
                     /translation="MESSVPSESPKLVIGVLELQGDFFEHERLLEKCGVSTKGIRQRR
                     HLLDENGKILVDGLVIPGGESTTIGKLLVELDMLDVIRTAVAPPHCLPVLGTCAGCIL
                     LARRIRTFDDQPRIGCLEVEVERNAYGPQIESFECQVQNVQVFGEEPLRAVLIRAPVI
                     TRVLDSARVQVLASFRDTPIVVQQDHILACTFHPELTGDTRIHRRFIEIVKQNIAVER
                     RLN"
     misc_feature    complement(889258..889492)
                     /note="possible transcribed region"
     gene            complement(<891162..>892442)
                     /locus_tag="CYME_CMR370C"
                     /db_xref="GeneID:16997008"
     mRNA            complement(<891162..>892442)
                     /locus_tag="CYME_CMR370C"
                     /product="probable sodium-dependent transporter"
                     /transcript_id="XM_005538542.1"
                     /db_xref="GeneID:16997008"
     CDS             complement(891162..892442)
                     /locus_tag="CYME_CMR370C"
                     /codon_start=1
                     /product="probable sodium-dependent transporter"
                     /protein_id="XP_005538599.1"
                     /db_xref="GeneID:16997008"
                     /translation="MVSHKVCRGSWRGTGGCCFVLCIKTAVLQTTAEHSCRRSRAASY
                     LQPATDSSKRWRTQRLCGLGRDDCCRGGGFSSWRTLGQHAYRQAPCPGRERPPVMRET
                     TQGRHLRMTSRSERVLGLLTNLFPLYVILGSITAATCPSVFAFFKREYISPTLSVIML
                     AMGLTLSVDDFVAVLRVPDVVLWGALAQYSIMPLLGWMLSRHLGLPTPYAVGMLLVSS
                     CPGGTASNLVCYLAGANVALSVLMTATTTQAAVILTPLLMKVMAGTMMPVDACGMFLS
                     MVQVVFLPLAVGMLLNAIPRTRAVIQRLLPWFPLVSVAGVVLINASIISGSVDAIRTG
                     GLRLFFALLLLHGLGLVLGYVVSFLRFRDKQINRAVAIEVCMQNSGLGAALAQAHFAD
                     PQVAVPAAISASMHSVIGSVAAGIWRWLDSQRQR"
     gene            <892375..>893727
                     /locus_tag="CYME_CMR371C"
                     /db_xref="GeneID:16997009"
     mRNA            <892375..>893727
                     /locus_tag="CYME_CMR371C"
                     /product="similar to rRNA processing protein 7"
                     /transcript_id="XM_005538543.1"
                     /db_xref="GeneID:16997009"
     CDS             892375..893727
                     /locus_tag="CYME_CMR371C"
                     /codon_start=1
                     /product="similar to rRNA processing protein 7"
                     /protein_id="XP_005538600.1"
                     /db_xref="GeneID:16997009"
                     /translation="MHKTKQQPPVPRQEPRQTLCETMQTPDLKTRPSKVLEASREPLS
                     RSCRAALLWILPLRIRGCDMWLPRSSCSLQQWALGCLQNSTNMDWEWNVVQVPLEKSV
                     EGQVTAWRCLFYGRPTRPEHVSSFVWRCLTQGRLPTALLEEDTAATHNAQLCGASTQK
                     RQHDGSHAIADACNGQSVTELLRLVLVFWNLPMGTRREDLEEACSSAGPVRWAFIEHS
                     DSAETKFKTENVLEKEKAFRIRPNSAVGEPAVVRGYVCFESPEDAQRTLNSPDELKLS
                     ALSRRTIPKLKQFLPVQLRGALEVNSFPHWAWLRFKHDHLADIRGLEATCDRIMAAYE
                     QQVRKIQRDQERKRCLVDEDGFTLVVPRTHKQQHVNNDDKRSRSGNANPLYAGAPQNS
                     RGESVIENVSETKAAPVGFYRFQRDELKKRELAELRAQFERDRHRLHSLRATRQTFLS
                     "
     misc_feature    complement(893968..894430)
                     /note="possible transcribed region"
     gene            <894517..>895590
                     /locus_tag="CYME_CMR372C"
                     /db_xref="GeneID:16996671"
     mRNA            <894517..>895590
                     /locus_tag="CYME_CMR372C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538544.1"
                     /db_xref="GeneID:16996671"
     CDS             894517..895590
                     /locus_tag="CYME_CMR372C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538601.1"
                     /db_xref="GeneID:16996671"
                     /translation="MFTKQPVSQALASLTLLDSSDINTHKEEAKGNEACFSSSSSSLS
                     STSSTATELRDLHDDAHTDVVARLDQRPLSENGDCESDADSSAGVGESRETRTLPRTP
                     HEVLYSELDPPVAPDSSLIRPDHSLKSVGSILAFIDGLVVVQSALELAPQVRASLGED
                     SLFCFEDRQPLGFVFEVFGSVQRPMYILRVDARDTALCSKIRVGCAVYYVEELLRPLE
                     LEKNAKRGCDACDEFGEELHSSDLEFSDDDEEARARSRRRRQVTQTPLLRSSGSSSLQ
                     GRQSSPFRNRVWSQRQRGRAAASSAMTSTAPTSSGARDPRSMPRQRAAETQVESAALR
                     GQASRRGHGRHAAVRQERALQFR"
     gene            complement(<896973..>897746)
                     /locus_tag="CYME_CMR373C"
                     /db_xref="GeneID:16997021"
     mRNA            complement(<896973..>897746)
                     /locus_tag="CYME_CMR373C"
                     /product="2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase"
                     /transcript_id="XM_005538545.1"
                     /db_xref="GeneID:16997021"
     CDS             complement(896973..897746)
                     /locus_tag="CYME_CMR373C"
                     /codon_start=1
                     /product="2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase"
                     /protein_id="XP_005538602.1"
                     /db_xref="GeneID:16997021"
                     /translation="MYLEKYRLDGRVAVITGGGQGIGLCCAEALGEAGAKVVLAELVP
                     ERIDQALKYLQSRGILASGVQVDVTDPAAVETAAERIQKEHGQIDILVNNAGINIMGQ
                     ATEHMTDEHWHRHMKVNVDGVFYCCRSFGRRMLERGQGCIVNIGSMSGEIANRPQLQT
                     AYNVTKAAVHHLTRSLAAEWATRGVRVNAVAPTYIETPLIRQQLSDDSFYKIWIDMTP
                     THRVGRPEEVASVVLFLASDASSLMTGAIVLADAGYTCW"
     gene            <899385..>901229
                     /locus_tag="CYME_CMR374C"
                     /db_xref="GeneID:16997022"
     mRNA            <899385..>901229
                     /locus_tag="CYME_CMR374C"
                     /product="similar to RNA helicase with DEAD motif"
                     /transcript_id="XM_005538546.1"
                     /db_xref="GeneID:16997022"
     CDS             899385..901229
                     /locus_tag="CYME_CMR374C"
                     /codon_start=1
                     /product="similar to RNA helicase with DEAD motif"
                     /protein_id="XP_005538603.1"
                     /db_xref="GeneID:16997022"
                     /translation="MLVLLHFEIRACSSKEKVRKKTEKKSRSAIGSICLFPSDTGGVC
                     RVVLDCSLALTHWTRRALVRHIPRRRMTFLQAPVTFSKARPRPCRGFVSPHPEYTRNA
                     SRFSQRVPLERRRCRVHTVLRLELSGDAFDKFGDSCRETPAITATPGEQRESGSFRER
                     YASRLPAWLLTRLESVGFHRYTPIQKAALDHFLGTDESAQGEERARDAVVFGETGSGK
                     TLAYLIPLLATVKPTRSAVQGLVIVPTPELAVQVYRVARRLAVGYLATTAPASSSVPR
                     RDRFLIGIALNEASVDRQRRFFRNAPPRILIGIADRIEALARSNKLRLHSVRMAVIDE
                     VDVSVGEPAYRASLHALLNVYCMSRIEGRRTTVFVSATIPQYRHFMDYARQQGWMDGD
                     IKILATKSSPMDAAPQVQAVHAATLRANAEETPASPNGLELALQRTNAPGVAQLPERI
                     EHFYVICTESRKKLKALAFLLERERPSLTQVIIFCSESRNLDQIANYIHVQGLFTESE
                     VAVLSTALPLRRRRLALERFRCGEVRALFSTDLASRGLDIPETSHVINFDLPETAEQY
                     AHRVGRTGRLGRRGRAISIIVPGERFVLQRYSNRFRIDFTDWTQTSQS"
     gene            complement(<901441..>905073)
                     /locus_tag="CYME_CMR375C"
                     /db_xref="GeneID:16997039"
     mRNA            complement(<901441..>905073)
                     /locus_tag="CYME_CMR375C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538547.1"
                     /db_xref="GeneID:16997039"
     CDS             complement(901441..905073)
                     /locus_tag="CYME_CMR375C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538604.1"
                     /db_xref="GeneID:16997039"
                     /translation="MESLHERPRETGEHVGSWNSEKTRHSRGLRVGRSFSAEQLHIAG
                     RPFEPLAKELRLLGSVGGSGSSTVGTGSFSHCNSEYESTCRAYNARQNQSRATAAAVV
                     PERPRHSDTTEDGNRQAASSERGTKKLSFRQLKSLHVSLSTVERAVAAAGAKESNEKA
                     SELKVIESVTPSSLLQEALMRASRRRADGKMIINLSALTEAIDELGRATEQLDCYTAH
                     LYQAQALGSNRYVRLRAGPEAVAQRTLALDLVSDALSKALGTLSENSNLIRRSRKELH
                     VSEELFERKVSKRSFLRSVVQSLETIRRMQQLLDEVRDALRLHQYDEANRLCKSFDLL
                     YRSSLLRRELGSVVRKGRIFRDFSDVFMDLAARSLQCMFEQVQGLCCKFDAEVFQAVW
                     NAYENLGAELVLAERFAYALEHVLAEIRARALECAQWRQASGATLNELSKREAAVASP
                     LLASFTNVWQAAGAHANALAPRTPKSQHVPSNTAPSGGELASRPRNPWEFLDCWAGFL
                     SAICYPVRQLFEHPRISKRFRSIVWEALQARLDADCDFMANQLVAEHDTYPVVTLAEL
                     WRSQLVLHALETQWISIAADDHFPEDADGRAAGIYSFDATAPRKHSMVTASPNGSVVR
                     TSSLELNAERLLRGTRQRKQRTLPLATIHENIVKPLLKSYIDLFKRDIESRFMEIFAT
                     PNDWQAISVQSLGNTDTRNQMQLDQNRFVPETWRSYWETIRAWYAVPDADPDSCLVVK
                     VLTHELASLRVEDLLSIIWERLHRDEGYSIPDDYTFTGASVFGIECIGTLASMLYAPS
                     EYANVAPAGLFAEAIQQIALFAMYLLGVVYAPCFMATGILGGSLVQLEKYESLRPALS
                     AYQRALLAHFLHEPGSSAASSTALQRPRSELNLSKFCCAVESAWTIGQVAALTLETAA
                     TFQEQTQVAYRPESRWRNAFVAEALGRANQLRGLADALQLALYRSLAPALVDTAEITR
                     NVVQQLKQKKAPWWQSITQGQSPVSPSAEGAVHETLGEASAGGNEDAVSVSRASPYVA
                     QITARLRMLHESRGLPAHAEEPLWRACVFGVLVAVQDGIAQIPVTSVDIQCVSQALVD
                     AKTLIGNLEEVLGFHPLPYASELCQFIQLHLAPLPRILQWIATHRETLSRATMRGLVR
                     HGVRLSIDDENASKTFSDEAIERLLTEAAAEVPETAARTSPQVTSEDATDGMQVSVTV
                     LRLDAL"
     misc_feature    complement(905114..907460)
                     /note="repetitive element"
     gene            <908448..>909167
                     /locus_tag="CYME_CMR377C"
                     /db_xref="GeneID:16997040"
     mRNA            <908448..>909167
                     /locus_tag="CYME_CMR377C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538548.1"
                     /db_xref="GeneID:16997040"
     CDS             908448..909167
                     /locus_tag="CYME_CMR377C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538605.1"
                     /db_xref="GeneID:16997040"
                     /translation="MEAPTASSDAALSSPVESRDARLPADSLEATAALLEALSRVKEL
                     EGELANERRRRIALENEVQQQKALNVRIQQQLEAEEEALTNRLNKRLSELRLEKEQLA
                     RDIEREEEYLTNTLQQRLEQLKKEKIDMENALEAEQEAIVNRLQREVQKLQKEKAALE
                     KQLSQYARSSLDLPPATPSDSESERDIVRRRRSFSRDSSPRVSAAAFRARLEQTRLAG
                     HSSSSAHTTPPGTPPRPKDQA"
     gene            complement(<909903..>910910)
                     /locus_tag="CYME_CMR378C"
                     /db_xref="GeneID:16997041"
     mRNA            complement(<909903..>910910)
                     /locus_tag="CYME_CMR378C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538549.1"
                     /db_xref="GeneID:16997041"
     CDS             complement(909903..910910)
                     /locus_tag="CYME_CMR378C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538606.1"
                     /db_xref="GeneID:16997041"
                     /translation="MMLRKGSSLGHQPVLERVQVPKACIARDLLTGSPAELRRVSKKL
                     TGTIGNRLRELEDLLHSIPNNADTTVSVPTLGKLLVRTEHLRVYLVALKEVVTALRRQ
                     SPDGELPSVDIEGQLDAFLQWFNKLDKLVERRLDKVTEAAPGVERLASAEALPRREQS
                     DPETVVAETLAEYAPFFKLFEPMETKREEGQEIKQPVLRRRRSHPGKEHTWLELPSVA
                     ADPTGQVSSTSSRYAIKAPDGVLAHFQLQDRYVEVLSDTVGRIREHAEQIEESVTRDN
                     EILDRMQPKLERNLESVRTQQGRLQTYVNERVRSICSQWLLVAVAIALWFVAFLAIRM
                     G"
     misc_feature    complement(912334..913685)
                     /note="possible transcribed region"
     gene            <913900..>917337
                     /locus_tag="CYME_CMR380C"
                     /db_xref="GeneID:16997027"
     mRNA            <913900..>917337
                     /locus_tag="CYME_CMR380C"
                     /product="fusion protein of glyoxysomal fatty acid
                     oxidation tetrafunctional protein, and acetyl-CoA
                     acyltransferase"
                     /transcript_id="XM_005538550.1"
                     /db_xref="GeneID:16997027"
     CDS             913900..917337
                     /locus_tag="CYME_CMR380C"
                     /codon_start=1
                     /product="fusion protein of glyoxysomal fatty acid
                     oxidation tetrafunctional protein, and acetyl-CoA
                     acyltransferase"
                     /protein_id="XP_005538607.1"
                     /db_xref="GeneID:16997027"
                     /translation="MTGESVSVQYQPDGVAIIVFSAPPVNALSVNLRRLLALNVANVV
                     ADRRAKAIVLYGGESTFSAGADVGEFPEKLGSAENIISLDTEPFKTLLETSPKPTVAC
                     ITGTALGGGLELALACHFRVALSDAKLGLPELRLGLIPGLGGTQRLPRLIGVEPALDM
                     IMHSRIIDGEEAHRCGLVDRLVPASRRETLLREACAVALEVASDPQKMPPPLLTRTDK
                     LGNADVEKIRSKYLPRAVEMRQKTGQIQFESCVRAVLEGIERGGGDAGWALEAELFRQ
                     CAASEASRALIHVFLASRRTVTNFKAEPHLHEPRTVAVIGGGLMGSGIAACILQNGGR
                     VVLKEVNENALAAAIQRIEAILSRAKVDTADARRRLQGTIEFDKKLFSDVDLVVEAAV
                     ENVQAKQGIFRSLAECTGPHCILATNTSTINLDLIGEAIPQVHKEGRLIGAHFFSPAH
                     VMPLLEIVRANRTRNRAVQMVLAFAKHLRKTPIIVGNCAGFAVNRMYFPQTQMAFFLT
                     EYLGIHPYDIDRACQEVLGLPMGPFGLADLVGLDICDSVNQVFSMSYPERVCSLSIAG
                     KLIEMGRKGQKSGAGFYRYGADHRKPIEDREMLDPLLASMTPPPLREPLTPLDIVQMI
                     FFPVVNEAMRVLEERIADKAADLDVASVLGYGFPAYRGGLLYWAQHLPGGPRLILERL
                     REWDTRFGTQCPLFAPSFALECALRSTEPVLERPPRPRLATGSDDDIVFVAAVRTAIG
                     KAGRGLLKDTLPEDMLAPLIGALLDRSAVKPAEVGDVIVGTALPRGDAAAVSLRVAAL
                     CAGLPDTVPVRLVNRLCASGLQAIADAAAAIQRGDYGIAIAGGVESMSMNAIQLSLER
                     RSHRLASCAAAEDAYLSMGDTSENVAARFAISRAAQDRFAASSHARASRASLSGRFER
                     EILPISTQVYPTRKAAKQADGNLSTAERAPAVPQPVVAQRDEGIRLGVTTGALAKLPP
                     VFRKQGTTTAGNSSQVSDGAALVLLMKRSEARRRGLRPLGTFRAFAVAGVPPAIMGIG
                     PAAAIPKLLSQAGVEANLIDLYEINEAFASQAEYCVQKLGLNRDVLNVNGGAIALGHP
                     LGMSGARLCVTLLHELAIREGRYGVVSMCVGTGMGAAALLERCEDDGFDERRLRAAL"
     gene            918256..920603
                     /locus_tag="CYME_CMR381T"
                     /db_xref="GeneID:16997028"
     misc_RNA        918256..920603
                     /locus_tag="CYME_CMR381T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461634.1"
                     /db_xref="GeneID:16997028"
     gene            complement(<922072..>923799)
                     /locus_tag="CYME_CMR382C"
                     /db_xref="GeneID:16997029"
     mRNA            complement(<922072..>923799)
                     /locus_tag="CYME_CMR382C"
                     /product="similar to sodium/hydrogen antiporter"
                     /transcript_id="XM_005538551.1"
                     /db_xref="GeneID:16997029"
     CDS             complement(922072..923799)
                     /locus_tag="CYME_CMR382C"
                     /codon_start=1
                     /product="similar to sodium/hydrogen antiporter"
                     /protein_id="XP_005538608.1"
                     /db_xref="GeneID:16997029"
                     /translation="MIATAVVILDLLLTTTWILRLVNERVFQIPQVVLNSLVALVLSF
                     VLKQLALVVPPLQQEVDRFTEVIYEFPELLLDYFLGFLLFATALHVDVREFRRIRVTV
                     FALSVLSTLLSALLVGVLTYGGLASLYALSFREALLFGAIISPTDPVAVMSILKKYRR
                     QVPDATRFAILGESLFNDAVSVILYVVLIRSGKSTEPCTYCSAVFRVLRVFLVEALGG
                     VAIGFAFGLLACHVIGMVEDALLEVTTSVVLVLNLEVFCSYVHASVPLAAVFAGIVMS
                     SRGRGTAFTRRGEKRLLHIWKFIDETLNGMLFLLIGLSAVVWSPTSSWKSTLLVACIT
                     ILITMIARAASVVLSLAAVMLSSRCWRYWSRGRRWRLFGDAVHEPRHRRAVYRIDSVA
                     IIIWSGLRGGVSIALALAAPGALEASGQAVTRSFNHLLFMLTYIGVVWSILVQGLFFG
                     RILRFAYGASDSDRERSIDGYGALEETQETASLSRPETQSAQCNADLSEFPLAATLDS
                     ATYLSGLIKSAEDAPDTVPGHDTGPEDETTTETNPIMTRWMHQQQQQTEDAVVAIDDR
                     ALLLGAREL"
     gene            <924323..>925168
                     /locus_tag="CYME_CMR383C"
                     /db_xref="GeneID:16997049"
     mRNA            <924323..>925168
                     /locus_tag="CYME_CMR383C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538552.1"
                     /db_xref="GeneID:16997049"
     CDS             924323..925168
                     /locus_tag="CYME_CMR383C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538609.1"
                     /db_xref="GeneID:16997049"
                     /translation="MGAEDSSLCAELYRFLRLLVHNLLYAAKVYPEQYFTQQIAFNLT
                     TRVATVDCLERYITEHIALLHRGQRPIGTVHEMIVSIQELPEQQDMNPTVESVAKQTS
                     QNGAEAQLASNTDPCHSMLELVRLRVLLPDLEALEALEATPDKWKLLEAYRSRFRLVL
                     CRVLTYPWPPLAAPVSLETWRRTFRLYFRLSMPEKQDDTGLILETLREPIISERESAP
                     STSEKEPANDARALLYASQRFGFPRGVSVPLCDDAITTLDGASSFPPKLSLFVFIEEP
                     PLVPI"
     gene            complement(<927555..>932324)
                     /locus_tag="CYME_CMR384C"
                     /db_xref="GeneID:16997050"
     mRNA            complement(<927555..>932324)
                     /locus_tag="CYME_CMR384C"
                     /product="ubiquitin-specific protease"
                     /transcript_id="XM_005538553.1"
                     /db_xref="GeneID:16997050"
     CDS             complement(927555..932324)
                     /locus_tag="CYME_CMR384C"
                     /codon_start=1
                     /product="ubiquitin-specific protease"
                     /protein_id="XP_005538610.1"
                     /db_xref="GeneID:16997050"
                     /translation="MRNQARRTPAQTGDMRQPRALGAPAAAEQQPLSASPQDVPMETM
                     LPDSARIDKNTGGEQLLDRSQSPETQPWVCVGDDELTFLGETTTQRRIAAPAAVRRQP
                     LNPYFSLAAPDRGSEPYGVRADDETGDCEGEDDVEEDSFVSSTSHGDGNCEDSDGTTD
                     RLDHMRPLIRSGVVDVENAADSSTAGSFDEIGPARPMRSVPSVPESDFIDMELDTRNH
                     RDLCSRLVSNAIVVFEYVLRDVTKLLRSPVYRQNMDQRSGGGGVAGRLRVTSPWLEAF
                     GFQWRLLIFPRGNGDPEGKFMSVFLECSPLDSAREEQKKSWRSHARFQLALKNQTGVR
                     PPIIRREMAGHMFSPRESDWGFQEFAPCAELESPRFGWLIHDQIIFRVWIEFDKDSYT
                     FSEQYDSKRETGFVGLRNQGATCYMNSLLQTLYNIGAFRRAVYELPLPPLEGEAAEMV
                     DRGLDSQAPASETSTGTPLTFALQRVFFDLQHEDQCVTTKELTNAFGWTDADAFTQHD
                     AQELNRLLCDTLEERMKGTPLEGTIARLFQGQAKRFIKCVHVDFESSHDECFYDLSLN
                     VKGCKDLYDSFRKYIEVETLEGDNKYYADGFGLQDAKMGVQFIKLPPVLQLHLKRFEY
                     DFNRDMMVKINDRYEFYPEIKLGEFVDGSTGADDEEYIYVLHAVLVHMGDVHGGHYHA
                     YIRPDPGTEEGSKIWFKFDDERVLRVTESEAVEDNFGAPLAANGVPFPPQRRFTNAYM
                     LQYVRKKDAHIYLGASTEADVPEALRQRIALEKELEEKKIREREELRQMMNIRLITPA
                     MQKGYHGLDWTDLNQGLILRVRRSMLLGEFKQMLLKEVLSPEGIDASSALSNENFDGD
                     ACQRMLVWTFVARINQTIRPSRLLNDGNHEEPLERAWNDRAIARNNQAGASPGSMGSS
                     IHAVNLFIDVRQEPVRLAALFDKRECLMLFKWYESADPPARESPELRVLGWDVVPMHL
                     TMQNLVALLRERNVLPRVPLSELYWYEEVTSQDAKEIVSDVALSTARNQLQSGDIIIF
                     GRRSPIRQQTDQTARALNVNESGNNSEAPVSSAALLASILQDPDLSVEEQANALYRHM
                     FWDARDFLRHRCDVRLVPLTLQRMSGAAGDEPLTEEPSRGGSVASGPGSDQQNASEIL
                     LRNVSTQLTQYGLGTLLVAKLRNLHQQQQGLDLMQTCGVTAEDLRPSRVRFHRRGFSS
                     LDDFLYPRDSDPIPMSGARTRKILECIVSKQRIVKLFYEFIDTDAEAFEGKQEVTITW
                     RPTPIDMIGRKILLALPLNATYGDLIRELESKLSVTERTALQSQYAGIRVHELWQKKI
                     IAGIVPLDRTVTVLGPDSNRENFEILAEPVPPHETPEELSRQGCVLIRVAHISKSASP
                     PLYGIQQDENYAAGGLATVNSFGLPFLLRVPSPEIHGTLPVQQLQTLIQERLQLPENE
                     FRQWRLLYVRPAERHPVIYLQPNGHEESERSAALGSPENTEKAHHGEQPVNHSETTKS
                     GRPSTEKISELAVSNGRQPSVAEGVTGAAVDTATMLSAEEKLLRRGLINLQDCIVEND
                     DTYVHNFIGLEHHDSNATKRRATSRLRYLNDKPLKIA"
     misc_feature    932541..933318
                     /note="possible transcribed region"
     gene            complement(933264..936061)
                     /locus_tag="CYME_CMR385T"
                     /db_xref="GeneID:16996672"
     misc_RNA        complement(933264..936061)
                     /locus_tag="CYME_CMR385T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461635.1"
                     /db_xref="GeneID:16996672"
     gene            935491..938751
                     /locus_tag="CYME_CMR386T"
                     /db_xref="GeneID:16997035"
     misc_RNA        935491..938751
                     /locus_tag="CYME_CMR386T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461636.1"
                     /db_xref="GeneID:16997035"
     misc_feature    939494..942221
                     /note="transposon"
     gene            <941916..>943283
                     /locus_tag="CYME_CMR388C"
                     /db_xref="GeneID:16997036"
     mRNA            <941916..>943283
                     /locus_tag="CYME_CMR388C"
                     /product="ATP-binding subunit of unknown ABC transporter"
                     /transcript_id="XM_005538554.1"
                     /db_xref="GeneID:16997036"
     CDS             941916..943283
                     /locus_tag="CYME_CMR388C"
                     /codon_start=1
                     /product="ATP-binding subunit of unknown ABC transporter"
                     /protein_id="XP_005538611.1"
                     /db_xref="GeneID:16997036"
                     /translation="MWQTGLHSSTSLYWSCTLGATGTSTGKPASVAHRCSVSAAGFRA
                     APMPCIRRGVCTSRTHSRTSNPLKMQRNTDPAGNSIGIEPTVRVEDVYKSFQDKKKSL
                     FSWRFEALTVPALRGVSLDVYAGEVFGLLGPNSSGKTTLLRCMSTLCKPDRGAVYVLG
                     KHTVRESFAVRHCIGVVFQDAGVDKILTGREHMELFGNLYHMPPAHLRRRIDELVGML
                     ELEPYVDRLTGTYSGGIKRRLDLALGLLHEPSVLLLDEPTVGLDLSSRRVIWNAVRKY
                     ATAGNTIVFTSHYLEEVEILADRVAILDEGVSIAVGSPPDLKRQIGGRRFTIRVEEFC
                     PENIAQAALEALRSEGIVERAQINAFDYNALELFVEPELLDQLGIDPSLNEDEAYSVY
                     AERIRQTLKGKGFDLFGITERGVSLSDVYMSFAGRDFRAADEAARLDASTKKRKPKRR
                     SSLES"
     gene            <945990..>946670
                     /locus_tag="CYME_CMR389C"
                     /db_xref="GeneID:16997037"
     mRNA            <945990..>946670
                     /locus_tag="CYME_CMR389C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538555.1"
                     /db_xref="GeneID:16997037"
     CDS             945990..946670
                     /locus_tag="CYME_CMR389C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538612.1"
                     /db_xref="GeneID:16997037"
                     /translation="MRRNTLSGFLPLLRVRARKATVSQQPSSMSVFAQYSSQQHQQCS
                     SIERVSCRRFRLESPPDTWRLGAALARLARPGDVFLLQGSLGAGKTTLARGFIQEFLN
                     DPELEVVSPTYLLDVTYPDYENKAKVPGVVLHHLDLYRLENADDRPIADFADIFTHQI
                     CLVEWPERLGKYSTPEEFLQIRFSFVAGADGPRVIESSGFASHKHLENPRWSQARIDQ
                     IQWQCSAA"
     gene            <949181..>950881
                     /locus_tag="CYME_CMR390C"
                     /db_xref="GeneID:16997038"
     mRNA            <949181..>950881
                     /locus_tag="CYME_CMR390C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538556.1"
                     /db_xref="GeneID:16997038"
     CDS             949181..950881
                     /locus_tag="CYME_CMR390C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538613.1"
                     /db_xref="GeneID:16997038"
                     /translation="MVDRRIANSGQVRGLSSSLESTGWKALSKRKLCLVIFILLPLLN
                     IVQTRIYSREQAHHVPAAKSPRHHDLLSLREILHLLEKHEKEIHEKHRASRDTVTVVL
                     NVFLRPGAFRRVLDGIGSQTALQSITHVNVLALGSPFVHQYGKLLEEYRKTASWTSEV
                     SISLVTSEPTFNPGYFGRFLLSMNLNTTFTLILDDDVVLGARYLELCLRWARSIDKHA
                     VLGQRGARYYRNELRKRSLFGLGKRLSPNKYHDFFGEHGLLRDTDVLFSAWFLRTKWI
                     LKMFAEEPLTWATAEDIHLGMLLRQRFGIRMVALPVDPQLPEFRLNHDQSLEITNRSW
                     SDENTALVRLRDAAVDMWLSRELHGQLLNPLLYSWTRKDVFWYSMPVKRGAGALSAYS
                     SSQRKNRSGRLHVLWRPFACKRLRFAPNDSVPMISLPYCRRLRYRRPRIGIAKSYFGL
                     WNSGYLADCMFWGDRNGASYHEFLGYTLDIRGQDEWILDGILYGNTYGRVRLWDVRRN
                     ALIIDEYLEQNVTLRLKRVTVVPPTTIIALFSERLDDGVRAAQRKLFDEIRILPKDGT
                     "
     gene            complement(<955522..>956865)
                     /locus_tag="CYME_CMR391C"
                     /db_xref="GeneID:16997061"
     mRNA            complement(<955522..>956865)
                     /locus_tag="CYME_CMR391C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538557.1"
                     /db_xref="GeneID:16997061"
     CDS             complement(955522..956865)
                     /locus_tag="CYME_CMR391C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538614.1"
                     /db_xref="GeneID:16997061"
                     /translation="MLTLCRKRVGRVLALLLYLLIYVLGRENGSCAIAPRNQGFPYDF
                     SLAFPNWPVPFCSERFRNNSRGSFNLGLHRVSKEVTAYSLPESAVVYRDTEERGGWGN
                     LLLGLASAYVLSVALDRPFFIDSERFTRAFTPGTAAALWNKSFDNASLFPRAERSLLR
                     VREHDSIWQRISPGYDQPYKMIAEENPTWWFRGRRGVRPPFLDVESNQWFVPALYLNR
                     HIRPLLCEKLGAAAFRSVSNGVWMPNAFVQNILDHFCARTGMLCTSSPMPGAKIVGVH
                     IRSEASAPRWRRYRLRGHRLYSMLRCISLVKSNLEDLLSPSSVYLFIASDSSPLLSEL
                     QKLEKAPHFHFLDPELDARDVPADIREHVIAAAELILLSRCHYRILSVGSTFGMCAHA
                     MSTSVAWPFVLTERGDCVQVPRNEPCQHHLYRLRHMNGIETIADLTNDMRFGCII"
     gene            complement(<958090..>958911)
                     /locus_tag="CYME_CMR392C"
                     /db_xref="GeneID:16997062"
     mRNA            complement(<958090..>958911)
                     /locus_tag="CYME_CMR392C"
                     /product="probable heterogeneous nuclear RNP protein A"
                     /transcript_id="XM_005538558.1"
                     /db_xref="GeneID:16997062"
     CDS             complement(958090..958911)
                     /locus_tag="CYME_CMR392C"
                     /codon_start=1
                     /product="probable heterogeneous nuclear RNP protein A"
                     /protein_id="XP_005538615.1"
                     /db_xref="GeneID:16997062"
                     /translation="MERKDKRRKVFVGGLSWDTNEASLVAYFERFGKVIDAVVMRNRE
                     TGQPRGFGFVTFEEEGVAQAVASLERHELDGRLVETKVAVPKSAEDPESNTVVDTAQR
                     YGPSGLGEKPSRRVYVSGLPQACTEDDLRAFFSRFGSLEAVRVVVDHHTGLSKGYGFV
                     VFAETAASQKVQSLDPENFVIRGSAFRVKVRCCRNNESSRPKHTNGNPWGLTPDALLK
                     SAHDGNHQGYSFDDMGVDTGIVAQYLHAVYGGDLAYWEKWAREVRTANRPQDEML"
     gene            959575..962328
                     /locus_tag="CYME_CMR393T"
                     /db_xref="GeneID:16997063"
     misc_RNA        959575..962328
                     /locus_tag="CYME_CMR393T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461637.1"
                     /db_xref="GeneID:16997063"
     gene            <962615..>963778
                     /locus_tag="CYME_CMR394C"
                     /db_xref="GeneID:16997082"
     mRNA            <962615..>963778
                     /locus_tag="CYME_CMR394C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538559.1"
                     /db_xref="GeneID:16997082"
     CDS             962615..963778
                     /locus_tag="CYME_CMR394C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538616.1"
                     /db_xref="GeneID:16997082"
                     /translation="MAFVCYPLFTSAKFRVIPAHGLHSRSSTLWKGTTAGRHAAGRAL
                     VASSTARGALTLRGNAAGAPRRPLQPLLAKGAAVLAALAVAISPLLGDPEAALAAQGG
                     GRVGGSTFRAPATRSAPPRSYRAPSGGIGGYYYSPAPVLPFTPFYFGPVVVPFGFTGI
                     GTFLLAAAFFAFATRALSSNLSGLGVSAAAEDSELAAEQTTLVKLKVGLLSTARELQQ
                     ELEEIALRSKTDSIVGLQQVLQETTLALYRNPDYWSFGSVNVKRTSLSEAEAAFNNES
                     FAERGKLEKETLSNFGGQIDIRKREVAERDSTDMRVPEFIVVTLIVAASGRVPGVPTE
                     IRRSSDIEAALRALSSIPREALQGVEVIWSPQSREDALTESEMLADHPELVRI"
     gene            <964690..>965193
                     /locus_tag="CYME_CMR395C"
                     /db_xref="GeneID:16997083"
     mRNA            <964690..>965193
                     /locus_tag="CYME_CMR395C"
                     /product="similar to glyoxalase-I"
                     /transcript_id="XM_005538560.1"
                     /db_xref="GeneID:16997083"
     CDS             964690..965193
                     /locus_tag="CYME_CMR395C"
                     /codon_start=1
                     /product="similar to glyoxalase-I"
                     /protein_id="XP_005538617.1"
                     /db_xref="GeneID:16997083"
                     /translation="MSFNGGFLGKNAVFAQTMLRIKDPSKSRQFYEALGMNFLTRFDF
                     PELSFSLYFFALEKDPTVPAEDAPQPERAKWLFSRQYPTLELTHNWGTEKDPNFKYAN
                     GNTEPGKGYGHIGFLVDDLYASCAAVEKAGYVVSRKPGPFQNVGEIAFVRDPDDYWIE
                     LIQKPKS"
     gene            <966407..>967660
                     /locus_tag="CYME_CMR396C"
                     /db_xref="GeneID:16997084"
     mRNA            <966407..>967660
                     /locus_tag="CYME_CMR396C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538561.1"
                     /db_xref="GeneID:16997084"
     CDS             966407..967660
                     /locus_tag="CYME_CMR396C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538618.1"
                     /db_xref="GeneID:16997084"
                     /translation="MSCKGAAFGFATLNGLSVRRHLFCRSSANRRVCGKLFTGSQCPR
                     APRYFLVHTDKSAGNTPSTRGWEEYAGNFIFRPPHVIVRPSQRTAYGTGNGTPLPPKA
                     LVHFLGGAFVGAAPQVAYRWFLEQLALEGFVVVATPYRLSFDHLWTMDDVLTRFSAAA
                     GMLALDYGPIPVVGIGHSLGALLHTLGGSLFCNADGYKAANVLIAFNNRRAEDAIPLF
                     REFIAPVVKTVAQTGELSDVIERLVIDGPATFDTLFDTVTDVVFPGSRDSELFALVRQ
                     SRALAQQIPPLFAEVADGAFAFNPDPIEVMEAIRTLYKVRQTLIVSFKNDILDDSRSL
                     QKALDPERGATVIRLGGTHLTPCAQDFLDPRLRQSSFFSSFTCEKDNDTSYILREAMR
                     RIVLREAMLMKNSVVAYLDRALGME"
     gene            complement(<967770..>969965)
                     /locus_tag="CYME_CMR397C"
                     /db_xref="GeneID:16997085"
     mRNA            complement(<967770..>969965)
                     /locus_tag="CYME_CMR397C"
                     /product="eukaryotic translation initiation factor eIF-2B
                     epsilon subunit"
                     /transcript_id="XM_005538562.1"
                     /db_xref="GeneID:16997085"
     CDS             complement(967770..969965)
                     /locus_tag="CYME_CMR397C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-2B
                     epsilon subunit"
                     /protein_id="XP_005538619.1"
                     /db_xref="GeneID:16997085"
                     /translation="MKKVNTESLIALLVVDSRKENELFPLVERERPACLLPLCNMTLL
                     EHALFQLDRGGVSDILVGVIDDSVSSALVIRNFLNESLRSPRIRSRVTLLGGGTRSFA
                     SVGEILRDIDTNEDLRPKGEFVVVNVFSVFRVNFARIAEEHRYRHEKDPSWTSTCLFF
                     KRHRGENKATFSGEVLVGIDEETKQLLLYRNLDECGTYVTVSDLSWSGRDHLQLIRGI
                     VDCCCDILSPEVLTEFRENFDYEELRDYMKNKLDSDSNEISGNKSFFLDIADRGEYCR
                     QLHGIASYYQVVRDFVHGWLGDPDLLANYERRCPPFRRIATRGPGAKLLAEISRHTAV
                     FDSGESFAAEDAVVSVDSRVTDCIISGGVHISEQCVLENVVILDGCVIEKGCVVRDAI
                     VGRNTRIMQGSRIDGGCVIGPDVVLPECTHIREGRAVFKASRDSLRVGEEVGVVEPEN
                     ETTNGSTNTEDVFGGLDEAETPTFSFGCSSNTGNETKHIGVTDAHNKLTYSTEQRFSH
                     DRKSLFETVGGVGDDFESIASSSPESESMNSFADECSSLSPTGFVRQTNTDQAFTSEL
                     VDTVLRALHNDSSVDDTAVELSSLRLAYDQTPEDISGNVVLTLAKESLTRASYSGSQS
                     VSLLHTYLNRWKTLIQRFASSKEAQMRILDCSASFSTTHQVPKNFFSYVVQMLYEADI
                     VTETTITEWTGRGEGFIAARLGIPEAAAGELLTELGPFLKWLSEAEEED"
     gene            complement(<972164..>973864)
                     /locus_tag="CYME_CMR398C"
                     /db_xref="GeneID:16997079"
     mRNA            complement(<972164..>973864)
                     /locus_tag="CYME_CMR398C"
                     /product="similar to dehydrogenase"
                     /transcript_id="XM_005538563.1"
                     /db_xref="GeneID:16997079"
     CDS             complement(972164..973864)
                     /locus_tag="CYME_CMR398C"
                     /codon_start=1
                     /product="similar to dehydrogenase"
                     /protein_id="XP_005538620.1"
                     /db_xref="GeneID:16997079"
                     /translation="MYRADYRAGLLRRSGSKAETLQSGNLKNAQGGASVQPGRDPRQL
                     SSSDLLSLASKEQAARQSKVGKGPEERIYEVMLRQELESFVRLTASALRLEDEELVEV
                     DSEDSSEQETALSKDAAEPAPSRVLVGTLSESVLPPVAGTASAQSAASAYNASRLRVG
                     IIGCGRIGQVHANNLANRVPNAALVAVSDAIEDAARRVAARFHVPIWYTNAEDLVHDP
                     RVDAVVICSPTDTHAPLMKECARYGKHVFCEKPIALGLDVIDDALATLDAANADVKEL
                     RLQAKRPSLFVSGETGLDNLSLAQFEHDRRLRRLQRSGIQLMVAFQRRYDQNFQRARL
                     AHDSGFLGRPLKLHLVSRDPAPPPLAYLKVSGGIWLDQAIHDFDMARFLLKSEPVEVF
                     AMGLCCEPSIAEIGDCDHVMTQVRFANDAICVIDNSRSTPHQAYDQRAELFGTEGCIT
                     VGNEYPNTAEYMDVIGQHRDKPLNFFMERYAEAYLQEMLAWVQHLVEIRAGGARKAEA
                     GTDAGTPALPLPSGFDGRIAVVMAMAARRSFELKRPVRITEIDPSLEPIIEAARTRAV
                     "
     gene            complement(<976431..>977138)
                     /locus_tag="CYME_CMR399C"
                     /db_xref="GeneID:16997080"
     mRNA            complement(<976431..>977138)
                     /locus_tag="CYME_CMR399C"
                     /product="similar to pyrazinamidase/nicotinamidase"
                     /transcript_id="XM_005538564.1"
                     /db_xref="GeneID:16997080"
     CDS             complement(976431..977138)
                     /locus_tag="CYME_CMR399C"
                     /codon_start=1
                     /product="similar to pyrazinamidase/nicotinamidase"
                     /protein_id="XP_005538621.1"
                     /db_xref="GeneID:16997080"
                     /translation="MEVQRCAACSLNSLERDCALLVVDVQNDFADKRGALYVTDGEQV
                     VPLANRLRRLFQTVVFTKDWHPRKHISFASSHPGKRPFEQVEVSDNSIEKRVLWPDHC
                     VQNTWGAELHSDLVVDKDRDIIFEKGTTVDRDSYSAFRDETGTETGLRHILDTLGIKR
                     VFICGLAYDYCVGLTALDAIAIGFDVLLVENATKAITIDGFKCMRQKLLQNGVRLVHF
                     EQSQQAFFESISKEDNL"
     gene            complement(<977688..>980264)
                     /locus_tag="CYME_CMR400C"
                     /db_xref="GeneID:16997081"
     mRNA            complement(<977688..>980264)
                     /locus_tag="CYME_CMR400C"
                     /product="unknown kinase with aarF domain"
                     /transcript_id="XM_005538565.1"
                     /db_xref="GeneID:16997081"
     CDS             complement(977688..980264)
                     /locus_tag="CYME_CMR400C"
                     /codon_start=1
                     /product="unknown kinase with aarF domain"
                     /protein_id="XP_005538622.1"
                     /db_xref="GeneID:16997081"
                     /translation="MLQKTLLCSLSVRTSWNHAGSARGLQVSAGITTQGDNREESYAA
                     FQALRRRFLGYTLARKTFNDVFELLSGGESYEECSTNVADYTEDGEDSANVPNSEDAE
                     TSDANPRGELRNGGPSDARDESYEVAPPEIVEKYQGTGDHDKTNLKMLDYDAHRAANS
                     KTAQAQPEDTRTSQGSSTTDETPQTSPRRHFGKAKPTQGKRRSSRGSTLGFLGRAAIL
                     LVLKVLLSKRHWSACRTAIILGTVFPGPQQAAALAFFQPLTLSYAVAPALRRMQPSLW
                     RSIDFWQRILPVYVAYKMTQKRAGRLKAEDALALWEKRHQWGSERVYRLCVELGGAYL
                     KNGILLSTRSDFLPQTWCKRLWELPHEGRAMTIEEVRATFLECFSMPMESIFLWYDRT
                     PLASATVAQIHKCEMPDGRLVILKVQYPGQERLCQKDFRNLRVLAQFLQALDLRIDLV
                     SIVREYERLIPLEFDFEREARMMTVIRRNLRQANLDHVVAIPEIVNDLVSRRALVMTY
                     IPGCYILDREKIRGWDLDLRTLLENIAAVFGQMILVDGIFHADPHPGNFVVMQDGRVA
                     LLDFGQVKRIREFVRRRLCWLYLAIADCDGPLIAARFQELGVRFDATAGFRSTVVWTP
                     LESRPSTSELAAEQSETESSYGLTAGDTRPREQSSMHSISRIGSFMYSPTDADLALFA
                     RFLFDTSTLDELEMNALGSLNPLRFIRFQEYPDDIFSVLRVMRLLRCLADELNIAISM
                     ADIFATYAARGIRKVAQVSAHTGNSLERRSNWAQMRRHQSASPMKESRDASPSSPANR
                     LGMRVSPARISHTYVDALERTSRIDRAMSLPNTPLHERLHNGDTLRGDAGASPAPPRT
                     SS"
     gene            complement(<983471..>983677)
                     /locus_tag="CYME_CMR401C"
                     /db_xref="GeneID:16997073"
     mRNA            complement(<983471..>983677)
                     /locus_tag="CYME_CMR401C"
                     /product="transposon"
                     /transcript_id="XM_005538566.1"
                     /db_xref="GeneID:16997073"
     CDS             complement(983471..983677)
                     /locus_tag="CYME_CMR401C"
                     /codon_start=1
                     /product="transposon"
                     /protein_id="XP_005538623.1"
                     /db_xref="GeneID:16997073"
                     /translation="MKAGDDLLLDNVIFHHSASVRDFADSIQAKLLFSPPYNPWFNPI
                     EGMFPIVTGNDRSNMRFAEPFSTQ"
     gene            <985290..>985673
                     /locus_tag="CYME_CMR402C"
                     /db_xref="GeneID:16997074"
     mRNA            <985290..>985673
                     /locus_tag="CYME_CMR402C"
                     /product="similar to rotamase/parvulin-type
                     peptidyl-prolyl cis-trans isomerase"
                     /transcript_id="XM_005538567.1"
                     /db_xref="GeneID:16997074"
     CDS             985290..985673
                     /locus_tag="CYME_CMR402C"
                     /codon_start=1
                     /product="similar to rotamase/parvulin-type
                     peptidyl-prolyl cis-trans isomerase"
                     /protein_id="XP_005538624.1"
                     /db_xref="GeneID:16997074"
                     /translation="MGKKTTKTANKAGTGSNSTDSKLKTANFVKARHILCSKQGTIQE
                     VYKTLIERTETQRSALPSTFAELASKYSECPSAKRGGDLGWFDRQKMEPKFREVAFST
                     APGNVSEPFKGANGWHIVFVEGRRN"
     misc_feature    complement(985885..986555)
                     /note="possible transcribed region"
     gene            <988406..>988645
                     /locus_tag="CYME_CMR404C"
                     /db_xref="GeneID:16997086"
     mRNA            <988406..>988645
                     /locus_tag="CYME_CMR404C"
                     /product="cytochrome c oxidase subunit VIb"
                     /transcript_id="XM_005538568.1"
                     /db_xref="GeneID:16997086"
     CDS             988406..988645
                     /locus_tag="CYME_CMR404C"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit VIb"
                     /protein_id="XP_005538625.1"
                     /db_xref="GeneID:16997086"
                     /translation="MESLSTAPRDERFPHTNQTRNCWVRYVEWKLCEEKHGEEESECK
                     KFGRWARALCPVDWIERWDEQRANGTFPGPSGESS"
     gene            complement(<990644..>991333)
                     /locus_tag="CYME_CMR405C"
                     /db_xref="GeneID:16997087"
     mRNA            complement(<990644..>991333)
                     /locus_tag="CYME_CMR405C"
                     /product="similar to retromer component VPS29"
                     /transcript_id="XM_005538569.1"
                     /db_xref="GeneID:16997087"
     CDS             complement(990644..991333)
                     /locus_tag="CYME_CMR405C"
                     /codon_start=1
                     /product="similar to retromer component VPS29"
                     /protein_id="XP_005538626.1"
                     /db_xref="GeneID:16997087"
                     /translation="MVRALVLSDAHISRGNAGFDDAFLTWMRQNLPDLILCAGNLGPL
                     AALQALATYTPKIHVVQGDCDSFAAPERLLMRVDDVTIGMLHGYQLASSTKETNGTLT
                     INSSVLQLVAADIGVDLLIVGGPYGPRIHQVSVASKTCFIILPGCLAGPENTFTLARR
                     LERERETRLKPSPPASEEEQGKSSVSLAYRGPSMIAMDISRAGADVYELILDPKDTSK
                     VQIGDVQRLNL"
     gene            complement(<991908..>992606)
                     /locus_tag="CYME_CMR406C"
                     /db_xref="GeneID:16997088"
     mRNA            complement(<991908..>992606)
                     /locus_tag="CYME_CMR406C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538570.1"
                     /db_xref="GeneID:16997088"
     CDS             complement(991908..992606)
                     /locus_tag="CYME_CMR406C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538627.1"
                     /db_xref="GeneID:16997088"
                     /translation="MPHRCEVNDQIPALQRAFCEEVCAPELLPFRASLVEDIEAVIAF
                     QEQRVGQHSAYASSGDREESDTETAFRRSLVAQLQRMDLERVRYLLASYLRVRLWKLQ
                     RHAAYYQQEAEGGSQTSMGRLSMHEQRFLKAYLDNLATCLHEAFLKHIPESLRGLTDT
                     EKHQSGRNTEIRMVTEPDFSETVMAVAGSPGQLAASVSAEQAAADSASMPEIHCVSYS
                     MVRDDILQEQISLL"
     gene            <993327..>994982
                     /locus_tag="CYME_CMR407C"
                     /db_xref="GeneID:16997089"
     mRNA            <993327..>994982
                     /locus_tag="CYME_CMR407C"
                     /product="cell division cycle protein cdc27"
                     /transcript_id="XM_005538571.1"
                     /db_xref="GeneID:16997089"
     CDS             993327..994982
                     /locus_tag="CYME_CMR407C"
                     /codon_start=1
                     /product="cell division cycle protein cdc27"
                     /protein_id="XP_005538628.1"
                     /db_xref="GeneID:16997089"
                     /translation="MERDLVGRGAALECSLRRALQRQMPEEHVFFLAERLCAEKSTAE
                     SFALYAQALAQYGRHRQAVDVVAKYWQQDLECRYWYALCCIEANELAAAYKALSFLLQ
                     ENANENLTKEVRSSLNNARGLPSERSLSVPWQAEGLYLLGRVFRLSNTRVDQAAQCFR
                     RALEIDPFLWCCIEELSSLYRYIDYFVPEMFGISGKEEQVFQSGRSSLRLDNCILRWK
                     TRSSGSPQDNFQALATVRALVEGYHCREAVALIATLPLALQQAPVVLKWQGRAYLDAG
                     ELSECARTFEKYLSLNRSGSLDGLEYYSTALWHMRRDVELNALARYALERDRFSAATW
                     CIVGNAFSLQRDTDSAIEFFLRAAQIDPRNPYPCTLAGHEYLYLDNYDAAMRCYQDAL
                     YRNSRHYNAWFGIGQVYQRQEKFRLAEKHYRIALDLNSNNSMLWYYLGHVIRVGGGRE
                     VDALNALEKALEMNPRNPVARFECCKLYMQIGRLQDAWKELYQLRNMVPREAAIYYQM
                     GVIARELGLKNAVELFSIALDLDPKQPLYRQALLSLDETQSAP"
     gene            complement(<996969..>997406)
                     /locus_tag="CYME_CMR408C"
                     /db_xref="GeneID:16997090"
     mRNA            complement(<996969..>997406)
                     /locus_tag="CYME_CMR408C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538572.1"
                     /db_xref="GeneID:16997090"
     CDS             complement(996969..997406)
                     /locus_tag="CYME_CMR408C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538629.1"
                     /db_xref="GeneID:16997090"
                     /translation="MTFGCGQVFPYIHQSLSCSCSSSSEGRFEASYSSRFRSFHAIDE
                     YRRLTTMLFSVCGLAAVRFAGRLHQRNALSEHSVGFFSLTKCLLRPAFSDCALFVFFL
                     FVCGEVAIERPASKFHDPHYFPDILVVSYVLSCVPSACRKRQQ"
     gene            <998391..>1000370
                     /locus_tag="CYME_CMR409C"
                     /db_xref="GeneID:16997091"
     mRNA            <998391..>1000370
                     /locus_tag="CYME_CMR409C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538573.1"
                     /db_xref="GeneID:16997091"
     CDS             998391..1000370
                     /locus_tag="CYME_CMR409C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538630.1"
                     /db_xref="GeneID:16997091"
                     /translation="MKRRPDNIALAGRTDAEPGNQMDATKQRLTNRPSGTNTDRFVGP
                     ETQQHYSALTTYPQVTPAAACWGRVAAPGYAGAGSMQAQSNSYPWTSSYRPLMLHGYH
                     FPIGPLPHSGPRGAGATSVTAFGVPASARAPQAPASGFHGSLQHAVDRWDPVPVQPPT
                     REALYQQELFYQSAQLFGMTPRHITGTEHTRGWPVAVNAEFYKAAHPGQIPVPHNIPS
                     SAEACCARPHDGALNCLHALAAISSQAATSLCGVGMARPNTGAQQSERATASCPAERA
                     QNRMENPQCCNVPADCSMPMHTSSNEGIPACLEHRPRPEFYPGKTDGTRPGHVQVSEG
                     NMSMVSLDASSHTNQSMSLPTALSSRFRTGYQGPWMQTVPETNAHWERMSRDSSGTSA
                     RAMPSDAASQTGLDRSSSGDDDAASLAGGEHLQRMSGDNPWTAASASPTAGDAAERSI
                     LHRNVGLAGGGAASSDPTADFYRDGASSQATGHVAGLPSNAAGPVEAPDRRFQVPHTS
                     FPAGAIRWVQTLPALQLDQSSNGVLLGGRFVASENTDHGMDRIPLTIEHPRCAITDHA
                     DRVAAVGAAPDTAAKSPTWSATERERYRLERVQRFLEKRRRRVAHPGLIRYDVRKRLA
                     DARPRVRGRFARPETVAAATAVAAAPATTKAPTPP"
     gene            complement(<1000808..>1005328)
                     /locus_tag="CYME_CMR410C"
                     /db_xref="GeneID:16997095"
     mRNA            complement(<1000808..>1005328)
                     /locus_tag="CYME_CMR410C"
                     /product="similar to translational repressor pumilio"
                     /transcript_id="XM_005538574.1"
                     /db_xref="GeneID:16997095"
     CDS             complement(1000808..1005328)
                     /locus_tag="CYME_CMR410C"
                     /codon_start=1
                     /product="similar to translational repressor pumilio"
                     /protein_id="XP_005538631.1"
                     /db_xref="GeneID:16997095"
                     /translation="MGTQRNWTGVDARARAAPAQDDAARVRVGTVSGSAVSPQMTLPV
                     GFEAALENEQPPRVASAPPPGQFRKKVEFGRGASLLGVATGEDIWSAASERIGGSGED
                     AGKNSMYASTIWGCPGFCSVPSPGRVSGSNDAQYSDPGELSTPNQMSSDRLASWKVAS
                     GSHQLGADTRRNEMLRGYGSQTDPLRGPRVLQRDWTEKDQTTLERFSNLSIQSAPPLR
                     RAPTQWTFQSRPEQADWWRAQQSALSAGSESGSAAFQSDLRTATPQGWGVAPCPRVWQ
                     PAACCSSPSEQQPLAGPLTCTGRTTPSAAEGAYSRLWAPIPHRTISEIARSDVARTPS
                     PAFESSSVVSSPVRARSASQYSSVSGLEGGSVVSGRAFGSSRSAWSGPVSGAASWKSC
                     EDAWDQQRATTALSGINTLNGYARSPRAPVSASSVSSSSSSLPMANNPSIVASDPSLM
                     RWAGGCGASPLYNASAAYQSAQSGTVCTRSWSSPATVQAPNSGYPAVLNHQPRAPKER
                     SADDRQICTGKKGDGLDTNGNEEHEQRVPNRRERAASSPGYVGHVTNGKSQNSEESSC
                     GRRDAAARLESTLQWASRPPLNIPVTESQPSPETCVQEQRTARCCLESPADGVSEPDN
                     QCRVDSQMIGSGTTSVSETGRPQIDPNANRTHRLSPSRQSSLVEGTFEHYECHNGRRL
                     CPGYSATSPRPLQVANAAGAHLSQALPLISPSPGATQPLEESIWIHPDQIVLNGSEQA
                     GLCTEVELADRRATPVYSWHPAAQLPSGIACPQGRAASVRKESTLVASGSEDANESSM
                     FSLVPDHCVSFPPVIPSGCRFVCAHATEDAMRMRSAKHGNLADASIPESCLSAEPAAY
                     GAQTTSPRPSSASSSSFVSEENGGRPAVPGSVGPAGANPIPAAAAAARAPRREPTTQM
                     GHSSGVAQLRAPFVSVAPILTDSYSGQVRVGGFLQTAAAPPATVPPTGAPPRSPLHFP
                     SLDLGTSGTLSSPDAANPPNSGVIASVGRSALLERFRTALLASDEAFTSWKLEDIRGQ
                     IVEFSTDQHGSRFIQTKLETATPDQVGWVLQEVLAEMNRLVTDVFGNYVVQKLLEHGT
                     ARDLQAIAMKLKNRILALSLHMYGCRAVQKALEVLPASTQAELVIELDGHVLKCIRDQ
                     NGNHVIQKCIERVPGQHVQFIVDAVRGQAVSLAEHSYGCRVIQRILEYSPEEQKVPIM
                     REIMQACRTLIRDQYGNYVIQHVVEHGKEEERAHILRMVRDQCISMSQHKYASNVVER
                     CLQHGSPADRKALIDILLGRSDVAGSGSGGGGSSGATALPRNSVPLIDLVQDQFGNYV
                     VQRVLDVAGDEQRQQAAELLRANLNVIKRFSYGKHILARLESTGAAAMAPTFANREGA
                     PGGAHPCVQNLQNTGKRAPAQRLQLEPSSNCSSASNSSSSSATTTSSASSTWNLRTAS
                     IASPSKRRGRATGCFSSEVLELEASMKKRSEGVTAGGFPQASPASATATAATAERNPR
                     AAGRARRQTHTR"
     gene            <1008815..>1011499
                     /locus_tag="CYME_CMR411C"
                     /db_xref="GeneID:16997096"
     mRNA            <1008815..>1011499
                     /locus_tag="CYME_CMR411C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538575.1"
                     /db_xref="GeneID:16997096"
     CDS             1008815..1011499
                     /locus_tag="CYME_CMR411C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538632.1"
                     /db_xref="GeneID:16997096"
                     /translation="MLAGFSDVFCSPLSQSPAHRTFRERAALDTSRRRPRSIRRIKAC
                     AEPLSDHPRRPFYRFHAPSWYGPLRHFPPGPVHPMDLYGRPSSLSIEDDREIRPGLKG
                     DSDFDVAMRYCEHHPLAPMRILADALENAPDAQRIPEWPQYLQWFDCDERTGDVRSIY
                     APLHPAESESITVLQFFTTENTDCWFGHRFWRHAQLVCREYPAVRFVRILAEKYEAVR
                     EKLTRERTEQRLNERLGERPPMPSKRSLHSTLERERLDGVVAVDSERLDFFRTVGAIG
                     WPFCVVLAPTGTLVAKWYQGSLCGGLALDENNGHVFLLDIILAGAMDYYATQLRSGLH
                     PGQFSLLNDPQRPPVFPEEPPKPIGHQLVPRSPKKQAQEMLDKSEALRLRYPSKVIVF
                     RRVEPLASAVRSPDSGQHHSLCDIDDSTVTSRTYMVIADTNNDRVVWCLLDESGAIPK
                     LDLRHNGTVEGLRRPRGICYDHTHDLVYLADTENHRICRFRVPQFAMPNPGTPYPVEW
                     IAGTGAAKFDLFGTRRARHQSLVFPWDVAVGPRFRFTPTAPLDEANSAAPLGSPDRSP
                     ASHAVYVTNAGLNQLWQIDFFAKQTAPDTMHPEPRSCRAVCGSGDHRQLDITSADNER
                     LRIEPKRSCCFVSSMAQPTGLALIPESCAGDGDTKGPFIAFIDAESSSVRYFAPRSRS
                     LCTLAGGGSATGDIDDLFEYGYLDHASGKNARFQHPLGITYDSSRRALFVADTYNNCI
                     RCVDWSTGAVDTVHLVPADPAATELLVDMDQRGKVTQDDAIPFCLNEPTGVEADPEAF
                     QGRGALWIADTNAHRILCVEWLPSASSEDSKESMDDEQLAQKQTPKQRGDQRQRLKLS
                     RVTLWGRVHVVWDDALLEQAAHLGQRARAGIVEAQPRT"
     gene            <1014515..>1016527
                     /locus_tag="CYME_CMR412C"
                     /db_xref="GeneID:16997097"
     mRNA            <1014515..>1016527
                     /locus_tag="CYME_CMR412C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538576.1"
                     /db_xref="GeneID:16997097"
     CDS             1014515..1016527
                     /locus_tag="CYME_CMR412C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538633.1"
                     /db_xref="GeneID:16997097"
                     /translation="MERSQRETWSETAPDMHPYGVGGRATRDGRDAALYAPTNVNEDH
                     FRLDETRAPYRRYSKRESLKLRKASGSTGIEEHTAGSVYGIGDAPTGTKGRTLYRPLE
                     LQSGCVQSVDLQEPSSFPASVPRPPETVVTRADTSSPPWYAFRKMHPQHGPFRLPDAP
                     VTLHVAGLMLIWVLVLVSLRNRSKYGVQRIDRGARIWRERTRARARHHGSPASAASLA
                     QHVHPCCWLLLPLPRVIRVHSASVWPTVKPITTTKLENPDHLERLWYQRHSRHYANLH
                     DLSLGGTFIALSDSDVDSEDSAIPTIEEYAAHRSELPASELMQHRSANVHTIENLAFP
                     TVSGQIEKNQAPFRARLESKPQIQVLRERNQDVPERQSKSGRRNGPMGKRASLPASWD
                     GSIQYSLPMPGADARAPIFDNASSISLSAIDSSLEAANTEKGDRVWEHQASAGDISSS
                     WLLPSRHSVGDCFEASEPSLEFETSEHAHHPERFITAMTAFSARAGPVSESGQIRASA
                     ALPDQSGTATECTPTAPNSFATGSKQGLPVLSALIWQDARVRRNADGNWWLERHGEYR
                     LEHQPHVLIHFGDKFGVDARILPHSQESQVWYEWYIERRPANSSVEQPSYQGCRWGRN
                     NAGDTWYVRYGTDTSGYHWEQRLDSNGARFQLEWEQSIATVLHVRL"
     gene            complement(<1016778..>1017419)
                     /locus_tag="CYME_CMR413C"
                     /db_xref="GeneID:16997135"
     mRNA            complement(<1016778..>1017419)
                     /locus_tag="CYME_CMR413C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538577.1"
                     /db_xref="GeneID:16997135"
     CDS             complement(1016778..1017419)
                     /locus_tag="CYME_CMR413C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538634.1"
                     /db_xref="GeneID:16997135"
                     /translation="MSAPEEAEKPSRTGSGEGHVQRSVHYGALVATLVFRIGAVVSFL
                     LLGVFTNSFVVQTVVTLLLLALDFWTVKNFSGRRLVGLRWWNHVQLDGSNTLRFEFRP
                     ESELVSTAFERQVFWWSLYLAPACWALLGVVCMLKFELNWLLVVFIAFILQASQLSAY
                     WQCARVASRGTAWSAADSLGAAAYLTRQFERLGSMFKQTARGDQAPANTNGRV"
     misc_feature    1017619..1018716
                     /note="possible transcribed region"
     gene            complement(<1018814..>1022302)
                     /locus_tag="CYME_CMR415C"
                     /db_xref="GeneID:16997137"
     mRNA            complement(<1018814..>1022302)
                     /locus_tag="CYME_CMR415C"
                     /product="similar to BTB domain and Ankaryin repeat
                     containing protein."
                     /transcript_id="XM_005538578.1"
                     /db_xref="GeneID:16997137"
     CDS             complement(1018814..1022302)
                     /locus_tag="CYME_CMR415C"
                     /codon_start=1
                     /product="similar to BTB domain and Ankaryin repeat
                     containing protein."
                     /protein_id="XP_005538635.1"
                     /db_xref="GeneID:16997137"
                     /translation="MSERRVCSALPCTLASKAASNCVERRLAPLDTDERETTLTGIVS
                     QRDECGRTLLHWIAGFENADLAFEGVQQLLAANRCPSNFLRERDWESGWSAAHRAVYT
                     GNLRAFIELILKDHEVLLSRDHENLSPLDLYYLRYVAPLNRPPRATCSIREVWAWGEN
                     ADFQLGLPHSTRSADAKPRRLGRNGGTSWPSEGRKAMSGSAAFDADVIQIATAEQHTI
                     FLTRDRRVYVAGFGANGRLGLGRPYSRTGSSSSESAFGTNRSPFSCLQPVRLSPPEWE
                     LRPIVYVAAGGKQSAAITACGMLCVWGSDLWSPTFVTSLKHDPIRIVDLSETHALALS
                     RENIVYWAPADAPCKYRAIMHGALGERKTRAIAAGDGFRCAALIRTDHHDEVLVWIAG
                     SADLRRVRFPGLTASMSAHVDELDHAPGARLSLASRVRPRGAVPCRRFAQISAAGSFV
                     LILGEAGDPFLLRLDSDTYARRDRAPAPAADRQDHPEMKGLWAQPLQTSGRMSYRFQR
                     ICCTATVCYALDEMGCLWQWSTEDAFTKRRRGKRVPYLRGAIEVAASAQHAFAIVEAR
                     WTQAQTSMAACSLEWGSCDFRMQQAATTTTTTTPLPCSLSHMCEEAVLARLTFDTVWH
                     LLEASAYANTPCIRESCSRFLLGNLDIFLASTTERGLDLEFFPMALAFLEQDLKRMLA
                     NTNERSRMLQQTEHWGTVSRAEQQSHRAAAMQSFRELCARYGLSVCSLTRFEKSASTR
                     EDVMRSARDFPSPGLGDRALSDVALLRNGRSLVMQETREHLEEAPERSKAEAQPFSRT
                     RPVRSGKSASTSSETTSRETPAGLVHVAANDAVTHNDGHAGSYTTVLLLPGDAGARVM
                     EDASEHTGAGRMTSGRSAPQHIARRESYIRTKSDRSWHQETCCEAGSFFSGKSHSTSS
                     VEGASVDRASPSSSAKARSAGQSFRELLQQEAADTQRATQLVSIAGTPENPATCTQRI
                     AKHPAGAGRQQRRAPRDAVLPEQQQQQQQQAGSLPSLLISDTLAAALGSAASSMRARS
                     WGQEAGSGPSVSQPCSFRKLLEETQNADRSCACAVRRNQLSPLWDRRYVSGQARASIS
                     EIEHEELQKAAEQAEATWLAEQMAIIEAMEAAQGRNGRRSHSRRQPSISRRACMEPVT
                     SQPRCTGRTTPHSSST"
     misc_feature    1021931..1023731
                     /note="possible transcribed region"
     gene            <1024823..>1025479
                     /locus_tag="CYME_CMR417C"
                     /db_xref="GeneID:16996894"
     mRNA            <1024823..>1025479
                     /locus_tag="CYME_CMR417C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538579.1"
                     /db_xref="GeneID:16996894"
     CDS             1024823..1025479
                     /locus_tag="CYME_CMR417C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538636.1"
                     /db_xref="GeneID:16996894"
                     /translation="MFVFGAYWFDCGERAVLPANSRGALRPQCTRLRFWRGRYWHRGA
                     VSALRRVRPLSASTPSPRVLDGSQSLAGTPDDVQQLLQHMSQELDSVVQSMVHLEEYA
                     LEQVEKLKGAMEADLRKLALYEEEQAFAQKLTEQLQKKEGAVFEAMRHFLFHVVGLQE
                     QTVAITNELQVLHEFVSENHERVELVLESLRERGLFGSRQDVFEGEVKKKLDRFDPEI
                     "
     gene            <1026969..>1029032
                     /locus_tag="CYME_CMR418C"
                     /db_xref="GeneID:16996895"
     mRNA            <1026969..>1029032
                     /locus_tag="CYME_CMR418C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538580.1"
                     /db_xref="GeneID:16996895"
     CDS             1026969..1029032
                     /locus_tag="CYME_CMR418C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538637.1"
                     /db_xref="GeneID:16996895"
                     /translation="MAEEPATPADTELRDSQGADTSREGSWSPHEYLIEQPLHVKQHQ
                     GDEASVAADSALPTAETAMCTAPALMEYEGDRQSKRARASELDWSPALPQGKDEASAT
                     AHKTNSEHLGSESPDDVEKSSTPGHTDTELDRNSTLVSNADHAREPLERRPGGDYDER
                     DACATTAMTTGAAPQDPGDECNGDSDAASTVDTELLFETPLAILKKFLDGHWVDAGRG
                     PVRILRLRRCSESSGNTETFLRMDSGLRPVLYLRLEHETARTARWEKVRERSIRFLCP
                     VSGQGPVMCVLQLRNAATADKLLALIEQVAFAAANKAPVASYTERSTGVQYSSSFTEL
                     WTRFQADTVPVLEQHREKALDDDETATAPRVVRLEQLIDASRKTLELQDAAQERLLQL
                     LEEARETCTRTERELQTVHQRLCRRIAAVEPQLSKLRSSLGPVDSPAPLTSDPAKALS
                     NNDLMITSVERRAVEASAYADPADFLGFCARLCSFRPSCFKQMRLEEKGAQGTGYPLV
                     IELALGGWTYLLSGALHCGRCGATSAVSELVNESESSAQGCRHQPGCRWLSERSPTTF
                     ASFRADSSTSRTEACWALHLADAVRYLRDALERSASPNASVTERVAFRKLASHGWVCQ
                     TRQERLLFSCMFCGTPRFMAQSEIERSLDSTAAAGHHRRYCAFADTTVAVDIEQQLRN
                     GTSAA"
     misc_feature    complement(1027993..1030101)
                     /note="possible transcribed region"
     gene            <1030258..>1032075
                     /locus_tag="CYME_CMR420C"
                     /db_xref="GeneID:16997118"
     mRNA            <1030258..>1032075
                     /locus_tag="CYME_CMR420C"
                     /product="threonine ammonia-lyase"
                     /transcript_id="XM_005538581.1"
                     /db_xref="GeneID:16997118"
     CDS             1030258..1032075
                     /locus_tag="CYME_CMR420C"
                     /codon_start=1
                     /product="threonine ammonia-lyase"
                     /protein_id="XP_005538638.1"
                     /db_xref="GeneID:16997118"
                     /translation="MFITAHCFRHCIQGVGSTSWHTRDCPRGRSKRCRPVCASRALPA
                     LRATQDRTETAAKLTVASNGDAPVYCYITSSPFKNDYLERVLNARVYEAAVETPLDNA
                     PLLSRRLGRRVLLKREDLQPVFSFKIRGAYNMIALTDMSQYEGGVVAASAGNHAQGVA
                     LSAQLLGLRATIVMPCTTPSIKVNAVHQRGAEAVLHGDTFDDAQAHALALAAERGALF
                     VPPFDHPDIIAGQGTIALEILRKHPGPIEAIFVPVGGGGLIAGIAVVVKRLRPEIRII
                     GVEPFDADAMYQSLQASQRVRLAQVGVFADGVAVKEVGTETFRLCRDLVDEVIRVEND
                     EICAAIKDMFEDTRSILEPAGALAIAGLKRYAQRNMDTSTSTSSSSSSNSNSSSSGTL
                     IAIASGANTNFDRLRHVSERAEIGEHREAVLAVRIPERPGAFRAMMNALGPGANITEF
                     NYRYASPEVAHVFVGLSVSDRRGAAAAISKLAAQGFAATDLTDNEMAKLHLRHCVGGM
                     GGPHFAPAHEIVYRFEFPERPGALARFLNGLRGWNITLFHYRNHGSDVGRVLVGLQVP
                     PLERSTFLEFVERLGYAYVDETQNIAYRMFLRPLPKNES"
     gene            complement(<1033277..>1034419)
                     /locus_tag="CYME_CMR421C"
                     /db_xref="GeneID:16997119"
     mRNA            complement(<1033277..>1034419)
                     /locus_tag="CYME_CMR421C"
                     /product="probable 4-nitrophenyl phosphatase"
                     /transcript_id="XM_005538582.1"
                     /db_xref="GeneID:16997119"
     CDS             complement(1033277..1034419)
                     /locus_tag="CYME_CMR421C"
                     /codon_start=1
                     /product="probable 4-nitrophenyl phosphatase"
                     /protein_id="XP_005538639.1"
                     /db_xref="GeneID:16997119"
                     /translation="MSQGSAFVQSVQCALRSKFTVLHTSATHSAYPRHLSDANSCRTS
                     QNKSFALKARRRPLSIAYVNAQLTMSTTTGSAQPTTVAENGTAVFRKLQDPEQELLNS
                     TSVFLFDCDGVIWLGDKLIAGVPETLDYLRSIGKRCFFVTNNSTKSRAGYVKKFTSLG
                     LKISPEEIFSSSFAAAAYLESKNFKATGKKVYIIGEVGIEEELDLLGIPHIGGPADKD
                     KQPRMGPGDKLEVDPMVGAVVVGFDRYFNYYKAQYANVCIRELKAEFIATNTDAVTHL
                     TDAQEWAGNGTMVGAIRGCTQVEPTVVGKPSPLMIDYLANKFHIPKSEICVVGDRLDT
                     DVLFGKRNGTRAVLCLSGVTTKERLFSQDEVIPDFYCESIADFRPR"
     misc_feature    1034679..1035647
                     /note="possible transcribed region"
     gene            <1035985..>1039047
                     /locus_tag="CYME_CMR423C"
                     /db_xref="GeneID:16997121"
     mRNA            <1035985..>1039047
                     /locus_tag="CYME_CMR423C"
                     /product="probable DNA helicase required for mitotic
                     chromosome segregation CHL1"
                     /transcript_id="XM_005538583.1"
                     /db_xref="GeneID:16997121"
     CDS             1035985..1039047
                     /locus_tag="CYME_CMR423C"
                     /codon_start=1
                     /product="probable DNA helicase required for mitotic
                     chromosome segregation CHL1"
                     /protein_id="XP_005538640.1"
                     /db_xref="GeneID:16997121"
                     /translation="MPRSQSVHDPGRPPVCPGILRDLVAAARLCFQLRTRHVSFEIPL
                     RCVCCVYLVKLLFLQKHIERVTGAKRRLHLSSHWSAGFDSLFSKHHTQLKCTALMKPI
                     DAHTKSPRALTDDATETAVSQSLQAKRPRSSGQTLALHCTTPPVSSANALSGADFGFP
                     YPQPYGTQLELMRAVYETIDRGGIGVFESPTGTGKTLSLLCAALTWIRQDRHRMDRTN
                     DVHEEPSSQSEPDWLRDYEIASSSGSNSPMKYNSFVNSGTRSEPTRVMQFSIGRYSQG
                     TRTEDPVIYSPVHSLDTNTSGSLGRASAASSGLVLFGDDDSAFAPDMPRQGMHPGRMP
                     PPYRILYASRTHSQLSQFISEVRRTEYAKQDPTLTTTVLASRKMMCIHPKVRMLRSAA
                     AVNERCHELRNNQVKTAAAEQQSQCPFYQKERIRNLANVMHQQVCDLEDLLALGQQHQ
                     ACPYYAARASLACAELIVMPYQTLLHETTRQSANVPVDQRTIVILDEAHNLVDALNEM
                     HTTKLSIAEVTAMEATVSEFIEKQKTWKPDPDRSFHLEQLRRLLAALRQGMQPEDLSR
                     RPSDPTRTRPLDKASDEHSPVVRSEIPEPGRDLQDDVILSEFCQTPSDFCFQMKIEQM
                     NFSQLIRYLFSTKCMHMLQSLHESRRRTERSIESSAHSVLSEVASVHSNESPTLYGTG
                     FYELASFLAALCEPRACGKVLTAPNRHIRYVLLDPIPYFSPIYRTARATILAGGTLEP
                     REALLPRLFDEETCKQVYFSAFQHVVPQENVLALILGKGPTGLPLEFSFSQRQCMAQI
                     DELGHCIVNLCALVPKGLVVFFPSYALERLVWTRFAETNISERIARRKEVFREQRGCD
                     VDKLFNDYRSAVTALPAATERAELASPQERDGALLSAVIGGKLSEGINFADDLGRCVV
                     VVGLPFPNARQTETRLVLHFLQERYPSSDLSREYLENACMIAVNQSVGRAIRHARDYA
                     AVVFVDQRYAAQERLRFKLPRWLRGRVLEPRTFGDAIQQLASFFRNKC"
     gene            <1039080..>1039712
                     /locus_tag="CYME_CMR424C"
                     /db_xref="GeneID:16996793"
     mRNA            <1039080..>1039712
                     /locus_tag="CYME_CMR424C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538584.1"
                     /db_xref="GeneID:16996793"
     CDS             1039080..1039712
                     /locus_tag="CYME_CMR424C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538641.1"
                     /db_xref="GeneID:16996793"
                     /translation="MSVGRKVFLWLRKYLMFFIAGFEAVNVALMLVTPAGGPSFAATA
                     GLSTLHNPFPFLRNLVAPLPYMRKHFWPCLVASAKTRTFWFYYLEYVVLLLALPYFVA
                     FIFNLNAPEYTPLTVSLSRIGLLWVFGDFDVVGKFMTHLSRDILYLNSAVVVVVEVLY
                     VLFFCESCHLPMAPCRASSKARAGSGTESPREPETSSANVSLAAGHAKAA"
     gene            complement(<1041379..>1042269)
                     /locus_tag="CYME_CMR425C"
                     /db_xref="GeneID:16996794"
     mRNA            complement(<1041379..>1042269)
                     /locus_tag="CYME_CMR425C"
                     /product="probable rRNA methyltransferase"
                     /transcript_id="XM_005538585.1"
                     /db_xref="GeneID:16996794"
     CDS             complement(1041379..1042269)
                     /locus_tag="CYME_CMR425C"
                     /codon_start=1
                     /product="probable rRNA methyltransferase"
                     /protein_id="XP_005538642.1"
                     /db_xref="GeneID:16996794"
                     /translation="MMTIPCSRKRALKEPQRNALAAGRTPQYSSYCALCMDTGTWYRR
                     QALMRALEFVFVTEWSPELPCFAGVSRASRQCISRSKCVRASYGPGVVSAPLRHTGTG
                     EPLLNVVFYAPSIHWNTGNTARTTVGFQARLHIIEPLGFSLSDRHLKRAGLDYWPFVD
                     LRVWSSWQAFRDEGLPQLGNVFYFTKFAQSSLLDADLVSSKKGSEVLATKITLIFGNE
                     LDGFERIPPEDIPRERTIAIPMVCPGDAGIRSYNLSTSAAIALWEAYRQVQVALRSDG
                     GPATVNRCAVESPRATVRPQ"
     misc_feature    1042026..1043648
                     /note="possible transcribed region"
     gene            <1044291..>1046792
                     /locus_tag="CYME_CMR427C"
                     /db_xref="GeneID:16996981"
     mRNA            <1044291..>1046792
                     /locus_tag="CYME_CMR427C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538586.1"
                     /db_xref="GeneID:16996981"
     CDS             1044291..1046792
                     /locus_tag="CYME_CMR427C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538643.1"
                     /db_xref="GeneID:16996981"
                     /translation="MATEQDVGAELLASCRENCRALKIALLQTLASRERGTHSKSADP
                     KTELVQETLRSIFDIYRHNTSAEASSNSTRNAWDASPVDDSLVCILFIAVGLLVRTEG
                     LMLDQPFHAMFRSVTRKIHSLWFQEIGSAGDSGVDIEARSLPDTSCLVYGSARVGSPV
                     SSKPCEDHHVVERRPLADKQTRATYGRETLLAARISSLDSADEPQHDPRFRRLDLGTA
                     RDHGESSLRRRGRTGALLARLGHHGETSMPQFLTRKLVADRDVLTGSIVDAERADAAV
                     TGAHATCTPLEKRVSEPHEQDIPEAPESATLPRQAPAKLDGLLQPCDAACDEPRFLPM
                     RSSAPLVDACSNDAFSSARPQRLAFANLFREAVELLAVMYKQLVRDMYPILATAMLER
                     LTRSLPFDHPKCRCMLLRLLLLHVDLNLTDDNHDDNGFALSELVSGARPCPQANARIT
                     EAGAPTTPPGAQLLSPEYDTCISKQMMHHSHFLSELWYSLEKHRTRLLKSGPRISRSA
                     QRIAANALATQSAVLFGVAMPLAHAYMHWLARYLDKHPSAALRSRQRSRILRALLPAC
                     MQVTRVAVHCMTSSAAATRVTAVGGRSRTASPSPIAVDMLASTLRMLIDWSHAEPGAS
                     SDLCRAGICDTLRTLWGLDLCSMISRVESPASSVQALGLPYDLRILSLALLVNLVEQS
                     SEARHMLFGQSQSRPGLETLHGARVPVLTYLWLLVAASGTGLEHAGAPAEASLPEAAT
                     LPESAITAAYSALAVACAVVQDSNLTAFASREIPELSLPVLTNILDKFVQLMEIVDAA
                     AGSSTDPEAGLHEALLRLLQRLRSLETSATDVVSP"
     gene            complement(<1049295..>1051844)
                     /locus_tag="CYME_CMR428C"
                     /db_xref="GeneID:16996982"
     mRNA            complement(<1049295..>1051844)
                     /locus_tag="CYME_CMR428C"
                     /product="similar to telomere-binding protein alpha
                     subunit"
                     /transcript_id="XM_005538587.1"
                     /db_xref="GeneID:16996982"
     CDS             complement(1049295..1051844)
                     /locus_tag="CYME_CMR428C"
                     /codon_start=1
                     /product="similar to telomere-binding protein alpha
                     subunit"
                     /protein_id="XP_005538644.1"
                     /db_xref="GeneID:16996982"
                     /translation="MELRLVQFRSLKPYTCNAEHPFRLRGRVLRTLVENRSGRAILAL
                     LEPWPSVPAPQQTVVVLVCTGDWTAAGTALAHWDVVEVQNAQVVPLGDICEARDHGLL
                     DSCLELHEYAVVLGPDQREACCAGAADATACKPALTIFKDAGKCNDLSQLANARIMKL
                     SPESIGQTLVVTEHGAGTDTSGRPVAQHESCEPVPRPVVPLDSKHHYLTLEQLRHPGQ
                     MSGRTYDVYGVIVDVRAPRLVRTGELLTELQIIDPSIVVTDSDGRLVSFAPPQFMLTS
                     FSSRLSDCVPYIGVGDVVRVHRAELRWFPQQSPSGSKTETLELKTNSLSSMCLWPALA
                     QHDEGAGLGRSSASASGDLSGLRAATATHLEEMNHLPDPLIYAYPSNTKSIVITNSEK
                     CYAMELLRWARALLSQSGFLGSKAFSATLRDILQSSLVVDSANGSAMQRLRYDLVVLI
                     RDLEKTPYEFLLKVTDGSISDLVTVSIAAECWTRLTHRLEPHLRGNWFRLRDVRLDRR
                     PGLPLRLTMNEGSSIYKFPQWMPEVQSRMQHLGAALTDPTCRTDSQSAYEAAPVAHQR
                     ALGTRNTPEQMSAAAYPILSAPCTELNRERVAYTTTSHTTTNIESAETGIVKRGPVQH
                     PSCLHCSGPPLLQTSSTMSIPWQALRPQSLAHMLDDMRALRSMRAAGNACARADTPMH
                     RLYRVYACVCDVHWIVDADSRHMLQLLLTDLPFQCPSGSKEAVENQPFLNDDLRFENR
                     KIIASAPTVISAWVLDEDLTTLCTGTNMSWSTAEPERVEAFSQSLRYVLTMPFVWIDV
                     LLVASWGDDLRAERPASDIIKEQSGLQPWVVLIEPVLRVPLWDETDNQASV"
     misc_feature    1051226..1051834
                     /note="possible transcribed region"
     misc_feature    complement(1052029..1054435)
                     /note="repetitive element"
     gene            <1056433..>1057134
                     /locus_tag="CYME_CMR431C"
                     /db_xref="GeneID:16996984"
     mRNA            <1056433..>1057134
                     /locus_tag="CYME_CMR431C"
                     /product="retroelement"
                     /transcript_id="XM_005538588.1"
                     /db_xref="GeneID:16996984"
     CDS             1056433..1057134
                     /locus_tag="CYME_CMR431C"
                     /codon_start=1
                     /product="retroelement"
                     /protein_id="XP_005538645.1"
                     /db_xref="GeneID:16996984"
                     /translation="MRLAIPKDGTTGTPSIPDEPDTILGKRLVELIQRMFEEAYIPDV
                     WRTAEVVPILKKDSHTDMNNYWTMRLIPSIMKLLCAILTNRIQTRFEERKFFASEQAG
                     FRSRKECMSHVLTLIGVAQRRFISDQQPTYVCFVDFQKACDTFPHEAPFLKMGRSEVS
                     GKCLAFFRALYADSWMRIRLGDSSRTPCIRIHRGLRQGDRASPLLFNIFINDLLNNCR
                     QYGLEVPWIDCGDAR"
     gene            <1059694..>1065690
                     /locus_tag="CYME_CMR432C"
                     /db_xref="GeneID:16996999"
     mRNA            <1059694..>1065690
                     /locus_tag="CYME_CMR432C"
                     /product="similar to cation transporting ATPase"
                     /transcript_id="XM_005538589.1"
                     /db_xref="GeneID:16996999"
     CDS             1059694..1065690
                     /locus_tag="CYME_CMR432C"
                     /codon_start=1
                     /product="similar to cation transporting ATPase"
                     /protein_id="XP_005538646.1"
                     /db_xref="GeneID:16996999"
                     /translation="MGQHYCGAFRPQLWILDDDLSSETRTSENFTPSERTYGTEQSTW
                     SVSTRSGASDGTQASPMDTSQAAADDDEDALEFEQQNIEERLEGFEAFADQYWRIVVY
                     ILLNLLTCGLVYAALQSFPSTKVRLLYRRATNLAEATMLLVTFRRKSRQNKGHYFVIP
                     SEPRARVPSSVLSAYLGRLSTRTILGQSARGRETLRLLSEPVETVLVIEARQRRYLLI
                     QLSGWRHAGQRGMHQRFICLRIHSAFIPAFEEYYRLPTDESSLITPSMHPIPEHEVAL
                     PVAGFHEEDEAAWDRPSDPRGNQESAVADVEDPAAPEAEVQPASLVLHRPLGIDLLEA
                     DVIRAIVGDNSIEVEMAPLLRLFLQSVTHPFFLFQFFSIALWILEAYYYYSATIAFAS
                     FMSALLEAMEMRSNAERLARIAASEGDVLVIRRSPTNRSCDCCERISSRELVPGDVII
                     VESGMVMPCDCTLLQGSAVVTEANLTGEAAPLFKSSWHSAYEEPSSRVPPRIPIESYQ
                     HSSGLAAVSEVTTQEASAHQGAESSAHFINMEESEGNEEDEQSSGESEGYFMGAYSAS
                     NEAEDLLPTPAFHHMSVGGLSAWLQPASAAEASAVGSALDASVEHSYTTAAATTAAAT
                     APAAAGADADVNVRQVSRDGERYRRERGARSVPRMMTAGRQHQAPAAHHLAWDQVNHV
                     LYAGTRVIEARPERSVPSTQQSTAAATDAGFSSAGTWQGTGITGADNGASATPATDDQ
                     MQSLDSAVLALVIRTRLDTAKGTLLHQILLADDQTSSYERGNPGPRDTRDTKLSVWAA
                     LWRRLRSRSPPGDAHLGDGELDDPESSDKRLSQMYLDAYKAMVVLLFGGVLATVYSFT
                     LLRPLLSFREALLSALDVLTIVVPPALPAAVTFGIVFALERLLAAQIYCIRPPAVLIA
                     SGIEALCFDKTGTLTDLGLDIHEILPVASMPLALETLPGIQVSSDPPGGITTAATEGT
                     IALFDTEHVIRRHDLTEEGAAPEHQPAPSGYAARLPAGLALVMSCCHTLTVVHGQVLG
                     DEVDSRLFELTGCELRPTASPADSRRWQGIHPAQTLFYVAERHAESSFGRVVKIFAFS
                     SEYARMGVIVQRLVTPESEQPPQVEWLFLVKGAPEVVVNFCDRRSVPSDFSHQVQLYT
                     SQGLRVLALAGRRLLTTDARARRVRLDAAAQALTKRNRSLGTREGAPTAPAAEPPGRA
                     QTARNATPLTWSRQRLERSLTLYGLAVLENRLKPDTAAALHELRHRADLHCLMVTGDH
                     IRTAVSVARQSGMMDRDARVIIADELNAQLVQRRRQCTRLSSFASANAQSAVPGNAGG
                     GNVVVPVDTTTSQVVFSDSMHVQKRFSRMEVFSLLAASPCSARLNRLLNRSSALGVRI
                     MERAPLVAWEAEQPAGFPGAVPEDAPMTSFQGTTHSTEATTEAGVFRSRTRSLRSEAM
                     LRDTRSAQPGYGRRTAGSTAAAAEQSDEGLVGATGVSAGTSGAEVTTLARGRLSEAKT
                     HPALLLREAEAAEAAPLEQHAAVADEAAVPPLPNRRHSLWTGERAGTSALSSVATARV
                     ALPQDEPVALAMTGAAFRLLLREFHRLSGSLARSRTPGASSGVGVGGVGGSCGGSRTS
                     SRRYHFLRQVFLRCTVYARMSAADKTALVHLLRSRFGLCVGMCGDGANDAGALREADV
                     GVGLVERRVWSTSESQASGEAPLERIRIEKPDALAREYGDSRAPKATGTKRDLLLLQR
                     LRPKSSSSAVAGDDEDAVASLAAHFTSQVTSIRAVVKVLTEGRGAAAASLACFKYMGI
                     YSLTQSISTLFLYRIGTVYSDGQFLFQDLVLIMPLALTMGRTASQTRLSRHRPPVRLA
                     SAPVCWSMVLQSLVQASFQAAAVYALTQADTVPGSVFGMTCRWNAPCPAATVLFHVVN
                     AQYIWSAIAFNMKSPFRQSWEQNPWFRTTLALLSLLCLSVIEPVVPLLQRMLALAPLS
                     TSMRRWLWVLIALNGLATLLVEAVLNWYEHGRVRVSVEEY"
     gene            complement(<1067439..>1070522)
                     /locus_tag="CYME_CMR433C"
                     /db_xref="GeneID:16997000"
     mRNA            complement(<1067439..>1070522)
                     /locus_tag="CYME_CMR433C"
                     /product="probable DEAD/DEAH box RNA helicase"
                     /transcript_id="XM_005538590.1"
                     /db_xref="GeneID:16997000"
     CDS             complement(1067439..1070522)
                     /locus_tag="CYME_CMR433C"
                     /codon_start=1
                     /product="probable DEAD/DEAH box RNA helicase"
                     /protein_id="XP_005538647.1"
                     /db_xref="GeneID:16997000"
                     /translation="MEQLGTATDSLDAFMATLSGPVAGNRHECLSFSVPYSRNGSACE
                     LDPVAQSHDIQQQPRRSPCPKAEPGSPTKTGLVSDGHEIEHLCASEKNGLHRSAGSWP
                     SAAEPSFSGTGNGTPGTSPRHEPAKRQRHWGAASRTAHLADRTRQVQALQPRSEPCLS
                     SLPASSRPDNADTVSVPASSDTEDNDAASGSMQVEGVTADRRHRTVSEAPGVLVRDLE
                     QPHRLLGVSLLHNWEQTGLPTTILDWLKDGLGMGHPTLVQRACIPVLVRGHHCVGVAE
                     TGSGKTLAYLVPLVRYLIRSWRDRGRRRTCPVAVVITPTRELAMQVHKLLVTLLQHLS
                     WPSCSALEPERYAADASFRASVADPDIAVPAMPESWCLCAYGGADLAANVATLCRGVR
                     VLIGTPGRLISLLQLNRGRFLHLRGTALLVLDEVDRLLDLGFAPQIQRILAATSTQVQ
                     MAFFSATLPPIMEKLIRKLISQQRQAAIASDGSHHQRYRARRRLVLIRCTTRPLTMPQ
                     SPGSAYEPGIPLTIQQRVHVLPETDPPQAVEQGEAARFAALLDLLDRHTTARMLVFVS
                     RQEQVDLLFQRLVEWHRQEKQQASKRAPALRRAANEAIEHMLALHGGIDQGDRDDTWD
                     LFRHPLKRSADAGSHASCRLLLATSLAARGLDVPDLDVVVNFHAPRSLEDYVHRVGRT
                     GRANRLGVAYTLFVPHQDDFAAPFLVQCLEAAGQEVPSALATARERWMGTKRPRFARQ
                     GAQMPMIECGATRSHVAAPAATRRTIEKSRETRSVSGDVASYPPMSPVEASRPATRHV
                     GRSPKTDDPPAASFDGDGARTVSHASSSMHGCGYSTGLASAAPQQQQQQQQQQSIPSA
                     SGHRCRRVEWRPPEYRGRGFTFDTRDLERLRRRLVPAATTDSILLGAGADSSLVEQHQ
                     LDACSAKDAVLWADECTAILVINGYPGTVRQRVTSSAFLRHIFEKHGCRVLVKGAYQR
                     NLPERRSRATFHAMPEIQRPLYLWFEAPTTAALQGALQHAQHELASDKSIEETMF"
     gene            1070655..1072884
                     /locus_tag="CYME_CMR434T"
                     /db_xref="GeneID:16997001"
     misc_RNA        1070655..1072884
                     /locus_tag="CYME_CMR434T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461638.1"
                     /db_xref="GeneID:16997001"
     gene            complement(<1072114..>1079091)
                     /locus_tag="CYME_CMR435C"
                     /db_xref="GeneID:16997056"
     mRNA            complement(<1072114..>1079091)
                     /locus_tag="CYME_CMR435C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538591.1"
                     /db_xref="GeneID:16997056"
     CDS             complement(1072114..1079091)
                     /locus_tag="CYME_CMR435C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538648.1"
                     /db_xref="GeneID:16997056"
                     /translation="MGITVSIFRPDDRTDNVASPVERGNASARTDAERSLRSWAEYHP
                     TVARQASVHVQAPHIDLQGPMLDSYEESPSLSLSGPWSAVLEPGTRFTVSGELPEGAD
                     TSRRTSWLGQRGDAARQRTSAVVVPELTTISNTPCGKLNDGFKQVQFLDLLEASYSVS
                     EQTPTTAASAANKRSCELHPLDTCITHEEALLSFLLHLIWTPSDTNANHDPLANEAVW
                     SALDARWSTTGVSALTRREVWQLCLAVLCASAYAPCIHMACGDADASSPCEVGVQPPA
                     SSTTSSTRGYASRRLGASVMDTVTRASAAAAAATTTTTTATEGPPRIQRHCASAPRPE
                     PEDAEYLSNRCCALCSWLQKRFILRMRRDMALIRLCLWSLCAEYQDKDQQMPQRMSVW
                     SASLPLHIGRDSLRLVDDILRSLIPNSSDKPFPVLVGERQHGASLHELKRGGRQHAPN
                     ATTLSTLPAPKPCRALDSTPKQPLVAAADAPELPACVDASAAASMAAPVANELPLPEQ
                     RSQSSDEALWHRWQQRRTGCLEGLSYDPFQHDLFADGSISVPFETLFDIDALLESLAA
                     LVARHTGPALPTDLVSGDLNASGGCSLRTHTARQRQTQETQQLDTQALERKTNIQGSL
                     QECPTNAAAVPNKFSRSISCIHGCSSSRTTCLEARSPPPPPPPLPPRDEDMQRSRSSL
                     QTDTSLDGRRLFINGGFRHATGAGAFSSCSSSGSLQSPNASFTASGSERTNRSTLARE
                     SALSLQDFINNERRCRLRASSFTDHKRYRQDAGSASLGGTVRRQQSPRGDRSSPSTGI
                     EAGESARTLCDGSTGVAPLARYPDEGEDPLTTDLDLMERYVEALEEVLESLEASASSV
                     SATGRAASTSVLPYRRSVRYPRCASYPSFGQNPRAHYHQHHDHHHHHHHDRGYDEYDG
                     NEQLQCWALHAMQMPSKPQPGRRFTLLHQRQQALSRAGARHPLLSELLQVLSGSSTGN
                     QGICASPKDGNLLQREASAAAGAAATTASPTGARVLDAASPERSVSRPQRRASLRASL
                     WLASSATTALHSYWMSLASSAGMDAERFHQNDGSRSRHSRPDAATQSSVSEGGFWTRR
                     SGVIPERYPSHRIQSVCAAGSPEIVLVNAHAYRCVPGQTTRSPVACRGYTLLYRWRGT
                     DPLPCMFAADADLHPSASLSRDGERPMPAAAVPLVSSLEREPGMSPTSLGERFATYSP
                     CTASDERQLQSVPAGMLEASPLLQRYGDVVGASASSVCALPAGHVPERRPSSTEATDE
                     RFETPRRTSSPSSAGFSSPVTPAVDVHTYRGRIDHAAFIAADSASVRLSVDAAASIER
                     CSDANSPPAELASEAFPRRHAMDALLSTATHQPDAHNSGFAKRTLHAATSALHQLLGA
                     ASPLSERARNDAEQDAVAGNSCRGRQCMSGPRSMRTGSGEDAGVARAGQQQAQCALLR
                     LDNSASPNDGPKAGIWQDPLPRNSTWVRVQRLVSSPASGAADSGSEAFCEALLAVNAS
                     SHPRVRELVRRTLPPDIGDSVTILGFGAVPASLQTLCAQCFVQYTVDGQHADSHLDRY
                     PQCQSMDAADAVNTFMASSWTAEAHLRQQARALVRLGVDASGMSASLLDGVQRAAAAP
                     AAAAAWDSLPEPLLALCWEAAVASGIATPALLRFYAQRVAPQVTLTAADSGLWPNIGP
                     GLQIRPAPVSLGHRFRVAAPYRTRIRDTWLLALAPAAAGAATLETLDLSGCSHITDRG
                     LIGLAPHLRQLKECILDGCLGIWGPGVRALLRLCSKLERLSLAGCRSLTDEAFQGLAS
                     GVARGPCQRTSAGRFALKHLDLSSCIHLTDEGLGALVAALSTPEAKAGDSEDTAIESV
                     ATTEASAGLVAPLTTEALLYSSSSNSSSSGTLETLSVAHCFRLGDRSLRPLLRQHRQS
                     LRVVDLSYTRITGAVLQELGALPQLQSLSLCGCGETLSVESDAATRFGEELALPGKQL
                     VHLDLGKCAQLVTDGFLAALAGLASGRRTHHQYNRQQYQQNPAAVERLVHATHGVYSS
                     RDTLRSLSVHGCRLTDRSLSHYVRLFQGLERLDLSQCRLITDAGLEHLQSLKSLRELD
                     LADTNVTSAVGASLLARLRQLRRLDLSYTAVQSNITKSLSTLEQLEWLGLDARLISDD
                     ALQVEENEASPEPVSSRDVAAPALSSATVAVHLHRRIGLPRHLRHLDLFGAHITDRGM
                     SYLVQACPYVESLEVCSGALTDAALRLIAQHLPYLRALNISQNMRISDAGLREYARLA
                     QVQQDLGQPHLLETLNLAFTAVTWRGLAVLLPTLPYLRLLCVRGCNKDSFSAVSVQSL
                     ERMRPGLVILGAETDQPGS"
     misc_feature    1079338..1081048
                     /note="possible transcribed region"
     gene            complement(1079474..1080875)
                     /locus_tag="CYME_CMR436T"
                     /db_xref="GeneID:16997059"
     misc_RNA        complement(1079474..1080875)
                     /locus_tag="CYME_CMR436T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461639.1"
                     /db_xref="GeneID:16997059"
     gene            <1081624..>1082040
                     /locus_tag="CYME_CMR438C"
                     /db_xref="GeneID:16997058"
     mRNA            <1081624..>1082040
                     /locus_tag="CYME_CMR438C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538592.1"
                     /db_xref="GeneID:16997058"
     CDS             1081624..1082040
                     /locus_tag="CYME_CMR438C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538649.1"
                     /db_xref="GeneID:16997058"
                     /translation="MLSFQPVLARTFTAANWQRSSLNSGADAHARTFLKRSTYPATAS
                     CTRRAQPSPTSTVQFLMCKGDEKPAYLRFPIPAYGYLGISSVLAIAAIGSVFELSSGK
                     PQYGVVFTASVLALSLPGFLATFWLALEKGRDESDQ"
     gene            complement(<1083171..>1084088)
                     /locus_tag="CYME_CMR439C"
                     /db_xref="GeneID:16997060"
     mRNA            complement(<1083171..>1084088)
                     /locus_tag="CYME_CMR439C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538593.1"
                     /db_xref="GeneID:16997060"
     CDS             complement(1083171..1084088)
                     /locus_tag="CYME_CMR439C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538650.1"
                     /db_xref="GeneID:16997060"
                     /translation="MRPPRERSERKRALRLALRLVRVLLAAAPLGQRFHEADLAALEH
                     AATAAEACQCIEAVRVLGKHHWVFEVLDVPGTASPVTVSGQSGTAFDKVQERETSRIE
                     EALQGIAENLTRMQEAVHEGDRLVLELNEQLVTSFDGPVRSNLTTLLHEMHWSEHVFW
                     DCVGSLEKFVRQLAMEVTRRRYLGEGLCRACYGYRVPLEWVQAMGVQPPQDASKNAEP
                     APTAEGLASAHWRTMPLSPQQVLQAWAYPDASVSDGVRRGWRLQYRYWNNIGWLEWID
                     ELRVLDNALQQTHAKLTCNQTQQTHRNLI"
     gene            <1085921..>1087891
                     /locus_tag="CYME_CMR440C"
                     /db_xref="GeneID:16997076"
     mRNA            <1085921..>1087891
                     /locus_tag="CYME_CMR440C"
                     /product="sulfite reductase flavoprotein alpha-component"
                     /transcript_id="XM_005538594.1"
                     /db_xref="GeneID:16997076"
     CDS             1085921..1087891
                     /locus_tag="CYME_CMR440C"
                     /codon_start=1
                     /product="sulfite reductase flavoprotein alpha-component"
                     /protein_id="XP_005538651.1"
                     /db_xref="GeneID:16997076"
                     /translation="MLGAILLIAAFWVLLRSLRSVWTGFSGSSAATKKKLKAAKRNRF
                     EDFLLDDKVRAGSSGLSNGVSAAPVTASDAAASIIQEAFENATTGGLPVLVLYGTEYG
                     FSRQVAKHVATELSQRLQGRVSPRVLNMLHHDVVDFRREPILLVVCSTTGDGVVPSDA
                     RAFADRLEARSLPVSADTRYGVLALGDRAYPHFCRAGKLLSEWFQTLCPGPGAALAER
                     MDVDQEDWTAINAWIHAVVSALEKELSKRSLPVPESDYLRASIMQGGALLAELANDMS
                     RRYSKEAPFLARMVVKRLLTRLVEPGDKETYHIELDITGSDLNYLPGDALGVIPRNAP
                     DIVRETLAALRMQGSEPLDDQTSVRQWLEERADLKHVRGSALIALLRKSLDKSTAADE
                     CELADTLLHDDQTMQAFLYGRELADVLLAFPSARLAPCELTQVVRSLQPRFYSIASSP
                     TAHDPQKIALTVAVVRYACHGRNHKGVATCYLADQVQPGDLVPVFLSRNPNFRLVSDP
                     QRPVVMIGPGTGVAPFRAFTAERRGCTGRTLLFFGSRHRDRDFLYGDEFEALAQTGQI
                     ELYTAFSRDQSEKIYVQHRLVERARDLFDLIWRHGAYIYVCGDAAQMARDVDHAIRKI
                     LATEGSLSTDQVDAFMQKLEREQRYQRDVWVE"
     gene            complement(<1089078..>1089650)
                     /locus_tag="CYME_CMR441C"
                     /db_xref="GeneID:16997077"
     mRNA            complement(<1089078..>1089650)
                     /locus_tag="CYME_CMR441C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538595.1"
                     /db_xref="GeneID:16997077"
     CDS             complement(1089078..1089650)
                     /locus_tag="CYME_CMR441C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538652.1"
                     /db_xref="GeneID:16997077"
                     /translation="MPSKELASRSHLLEFYGIECDHCVDMEPLMERLQKELGVPIRRF
                     EVWYSDDNLRLLQKLDKNGSCGGVPFFYNKRTKGWICGATTYENLKNWALGRPHQRFL
                     PPPKDSKGENVILKFLERVQKQAMEKMQQRMNEKNLPEKGSKVKDGKTGQGKRSGPNA
                     GDSKNKSRDQDITDRKSSTSLQLRGKKDSN"
     gene            <1089990..>1090415
                     /locus_tag="CYME_CMR442C"
                     /db_xref="GeneID:16997078"
     mRNA            <1089990..>1090415
                     /locus_tag="CYME_CMR442C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538596.1"
                     /db_xref="GeneID:16997078"
     CDS             1089990..1090415
                     /locus_tag="CYME_CMR442C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538653.1"
                     /db_xref="GeneID:16997078"
                     /translation="MENLLRRAKLWNVPEGDEWRLETCPTCNGKGLIICPCCHGRGKC
                     LSLVLFVNMDTPCLLCFGNPEVTCGNCEGNGKFVVTPDGRYWCKPPKYRRKPPPGVSS
                     WNLFANIRFPTQELPPEVANAIRGLKFDVFGQVIKRTSE"
     misc_feature    1093768..1095748
                     /note="possible transcribed region"
     gene            complement(<1093777..>1094439)
                     /locus_tag="CYME_CMR443C"
                     /db_xref="GeneID:16997107"
     mRNA            complement(<1093777..>1094439)
                     /locus_tag="CYME_CMR443C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538597.1"
                     /db_xref="GeneID:16997107"
     CDS             complement(1093777..1094439)
                     /locus_tag="CYME_CMR443C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538654.1"
                     /db_xref="GeneID:16997107"
                     /translation="MDQRIAASRTSAFALQTLRYTRGRFALGGAATCCAPFGRRQRAA
                     AAAVRVRPRSARLRCAQNEGERDDERLIESGKRTENTNGARRTNEHAETARETRASTS
                     AAVANPGEGEALFPWISNHVDKVVDQVPKQTPNEQWDARIEREVAFMRRVKLRETSGL
                     PAWIVFLLDLADEFRMIEWPSPKRTLRILVISVIFLVLSVSYIYVLDSVFGWLSSIFF
                     ES"
     gene            <1097081..>1098487
                     /locus_tag="CYME_CMR445C"
                     /db_xref="GeneID:16997106"
     mRNA            <1097081..>1098487
                     /locus_tag="CYME_CMR445C"
                     /product="oxygen independent coproporphyrinogen III
                     oxidase"
                     /transcript_id="XM_005538598.1"
                     /db_xref="GeneID:16997106"
     CDS             1097081..1098487
                     /locus_tag="CYME_CMR445C"
                     /codon_start=1
                     /product="oxygen independent coproporphyrinogen III
                     oxidase"
                     /protein_id="XP_005538655.1"
                     /db_xref="GeneID:16997106"
                     /translation="MWLRAVTSLPRSVYIHIPFCRRRCYYCDFAVLPVGHSTREVSQR
                     LWEQLQELSAQGRSQHALTAPSTSSDRTLDRIYVDAVISEVSQTLERLPDRPSSLPEL
                     DTIYIGGGTPSLLHVDELARLLSVLPRSGHTEVTMELDPGTFDAVRLHQYRDLGITRV
                     SVGVQALSDEVLRACGRSHTVRDIERALDDLHRCGFGDAYSLDLICGLPNLSPGAWSE
                     TLARIGTWKPPHVSIYDLSIESGTRFAAWLRDGLLQLPLEDEAAEMLREAMITLRETY
                     GFDHYEVSNYAREPALRSRHNQIYWRGGEYFGFGLSASSYVHGKRFDRHRQLKEYLEW
                     VYSGCLPFDEVAGDTLDEWLMLRLRTQEGLSLDALQERFGAQTVDRLRIAAEPFCRSR
                     HLAFRDDAHGISLYATDPDGWLILSHIVLELLVALEGFQDRSPARPNGNIAGCNEDAL
                     KPVLLYETSSTRAQAPNS"
     misc_feature    complement(1098065..1099700)
                     /note="possible transcribed region"
     gene            <1099798..>1104381
                     /locus_tag="CYME_CMR447C"
                     /db_xref="GeneID:16996799"
     mRNA            <1099798..>1104381
                     /locus_tag="CYME_CMR447C"
                     /product="deoxyribonuclease"
                     /transcript_id="XM_005538599.1"
                     /db_xref="GeneID:16996799"
     CDS             1099798..1104381
                     /locus_tag="CYME_CMR447C"
                     /codon_start=1
                     /product="deoxyribonuclease"
                     /protein_id="XP_005538656.1"
                     /db_xref="GeneID:16996799"
                     /translation="MGVPRFYRWLSERYPLINGPVSRSNAPPVDNFYLDMNGILHNCA
                     RSAENPLGGRSDEDIYWESCNYIDMLVTLIQPKRLLFLAVDGVAPRAKMNQQRARRYR
                     AATALEKVAETSHQRGNTTQRLRTESEAGPDRVFDSNCITPGTTFMHGLSRALLYYVA
                     VKLESDRSWQDLEVIVSGAEVPGEGEHKIMEYIRQLKEQKRMPPNTRHCIYGLDADLI
                     FLGLVTHEPHFFLLREKIDFQAAFRKVRFEKVTATKMDRDIRGDFELLSLGILREYLS
                     LEFAYLEKRLPAGVYNLERIIDDFVFVAFLVGNDFMPHSPTLEIREGALNSILFLYKE
                     LLPRFGGYLTEATGKARNPKLINFDRVEILLSKLGLLESYILEKRATVGTRGTAFIWG
                     TDSPNDHTAIWGFSSEPTAAATASKKQRSPSCTTDPTRASLAHANNPDPDSEAPSSSP
                     ADAAASVAPERSPGNGDAAELEPEIPLWDEEALAVALEDAADAQKLQRMLSYKRRYYH
                     EKLGIDYDHDAAAVRRICRSYLEAIVWTLEYYLNGVASWRWFYPYHYAPFCSDMVGLQ
                     ALAQEIRLEQGTPFLPLQQLLAVLPPRSAWCLPPAYAKLMTDTSSPLADLYPSQVAID
                     MQGKRNEWEGIVLLPFMDENRLFAALASVPPDALTPTEQERNHLGSCILLRYRPQEGT
                     SNEHMDAVLSAASGIGSSPFPSRMARSLSACVQMESLSLQHERGFVPRLPPGTRPAAD
                     KAVGHPSLLRRDVTHCFENVAIDVFGVPSRLESCIICMETPQAWHEAHAAQACANAFL
                     SGVADAGAAVSSLDQSRTGLMVPVHMGFPWQSPALLEAVESATERVTWDANKALIIER
                     NDPQRFRQTDTTLLAELLQRRGICLDKNSLHGRVRRIVEIAAGGGVTDAATAESFPLE
                     LIEAIDSKEGNEASSSTELKPGDTVIYVGRRHGENARYFGCRAQVVAIRAAKLARKRK
                     QASDDQVDTQVVIRVLEPPLVPIPALKEIVARNDAVQYAPLPVALRRAGLEGVISLRF
                     AGMLTGKVRCRIPKHERFGDLLEVNLGLGLRFKREKLVVPGYVVYRPVQERPAGGTTA
                     GNAPQASEGTFLFAPEPTARLLRSYHETFPGLLERMDEIVTKRGDGDLVLKAVELFGT
                     AQWPDMVARIQTFLRSLESARLPLVRVTSRVLTQDIVTDIQTQIQRIACERSASFPAE
                     TPPVEAATPPTAPTLVCLRSEVLPGFPAVATSTSGLVTPFSAYELGDRVLYVGRSGAV
                     PFGARGVVVGIHPPSREVDVVFDQDFIGGSDLQGRCRGCAGKTLDAETTLLNLSRLPS
                     EHRSSQPTKSAHPVPVARQRDAPLRKMPRAPPSERTHSEKRHERVQVRGNAGVRTADL
                     LPGTSRATVDAHHRQSLNTSTGSSKDTTRRRAGRREPHEVRSSHQGDGKRAADAGRFR
                     TRPQGSPPSRQDAHRATPAGHTHMSGAGASTATLSIPVSADSQVHGAVVGQSASSPHR
                     AQVAEEMSLYLKQLLRIDGQGVVPPPPPSARHT"
     gene            complement(<1106430..>1111019)
                     /locus_tag="CYME_CMR449C"
                     /db_xref="GeneID:16996800"
     mRNA            complement(<1106430..>1111019)
                     /locus_tag="CYME_CMR449C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538600.1"
                     /db_xref="GeneID:16996800"
     CDS             complement(1106430..1111019)
                     /locus_tag="CYME_CMR449C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538657.1"
                     /db_xref="GeneID:16996800"
                     /translation="MPSSTTLDNIQELMQQGPEGFCPEKYRQVLVEAAQTLCNCAQVA
                     SAGLRGNVAASEGGVTLQSLFEAAELLLQRLARWVKEGLLQSHECLPLLQRLRGFVAS
                     SLADDPACQAPASSSQLKLPDGSERCHPKLTSKLNSEAHRLRICLYACCLRTMCLASA
                     EWINRILSDSPRYLLCFPWIGDTALPMLQIYMELRERWLLCNDPTSIREQVTTTERQV
                     QSKLMQDAVWSCDGATLTALSQLLVRILQQVLRIDWWWQSAGYDLETARDWSCVLRFV
                     LAAAPEQALPDILCIVEMEAHAEPALGEALLASIATEVNALIPGTLSRAARLSIDLHL
                     CFHLAEIEAIADLAREQAAALLWRHEEETAIAEAPENAPPSTSACSAEAILSRIIRLP
                     GLEHAAPVIAELAFQWMQLTPAQKIRNFSERLRSGNSCPQTGRPDRPLAIRRRGRRRT
                     HEQISSRSFFLQRCAVHVLTELFGHHSSARKEILSACLSAIAESQHLLATRAAYCTVI
                     ERIASSPAYRVHLRDLSESVLVWLRELMIEFPISLAKRILAALAPLGALWQPMGDGLL
                     IFLRKLACSRAIRARRIAAHGLACFLVSPYLTESAEIETSQLLLRTLNMAPEPLRAEI
                     LLAIGSALRGRVLRHATISVWRESLARCIEAVSTETPRGSTLVSTPHLDLHRCFHAAG
                     VATEALPELLRCIHAVPLTGYASEAGDAACTPAMTSQQAATSFQADVSTNFLRSFLST
                     LVSDLSNAPTVLRMLALDLLLERKASTEQWLAPLTRIQVADSRLKMLATCYETLLDVG
                     RSSQTEQQTLLETYGQLMHLCEAILPILANAVTRQRQQHVVPETDHEPTAGEDYVTGA
                     RSVAREVLQDPRRIVLWTPATVSAAEAASDLAYASSRQDGEAGGFMHDMLAWVRIVPA
                     LSAARAIQLLQVCRSAHGAASLFRILRRHLDIETYFWDLRGTGDYFVNNRVWPSWLYQ
                     GIVEALRRLVIAPANASDEVPAGKTSLQCAFLSLDLACSSVVRDSIELQCRPASAELW
                     LKTHALDFIAAILPKWPVHQVAAFLAVPQVQSQLRLMLTNNFSELYAIQDSTKLTQAP
                     GLEWLAAYLTRRLRADFHRGLTVKLVSIYADLIAHLICQSREWSQASASSGVEDNSQS
                     QALQYIENELLGILFDFDIPQVSVHRLLLRPLLLVLGSKRALHLCTNLILQCRSSADP
                     SSEAPNEDTPALLRLLAQASKETRMAALWAVVEFGADHLPRVRVKTQVARASTINDQE
                     LRSVQQLVTLLESFFAPGTVAVPLALFMRLASVSQQALHYLQGVSEMIRRQLDRIVKQ
                     RGKRPRGDETPEMESFTDADQAPPLVQWASALEFLQRTRASAQRVARLIRPDAIREAL
                     PARCASARSVNQACARFVYCLEKFESECRQLDASLARLQQKLQDVPKALQDAVCGWLA
                     NHAPTQKSTPPPAPGLVTGELKIIFTDWEQAPVACTKARASTRRVCYLRSRNAYIDQV
                     LRQEGADEPYADLEDFIAADDALSFTERRHAPATT"
     misc_feature    1106937..1108422
                     /note="possible transcribed region"
     misc_feature    1111598..1113599
                     /note="repetitive element"
     gene            1113537..1114627
                     /locus_tag="CYME_CMR451T"
                     /db_xref="GeneID:16996801"
     misc_RNA        1113537..1114627
                     /locus_tag="CYME_CMR451T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461640.1"
                     /db_xref="GeneID:16996801"
     gene            complement(<1114360..>1115304)
                     /locus_tag="CYME_CMR452C"
                     /db_xref="GeneID:16997069"
     mRNA            complement(<1114360..>1115304)
                     /locus_tag="CYME_CMR452C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538601.1"
                     /db_xref="GeneID:16997069"
     CDS             complement(1114360..1115304)
                     /locus_tag="CYME_CMR452C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538658.1"
                     /db_xref="GeneID:16997069"
                     /translation="MTSARNRSGNVSARGRERFATASTCQRHSHRVLAPLTQRADWDC
                     GITCVENVFRYFCRPVPERSRLEELAGSRSTWTIDLVLLLHKTGFLNVAFWTTFAGIN
                     PTFKDWPFYRKAIESDAARVQSRFVLAQRLGIPVFSTLLPTMALIPAAYRAPHPDCGY
                     KAPSLTVSKASVRPGSSPVWIVLVDRRHLRYSCSLPVRWSSKVLTWIREQLFHAFRSL
                     DDSNFQGHYVLVLEYCPEIDAFLVMDPAEPRAGLHVERCVLDKARLAPGTDADIIRVM
                     PEFSANLQAFGTFGACHEREESEHTLSSSRHSGRGPFS"
     misc_feature    1114619..1116218
                     /note="possible transcribed region"
     gene            <1118270..>1119478
                     /locus_tag="CYME_CMR454C"
                     /db_xref="GeneID:16997071"
     mRNA            <1118270..>1119478
                     /locus_tag="CYME_CMR454C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538602.1"
                     /db_xref="GeneID:16997071"
     CDS             1118270..1119478
                     /locus_tag="CYME_CMR454C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538659.1"
                     /db_xref="GeneID:16997071"
                     /translation="MNAWNRVRVLLPSVVVFIGVICLLLGYVREKQTTLALAPAIASS
                     AALSAVPRASRLPLPVRVSVSTLARASEGPVEAPANPNDVVSAWGNTERCETVVKRVF
                     EKARIDRSSVGESTCGLWGTRAPALDSGSLEYERVLQRLEAEQQEHLDRALLYASLYL
                     LRFSQAERLGQRLHALRTLRELCHAWQHALRLGNLGAIPLITQALEDPNALIRREAAY
                     VLASASQNHYEFQQFVRPTAPELLRHAADSTEWLPVRSACLHAALAMVENYRHDYGES
                     TTDSALRIFEEALEICSKLCTAAVHERADMNRFVRRSITFIRYLLCISSRSGDESVST
                     LFLRAFDQYAERHAVRHRLEQTLRSACVASDARLELSALMQVLRSTRMPALPDAAMLN
                     TLAGRGEFTG"
     gene            <1120673..>1121659
                     /locus_tag="CYME_CMR455C"
                     /db_xref="GeneID:16997072"
     mRNA            <1120673..>1121659
                     /locus_tag="CYME_CMR455C"
                     /product="similar to serine dehydratase"
                     /transcript_id="XM_005538603.1"
                     /db_xref="GeneID:16997072"
     CDS             1120673..1121659
                     /locus_tag="CYME_CMR455C"
                     /codon_start=1
                     /product="similar to serine dehydratase"
                     /protein_id="XP_005538660.1"
                     /db_xref="GeneID:16997072"
                     /translation="MGVNRLHIATPCIESREFSRFIGSQHVWLKLENLQRSGSFKIRG
                     IGLLCSESLRLQHCTEIICSSGGNAGLAAAAAASALGLPVQVYVPETTPAYMRARLRS
                     EGATVHVHGKVWDETNRKALEVVERSSGALYVHPFDHPLIWTGHSTLVDELDQRPAAI
                     VLSVGGGGLLLGVVQGLQRRGWTDVPVVAAETVGAASFAATFNANGVLQRIPTIDTVA
                     KSLGALQVSEACAELIRSRAHPLYSYVCTDQEAVEAMLAFATLHRMLVEPACGAALTL
                     VTSPRGRAFLHEHIGQTGNIVVVVCGGNMITPSMLMELAKVTGASGDSWSAM"
     gene            <1126323..>1127378
                     /locus_tag="CYME_CMR456C"
                     /db_xref="GeneID:16996735"
     mRNA            <1126323..>1127378
                     /locus_tag="CYME_CMR456C"
                     /product="ribosomal RNA assembly protein
                     mis3/dribble/Krr1p"
                     /transcript_id="XM_005538604.1"
                     /db_xref="GeneID:16996735"
     CDS             1126323..1127378
                     /locus_tag="CYME_CMR456C"
                     /codon_start=1
                     /product="ribosomal RNA assembly protein
                     mis3/dribble/Krr1p"
                     /protein_id="XP_005538661.1"
                     /db_xref="GeneID:16996735"
                     /translation="MREEQTTGTAQLSEEQVPSKKNRYRKPKPWDSDDIDHWKEDPFS
                     EKDSSGPFLEESSFATLFPAYREQYLRQIWPLVTQHLQKTGIACELNLIEGTMTVRTT
                     RKTYDPFAVFRARDFIKLLARSVPVQQAARILYDEKLYCDIIKISGYVRSRDRFLRRR
                     ERLIGPNGSTLKAIELLTNCYVLVQGNTVAAMGDHKGLKQVRRIVEECMQNVHPIYNI
                     KRLMIKRELAKDPELAKENWERFLPQFKKRNQKRRRGKHQTDQQEGGSKAYEPFPPPQ
                     RPRKIDLMIESGEYFLTEQQRDQKRKTERERKSEAVALERRKERAKVWDAPSHEQMAQ
                     AREKRRRLLEQTSSEAV"
     gene            complement(<1127494..>1127859)
                     /locus_tag="CYME_CMR457C"
                     /db_xref="GeneID:16996736"
     mRNA            complement(<1127494..>1127859)
                     /locus_tag="CYME_CMR457C"
                     /product="histone H2A.Z variant"
                     /transcript_id="XM_005538605.1"
                     /db_xref="GeneID:16996736"
     CDS             complement(1127494..1127859)
                     /locus_tag="CYME_CMR457C"
                     /codon_start=1
                     /product="histone H2A.Z variant"
                     /protein_id="XP_005538662.1"
                     /db_xref="GeneID:16996736"
                     /translation="MAKTPGKSIMSRSARAGLQFPVGRVHRYLKERVHKQERVGATAS
                     VYLAAVMEYLTAEILELSGNASKDLKQKRIAPRHLQLAIRGDEELDQLVKATIAGGGV
                     IPHIHKALLKKGTKKFQQE"
     gene            1128013..1129950
                     /locus_tag="CYME_CMR458T"
                     /db_xref="GeneID:16996737"
     misc_RNA        1128013..1129950
                     /locus_tag="CYME_CMR458T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461641.1"
                     /db_xref="GeneID:16996737"
     gene            complement(<1129864..>1130790)
                     /locus_tag="CYME_CMR459C"
                     /db_xref="GeneID:16996874"
     mRNA            complement(<1129864..>1130790)
                     /locus_tag="CYME_CMR459C"
                     /product="similar to fructosamine 3 kinase"
                     /transcript_id="XM_005538606.1"
                     /db_xref="GeneID:16996874"
     CDS             complement(1129864..1130790)
                     /locus_tag="CYME_CMR459C"
                     /codon_start=1
                     /product="similar to fructosamine 3 kinase"
                     /protein_id="XP_005538663.1"
                     /db_xref="GeneID:16996874"
                     /translation="MGSLYTSELSRAVSESVAAALQRSFQGELRSASALGSGWSTSAE
                     LLNRNDSTERYFVKLSEPQAVSMFSAEFEGIQAMAESETVRVPAPICYGNTAERSFIV
                     LEYLELGGIGNEAVYRDFGEKLAAMHRCSSGGRGYGWHRGNTIGSTPQLNTWMHSWAD
                     FFVENRLRYQLKLARSRQGGRLRNEDALLQRVHSVLQEHEIQHQVTPSLVHGDLWTGN
                     VATLRNQNEVVIFDPATYYGDREVDLAMTELFGRLPRAFYQAYDASWPLPKGYREKRR
                     VIYNLYHILNHGALFGGGYYDQAQSMIETILR"
     gene            complement(<1132384..>1133445)
                     /locus_tag="CYME_CMR460C"
                     /db_xref="GeneID:16996875"
     mRNA            complement(<1132384..>1133445)
                     /locus_tag="CYME_CMR460C"
                     /product="similar to transparent testa glabra 1"
                     /transcript_id="XM_005538607.1"
                     /db_xref="GeneID:16996875"
     CDS             complement(1132384..1133445)
                     /locus_tag="CYME_CMR460C"
                     /codon_start=1
                     /product="similar to transparent testa glabra 1"
                     /protein_id="XP_005538664.1"
                     /db_xref="GeneID:16996875"
                     /translation="MSGDLVQELKRAGGERFPEVTFEWDSQWPLYAVGWCASSSAQGV
                     ARLAVGSFIEEGPNNYIEILDFVPGSRGTIRRFQSRHKCSIVFPCTKLLWEPAYEHSL
                     ARTQNVVLASASDMLRLWAVTEEHMLLLRTLAPNERAEQIAPLTSMDWNEVDRSALAT
                     ASVDTTVAVWDPELGRMRTRLIAHDNAVYDVSFDQNTAHHFVTCGADGSVRLFDLRSL
                     DHSTVLYESPTGNPLLRVTWSKQNSHYLLTLPSRSRYAVAIDIRMPAVPMAYVGGNTG
                     SVNAISWSPSSANYLATADMDGRLALWELAQAVPKTEVRAFAACKLRGPIDNVAWSTA
                     LPQWIAAVTAPSSLTVLQI"
     gene            <1134375..>1136834
                     /locus_tag="CYME_CMR461C"
                     /db_xref="GeneID:16996876"
     mRNA            <1134375..>1136834
                     /locus_tag="CYME_CMR461C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538608.1"
                     /db_xref="GeneID:16996876"
     CDS             1134375..1136834
                     /locus_tag="CYME_CMR461C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538665.1"
                     /db_xref="GeneID:16996876"
                     /translation="MTYALDLGSSWDGFIVIGTLVVQFILRCEADRSKDEFAKQVELL
                     SLVTAGAVLVSAFRRAACEPCHRKAATRRILDSASSSLDATASEHKTSGTGQTAVRAR
                     QRFRRARDQGLLVGLFLPFLCILGALRANLLTPAQAVHSLSLAFCQAWCAAWTWHLVP
                     EETPAPAASGDRAFCRKRRPVGTALLSKVPPLELNSDKEGAGLCWAFLLELLWLHLVP
                     LVILRRLSGTSWMPICTATVATLIVRKTLASDAFAGTFTYGEALLVSFLVTVAWFSPF
                     HMFPTALGSWHVVGVHQSHPAVWQEHSCFSVEKRLVPAMHSELAADVKRSGVEAIPLF
                     HLFKARRISAASCTEACGCDAQPPRQHGSPGTLQQSRHISHACPYRRLMQRYLLKTSV
                     ELATAGILFVNHWHRWLAGWNQGHRARASSCGAVGIALRSQQVSAVRNLLRRFARPLG
                     LALPLALILPLNYLMARRTLKRLSSMNSGSFSDCTDADAAEPFRLLCSWMTRDVSIMV
                     LVLYWAVTLAVGIFALGPHRWKWRRIVARKYYHLLALLLFMPVILRQDPLLWQFLSFA
                     QTVALAVLIALELARISGTNAAFPLERHSPSKAAYLVAGTSMHQVFDGGHDDGVSAAA
                     SGDRTTPSMDASLGASGGTQSRPSCDVTRGRSFYESVHQFMTTLVDERDQGSVIVSHL
                     YLLLGCAAPGWLLLGLLERFSASNGSWTSLLTDWSSGLLSLGVFDTAACILGSRFGRH
                     HWPHSRKTIEGSLGGFIATWLCQLLLQQWHAPNVFHVNWTALARFSGAVFLCTVFEAL
                     TAQNDNLVLPMFCFAVLGLFG"
     gene            complement(<1138347..>1139024)
                     /locus_tag="CYME_CMR462C"
                     /db_xref="GeneID:16996897"
     mRNA            complement(<1138347..>1139024)
                     /locus_tag="CYME_CMR462C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538609.1"
                     /db_xref="GeneID:16996897"
     CDS             complement(1138347..1139024)
                     /locus_tag="CYME_CMR462C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538666.1"
                     /db_xref="GeneID:16996897"
                     /translation="MLVGPAPTTDGSAENTLNEKRLVHGSIAFWLGPRAPQTKTHRWT
                     VYVRGARDPLEDLSLYIQKVEFVLHESFADPVRVVKEPPFCLTEHGWGEFEVIIRLFP
                     ISDPDKPVEMYHPLRLFPSVGQELTEKPVVSEHLDVLVFSQPAPEVERALHRSDVARM
                     PSDCWGDLMPLFGGDLHQVEEEDLRKVQQARERVRQQIQATRLQYEALTAELARARTH
                     ALHRELS"
     gene            complement(<1144271..>1144534)
                     /locus_tag="CYME_CMR463C"
                     /db_xref="GeneID:16996898"
     mRNA            complement(<1144271..>1144534)
                     /locus_tag="CYME_CMR463C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538610.1"
                     /db_xref="GeneID:16996898"
     CDS             complement(1144271..1144534)
                     /locus_tag="CYME_CMR463C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538667.1"
                     /db_xref="GeneID:16996898"
                     /translation="MGAMQVKKNPYVEAWVAGRETLEERFRFTPRNIRTALLFGVLVP
                     YGIYLLVAHDMAESKSTDRPEWKHLKREFPGVPVRSADSAQHS"
     misc_feature    complement(1144623..1147198)
                     /note="repetitive element"
     gene            <1147219..>1149348
                     /locus_tag="CYME_CMR465C"
                     /db_xref="GeneID:16996899"
     mRNA            <1147219..>1149348
                     /locus_tag="CYME_CMR465C"
                     /product="sulfate ABC transporter ATP-binding subunit
                     cysA"
                     /transcript_id="XM_005538611.1"
                     /db_xref="GeneID:16996899"
     CDS             1147219..1149348
                     /locus_tag="CYME_CMR465C"
                     /codon_start=1
                     /product="sulfate ABC transporter ATP-binding subunit
                     cysA"
                     /protein_id="XP_005538668.1"
                     /db_xref="GeneID:16996899"
                     /translation="MELGGSCLMMDNYMNPNTRPAIWYPLSMKTFLHRKKISGTASSS
                     SARRRRRRMPAMHSDILLRTIAWPQDRTGKQCTRQCCFVLCCVLDEPLREQRGSCPHA
                     MGSPQLGHACAPHQGLHKGTRQRTTEKRHIAPAQLGQFDTESEVAFSGYGNAAVVNRG
                     THPRSFSARTSFVWFTEPCALTKVHGKHPCIGIQESSFSAPVLYPIHGASRILVQRHS
                     PHPVKRALPRSRSRSWKASLFERFFGRKRSSRQTWPHLIKEQAPTGTVPASGASFAQN
                     GADTTVIPRARARHSRHEPTRVASPTPSSRDITDVDRSNAETCIAIRHVHKVFPDSHA
                     PGGQFYALCDILLDIEDGSLVALVGPSGSGKSTLLRCIAGLENPTSGRIFLHGRDTEE
                     MSVQERRIGFVFQHYALWKHMTVWKNIAFGLEIRKTPRSEIERRVLELLKLMGLEGLG
                     DRYPHQLSGGQRQRVALARALAPEPRVLLLDEPFGALDTRVRRSLRAWLRRLHDEVGT
                     TTIFVTHDQQEALEIASSVVVMNKGQIEQVGTPLEIYEHPASPFVMSFMGDVSVVSRD
                     ALPAEQANGRTFTNATRARSVETSKKDSIWSDPERPPTIPRESETTTNVRKSDNAAQY
                     LMLRPHDVHLHRSPDSTTAPARVVDVFFLGWSVRVDVELQDGQILQSIMLTTRYKELG
                     DLYPGDLVHVKFFGERSFEVDEAEYNI"
     gene            complement(1148770..1150665)
                     /locus_tag="CYME_CMR466T"
                     /db_xref="GeneID:16996709"
     misc_RNA        complement(1148770..1150665)
                     /locus_tag="CYME_CMR466T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461642.1"
                     /db_xref="GeneID:16996709"
     gene            <1150943..>1152997
                     /locus_tag="CYME_CMR468C"
                     /db_xref="GeneID:16996710"
     mRNA            <1150943..>1152997
                     /locus_tag="CYME_CMR468C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538612.1"
                     /db_xref="GeneID:16996710"
     CDS             1150943..1152997
                     /locus_tag="CYME_CMR468C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538669.1"
                     /db_xref="GeneID:16996710"
                     /translation="MPLTDPGTNGLHLISALRVAPVPVWLQLCVLSFAAYHTLVLLGM
                     LLTGRGCSTLRYRRVFQFWIVYGFSKLCTGAIRELFRILWLVTTWGSNTAHLSGSDLL
                     VRRLVRAHSWLEALILMFLVFPLHRGLADTLAPLLFFGGTYQVEPARRANSGAETRAS
                     PLSAHTSATNSPGARSHSVGNVEGTSFRNRSWFPRASRLRHRSGYWASAASPLFECAA
                     LVYQNLLLPNLETWEPEIDLFLGRVQAQLRQSRLAFKELLCFALAWMLARSGNAAEAA
                     MLGNAALHGAQIGLAERLARVRRVAAAWLERDHHLEALYRGEYRDRRGHVYARHAVEG
                     MHVTGAAAAAAAADGTDAAAVRERCTHADTREVHGGDARSRQRLSSAERATRVHAGDS
                     EANVRDGAIYRGTSKQWTPGSPAGASGRVVERFELGKEPDSDHVLDTEPEHAQSSAVV
                     DARSRAVHVMSVTELESMKEARFPRLLAPKMEPERFPYAWCSADEAAIRQMYAADEIV
                     RMPRSCRYGAALGPSSSVLLPSQAPRSAVGVQRSRASGWWQTLVTAFHAGVRNSTTHT
                     NRDDDDDGDDGACAFAGQVDDGTQCPPPASKAGEAGAPALRGLSETDFGQISSEGAHP
                     NAALHGSMLLHRPGAYKATFLNESRSCYLQSRTRTYERIRALRRQLQMQRQQRTADAI
                     ST"
     misc_feature    complement(1151124..1152053)
                     /note="possible transcribed region"
     gene            complement(<1155530..>1156201)
                     /locus_tag="CYME_CMR469C"
                     /db_xref="GeneID:16996711"
     mRNA            complement(<1155530..>1156201)
                     /locus_tag="CYME_CMR469C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538613.1"
                     /db_xref="GeneID:16996711"
     CDS             complement(1155530..1156201)
                     /locus_tag="CYME_CMR469C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538670.1"
                     /db_xref="GeneID:16996711"
                     /translation="MFVTGLNRLRLEERTRSSGCTHTALHCAAVYRDLVHGTRLLPWN
                     SASLAAARPVRRRARTGSVVRMATQAPGRLTVDQAAGKFPRLVEFLEACKELGELRFI
                     ATNAAVVLESTATLEKLFYAEVPRRGLYANVVDLSINMDLHILLSGVRAARFEQGVSR
                     GDPSTPTYIIRLLGHEKAGEEVVLSMFLSPVGDVSSERAAVWEQLRTRFASADGTAAA
                     NTCVF"
     gene            complement(<1158050..>1160740)
                     /locus_tag="CYME_CMR470C"
                     /db_xref="GeneID:16997126"
     mRNA            complement(<1158050..>1160740)
                     /locus_tag="CYME_CMR470C"
                     /product="similar to adaptor-related protein complex 3,
                     beta subunit"
                     /transcript_id="XM_005538614.1"
                     /db_xref="GeneID:16997126"
     CDS             complement(1158050..1160740)
                     /locus_tag="CYME_CMR470C"
                     /codon_start=1
                     /product="similar to adaptor-related protein complex 3,
                     beta subunit"
                     /protein_id="XP_005538671.1"
                     /db_xref="GeneID:16997126"
                     /translation="MTTLASQLAGNWTDASYLDDANTDWALLRLQLEQGNAQVRREAL
                     KRVLALSVQGQPVAKLLPAVVSNLLQADYELKRLVCIFLQQHADDEPHLVLLAVNALF
                     KDLQHNDPWVRSQALRLLTSLRVPALRQVMWLAIHRGVRDRHPQVRLTAALSIPPVLT
                     WNEPDGAEPAQSLHQLPVEQIASALTAPLWQLLLNDREAPVLVATAAALGMLDRDAML
                     NIPVSLVERLDEEYQTIPGNLLPIALHQLLRYVLLRTTTRPERMTETLCGEELTRFVQ
                     AVDRLARKAVESLSAAVAVSGALTLYHLRRSSDNDVTETVVRTLLRYALDHESGLKVL
                     ALRMLHVLAWREPACLTRYAPLFVPTIGTDEPAVYRHQLGILVKLVEFEETLCITIMD
                     RLVPLLKCRGEELAIMAARALALMAAVHPVSSAAAIPQLIDIWRSRSVVSPSVYGAVG
                     LLLLRMTVGALRTTPRERISQAENLLKEIVLNAAWIESDSPTQSRFLWIVGTMIDHIG
                     TVADEVLRRWMQQQQQQQQHRLLLAAPVRLELLRLARTLAARRTSTDRAWRALNSLLV
                     AGLEDDDVDVLSYAVECAQSLDKISVRPESVMDTMEARVAQSTTLIDTDPTPRAGTAE
                     AAAAHPQCAPLRTSSIVDDVRTDAIDALRNRDAVAFAVPSAWTNGCLLCAWSACTSAG
                     ATFSSCLPENANLLHVSLPLVPSTEASKHQAAEKHQDTSTELQAPVATNPVPAADSLA
                     LFFGETTASATTTAPVAAAPADKHEDASEPLIAISSPEQTSPDAPVDSTLHMSVFDAL
                     LTAGLVSSERVEQLRPRMLAENSLDALFQELIAAASGALQPSSEAESLDALAAESAGL
                     LPTGAAQSMYEAPVSLTQVPEATQQSRDKRRNAASEHPHL"
     gene            <1162640..>1163449
                     /locus_tag="CYME_CMR471C"
                     /db_xref="GeneID:16997127"
     mRNA            <1162640..>1163449
                     /locus_tag="CYME_CMR471C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538615.1"
                     /db_xref="GeneID:16997127"
     CDS             1162640..1163449
                     /locus_tag="CYME_CMR471C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538672.1"
                     /db_xref="GeneID:16997127"
                     /translation="MGSAAPLSRIARLLERDAATLAWSELHEAHQVLLRCTLRSTDGQ
                     ALWLLSQFYERGFHVQWQLRRKTRPRGGGLIARWWSSARYRWHSLFTEPVLALDRFLA
                     DRYRYAAARADVLPAQLALVEELRRNGDDADHELAYALLKRMVRLMAGQRSAGMNAAV
                     LPKIGLVCLTRGAFNDALTFLEQWYENAAPREGHADTIAVLGVLYARRWLHATEAART
                     DHDLMQAQRYLTEAAENGSVLAQSWIVALEEHWKHPRSGEERTASIQAVHI"
     gene            complement(<1164164..>1165786)
                     /locus_tag="CYME_CMR472C"
                     /db_xref="GeneID:16997128"
     mRNA            complement(<1164164..>1165786)
                     /locus_tag="CYME_CMR472C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538616.1"
                     /db_xref="GeneID:16997128"
     CDS             complement(1164164..1165786)
                     /locus_tag="CYME_CMR472C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538673.1"
                     /db_xref="GeneID:16997128"
                     /translation="MSEDSRTETSSTETEEEIVRGANTHASGGRVPLVASGAQSLSTV
                     GSSLRAACAGPAVPPSLAQPLPSKRNVRDNENIKRRRLGTEAADVEVVPRNGQRRRRG
                     AAKTEARVALPTVASLESRPGSTSEWRRQRMSLHSLSHGVVIDLNRVTIPERYRRCRT
                     PLSNHAIAAIAHGWAPDDVCSICGLGGDIVCCDECPMGYHLQCIGLPSIPSGEWFCPA
                     CVLRIKVEERMRQELGLASSLGEHASSIPTGWSQGWTRPPTMKALREESTTQEPRRTS
                     PGIAGIRGTDERFPGCGDGMSEPHPPRPGPIAGADIGSEHCGLASAATKERNESAVLN
                     HEVVQTIQAPVEDAAKLSPLESAFTGSNAAQQPGNAAPGWTSSIDEKQQTTANVMRSF
                     VTHAATHLAAVQTNVSAGSMSRDVRLPPLVPPLDTEQSMESMRGRYASRDMTRADVAS
                     STYLATKAQLADTPASLPPSTSTDSRGVAWSVLGAIAALKLAPWKETQLVQMALRQDE
                     RLIGLYRSFGAEKDRFRDYAMLLLEDVRARPK"
     gene            <1166021..>1166884
                     /locus_tag="CYME_CMR473C"
                     /db_xref="GeneID:16997129"
     mRNA            <1166021..>1166884
                     /locus_tag="CYME_CMR473C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538617.1"
                     /db_xref="GeneID:16997129"
     CDS             1166021..1166884
                     /locus_tag="CYME_CMR473C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538674.1"
                     /db_xref="GeneID:16997129"
                     /translation="MGACTTRGALSSTFVCRKLCFIAGTGCCGSAFHRIVSDERVVQF
                     CRPRRRVLAAAGPCWRAALSEEPPVSRRTLLRHGACALVTLVVAQVLSARVTLAAAAA
                     AETTHASGSATEQQAAGAPLGKVTATGLRYYDFVEGDGTSPDWGDLCVVEFVLYSVPR
                     PRAAPGSSAAPAIRLRPWYSTGGRGYLIKHGDGRTIAGIEEAIHTMREHGRRRVIVPP
                     RLAYVHADLGPVPDRTWTRLRLAKKLEEGELLVFDLELRKVMKDPKDRGYYKDIIVRD
                     GMQLPSLADNE"
     gene            complement(<1167401..>1168672)
                     /locus_tag="CYME_CMR474C"
                     /db_xref="GeneID:16997130"
     mRNA            complement(<1167401..>1168672)
                     /locus_tag="CYME_CMR474C"
                     /product="undecaprenyl pyrophophate synthetase"
                     /transcript_id="XM_005538618.1"
                     /db_xref="GeneID:16997130"
     CDS             complement(1167401..1168672)
                     /locus_tag="CYME_CMR474C"
                     /codon_start=1
                     /product="undecaprenyl pyrophophate synthetase"
                     /protein_id="XP_005538675.1"
                     /db_xref="GeneID:16997130"
                     /translation="MWPVFLMETIPRASEPQRLRGRCSLRHERLLTYAGPPPAAGVSS
                     WTWCIFHDDAKVPCRHRRPSGAFTENRRSFSAAGVRWGARNLRQNGTLHNCLLLPRSP
                     SNRQLRNRLHRGCFQLRLCQKLENSEHATSSDCITTGPVAADYPTKEPPKVAGQTDME
                     RIRDHLVEKLKLPTHIGIIMDGNGRWGLRVRGSRSAGHEYGTQTLRRIVEDCLWLHIP
                     FLTVFAFSTENWRRPAAEISSLLSLFQHVVDTELEKLQSRSVRVSFVGDRSALPDSLR
                     ERMHDAEERTRSNRALCLQVALNYSGRQDILQAVRCVARDVERGVLDPDSVNESVFET
                     YLAQCWGIDVPDPDLIIRTGGEQRLSNFMLWQAAYAEIYTTDILWPEFTSRDFFRALE
                     AFHERRRQFGGLPNCENDAYSTRKVPEHPSL"
     gene            <1171586..>1172728
                     /locus_tag="CYME_CMR475C"
                     /db_xref="GeneID:16997131"
     mRNA            <1171586..>1172728
                     /locus_tag="CYME_CMR475C"
                     /product="probable inositol 2-dehydrogenase"
                     /transcript_id="XM_005538619.1"
                     /db_xref="GeneID:16997131"
     CDS             1171586..1172728
                     /locus_tag="CYME_CMR475C"
                     /codon_start=1
                     /product="probable inositol 2-dehydrogenase"
                     /protein_id="XP_005538676.1"
                     /db_xref="GeneID:16997131"
                     /translation="MRMEQPAAFLSGKLQPLCLDRKFQLRVSGSRQQFRGRRRPILVA
                     RVGIGVIGAGRIGQVHAATIARLMNAELRGIADPIEAAGRKVAESFQTAYFPDYRTLL
                     EDPDVQGVVIGSPTPFHAEQMIAAAEAGKHIFCEKPISNDLATIDRCLEVVRTSGVKL
                     LVGFQRRFDSNFSYVRDQIERGTIGQVRMFHIHSRDPAPPPAEYLAKSGGIFLDMCSH
                     DYDMARFVTGQEIEEVYVVGKAFDPEAQAANDLDTHITVLRMSGGVMGTIDNSRRCAY
                     GYDQRIEVFGSDGSLIGQNKSKHSVVAAGQDGYHHGRPFDFFMDRYLEAYGNIMTAFV
                     QMIERGTDPPVSGLDGRAPVLAALAAARSVKENRPVKLSEVDIRMR"
     gene            complement(<1175761..>1177038)
                     /locus_tag="CYME_CMR476C"
                     /db_xref="GeneID:16997132"
     mRNA            complement(<1175761..>1177038)
                     /locus_tag="CYME_CMR476C"
                     /product="similar to glycerol-3-phosphate dehydrogenase"
                     /transcript_id="XM_005538620.1"
                     /db_xref="GeneID:16997132"
     CDS             complement(1175761..1177038)
                     /locus_tag="CYME_CMR476C"
                     /codon_start=1
                     /product="similar to glycerol-3-phosphate dehydrogenase"
                     /protein_id="XP_005538677.1"
                     /db_xref="GeneID:16997132"
                     /translation="MQPEQTVPRLQSTRSVSSAFTCAISLARGFEGAGSARTETAFSV
                     TLWRRPSADPSYGRRSVRRKVPPTHARLSGQSQEEARHVAICGGGSFGSAMAFALANN
                     GHQVVLLVRRAEVAETINKERTNPRYTALVPGFRFPKLVRATTDPEDALKGCWLCVHA
                     VPVQASRAFLVESVRPNLAPGTPILSTSKGIEVSTGNFMYEIFDDVFGKERPVPCMFL
                     SGPSFAHEMLADLPAAVVLASHDAAACASIAAAISSPALKVFRSSDVVGVEICGAVKN
                     VIALAAGICEGLGLGMNATAALVTRGCSEMRRLARSFGARPVTVAGLSGVGDTFMTCF
                     GTSSRNRTVGYRLGQGETLAHILETSSQVAEGVPTAKAVASLIERQFPHLNPMRRALK
                     FPILLGVIDVLENRQSPREKLEEWMDRKARIED"
     misc_feature    1178453..1179877
                     /note="repetitive element"
     gene            complement(<1180805..>1181563)
                     /locus_tag="CYME_CMR478C"
                     /db_xref="GeneID:16997133"
     mRNA            complement(<1180805..>1181563)
                     /locus_tag="CYME_CMR478C"
                     /product="similar to transcription factor IIA small
                     subunit"
                     /transcript_id="XM_005538621.1"
                     /db_xref="GeneID:16997133"
     CDS             complement(1180805..1181563)
                     /locus_tag="CYME_CMR478C"
                     /codon_start=1
                     /product="similar to transcription factor IIA small
                     subunit"
                     /protein_id="XP_005538678.1"
                     /db_xref="GeneID:16997133"
                     /translation="MSDATPQRTAKAEPDAGQATTESIRGGKQDANTAANQPGVFYAH
                     YRASTIGLTLEDTLDELLSAGHLQESEAALVWTQFDQAVARYLRRKVRQRSVLRGRLA
                     HYNLRDNVWTFLVRHALLRLERKPETYAAVERLPRTSDLGGATDASIRVEPAVPASGS
                     LKLEGPRLASHLPPRPDCLDGRAVPAVTSHARSAGDATTEAYVYADRLRLICTAADAN
                     IVKATSGSSRRKRSAAPLRFRPRSRPASSASAEE"
     gene            <1183718..>1185655
                     /locus_tag="CYME_CMR479C"
                     /db_xref="GeneID:16997134"
     mRNA            <1183718..>1185655
                     /locus_tag="CYME_CMR479C"
                     /product="p68 RNA helicase"
                     /transcript_id="XM_005538622.1"
                     /db_xref="GeneID:16997134"
     CDS             1183718..1185655
                     /locus_tag="CYME_CMR479C"
                     /codon_start=1
                     /product="p68 RNA helicase"
                     /protein_id="XP_005538679.1"
                     /db_xref="GeneID:16997134"
                     /translation="MGQPTHIKWFNGNDYTAPSFDYASNGSQSGPKTWHGNDHSLEGQ
                     APSFHAAPVGWSATIPQAPGARYPDASNSYGNGDWGHSTAPYRGRTATQDVHGHDSYA
                     QKGTRPNNWRGAQPQSRARFASRGETRDRMGSLGANLSDIDWTQANNLDNLVPFERNF
                     YQEHPEVAGRSPEHVASFRQRMEITVRGKNVPNPCESFLEAGFPPAIVQCIQRAGFTA
                     PTAIQAQAWPVALKGRDLIGIAETGSGKTCAYLLPALVHIHGQPPLRRGDGPICLVLA
                     PTRELAVQIQTEATKFGTASRIRNACVYGGVSRGPQARELSRGIEILIATPGRLIDFL
                     ESGRTNLRRVTYLVLDEADRMLDMGFEPQLRKIVGQIRPDRQTLMFTATWPRQVQVIA
                     REFLTAGDWIQINIGGLDLSANKSIRQVVQVLDEDEKPERLQSLLKTLLNASADTDSN
                     AKVLVFTDTKRKADQLSRRLQHWGLAALALHGDKTQMERDRAIGSFRSGQARLLVATD
                     VAARGLDIKNISYVVNYDFPGTIEDYVHRIGRTGRAGSTGTAYSFFTPANARLASELV
                     QILEESQNEVPAELNQFVNRRNRKRTYEHSFGRGYARNGARSTRRRGSAAGYGASGGG
                     SRYRGGAGDRSHVRAHENGAF"
     gene            complement(1184174..1186376)
                     /locus_tag="CYME_CMR480T"
                     /db_xref="GeneID:16996723"
     misc_RNA        complement(1184174..1186376)
                     /locus_tag="CYME_CMR480T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461643.1"
                     /db_xref="GeneID:16996723"
     misc_feature    complement(1186485..1187360)
                     /note="repetitive element"
     misc_feature    1187315..1188223
                     /note="repetitive element"
     misc_feature    complement(1189669..1191608)
                     /note="pseudo-gene of triacylglycerol lipase"
     gene            <1191858..>1196747
                     /locus_tag="CYME_CMR484C"
                     /db_xref="GeneID:16996725"
     mRNA            <1191858..>1196747
                     /locus_tag="CYME_CMR484C"
                     /product="chromosome assembly complex Condensin I, subunit
                     D2"
                     /transcript_id="XM_005538623.1"
                     /db_xref="GeneID:16996725"
     CDS             1191858..1196747
                     /locus_tag="CYME_CMR484C"
                     /codon_start=1
                     /product="chromosome assembly complex Condensin I, subunit
                     D2"
                     /protein_id="XP_005538680.1"
                     /db_xref="GeneID:16996725"
                     /translation="MTSAEAFLLPFHWEDVVLDPDLRSKHPARGPVAPRYAVSVDAFD
                     LSDPDMVQSAVALASGHVSDHAANALLIPEDVAENETIQCLDSLAGVDGDQSLSWWLA
                     PLSDRAAAQLRALLWCIHHWCGLNDFSIRAQLFTCVQHGIKQALHVMRNAARAELSAD
                     PANRTGTDTWRSILRLVAFVSAHWLQAVERELAEDAVALSLPLAGTSGGSRVTRLESS
                     SARTGTNQGGTPARCRAKRPNLRKKTSRFIVESDASDEESPAYAEDQATVCTGDLPGE
                     REHAGPENSWAELYEGERERLLEAFGELLRQEGIIKLAFPSAIPEDAYLYLFVRTSCA
                     LLESRLVCRKERARALLVDLIVECLSRYGQAGRLCPILVHSLQRYEHVAPVLVDIVVV
                     LCQDDADSGNTQRRSGSNTRDALQESLTRGDVPALSVSQAGRDDCIRDLMTQVTQIPI
                     SELARDNTCARHVARFLTELAERSPGTLVPYFAAWIPHFDGEAYSVRNALVQAFGCVL
                     KHLAEHRSPEAVQAPHQEPHDESMTLQERLLQLLLRRLDDVHALARSRTLQVWQQLIE
                     ARCVPVSLYATLAAQVAQRLQDKSMHVRRAALQLIAVAIRLNPFADRLQPALFIQRQA
                     QCLRIAPDDPASTFEMPFALAQEGASFYAGAATFAEILNKAIPLVSRLCRSRQNGDVL
                     DAIRVLCTAYQFEVPAAVAEAPKQTLRLGLSREESVQTAALDAFYTMCFVLPLEQVLR
                     STKQQQDMALATEALQTMGVLAITRSLVSLVARATVGELTCFERLLPALYRSERLAPS
                     VLQCWWDVLAGRIPGANLELIRGCTFLIQCVVSAKPLTKSQCELLREHAFTDLVTARW
                     ACAALTHGLAAQSLDSEDGLLVGKVEALLVDDTRSVYWPAAAQAAVTCLFHCSRDPSQ
                     SVHRVLQRLVERHQVAQQQARGSQGSTAHGDVHQDKPQVRCASSWLSRLFTVGSAFAV
                     HQLHFAVKSVRACLRSESSTNPVETCLAEAVAQLQLDDASKQVEATLTTPATGQARRA
                     RQSHSKAAASVTEASVAHVGIDPERLQYLESRLDQLCSVLETELTAPEAPLAALAPLA
                     AHVLLRACAWTPQSQSQSQSQSQPAASLEDDSSVTAAQTPVHGARVQPRSSADNTLGA
                     AAALCLGRLACLHESVAERFLRVLFTALQQASSAVVRINIVVALGDLVARFPNRLEPW
                     TDQLYTVLRQDQDARVRRYMLMVLTHLILNEMIKIKGHWVDLVRCLQDSDASVARLAR
                     TLFTEMQRKRVSAAQTFMLLLPDLVCSLSQEEEAEEEAATLVSGHAPSRLTKPKALQP
                     SISTEAFLDMMQFLLSFVRQERLTEHLLERFCYRLRGAADVHTAQRLALCLPLLHCTS
                     ERCLRRLVELSKCYTHWLADGVVAEALSHVLARVQRAAKRPEQRELVQAFAQCLARGA
                     HVDQGVGCHGISTGDNDDDDDKGGTAAAAAAAAAAATMTTPARVPQHLSNSNSSRLSM
                     LRSPDADSPVLWTPGAPTATTRAISASTSTPKNAAGVPGSAALCTPGSGWRTPASARQ
                     LARARARTAMQQLLQEHLHHRHNHNHRSHSRKQQQNSTKLERSPSFDQVTPERGRSTS
                     RRRRRRRCAGSPGASIRSP"
     gene            complement(1192257..1196616)
                     /locus_tag="CYME_CMR485T"
                     /db_xref="GeneID:16996726"
     misc_RNA        complement(1192257..1196616)
                     /locus_tag="CYME_CMR485T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461644.1"
                     /db_xref="GeneID:16996726"
     misc_feature    1197165..1198540
                     /note="possible transcribed region"
     gene            complement(<1198511..>1202071)
                     /locus_tag="CYME_CMR487C"
                     /db_xref="GeneID:16996739"
     mRNA            complement(<1198511..>1202071)
                     /locus_tag="CYME_CMR487C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538624.1"
                     /db_xref="GeneID:16996739"
     CDS             complement(1198511..1202071)
                     /locus_tag="CYME_CMR487C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538681.1"
                     /db_xref="GeneID:16996739"
                     /translation="MPASSSTVVTYPDGAFALVNRRGRPVWLTSHRLRVPNLGLVVFE
                     AAGDHDIVCLLCHRSTGVDADSRVETQAQGSRACFEISFQSHRRTRTLLREHGVVRQE
                     YIYERPALGRNASQESHAGPRGAALPFPGHSVATGGPFTNAGRDIAPLSQEFLNGQSR
                     QRYWVALSPEYVAAGLGWPGESSHLHYRRMRREQTTTVATGSVLDAFTESCPIQWIGF
                     SCWDTAVIFYRVDVLHLPQVRLLPWIAAAAAAAAAAEQEEEEGSTTALGDGVHGSAQA
                     RVRCEHATSPLPSRAQDASLRRQAGPLRSTTRPPIPDQGDAENGTGQKASQHRSSSDL
                     VLFWCAKDAVYVPAWTTGAVPAPANRSPRKLSVELEALALRNTDESIKNRKNSNSSTS
                     SHHGTKQHINTNTSDVPGEWVPVWAPRQQLIAVSPVFRALLETSGMRESRSLTSTCPG
                     AGAPPESETVVKQPDPLCGIMLPSVSAGCLRTALQFLERYPGEAKTPYREHWTPEQAL
                     ALLCFADTFQWDHLECEAARALVHHMRTLSEHHLPWTAAVAETALRLSRSDMLLTAWE
                     AMARSLDHCWDLMQTDMTGSSSSSSGSSSESSCDTSHCCASTADARPSVPSAEQNVSP
                     QWHSPASPDEQEASVPVPPWVPAEVQTGILEGQSRGAACASASSTSTPPEDPNALVEA
                     TLQRLDLYCLLGMLSFWNRPEASLVLLQQWLDTRAQAPTCTKVDTPEQLVLMGSPGTA
                     ASAVGPAADAAAKRANMLLEWACAFAAAADVSSLEHHIERHEIDEHCLPSLELIDEDH
                     LFYRPRVCVPPQLDTFVDEHVSLAVACSVLQPSPWSRDPVNMPPDGRNWQHVFVRYLP
                     GTEANGILSFLGTLPQGRVWRNPHRTGMVRITASSLLNLNCELLCDHLGRAAHSFVAP
                     RRTKEPARRSLPVYDDNDDDVDRATLSSGRAARQHSGSITQTGPVTALQESNDNDNDN
                     DTAWVSIDLGALRRVRLTHYALRHDERDGEYLREWILEGRPDDNDHVDFENQKLDKAH
                     TQAGGPTQVACACSAPSTSSQRIRQTNATHGLPWVVLQHQHHDERLTSPHAFAVWSLG
                     AVPNKPSRAWTGVHPHDKRGAAAGASEAAVAGAAAAGAVGAAGASDAAGAAAQAPLLR
                     YIRLRALRNSSGTDRLVLASWEFYGQVWWRSSDVSERLNL"
     gene            <1203054..>1203962
                     /locus_tag="CYME_CMR488C"
                     /db_xref="GeneID:16996740"
     mRNA            <1203054..>1203962
                     /locus_tag="CYME_CMR488C"
                     /product="similar to phosphatidic acid phosphatase"
                     /transcript_id="XM_005538625.1"
                     /db_xref="GeneID:16996740"
     CDS             1203054..1203962
                     /locus_tag="CYME_CMR488C"
                     /codon_start=1
                     /product="similar to phosphatidic acid phosphatase"
                     /protein_id="XP_005538682.1"
                     /db_xref="GeneID:16996740"
                     /translation="MNGSYALEALDSERRWMKRSELVDCSLAVLVGWVLPLVLDRYIP
                     PRVTAVALEDPSVQLPKRAELVPAPLLLLFAYVAPVGMLWWQQQQQQQRLRESFGNGF
                     RSKGGTLLDLLTGVIEANGLTLLATVVLKLLIGKPRPYFAQVCGQYLDPVLRHECAGD
                     PWQVREARKSFPSGHAALAFSGVMHWQCCIWYLGIPLPWFEALPSVTMVHLLLRLLPW
                     TGATLVAASRVLDHHHDVVDVLGGAVLGCALSHLVTMNRFLRLEGRVPGHQSTASTVG
                     ARRTASASEMEAIQVSETTSIPDAVV"
     gene            complement(<1204898..>1207657)
                     /locus_tag="CYME_CMR489C"
                     /db_xref="GeneID:16996741"
     mRNA            complement(<1204898..>1207657)
                     /locus_tag="CYME_CMR489C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538626.1"
                     /db_xref="GeneID:16996741"
     CDS             complement(1204898..1207657)
                     /locus_tag="CYME_CMR489C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538683.1"
                     /db_xref="GeneID:16996741"
                     /translation="MTTETIRGTVEVSDPFVGVHEAVLAGVDANTGTATHDAASTLNE
                     DLWVARSIRVRQVLLPTFRRTLGPPDLCVVYKSWRTVLASGSDGRANSTKVNISSGAG
                     AEVPATSTPDSLAMEVTSGDLKSRGAQLAAWFHFVRGIWHRTPADAASYLGSLVKHGL
                     EGASWYATGSYRIDRAACLAYNCFTNEDTVVEARFPGCTQVKRLRGPEPFHQSVANEN
                     GQPATRQVADTQDDENQWAQLFVSAVLRSVKATGEHPLYPALKVVATLDVAWNAEQLF
                     LDAAARTLPQWKLAGSRFVDAAQATATCSIIAEGVWEYFARYARYQAAQDFFQTLATS
                     CHEPALVLYVARSLMGQRQHQIAQKKLEELLLDQAACAELPGIDRLLLELTLAECELE
                     LGNLIEATDRIQGTVIPECFGTHTSPESSATGAAAQEERTKHLNTTDAVEASDEESAN
                     VRIAAPGELGRLACFLLARLYVQTGEYESALRSLNIADVEPPQMDWFLRQVTAPDSSP
                     GIEGKTSKMRQLTQPRPGFAAGTDGVRVLARRLSEERIGAGAFGKGREQHHADRLLGD
                     LTASVLSPEEREAFDILVKIVNQIGWDEFLLIRNRVFIMESDVLPLESAGTGALELST
                     ASAEARPAPPHESPPQHSSTDNAEEPSLQTISLSSRREPATETQVHSTGTGPLGATQS
                     DLDGHQQGEPKATLTLADARRQVHPAALSKALCTAWLDMLIHCLYEDLRAWSIWQHEE
                     STLYESLHSNETTAAENAERAASPALVSESLLITETRRAPVDWLRRGELAERLGRPEM
                     AERAYRICLGVAERAQTPTLTVWFRLAALQTEHGEAPAVVQALDHIWQYLVEHTDDSG
                     KSTLTTRTERLLPETMQAVLCHAVARFGFQTVRAAVSTLRQHQERMRSLLLDAVAAQV
                     HGYDR"
     gene            complement(<1208746..>1209216)
                     /locus_tag="CYME_CMR490C"
                     /db_xref="GeneID:16996862"
     mRNA            complement(<1208746..>1209216)
                     /locus_tag="CYME_CMR490C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538627.1"
                     /db_xref="GeneID:16996862"
     CDS             complement(1208746..1209216)
                     /locus_tag="CYME_CMR490C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538684.1"
                     /db_xref="GeneID:16996862"
                     /translation="MNVVFEPDRFVRAFRFFSELFSRLSIEHLFAVTINFGFIRGLQE
                     FSVVLSRAFLRRSAAATCSIDGVRINRDALEHGLVASPMSLSNAYLQVSFLLLALRAA
                     CFKIWHSPSFRFLCINVSEWCNDERLWIDKEKYARSCVGDSRASSYTMFKETVK"
     gene            <1209555..>1211240
                     /locus_tag="CYME_CMR491C"
                     /db_xref="GeneID:16996863"
     mRNA            <1209555..>1211240
                     /locus_tag="CYME_CMR491C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538628.1"
                     /db_xref="GeneID:16996863"
     CDS             1209555..1211240
                     /locus_tag="CYME_CMR491C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538685.1"
                     /db_xref="GeneID:16996863"
                     /translation="MESANQRPAGDVATDATATRTPLSSNLSAETASPGTAPAALHPE
                     TAGPESAVSASEALDNWRRRVCKALHKLTTAESISSITSGLQVHRGKLAALADLLEEL
                     HFIECWVHELALRREAARLASDCASPEQSATREEPLVIPDIPACFADSLLNWQGIFTE
                     TCKPSPLDIALYTWRTCFGVLLAAAIQHAVAIDGHALVLDYLTSFLTRTGYFQQSVCS
                     ACLAKQATTTHHRIHGWQPLLDMVPNALNLWETTQLVQLLLCIMRGFLSLLAIECAVA
                     TLQLCEQILKRLQLLAGETGIRAPDTADTAPRAEIFQVPDETPESMIQSQERPRETLP
                     IPVAPEMPSSASTGEALPERTSFEAVPAMTSDIVQGQSRIAQPALEMTVQALRALLLF
                     HRGLLDGMRGAHEDSIDAFDAAVILCESLDHGDWALTPESEAMLPSAAVPSGLFRTAP
                     IRDWVRVAYNNSALCSVQVEDLADALEKLDQAKRFSVSAATAWLSDPCSLGRNEDVER
                     SAEMPLHSEEHCVHAHYAWVAERVPWELQPTDHSAALEWSSVIQQFEDTSLRR"
     gene            complement(<1212925..>1215654)
                     /locus_tag="CYME_CMR492C"
                     /db_xref="GeneID:16996864"
     mRNA            complement(<1212925..>1215654)
                     /locus_tag="CYME_CMR492C"
                     /product="similar to MAP kinase phosphatase"
                     /transcript_id="XM_005538629.1"
                     /db_xref="GeneID:16996864"
     CDS             complement(1212925..1215654)
                     /locus_tag="CYME_CMR492C"
                     /codon_start=1
                     /product="similar to MAP kinase phosphatase"
                     /protein_id="XP_005538686.1"
                     /db_xref="GeneID:16996864"
                     /translation="MCPLLESGEHAKHFGLPKTPDAHARPCHSCSQRGTGPQLGHGSE
                     VRFSAEYAKPDTLVIPTTPIRASHAEDLNSARSLGSRTSTPTSLPSLDLSTVATCPIY
                     RSELAATCSRSCAANEDGLARFAIPAAEDQQQQQQQQQQQQSKHFLSELGWSIEGNMT
                     RRRFRSRSRSNGERDDWWQDLASQVEAETRKTKCSTGSESPDCPAAQRANADCSTERR
                     TDAAQPLSPPGTSSGQPRSSQTGNRSVYGTENGVGHRSRAGSLGWVSRLRSRSPLRLH
                     ATAASGRPESLTPDASTTSGKAAGYTEATLPPVTPVSGQDVSSLVQHLSESISFVRSY
                     LGVSGRKPAANAALLQHHGITHIVNASGLEVPNFFENEFRYLPLFIQDRDERFATEEM
                     MQLFYPVCDFIDAARVAGGRVLIHCYQGISRSSALALAYLLIRESIWPLEEAVRQLLR
                     VRPTACPNAAFLDALSEIELRILIGRYRAAMRNALLGQTGDFAYAAMTARNALFQNTF
                     AATHHQNRALEPSMPTSAASPTASDGAASTGEAAKHKVRERSIATNCGYAQRMPSGER
                     ASSGRASSTVANAAPFRCISQFSTSRLTNLLSMWTLGSSTECPADTQPHTSDKCTLLR
                     PEEVDELLKLRLFRLEKYRGMPSPTGHRGMRYLLLLRSFRSPLSPGHETERSGEPHSV
                     GALDAGSGAQQDAATTQRSVRRASGCHSFYTGKLQRRIRIASDRCYVLHTPFSATFLG
                     RLADSILERYPTGSAPEPAAEPVNRVRHRRSVSVGTQSMVHDPPSHALAAVRPEENEW
                     LGDTRLFIWCGSRAPVELLYASLRLAWNIAITECLYVDSIHEKIAMWETLERELELAL
                     KTRQATNSFEMLTLYTIPNLPLHVVFEYHEPEEFTAHLHRSRSVLSRWFAFAI"
     gene            complement(<1218352..>1220742)
                     /locus_tag="CYME_CMR493C"
                     /db_xref="GeneID:16996891"
     mRNA            complement(<1218352..>1220742)
                     /locus_tag="CYME_CMR493C"
                     /product="GATA transcription factor"
                     /transcript_id="XM_005538630.1"
                     /db_xref="GeneID:16996891"
     CDS             complement(1218352..1220742)
                     /locus_tag="CYME_CMR493C"
                     /codon_start=1
                     /product="GATA transcription factor"
                     /protein_id="XP_005538687.1"
                     /db_xref="GeneID:16996891"
                     /translation="MVSNSLRCISCSTNDTPLWRAGPTGAKTLCNACGVKWKKGKLAL
                     VIDGVTYSYGDLAVNATRGSAAPRGFGKGFAQGASTNRRPIVDGEETSSAPTTDEVRK
                     AADRGSAAGRSRQFGTGAQNSRSRATPATLNRRITQPQGRERSLARSRSQTRVSVRGA
                     THTLPRSASWAQFGDASWSLSGVGKPGRGRRRRGPIVSGEQARFGRLQRSASAVSLAP
                     LHEYQQAVPGGDQSETTYASARLPANLWTCFPSEGDDADEGEHSSPRDRCHSVVVDDQ
                     ANTTNSGVSSEHRLMADQTLYDNVEDAWLGERMPMLSAWPLASSGYGEVSHRTIAAED
                     NEDERVASTDANFVLGEYPGWESTHRMDQDLSRIYAGNVGDPACSVFSVSHGTHPREQ
                     GLMSASEEAFMVAAVHGFCVQENDRSFCTNASNLESSVVDMTDPYSRVCLKTSATATV
                     DRRCSRTDSQGTEPEEAWSPLFMAPAARSAARNRSGERMLQGNHLECTEAEQKRGSLT
                     HCQQFAQQTPGIQKVVGRTNASASAASEASHHQGDLPHAPSALSVADAVAHPLADGSA
                     PAASLWTHPSLRTNGERPVLTDLKELAPTVREIKHAGQLLASIPPLPLTREIPSISRI
                     IALVRNAHQSLSKLYALGVYRLAALMARFPPDVCCGIGEEAYIRAFVADQASCSICSA
                     QTAAAVHGRLDMQRAHSLALQGFYYDPCAYRRAVAAFRNMYALNELNTFAIDEFVRVF
                     AYDTRVALAKHRTVCQLHPVHSCHRDSTATVSMHQERSVGASTSESSSSSALRTRA"
     misc_feature    complement(1221230..1223528)
                     /note="repetitive element"
     gene            complement(<1224629..>1225795)
                     /locus_tag="CYME_CMR495C"
                     /db_xref="GeneID:16996892"
     mRNA            complement(<1224629..>1225795)
                     /locus_tag="CYME_CMR495C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538631.1"
                     /db_xref="GeneID:16996892"
     CDS             complement(1224629..1225795)
                     /locus_tag="CYME_CMR495C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538688.1"
                     /db_xref="GeneID:16996892"
                     /translation="MVGLFEDGALALEEGVQRRSRSLRNRIRALERLLRWENLATGAR
                     AAKIQELESLQRLLHRRKRQSEKDAITRKYLPIRKREERKLCNELQRLLEERPEDVPD
                     YDSKKAQLERDLEYVRHFPAGVKYVALFPKGGHSPRALKLIRRFRARIARQLREQVSS
                     GAADIPDKSPEKLTEALEGPRHAFSAPHNVASSGMRKRSHAVGAVLPPDAVSSLRSDI
                     RSRMHQRTNDLQRASRMEMSGDHEKLQDTVQARARQTLRSRSIDDHLPRVPGRRQAQR
                     KADEKSSLEQPEPPTRRCEPRAVATLPRVSYTDPLLEPDTDSETRDSTRIYRQSGDDE
                     DDALERHVFLARLRCPDDRPDRAATTRRSRGRGRILGSVEPGAYDSAAVPTGTV"
     misc_feature    1226047..1227661
                     /note="possible transcribed region"
     gene            complement(<1226192..>1228747)
                     /locus_tag="CYME_CMR497C"
                     /db_xref="GeneID:16997030"
     mRNA            complement(<1226192..>1228747)
                     /locus_tag="CYME_CMR497C"
                     /product="kinesin-related protein"
                     /transcript_id="XM_005538632.1"
                     /db_xref="GeneID:16997030"
     CDS             complement(1226192..1228747)
                     /locus_tag="CYME_CMR497C"
                     /codon_start=1
                     /product="kinesin-related protein"
                     /protein_id="XP_005538689.1"
                     /db_xref="GeneID:16997030"
                     /translation="MIRDRVPASRLRPPTPINTSLEGVGSLLLTRTGAASTVVERENK
                     APGNSDGEGGCKAAGSAPAASKEPVGQTVESRSETPVTEDTGKGAGPAASGLQLTSQF
                     PASLPHTSLPSESGPSQLSTFIEETRRRMEEQERRLQAMIRLHQKQLSSSAAPAGYNR
                     GQGAAAAEMEALHTMISSQKHLIDSLQLEKAQVVNALQTERLAKQMIEREVMELKNAL
                     QETERRMRQLAKELEEARSQQQHLSEKELGKLRALERDCAELEEALAAEKRQRLRIVE
                     EKDAEIARVRLQLEEESAEKIRQSIHKERVHADEVRQECERLRLHLAEKESEANAFRD
                     RVRLLETQMRENLERQSEHEQKCRQLDSDLLCLRNELRSAEEAKQAIEQALERCRQDN
                     AALKAACQSLETALQTIRAEKLSMEAMLGSHEQRFEQNDNEIMELRAKLADREQMVRE
                     LEEQAREDEKVRRELHNMVQELKGNIRVFCRIRPLLSEERQCNPDVLFQPVARSSGRG
                     LEVYAPCDQKRGSCFRTDRPSSGGEVASTAATHDRPRWVFQFDRVFDASSTQVQVFEE
                     ISQLVQSALDGYKVCIFAYGQTGSGKTFTMIGDRQNPGMIPLSVRQVFAHAARLSEQG
                     FTFSFEACFLEIYNEHIRDLLAKDNGSASTETSETNKYTIKVDRATGSTYVSDLQMVQ
                     VRNADDVERLLTISARNRMTASTNMNERSSRSHSVFRLYIRGENREMQQKIHGLLNLI
                     DLAGSERLARSGSEGERLRETQHINKSLSALGDVIAALANKDKHVPFRNSKLTFLLQD
                     SLGGDSKTLMFVNISPTAESFPESLCSLRFAAKVNACDIGTARRSQRVSFQEP"
     misc_feature    1228299..1228819
                     /note="possible transcribed region"
     gene            complement(1230092..1232195)
                     /locus_tag="CYME_CMR499T"
                     /db_xref="GeneID:16997032"
     misc_RNA        complement(1230092..1232195)
                     /locus_tag="CYME_CMR499T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461645.1"
                     /db_xref="GeneID:16997032"
     gene            <1232430..>1236284
                     /locus_tag="CYME_CMR500C"
                     /db_xref="GeneID:16997033"
     mRNA            <1232430..>1236284
                     /locus_tag="CYME_CMR500C"
                     /product="membrane-associated calcium-independent
                     phospholipase A2"
                     /transcript_id="XM_005538633.1"
                     /db_xref="GeneID:16997033"
     CDS             1232430..1236284
                     /locus_tag="CYME_CMR500C"
                     /codon_start=1
                     /product="membrane-associated calcium-independent
                     phospholipase A2"
                     /protein_id="XP_005538690.1"
                     /db_xref="GeneID:16997033"
                     /translation="MAFVTFGVVSGGTGRQPLADRSPAFLNQHPRKTSRSVRCRRRRF
                     SRKVSRRCLLKLCSVAERQSSDSVRREQGQKRGSSSSASSRDERYARNAAEQRQASDS
                     VSTETRARVSRALLQGAQGVGLGLYWIARQAVRVCVPMARSAFSQLSTLVQDHSSRAF
                     TSVGVQSQPEPHHKPYVASEADEAARARPNDTAVGADRAQRRSNHKKRGPRSGPPSGA
                     NAPEQADEMSARLRRKYLRSFGSIPEVVLFDLVAECEMRKQFALPEETPSNMSLLGQR
                     ACYIPYELQRIIFDEILTPDFAASDADRDLFQSSNTSIPLGAKHTLRATDGSAASTPR
                     APEVAVPVPVHIMDSLVAAVAPWSAGTGSPGSAPKAANSPNDWSQTATAPRVGVQGES
                     PASTSNLDDMVPAAAAAAAAAAGQVSVDSSARRGSMLYIPISALGSLWQAISAMSAGG
                     RKRREEAQRIRTYSNAADAMAREDAVMAGLAGADGGSTMASAFATASAIMASTPTRSP
                     SIPVQGAEAGTTASTRETEQKASRPTNGSVESIEVLSRPQASAANLGNQQKRDRTESK
                     EGTGAKQSAPVNPSSASAASAAATSTEVAAADAAESPLSKDKTRNWWSTLFSFTWPRP
                     RNAVDSGSATATNSEDHAIESIQRLLLSRHYGAGAGHGPVDAAVFDELVDRVEQLTLR
                     AAAEAAMAIRTRKQAIAFLEEVGVAPLLNALSMTDSLQLSRPDAGRRRNSNSNTNLDD
                     ETASQRKRPQQEQQREAAFTVSLAVAALANLTNVLPRCKPQILRYPGLLDGLLRILEA
                     PVAGESWEMQGKWSACMLIGTLMMDAATSDRALFFRNRRLVRVLESMAGGTRVGYPED
                     VARASRRALACLGVHHWRPRVRGQRGLRILALDGGGTRALMSFEILKHLTKLTGCQLH
                     EMFDIICGTSTGAIIAGSLGIRRRPVEEVESLYRELIGKIFAKKLSSAPKMLLTRAYY
                     DTDLFESILKREAGSLRMIDSTMDRDMNYVFFVSSVMNRRPHQLHLFRNYCHAPGQES
                     RYPGTVDATLWQGMRASSAAPTFFSEIVLNGLIHADGALVANNPAGVAAHEARRLFPN
                     VPIELLVSVGTGVAEKTSPLSPLSTTDSGVSTGTREGSGGDGGASTESEAASALREAA
                     TTSAISASGGDGADAAAAAVPSRMSWNDVINSIVDSAVGTESVHHILEDVLPADVYFR
                     CNPEISVMNIDEVRPGKLMEMIRCAQDYIAANADRFDELAARLRPKMPQNLLERIRFE
                     LQQEASLILDLDDAREGPLPAL"
     misc_feature    complement(1236288..1239071)
                     /note="repetitive element"
     gene            <1239368..>1240030
                     /locus_tag="CYME_CMR502C"
                     /db_xref="GeneID:16997034"
     mRNA            <1239368..>1240030
                     /locus_tag="CYME_CMR502C"
                     /product="unknown cupin family protein"
                     /transcript_id="XM_005538634.1"
                     /db_xref="GeneID:16997034"
     CDS             1239368..1240030
                     /locus_tag="CYME_CMR502C"
                     /codon_start=1
                     /product="unknown cupin family protein"
                     /protein_id="XP_005538691.1"
                     /db_xref="GeneID:16997034"
                     /translation="MLRKVSLVFLVTLLYVLAAVVSKPVRGLSQSSTIAELLAASPSS
                     YLQNALTSGAFLVNNSAGSIQLFDVTQNSLLTSVGLSTLISTLNKCGIQELHVQTDAI
                     EYAYVVEGEGTFTLWSSNGSVVLLKAPLKPGDVAIIPAGWPHFFTGSETSTTPLVFVS
                     TFTSGEPQVYFLAGAGNLFANVPSEVGSSLFNVTASQYGSFFRAESTVGVVFNETCLG
                     NA"
     misc_feature    complement(1240169..1243382)
                     /note="repetitive element"
     misc_feature    1243872..1245091
                     /note="pseudo-gene of NADPH:protochlorophyllide
                     oxidoreductase"
     misc_feature    1245420..1246757
                     /note="pseudo-gene of trefoil factor"
     gene            <1247556..>1249754
                     /locus_tag="CYME_CMR506C"
                     /db_xref="GeneID:16996733"
     mRNA            <1247556..>1249754
                     /locus_tag="CYME_CMR506C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005538635.1"
                     /db_xref="GeneID:16996733"
     CDS             1247556..1249754
                     /locus_tag="CYME_CMR506C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005538692.1"
                     /db_xref="GeneID:16996733"
                     /translation="MRKRYFSIVRLLVVVLVVSSTHTVRGVLSSEDTFLWTWIGGSNS
                     TGSSGSYGVQGVPNTSNVPPARYGAVFWTGADGVLWLFGGGSDLRDVFGDLWNYNLST
                     FSWTWVGGSASLNSAGVYGSRGVPNKSNNPPSRTESASWSDSYGNLWLYGGWNFISAY
                     SDLWMYNVSSGEWTWVQGSNETNVPPTYGPLGKSASSNTPGGRYQPATWVGLDGQFYL
                     FGGFNPSGSTYGDLWQYNPANNEWSWIGGTQQQNPSGSYGKFRQASPSNYPAGRLGAT
                     SWRDLDGNFWLFGGFGQIETFGRLNDLWLYNISSREWTWMSGNDSVGLDGEVYGEKGV
                     PSSSNTPGYRSFSSGFLDSTNTLYLFGGVSRAVCNDLWTFNITSLEWTWVDGDNTTDG
                     AYSYGELNKTSNTTLPPPRYGAVLWDTYQNDPVLFGGLGNSGLLNDLFTLYIATPTPA
                     PTPTPTPTPTPMASPTPSVTAEPSATTNVTQTAVGEGSAVCFPADASVLIDGLGNHLQ
                     ISELRSGMAVMGVNGRGQLVEDSVLGWLHNEAGATAEILAIKTLSGKQLRLTRQHLVY
                     RMIEHSRDFYGMTTAFSCISQKQQQQHQKHIRQSLELDTSAVEAVFAEEISVGDALLD
                     VAAHLPDPVVAIETFVTHNGLYAPLTRSGRFVVDGVLVSCYGTYASHAVAHAVLWPAR
                     VNALRKVWGSGLGTEGIVGIMPYAERLYHIWTSAARVLTEARISVVVAAC"
CONTIG      join(AP006500.2:1..1253087)
//
DBGET integrated database retrieval system