GenomeNet

Database: RefSeq
Entry: NC_010145
LinkDB: NC_010145
Original site: NC_010145 
LOCUS       NC_010145            1282939 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 19, complete
            genome.
ACCESSION   NC_010145
VERSION     NC_010145.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 1282939)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1282939)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006501.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1282939
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="19"
     misc_feature    463..3418
                     /note="repetitive element"
     gene            complement(<3521..>5401)
                     /locus_tag="CYME_CMS002C"
                     /db_xref="GeneID:16997499"
     mRNA            complement(<3521..>5401)
                     /locus_tag="CYME_CMS002C"
                     /product="copper-containing amine oxidase"
                     /transcript_id="XM_005538636.1"
                     /db_xref="GeneID:16997499"
     CDS             complement(3521..5401)
                     /locus_tag="CYME_CMS002C"
                     /codon_start=1
                     /product="copper-containing amine oxidase"
                     /protein_id="XP_005538693.1"
                     /db_xref="GeneID:16997499"
                     /translation="MHPLTPLTPAEILRAASIGRQGAPFPEEPLFERIQLHEPPKELW
                     VAGKPTEREAEVFIFRRSSIGVWKLIVSLSQEIVIAKKYYPNARPMLQLEQFTAIEEA
                     VRACPEFQAACRKHGIEDMSLVCIDPWSAGAFGSVEEKDHHLALAFCWVRNHADDNLY
                     AHPVEGLYAMVDVLGNKVLKVYDLQNIPVPRTECNYEPNLRTDIRKPLKPLRIVQDQG
                     PSFVLNDHTIAWDQWSLVIGFNAREGITLHDIRFAGRPVARRLSLVEMVVPYGTPVEP
                     HFRKNVFDIGEYGIGKLANSLRMNCDCTGCVVYMDAHIATMHGEPLTIPNAICIHEED
                     AGLLWKHWDFRTDRAETRRGRRLVISSISTVCNYEYASYWYFRQDGAIEYEMRATGVI
                     STVACEPGRPSRYGTEVMPGVEGHIHQHYFCVRMDLSVDGDRNSVVECNTRAEDAAAN
                     PYGNAYYVTETLLRTELEACRCANPASHRYWKVLNPNKKNRVNMPVAYKLEPAHTLTS
                     FLDPDSPSGQRSGFIRRHLWVTAYDPEERFPAGEFVNLSDGQDGILRFVSQNRCIEDT
                     DLVLWHVFGIHHLPRPEDFPVQPAMSTGFMLQPYGFFDENPAITLPRSSDASQSGCRA
                     CG"
     misc_feature    5595..8479
                     /note="repetitive element"
     gene            <8580..>10091
                     /locus_tag="CYME_CMS004C"
                     /db_xref="GeneID:16997298"
     mRNA            <8580..>10091
                     /locus_tag="CYME_CMS004C"
                     /product="plastid division protein FtsZ2-1"
                     /transcript_id="XM_005538637.1"
                     /db_xref="GeneID:16997298"
     CDS             8580..10091
                     /locus_tag="CYME_CMS004C"
                     /codon_start=1
                     /product="plastid division protein FtsZ2-1"
                     /protein_id="XP_005538694.1"
                     /db_xref="GeneID:16997298"
                     /translation="MNHRTPLSARGEARAAYAAFVPATGTVWSASRHRSLGRSYFTAS
                     RPGTLQPHCSSRGKRHNVDWLRSAMRVQANGASYPGRGNDRQLSSLPLSSDSSAPPCL
                     IKVIGVGGGGGNAVNRMADTGISGVEFWAINTDVQALKRSAAHHTLSIGNKLTRGLGA
                     GGNPEVGRKAAEESCDQIAEAVRGADLVFVTAGMGGGTGSGAAPVVAEAAREQGCLTV
                     GVVTKPFAFEGRKRMNQALEAIEALRESVDTLIVVSNDKLLQIVPENTPLQDAFRVAD
                     DILRQGVVGISDIIIRPGLINVDFADVRSVMAHAGSALMGIGTGSGKSRAHDAAVAAI
                     SSPLLDFPIERAKGIVFNVTGGEDMTLHEINQAAEVIYEAVDPNANIIFGALIDQQME
                     SEISITVVATGFPQPNESANSGGSSSTLNATANEFYQAGAAPSSPKLGGTSRRGGIAA
                     DTATHFGRDAGARRPAPGPQVPPPNRQVTPPPPQPGPSRTIGNIPDFLRRFQK"
     gene            complement(<11335..>12297)
                     /locus_tag="CYME_CMS005C"
                     /db_xref="GeneID:16997299"
     mRNA            complement(<11335..>12297)
                     /locus_tag="CYME_CMS005C"
                     /product="similar to human p47 protein"
                     /transcript_id="XM_005538638.1"
                     /db_xref="GeneID:16997299"
     CDS             complement(11335..12297)
                     /locus_tag="CYME_CMS005C"
                     /codon_start=1
                     /product="similar to human p47 protein"
                     /protein_id="XP_005538695.1"
                     /db_xref="GeneID:16997299"
                     /translation="MPFKTLADLQKDEDVEEDGSDNEYYAGGESSGQTIRGNPAQDPR
                     RNSAARQSGSSRHRLVSAILDRARQQLGQPQVADAGSAARPSGAFHGTGYRLGDTESP
                     GSDAYEPAGAPTPARTRIVTKTITFYRNGFIVDDGELRRLDDPAQAAFLADIHAGVVP
                     RELEEPDLSELSVNLVDRSFEDYTAPSDKAAASRRRPFEGGGYRLGEAAEEPPKEPAA
                     TSQRTANTCTSDVVEPDDLDPDAPTTQVQVRLADGSRLVMRLNTTHRVRDLRSLVCSH
                     RADYAGTPFVFQTVLPRRTLEEESQTLAEANLLNSVVVQQLQQQ"
     gene            12417..14463
                     /locus_tag="CYME_CMS006T"
                     /db_xref="GeneID:16997300"
     misc_RNA        12417..14463
                     /locus_tag="CYME_CMS006T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461646.1"
                     /db_xref="GeneID:16997300"
     gene            <15136..>15990
                     /locus_tag="CYME_CMS007C"
                     /db_xref="GeneID:16997294"
     mRNA            <15136..>15990
                     /locus_tag="CYME_CMS007C"
                     /product="similar to 4-methyl-5(beta-hydroxyethyl)-thiazol
                     monophosphate biosynthesis protein"
                     /transcript_id="XM_005538639.1"
                     /db_xref="GeneID:16997294"
     CDS             15136..15990
                     /locus_tag="CYME_CMS007C"
                     /codon_start=1
                     /product="similar to 4-methyl-5(beta-hydroxyethyl)-thiazol
                     monophosphate biosynthesis protein"
                     /protein_id="XP_005538696.1"
                     /db_xref="GeneID:16997294"
                     /translation="MRVATHIAAFQASPLRSLRSLSVKGGSTTGLSCCSIASARQAEH
                     LSWRANVSTGCALRSQLLGRANPASSSAAPRTAHALRLLATVSAMTTKTALVAVANGS
                     EEIETVTAVDTLVRAGAHVTLASVEKELQVTASRGVKLVADLLISDASLRSKQFDAVV
                     LPGGMPGAEHLRDSQPLMDLVKRHLETGKLIGAICAAPAVALASHHLLNDVKATCYPA
                     PNFRAKLTSHAHIDDPVVRDGQFITSQGPGTAMAFSLALVEALFGHEQAEKVAKAMLV
                     TLPAVSKR"
     gene            complement(<17491..>18783)
                     /locus_tag="CYME_CMS008C"
                     /db_xref="GeneID:16997295"
     mRNA            complement(<17491..>18783)
                     /locus_tag="CYME_CMS008C"
                     /product="similar to 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase"
                     /transcript_id="XM_005538640.1"
                     /db_xref="GeneID:16997295"
     CDS             complement(17491..18783)
                     /locus_tag="CYME_CMS008C"
                     /codon_start=1
                     /product="similar to 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase"
                     /protein_id="XP_005538697.1"
                     /db_xref="GeneID:16997295"
                     /translation="METAPLLEQRYQAQTGMHQLARTAHRGRYTRIQPQTEAICAETR
                     ATDHRSTDAMENAGALSDETLPRRSAAGAALNGTTKGVDGCGFGGGDSDSCRKLVRNP
                     FVRRDRTFRVGTLVRLVFGLIVLLPIRLLLSVGCLVFAWILVFLVTLGVSRASLAAHP
                     LPRWRRRIVFGVLRFFSRFLLLVYGFWRVREFGDLGSRQNLSSGTLIVSNHVSFFDIL
                     YFIYAFAPAFVAKKEVLRLPFVGTIAAAMQSIFVDRERSRTGGTAELIRMRLTSADAN
                     AYPPLVLFPEGTTSNGDALLRFHSGAFLSGVPVRPLALRYGFWDFDPAFVGLTPWRLA
                     CILAQPWMSLTVHHLPLYEPSPTEMERPRLYAENIRALIARALQVECVDMGYRDRVQR
                     NLSRIGLHMVEVIPVERATERRDPEVAAEDDALRSALV"
     gene            <19107..>20369
                     /locus_tag="CYME_CMS009C"
                     /db_xref="GeneID:16997296"
     mRNA            <19107..>20369
                     /locus_tag="CYME_CMS009C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538641.1"
                     /db_xref="GeneID:16997296"
     CDS             19107..20369
                     /locus_tag="CYME_CMS009C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538698.1"
                     /db_xref="GeneID:16997296"
                     /translation="MRRFDLTVSQEPRGALWGVLHTRTGFVSTSGVFLERRPRQRACY
                     ATRGCSTSLHRAGVKMLAKPRSKGKKGSKRPAVGKPADGNAVQNANSNVTRETDHKAA
                     RADSTDSSPRTMPFSGPIAPYLLRSAGSLQQRSQSASSSEDAPGGAAPAAPSPATADA
                     SERPVSETATQDQKPSKVGKQTSKRNSSAKLSRPGTKKGTVSKETTASNSAAEARDPA
                     NVEVDTTSGAGEGDPDAASVLELVEAFRKDKRPKDRVLGNDESATGNTKPGKAKAAAD
                     LQRYLIRDVEQNPETGYDRVAAVLGKGRPSKRFLGTLLGPYLQNSHLVGLVTVLICTF
                     GYDAGNPLTNLSEDVRDKLRKGLLIVATVNLVMAVQAYIEARRRNQSPWFWFAKTMAL
                     GGLALGELLENVPLSSSSQPDPHERREQ"
     gene            complement(<23066..>24991)
                     /locus_tag="CYME_CMS010C"
                     /db_xref="GeneID:16997297"
     mRNA            complement(<23066..>24991)
                     /locus_tag="CYME_CMS010C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538642.1"
                     /db_xref="GeneID:16997297"
     CDS             complement(23066..24991)
                     /locus_tag="CYME_CMS010C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538699.1"
                     /db_xref="GeneID:16997297"
                     /translation="MFIGISAGVQAQRCSLSRVERQAQLPVQSGRCCYRRRGASRKRA
                     LRRCTSGSTLFGCALSSGPEQEPPLTASIHGKRAVGSASESAPDELTELRRLHELFCN
                     MVRRDLEQRYGKEVAEQWASVPPDEEINLDNPRFQRFLQELVENEGTLFANEPLASPE
                     DLALDQQVAAFLAEHAEKLGLDGPPKKAADFLPPRSTLRQALQQYRQQLGQTPGRDPT
                     FRRADWPPQVLSFEKPRLAHEAWNGWSCRYDVTSGSLIERKFLHHVRPSSLLPEEADL
                     VPLELESPETSSTERDSRYDWCMPFGTVVFPDGSYTGGVPAVHVESAVGRHYVPPAHT
                     PFELNFGFVIPSEQAERCGCSSGLLDVAVEYRERAAVAVRVRWLTPVSRATASTSQGW
                     RQASDAFSARMLGTSTPSTTNAAEQKATSVLERIQFPSEEESAFCIFPLYPQMPCCWH
                     ASQVSLEPIDSRPVAPETLSRFEVDLDRSSFEDPDLTGSDIQLLRTPRSMKLKGRKGR
                     LGRTIEALLAREAARTAPCTHRLRRSIARFETVDGLYVVNGDSVCLVPNVEEGFVARR
                     LLHLPGGLVCMFPERIPRMGFVWDSELWFWGPAVEKQLEESQTDRVSLSKTSFRRILR
                     SYSALGDFVAGCATLGA"
     gene            <25495..>27717
                     /locus_tag="CYME_CMS011C"
                     /db_xref="GeneID:16997278"
     mRNA            <25495..>27717
                     /locus_tag="CYME_CMS011C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538643.1"
                     /db_xref="GeneID:16997278"
     CDS             25495..27717
                     /locus_tag="CYME_CMS011C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538700.1"
                     /db_xref="GeneID:16997278"
                     /translation="MVRLSQTAAGRKRRRGNAGGRDSAYSSDQVQVVEHEIPLAPGEG
                     IIGVTTSSGADLVVVRENGLIEWRSPRYRYHAESVLAAHAAVRGNRTITAAAFLAVPG
                     GLLLALGDAQGQVHFYDALQAVLLESVWTTRGTAVASLAFRPLGERLEEEAVIACASK
                     DGKLRLFRGPAAVGDAYHAARGVMQAAWYLERTLLIAPNVPLQCLDWSRSGDAVAVGT
                     ADGQVRLLSLPSGKSETIALLKSAGKALSIESLSWNGAETGGFLATGDASGRVLFWSL
                     DPWTRGKALAVCESFENCHGAITHLRILGANLVLFGSADGSVGFLQRLEARTPWFVSG
                     RPQRLHRRAVRTSCAVRPACSDAFGIATGADDALLCLISDLARHLESPEKVTRHGALR
                     APGQLRVSCWPSSEGSCFVADSPVERVLLQCKANTRCELCVDRYRFTTQALLAAGDNG
                     SASLTLGHPQGAFCLFVHTGGAALYALRKHRAERIPLSEKKAGILKGAMMGAAVHPDT
                     FVVLASDKIHLHVLFVQETNTTSQWKTRVRSLRLQQADACCLLGAGENELAVAYRSGV
                     VERFTLEISENHHPELRTQQRMLLSAPACALFLDSPRGALWTIDSDHILAENGEKKVQ
                     LPQPTVGCYYLLRGGPGSSLLAATRSCVLQIDVPSCGAYRSLYTCRDCIWGLNYASAA
                     NALLVVHGADSYAADLALDEALGRKRFGMERRFRGRHTYIMKSATARPRRARSSMIRS
                     "
     gene            complement(<28737..>30056)
                     /locus_tag="CYME_CMS012C"
                     /db_xref="GeneID:16997279"
     mRNA            complement(<28737..>30056)
                     /locus_tag="CYME_CMS012C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538644.1"
                     /db_xref="GeneID:16997279"
     CDS             complement(28737..30056)
                     /locus_tag="CYME_CMS012C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538701.1"
                     /db_xref="GeneID:16997279"
                     /translation="MEWATTPLLKVQRAAELSPAVLGPRLRSAHALCTFYHAEFQAVF
                     VVTETSIEAFRWNPELGWQDKLVDRRLCVVFECPERLRAERKQSGVVQLGGLAGARVL
                     RATAATYLASSNEVLVAHEDLSLRCYACESGELGFETRSTILVLDDQTTVPSPAEREY
                     VTKLHPLPSGAVIAGHVSGRVTYLDAAWHAGPLSLVAPERIRQWLGAAAPVAGVSALA
                     VQAPIPALVTTANAAASPEQARRNGTATEPVRESDSPLVVAVGYTAGFLLLIRGKLMH
                     PEIDFLGWMHCQEIVDVLFWQRWRCVCTASRPGEVALTSLDTGRTLHRQSLPFCCAFA
                     RAQNDDRLLVGGDAPVPVWISIESGASSTDIGQPGSAHQAGGVADGSETTPSRRLATG
                     LSRLSQRLAASMITMTTGCWATSASDFIFVTRSGQLAWLSTRTVSPS"
     gene            <31164..>33062
                     /locus_tag="CYME_CMS013C"
                     /db_xref="GeneID:16997280"
     mRNA            <31164..>33062
                     /locus_tag="CYME_CMS013C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538645.1"
                     /db_xref="GeneID:16997280"
     CDS             31164..33062
                     /locus_tag="CYME_CMS013C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538702.1"
                     /db_xref="GeneID:16997280"
                     /translation="MVLPTDPEFPFPIDALVRIELETGETLWVRTRTHDVVSKSDSNG
                     KSWTARLRWQQHSQRVVIRPNVRNPQHPVVTRMRDGKLVLWRQLESMPTRAACGNVAE
                     APVRPSRSKRRRTSSAPVSSAPQLKAQKSKEIAHEVKDSHDVESAAPGAAVATNTRAT
                     AVREAPRDETPEHMRRQRRCRTLPERPAASIATVPASAGSVSTPRISACIRETSRKNA
                     EEPSSARSTPQNRNASRMPRPIRKTESRCACASTRNPCPRLAKAPHANRKDLENYNLH
                     STAAAAAGAAAATGAPDTDLVERTDTETRMALLDELRHAHAAAAAATSSSMIHGHPVP
                     ATDRRSVKYGPHWRFAPLAAIAAHARSLATPGVVTGVGETACSTLSLLKLLAEDTRRL
                     VDEILILASGTDEAETTEPAKRLPDRDTTTETLGRILLAYAQALVSVAEAQAGSGESQ
                     NTVMHDLGKTALQALIQAERSGIREPHFRHALRTLIRGFVPATASADCVAAISAILEE
                     HLPSGRIERESHRLELLCQVVTLGPDLLALASVLRRASRNQTSHVLSAVACPDLRAPC
                     STKWYRQVVQLYEIGARTIANQLTGCWPAEDLQEHTADFLVNGAMQLPLLCTGNLSEH
                     DSTVAPVR"
     gene            complement(<33345..>33737)
                     /locus_tag="CYME_CMS014C"
                     /db_xref="GeneID:16997286"
     mRNA            complement(<33345..>33737)
                     /locus_tag="CYME_CMS014C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538646.1"
                     /db_xref="GeneID:16997286"
     CDS             complement(33345..33737)
                     /locus_tag="CYME_CMS014C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538703.1"
                     /db_xref="GeneID:16997286"
                     /translation="MSLKHTGAQCGRTQGSEVGLLCARCDGQCVTCEAVHALFEPARI
                     CADCALLLVEQPQRRGETPRCCRCNAPGAKYQAMFCRECVLLLKSRNGCPRNVAVLEN
                     RSGSAHRRLQRPQATGGIQHSAARAGDL"
     gene            complement(<34502..>35761)
                     /locus_tag="CYME_CMS015C"
                     /db_xref="GeneID:16997287"
     mRNA            complement(<34502..>35761)
                     /locus_tag="CYME_CMS015C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538647.1"
                     /db_xref="GeneID:16997287"
     CDS             complement(34502..35761)
                     /locus_tag="CYME_CMS015C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538704.1"
                     /db_xref="GeneID:16997287"
                     /translation="MPSRRYVFAMRSLGRQRGGTLFKETPSSLRQPVEPDNPLQFVIN
                     TCVYRGSLFSSASALRCLRGQHSHEAQRRCGVAKLSLRSEPHNEQRPLAVSEQRCVFR
                     CGTYQIIGDRPSAEQGTTFPGEALLLSGSTDTVFVCEGKGAVGLADCGHVLYATERGV
                     VRAAFAPIKDTRDVELAHMYTAQYHVRNILDGFIEQVLFSESEQDTARGRNWQPRFEL
                     LSCLRDAVTHMRPPEAVRSVSVLAACLANNGNLLYAVRTGNIGFLVIRDQTIVFSSLN
                     GIEGNPETQRTSITIETCTGDVVPIYLDVFRLRAYDTVIFGTDGLFDNISESQILALV
                     CPVSSAYDSNLAVANRTCLGTFTHIDPVLLSYQLAQLAHNFSSCTNCDPYISERMPRL
                     VCPGKGDDASVIVAQLEPESEPEPESP"
     misc_feature    complement(35915..38717)
                     /note="repetitive element"
     misc_feature    38510..41467
                     /note="repetitive element"
     gene            <44050..>44475
                     /locus_tag="CYME_CMS018C"
                     /db_xref="GeneID:16997288"
     mRNA            <44050..>44475
                     /locus_tag="CYME_CMS018C"
                     /product="thioredoxin-like U5 snRNP compornent dim1"
                     /transcript_id="XM_005538648.1"
                     /db_xref="GeneID:16997288"
     CDS             44050..44475
                     /locus_tag="CYME_CMS018C"
                     /codon_start=1
                     /product="thioredoxin-like U5 snRNP compornent dim1"
                     /protein_id="XP_005538705.1"
                     /db_xref="GeneID:16997288"
                     /translation="MDSAPLVPVLSSMAAIQQALAEETERLVALRFSSDPAAVDCVFM
                     DEFLARSAARVRRFAVVYDVDLRQVPQAARRFGVEAWRPLSLQFYYRKRLIKVDCGTG
                     DTARLTRPVPSVQQVVDLFEVVYRQALRGKGLAMAPFRL"
     gene            complement(<45360..>46529)
                     /locus_tag="CYME_CMS019C"
                     /db_xref="GeneID:16997289"
     mRNA            complement(<45360..>46529)
                     /locus_tag="CYME_CMS019C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538649.1"
                     /db_xref="GeneID:16997289"
     CDS             complement(45360..46529)
                     /locus_tag="CYME_CMS019C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538706.1"
                     /db_xref="GeneID:16997289"
                     /translation="MASEQPAGVEDPAQARDAATFNQSEERPVSALASQQRLPWQLRW
                     QRTFNALGGVVSRAHGGITEQFRALFARRMAAATPVLLFLGDSLTRRGLDINEYAGYT
                     SVGWGLRLVHAYNGAADCIFRGLSGYNTRWALPVVRHHLSDVAQERLLLVGIWFGAND
                     AAAPGTAQYVPLDEYASNVYEMLRLILERSHDASLTLTSERRPQRQQHGRTPPSLAAA
                     PAPDASEANEIESVRYPRVLLMTPPWVDEEARRRHIQSSLAAERAAPDAHQPSDSGQR
                     TESDRMCARTRQYAAACRRVAAQIRPRDRVLLLDLFTQIEQLPPAERSGLFIDGLHLS
                     DRGQRFVYDAILELIAREAPELSPSSLGQFAIPWCDINPVRPQEQLAVYDQQRWW"
     gene            <46743..>47204
                     /locus_tag="CYME_CMS020C"
                     /db_xref="GeneID:16997329"
     mRNA            <46743..>47204
                     /locus_tag="CYME_CMS020C"
                     /product="similar to glucoseamine-phosphate
                     N-acetyltransferase-like protein"
                     /transcript_id="XM_005538650.1"
                     /db_xref="GeneID:16997329"
     CDS             46743..47204
                     /locus_tag="CYME_CMS020C"
                     /codon_start=1
                     /product="similar to glucoseamine-phosphate
                     N-acetyltransferase-like protein"
                     /protein_id="XP_005538707.1"
                     /db_xref="GeneID:16997329"
                     /translation="MDETASYEVRELCETDLEHGFPELLAQLTQTGTLPLSFWRERYR
                     LRQQLPGTYVTLVAVESATKRVTATATLLIEYKFTRSCGQAGHIEDVVVDAAYRRRNL
                     GSRLVRELCARARDQFKCYKVTLDCVEENEAFYAKLGLERKGVQMVRYFRI"
     gene            complement(47135..50773)
                     /locus_tag="CYME_CMS021T"
                     /db_xref="GeneID:16997330"
     misc_RNA        complement(47135..50773)
                     /locus_tag="CYME_CMS021T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461647.1"
                     /db_xref="GeneID:16997330"
     gene            <51042..>52004
                     /locus_tag="CYME_CMS022C"
                     /db_xref="GeneID:16997331"
     mRNA            <51042..>52004
                     /locus_tag="CYME_CMS022C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538651.1"
                     /db_xref="GeneID:16997331"
     CDS             51042..52004
                     /locus_tag="CYME_CMS022C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538708.1"
                     /db_xref="GeneID:16997331"
                     /translation="MSLQTPPHYRRPQGMRSPLAYEKENVRLTPNNLTRMNESFATPF
                     KELANSPMRLEDKALLVKRIQEEAYKAKQLKLLNATLISRLRETTLELEGNRERLHQA
                     EQRVTHLDQQVKTLEAQLHDKDVDLVSVSKQLALQEQANRELQAYMRELEELRLEVVA
                     LRESKQQVLVDMEGLRFEKDHEMELLQNDMEKRQQARERELAELLETVATLRREQAQL
                     RSTLETIECKKNEVALTLDRMFGEVRVYREACQLRDQENQQLRNRNLELEGERTQLLL
                     EIERLGKQIEALRMDLETTRLKSTLYYKVRSLLGNLFTYFTRSN"
     gene            complement(<54507..>56885)
                     /locus_tag="CYME_CMS023C"
                     /db_xref="GeneID:16997332"
     mRNA            complement(<54507..>56885)
                     /locus_tag="CYME_CMS023C"
                     /product="similar to Golgi associated retrograde protein
                     complex component VPS52"
                     /transcript_id="XM_005538652.1"
                     /db_xref="GeneID:16997332"
     CDS             complement(54507..56885)
                     /locus_tag="CYME_CMS023C"
                     /codon_start=1
                     /product="similar to Golgi associated retrograde protein
                     complex component VPS52"
                     /protein_id="XP_005538709.1"
                     /db_xref="GeneID:16997332"
                     /translation="MGESLFSEEDFAVAWRIAQPEEPLAPLGKDALDDDLGRLLEKLA
                     RELDDAPQVERPLSLDTLQHVQELYLQYEQELRALESKLLQRVAADEPLLETTATELA
                     RCEGFFTDAEERLCQVLGQLDDRRRRLAFDEVESQRWNERVHTTREAAGHLQAFALEV
                     VLPPALVRRLTARPQIDEVYLEEVKRFRSKLAFASLPDVQRTAAYKDLRPILHELQRR
                     VVARLQAFLLGQMSRLEEPNTNIQILQQNMLLKYRYFIEFLQDVAPEAVESITQTYKN
                     TQSRVYLNFFRQYLDGLWALHEPDQNLEDTLLIPPSMSSSLGAVWQRLLPTATSFRLP
                     SMFTSSWMSNSKAATSTSGDRMRSAGTTAGSAAAGDRTAAGAATPSGLGQRLAVLEEL
                     AEPPLVLAVAQAEGRLIPPERIFWSVGRMLLTICSSERDFLADFFGPVESPTLEHVML
                     QARDYVAERFSEYFARTTDVVGLLLCTRIGQTQRDDARANGLALLEIFFSRVELAIIP
                     RLKEILDANETSLAQADPRLLFEISAAAYSAEQDPETELARRIHAVVQRYADYVQILL
                     TLALRVPSSDAMVLKSLHVQQREMHRILHGMAERFQTAQNRNAFLINQLGTIVQRLTR
                     VASSVQRERDPVTDAGLETLQEMKREFELELEACTNQLAAMVLMGSFGEFLTLASSKA
                     ESSPRANAPSTEHWRLVLAEFRSEWKAQLELVCKAIVRSFPNWEIGASVLRRSFQELR
                     RYNMNLQRLLPYDASSELGALLVDDAALVFEMRRYVKVGTAINAALVEEASD"
     gene            <58994..>60742
                     /locus_tag="CYME_CMS024C"
                     /db_xref="GeneID:16997326"
     mRNA            <58994..>60742
                     /locus_tag="CYME_CMS024C"
                     /product="prolyl-tRNA synthetase"
                     /transcript_id="XM_005538653.1"
                     /db_xref="GeneID:16997326"
     CDS             58994..60742
                     /locus_tag="CYME_CMS024C"
                     /codon_start=1
                     /product="prolyl-tRNA synthetase"
                     /protein_id="XP_005538710.1"
                     /db_xref="GeneID:16997326"
                     /translation="MEKPVADGLEGLELEKKQSHAPDSVALGKEKPARSAAAQGSVSA
                     ETKKRVERETKEGIDCRKADNFSAWYQQVVIKAELIELYDISGCYIIRPWAYAVWEKI
                     VEFFDAEIKKLGVQNAYFPVFVSERRLRTEQEHLEGFAAEVAWVTKSGSSELEEPIAI
                     RPTSETIIYPAMAKWIRSHRDLPLKLNQWSNVVRWEFKHPTPFIRSREFLWQEGHTAY
                     ADRSAADEEVLQILELYRRIYEELLAVPVIKGIKSERERFAGGLYTTTVEAFVPANGR
                     AVQGATSHSLGQNFARMFGVYYEGKDSGEKLMPWQNSWGCTTRTIGVAVMVHGDDRGL
                     VLPPRVAPLQVVIVPIIVKNAAANVSQVCEVLCLRLQRANLRVKFDDRPEKTPGWKFN
                     EWELRGVPLRIEVGPRDVQSKTITIARRDTMEKRSIQLVDWDALEADDSFGREIAKIL
                     DDIQKSMFERASAERNARIRCVASWEPFMKAIIERCLALTPWCAETNCEEQVRQRSMQ
                     DSVSYRERLANEVDPAAADTVLSGAVKTLCMPFASELERLRLVDRSEYEAPAPGKQCF
                     ACDAAAKRWALWGRSY"
     gene            complement(<61347..>61598)
                     /locus_tag="CYME_CMS025C"
                     /db_xref="GeneID:16997327"
     mRNA            complement(<61347..>61598)
                     /locus_tag="CYME_CMS025C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538654.1"
                     /db_xref="GeneID:16997327"
     CDS             complement(61347..61598)
                     /locus_tag="CYME_CMS025C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538711.1"
                     /db_xref="GeneID:16997327"
                     /translation="METETNVYDEVEIEDMNYEEDAQRYTYNCPCGDLFVLTVAEMRR
                     GEQIAKCPSCSLRIRVIYDVEAWCPSRAVPVCAPAATRV"
     gene            <62643..>63440
                     /locus_tag="CYME_CMS026C"
                     /db_xref="GeneID:16997328"
     mRNA            <62643..>63440
                     /locus_tag="CYME_CMS026C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538655.1"
                     /db_xref="GeneID:16997328"
     CDS             62643..63440
                     /locus_tag="CYME_CMS026C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538712.1"
                     /db_xref="GeneID:16997328"
                     /translation="MVLFEIEYRVRLPREEMWSLREDPEFLRWQYEHSSDMSNLEIVE
                     KNVDAADPDRITVTWRITPSVPLPQFVLAYVGEGAGIYIEDVHEYRLSKPYYINFRSH
                     PNMFQEYTETRGECEFVDEPADSADAQAGTRVCIRGEVIVNVPLVGPYVENFVVNNLR
                     NFYTGFPDLVHSYVAAKNGRLNPDDSQMWLNPESSVHVQPNTAEANEASAIHGAGADV
                     APALAALQRSLPPSVDASLASVPVASGAPEAIPESIQAPRRSWWPWQ"
     gene            <65861..>66799
                     /locus_tag="CYME_CMS027C"
                     /db_xref="GeneID:16997333"
     mRNA            <65861..>66799
                     /locus_tag="CYME_CMS027C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538656.1"
                     /db_xref="GeneID:16997333"
     CDS             65861..66799
                     /locus_tag="CYME_CMS027C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538713.1"
                     /db_xref="GeneID:16997333"
                     /translation="MIGAAAAAAACVRHPVNACGHACRSANGICGWLAGWLVLLRTRA
                     FTQLFTPRCRALVSPSGMRSLQRLLPVWRQKSAVESVVIAPLVQWRRRLAALAMLERE
                     LPQYLDLDSWQMTLAQFIQSQPRRAYTISPESTVFEAVQKMVAHNVGAVAVVEPDAND
                     AARQAQRLVGIFTERDYLRKIIVASKASKTTPIAEVMTQDPVCVTPQQRVGDALHLMT
                     ELDIRHLPVLESLPNGSLLTMVSMRQLMREVAASHEKQVSALMAQLRKLSLLVVDDRS
                     PGDGAATLGPASSTTPNTRTIHTGSDRLSLKSWWQR"
     gene            complement(<67293..>69458)
                     /locus_tag="CYME_CMS028C"
                     /db_xref="GeneID:16997334"
     mRNA            complement(<67293..>69458)
                     /locus_tag="CYME_CMS028C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538657.1"
                     /db_xref="GeneID:16997334"
     CDS             complement(67293..69458)
                     /locus_tag="CYME_CMS028C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538714.1"
                     /db_xref="GeneID:16997334"
                     /translation="MEALPDGGGGLTQGALRAAAVSKQHAAALGGLVAGDAPLSPDVG
                     MESVASSFQVHDGGKSSEKSEPGADTVGSRATSPSQADSDSLGGGAEPATIFRNLPVN
                     HATLKMLQEDVSQLSEEEANMHVTIWNRAELRKIAGNAAPLRRNLRKYLSRHPECEVF
                     DGQDERLDPEVRASMVDNEHVPIWHRIERRKVTGNAAPLRKNLAKYLAKHPECEVYNG
                     QDRVLAAVSTDADTTQVGAHSSALGIMGDRLMGRPVLGAVGTGPHSESAFSTSTSADF
                     SNMNMRPRAGDAPAGGARTMRSSQPMPVGTSGMHTNPDSRHILVANPVRGDTRALSGL
                     GTVFEGGADHVSVHFSYMHRDSSPIETAEMSFHQGLPQSLAQMTAGSSPLYFNPYGSP
                     AADTNNAGSIGHYHNTMAMVAAANGQTSAHIQGVMAMHPTGASSPPSGMSYEQTMPWT
                     THPMHSFGTNTGWLGGGNHSGFPTGTSSLLGSSPRDYLYTGRTPEYWKSISTSANAAA
                     AYFVMPQPLDSDPPMSEDERKDVTYRGTRLAEAPASALVPMDALEQCSTDMSCTAGRG
                     PALRGEHAGEAHRTAAGGITGESALHSQRAMPHIDDTSRSSASALDASTSRFGTGAAG
                     TGAGAAGASAALLPMADASEFELSPGNLLMLSSSPSDGARLETKPTTSRSKAQWKAPS
                     GGLSSAGSARTTAASADTGAPVPGVSAMIPPRPRHPANR"
     gene            <70802..>72055
                     /locus_tag="CYME_CMS029C"
                     /db_xref="GeneID:16997335"
     mRNA            <70802..>72055
                     /locus_tag="CYME_CMS029C"
                     /product="similar to RNA guanylyltransferase and
                     5'-phosphatase"
                     /transcript_id="XM_005538658.1"
                     /db_xref="GeneID:16997335"
     CDS             70802..72055
                     /locus_tag="CYME_CMS029C"
                     /codon_start=1
                     /product="similar to RNA guanylyltransferase and
                     5'-phosphatase"
                     /protein_id="XP_005538715.1"
                     /db_xref="GeneID:16997335"
                     /translation="MRYLPLPLVCEIASRRWRVWRAHTRSSVNWIAKPLYLGLSLVLI
                     SCVWWLLSHQVNLAACWQRYRHASAPYQRLDVKQVDTPRIAIVTGATSAFLNRFSLAI
                     TNKQCFARLHGYEFIIDIRDWSEVHGKSDYWNRLWFLMEYVQACLGGNSCPDWIFYVD
                     ADAMVMNTSIPLSAFTDAVSEDIDLVLHDGADYINSGAFFIRPTEWSLAFLEKWRAQA
                     DEPQTLADQSALWEVLLELADAHAQVDASLQPSPAVVARYTGACKPQQLHRGTPDENC
                     FTWDTCRCKRCLRRAERCWREEMRRLGHPYGQRRLPKVHFWSPDGDWTTNWTKPWPRG
                     FNFYASVGHWGNVERCHPAQLWRLGDLLVQDAKGLGQAYATWWDAFRCPTTMTTEQLL
                     VHLEASRGPTHQQLWGPSGRFQGSR"
     gene            complement(<72562..>73569)
                     /locus_tag="CYME_CMS030C"
                     /db_xref="GeneID:16997336"
     mRNA            complement(<72562..>73569)
                     /locus_tag="CYME_CMS030C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538659.1"
                     /db_xref="GeneID:16997336"
     CDS             complement(72562..73569)
                     /locus_tag="CYME_CMS030C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538716.1"
                     /db_xref="GeneID:16997336"
                     /translation="MEESHAAAFACGHALANTRSRVTGMELALVYERVHTATTLIRCP
                     LRRLRRSAVTPGHSGARLTPRLRHQRAGRERRLDMNVTWAPSSGRALTAVLVNGALWA
                     LGFVSRQRALTQAGLLHAAALGTLLWASLGWAGWTTCLLFLVISSIATRLKQDRKEQL
                     GIAEKRGGARGPENVWGAAAVAALCALLHVWLPGTGASARWKALARLGFLTSMATKLG
                     DTLATEIGKAYGRKTYLITTMQEVQPGTEGAISREGTIACAAGILILTLFGAASRLIP
                     FQANALAICSVSAFSATLIESVIGATLQRRYPWLSNEAVNVLNTAIGAVLAVIVGALV
                     L"
     gene            <75452..>76015
                     /locus_tag="CYME_CMS031C"
                     /db_xref="GeneID:16997364"
     mRNA            <75452..>76015
                     /locus_tag="CYME_CMS031C"
                     /product="similar to peroxisomal membrane protein PMP22"
                     /transcript_id="XM_005538660.1"
                     /db_xref="GeneID:16997364"
     CDS             75452..76015
                     /locus_tag="CYME_CMS031C"
                     /codon_start=1
                     /product="similar to peroxisomal membrane protein PMP22"
                     /protein_id="XP_005538717.1"
                     /db_xref="GeneID:16997364"
                     /translation="MATFWSKYTQLLAEKPLQVKTMTSFIGFTIGDLVAQIPALMDGK
                     PWDAARTARMASFGLVLHGPIGHYWYEFLDRTIMPQASKSTAAVVSKMAIDQLLWAPV
                     FTSLFFSYMQAAEGKPERAPEVVREKLWPTLKVNWTVWPLAHLINFRFIPSSQRILYI
                     NTVQVGYNAFLSTMAAAKTSVPVEKTS"
     gene            <79134..>82631
                     /locus_tag="CYME_CMS032C"
                     /db_xref="GeneID:16997365"
     mRNA            <79134..>82631
                     /locus_tag="CYME_CMS032C"
                     /product="similar to nuclear mitotic apparatus protein"
                     /transcript_id="XM_005538661.1"
                     /db_xref="GeneID:16997365"
     CDS             79134..82631
                     /locus_tag="CYME_CMS032C"
                     /codon_start=1
                     /product="similar to nuclear mitotic apparatus protein"
                     /protein_id="XP_005538718.1"
                     /db_xref="GeneID:16997365"
                     /translation="MADIGEPHDQEYASHPWRPLGSERWNQSLSPIEKDTPKPPGAAE
                     EAGQTYWRNFLQTPSSIAQLSPEALDETAQSEAVVASNGALGTVESRQEGDTAADLVH
                     GANSVAASSARRSNAPHPRKSAENIGEESIENGVSSELSRTCSTLEDNASGSREKALE
                     GLGSPHTRRTGTRGDFAPSMRTLLDAGVERTPRPSSPPTPPSPTTPHLAMRHMQQEIE
                     RLKKQNFNLKLRIYFLEEALAAAGIDYRAIDGTAPTGARKLNDDSTVSQCGAIDFDFD
                     SIRLELEAKEERLRSLQAELEERLADLEERDELLQTAREAIMGLQEALQDAQARIQRA
                     EEQALEAAKKSSASGEALPSPPPQAGDCQTPTPVNLDAAIREALASTEAAFREEIQRL
                     EEQIRIRDEQIRDLEQEICSVRDSKDEEIRGLQEELQAAIHEREKGIDVGHVPADASH
                     VVEREQRSALESHLAEAEKRIEQLSLEAKHYQSLLKESDEQRTMLQRALEKATTHAAR
                     EPAVQTELQERLTAAQKERDALASALEAVRTEQATSNERVAAAEDACRHAEQRCRELE
                     STLTRTTSDAMERVRRLVEAHEKEREHWQLTEEQLRHRESAEREELHHAQKTLKETQE
                     KLAAECRSHAQLSLEHAQALGHIEHLQARLEAGDSELDALQARLKSIELESQRQQEEL
                     ELCQSERDELAEKLHEAIRRIATLERELQAKAPAGEHSTAATEANVKKPETGNYLSHS
                     SGYETLKAASAPPSTEENERNTTRAAESHAAAVQAEREPQDQHVERLRAEFMHYQSRC
                     RSLEEMIADRDRHIHQLCMELSQSITREQQLQDQIREVTMRTANARPPLSAPAATATP
                     SAGNGAGGRKAADGAPASTDVLHWDAIHRDIRTLHEDIRFWREEVRHFCEQLVSLQRF
                     QGPRPEASVPPPTSTPEPHLEKKAPPALGETPPKPAQNSWERTLHGLEQRIERVMRTV
                     DRLAQVRGRDAASEPGSPCAPEATQAVPDEVPQPAPPSRSQAVAAKPPAAAQASRQKT
                     ETRRRPKHHDHDASAWRAEELDTDEPSIALDQVPDDLQVSREMIHFMRTRHHRRRVEA
                     PEPAVQPVSAPKQNDAIAPTQNKLSKQAWQDAILRQVEETQRVIAATQKRLERERAAF
                     LRRTHTQSAARTTDDLFSA"
     gene            complement(80579..83056)
                     /locus_tag="CYME_CMS033T"
                     /db_xref="GeneID:16997366"
     misc_RNA        complement(80579..83056)
                     /locus_tag="CYME_CMS033T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461648.1"
                     /db_xref="GeneID:16997366"
     gene            <83363..>85114
                     /locus_tag="CYME_CMS034C"
                     /db_xref="GeneID:16997370"
     mRNA            <83363..>85114
                     /locus_tag="CYME_CMS034C"
                     /product="probable structure specific recognition protein,
                     recombination signal sequence recognition protein,
                     chromatin-specific transcription elongation factor"
                     /transcript_id="XM_005538662.1"
                     /db_xref="GeneID:16997370"
     CDS             83363..85114
                     /locus_tag="CYME_CMS034C"
                     /codon_start=1
                     /product="probable structure specific recognition protein,
                     recombination signal sequence recognition protein,
                     chromatin-specific transcription elongation factor"
                     /protein_id="XP_005538719.1"
                     /db_xref="GeneID:16997370"
                     /translation="MSAAQVIDPVYVTDQSLGPGSLRLSKAGLLWSPRNEGLYTISVA
                     REDLASLRWFRGARGDQLRCTRKDGSTVNFEGFRPADRATLEEYVKEAWAWTKGVPRG
                     EQGVVGWNFGQVRIEGESVLFVSGSETAFELPISDISQVVRSGRNELALEFHLDDTAG
                     KTDECLVEMRFQAPTEEDAIALHAELSARVGSASFMGESLVFFEELPFIVPRGRYDLE
                     LFPTYLSMHGKSFDYKILYKTVRRMFLLPKPDEIHLALVISLDPPIRQGNTTYPHLVL
                     QLRRDDDEIEVALNMKPEELQKRYGDKLPPKISGELWQVVTKVLRVLVDKPLHAPKNF
                     VTSQGAHALRTALGANDGYLYPLENCFFFVNKPPTYLRYEDVDFVEFKRLEMDRRFDL
                     QVVMLNGSTLLFTNLERSEFSTLYQFLESKQVRMVGIPPALLRGATTGKTSMRAAAVR
                     AEMAIAAEEAARREADGEDDEEADDQDTKYDGKRDPQTFDDEDDEEDEDFAGDVEDES
                     DGAPSDSDAARDDDDDDDDDDDDDDDEALEAELEPEEPLEQVTEEDQSQGDPESTSAA
                     AAAETGHATDLEKALHS"
     misc_feature    complement(86029..86809)
                     /note="possible transcribed region"
     gene            <87011..>88294
                     /locus_tag="CYME_CMS035C"
                     /db_xref="GeneID:16997206"
     mRNA            <87011..>88294
                     /locus_tag="CYME_CMS035C"
                     /product="ferrochelatase"
                     /transcript_id="XM_005538663.1"
                     /db_xref="GeneID:16997206"
     CDS             87011..88294
                     /locus_tag="CYME_CMS035C"
                     /codon_start=1
                     /product="ferrochelatase"
                     /protein_id="XP_005538720.1"
                     /db_xref="GeneID:16997206"
                     /translation="MFVVVPGNAWRLPRPRGGLHRRPTWRLSLIHGSEDGQHALTSSG
                     TARNAASPATSTTATATTARVANRGTAGSASFLEPRFQGRTGLILVNIGTPASLNVAD
                     VRRYLREFLGDDRVVDIRPKWLKTILLQVLLLTRPAKSAEAYANIWDKETGSPLLHYS
                     QELATKIQKRVGNGYAVAVGMQFGEPNLVSVMHDFRRRGIDRMIIVPMFPQYASSTTG
                     SASEMAYHTASKLYSTPYLHIVPAFYDHPAYIQAYANVIERVIGPRGSRRVDHLLLSF
                     HGVPEKHCQQTDDTGLVCMQQEHCCSALVQANRNCYRAQCFATARALAQTLGLAPHEY
                     SVSFQSRLTAAGPEWIKPYTDEVLTILPKQGVRRLAVAIPSFVTDCLETLEEIGMQGR
                     EEFLNAGGEEFYLVPCLNDSQEWADALLRIIEDSC"
     gene            complement(<88521..>91427)
                     /locus_tag="CYME_CMS036C"
                     /db_xref="GeneID:16997372"
     mRNA            complement(<88521..>91427)
                     /locus_tag="CYME_CMS036C"
                     /product="similar to syntaxin-binding protein, UNC-18
                     homolog"
                     /transcript_id="XM_005538664.1"
                     /db_xref="GeneID:16997372"
     CDS             complement(88521..91427)
                     /locus_tag="CYME_CMS036C"
                     /codon_start=1
                     /product="similar to syntaxin-binding protein, UNC-18
                     homolog"
                     /protein_id="XP_005538721.1"
                     /db_xref="GeneID:16997372"
                     /translation="MPIDVQVPAVSSPVFDLGPVDDDSVLQPGIRSLVRERFHRLVIQ
                     ASLKRLREIERARTGVRSTEHPQPVDAQREWMLLVLDRYALRIVSAAMRLSDLLNEGV
                     ALVERLELPREKFPRMHAIYILRPVVESFTYLSKPSRNEYAAIHVYFTRDASSLAAQL
                     PGLGRPLAPEAGASSLQYVFPESIRDRVVASVDLDLDFLALDERYFSLDRPFGALHRL
                     YCPDQGSMVNEMQTQVEQLVSLCCTIGARPLIRFAVDAPLSKWMAHQLERALATHARA
                     RALPHSADLNKQVSLRTQRSQARRMLPGGGAAEASRTPVPWTLLIADRSYDPLAPVIH
                     EFTYQAMVMDILADEIDRSHAGGARLRHPFFDSSGREQSREVVIDDVENDALFRSIRY
                     LHMADAIPALTSAFQRFLDTNPAARLQMTKARKDDADGNANSGGTDGLDKTSASSPGT
                     QQINLKQLGAAIRALPQYREQLSAFSLHTYLAGQCMRAFHERHLEEVASLEQDLACGR
                     DLEGHRVRREALEQALLRLFPDIQRTERPSSTRDKADASKAPQAIALPDSERVRLVLI
                     AMLAKYTGQCESAALFDERMMMQRARVSSGSVEHLLNGAKTLVSFRAPVNEYAPKNWW
                     KRRQWRRRERKLHRMRMQQADVPYTLSRYVPAFRSVMQDFADGRLRASEWPLVSDHQV
                     NASDGRTSAGANASSTESDTGTESDEHTTPKQPSSFVAGSNRRPGKSATQRIQRTKSM
                     STGSSAGATVDAHRSPGATFSTPAGARRRGSQRALSTTDAASVQRAQSSPLKVETAGG
                     GASGSPAAAAAAAAAGAADDYVERTPRLVVFVAGGISYSEARSAAQVMSRTGQDIILG
                     GSGMLVPTTYMQALQALDDRDAACRLERLPVDPELEAALADARSSTETSDAGAPAASE
                     RTGLRRSGRQARVQRRGQWNNRGGGRSASWFRSICGVCCFGGAENNDEEPSRPA"
     gene            <92831..>94399
                     /locus_tag="CYME_CMS037C"
                     /db_xref="GeneID:16997373"
     mRNA            <92831..>94399
                     /locus_tag="CYME_CMS037C"
                     /product="cystathionine beta-synthase"
                     /transcript_id="XM_005538665.1"
                     /db_xref="GeneID:16997373"
     CDS             92831..94399
                     /locus_tag="CYME_CMS037C"
                     /codon_start=1
                     /product="cystathionine beta-synthase"
                     /protein_id="XP_005538722.1"
                     /db_xref="GeneID:16997373"
                     /translation="MEHANKSGVQRWKALPPAADSVLECIGGTPLVRLSRVERALDVA
                     CKLYGKCEFLNAGGSVKDRIAVRMLLEAERQGRIKPGDTLIEPTSGNTGIGIALVAAV
                     RGYRCIITMPEKMSEEKVNILKLLGAEIVRTPTEAAFDSPDSHISVARRLTAEIPNSF
                     ILDQYQNPENVLAHYHGTAAEILEQVPEGRVDVFVAGAGTGGTITGCARRFKEQAPAT
                     KIVGVDPEGSILAQPEALNAKGVHSYAVEGIGYDFVPGVLDRSLVDLWVKTSDRESFC
                     AARQLIALEGLLVGGSSGAALVGALRALDQLDLRQRTDVVVVLILPDSCRNYMSKFVS
                     DSWMMKHGFLDDVTPRELWEAYPVSRLPLQVPVTVLPSVSCGDAVKVLAENGVDQLPV
                     VAEGEILGVVTEGNLMAQLVSKRVSPNDPVSKVMFRQYASITPSTTLGELSRLFKFDH
                     FAIVSAAQREYRNNGECVLKKIVLSVCTPIDLLSFLVKAGFEPPEAASSQSPVPLRTR
                     RQHESNHVDACLNA"
     gene            95728..97531
                     /locus_tag="CYME_CMS038T"
                     /db_xref="GeneID:16997385"
     misc_RNA        95728..97531
                     /locus_tag="CYME_CMS038T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461649.1"
                     /db_xref="GeneID:16997385"
     misc_feature    complement(96439..97991)
                     /note="possible transcribed region"
     gene            complement(<99704..>101002)
                     /locus_tag="CYME_CMS040C"
                     /db_xref="GeneID:16997387"
     mRNA            complement(<99704..>101002)
                     /locus_tag="CYME_CMS040C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538666.1"
                     /db_xref="GeneID:16997387"
     CDS             complement(99704..101002)
                     /locus_tag="CYME_CMS040C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538723.1"
                     /db_xref="GeneID:16997387"
                     /translation="MRACRPVFSTCLLLGRLYHTPAVVNEFRVLSHRLVPEAWPKGVL
                     ARWTEVHGADASKRHSTETKTALKLLWRQADADVWKLVQERSDPLWQGTRCVLLRGPP
                     GSGKSTSLFHAVERAREQDWLVFYLPNLYHWLHERDSCDVVLTPRPRGARSASLLREP
                     LFFDQARLVLDSLQACRQVHARTLESITCLPTEQLLRESDLDDEARDGDVARQTATST
                     DQHTNLLGLVDACLQSGRRLEGELAELNLDAFGRTYRLFLRQLQCVRQVPVLFAIDDW
                     NLLNALTSIRHPQKKGRFLHASALRSLRPLNAWNMFTRFGARMRRGLVLCAETSARGL
                     GRVRASRVVGSVLHRPTPAMQRDPDGSQAARWVDQELPSNLQPVIQEIPRFHSDEIQR
                     ILKDFQDHKVFHAVDAHTLWRLERLASGNGVRLLRICQSI"
     gene            <102985..>106458
                     /locus_tag="CYME_CMS041C"
                     /db_xref="GeneID:16997388"
     mRNA            <102985..>106458
                     /locus_tag="CYME_CMS041C"
                     /product="ubiquitin conjugation factor E4 B"
                     /transcript_id="XM_005538667.1"
                     /db_xref="GeneID:16997388"
     CDS             102985..106458
                     /locus_tag="CYME_CMS041C"
                     /codon_start=1
                     /product="ubiquitin conjugation factor E4 B"
                     /protein_id="XP_005538724.1"
                     /db_xref="GeneID:16997388"
                     /translation="MNLRRAHRERMARGIDPVDAGVRCGCPAREAPATRSVLKRQHKR
                     PLTLSCIMFSGRRERDPAEPRDQLQGDSYYTEAGSTEQNPLVDLDLVRSRRLARFTTK
                     STAADSSGAVAETSATAGQHSSRPACERPENKTGTEERVLHRAESEKAPSVEACPAPQ
                     RKAAPAVSEKELVHQSLLRILNLSSAELEEIWARAGVAASQAPTHLTVAELDTVLAER
                     LQDPRIVDALSYLILCYQRLRQELASIQAARSQVLRESLGNALPLVVTYARTCLWEPH
                     LFVSGRRWPAESAPHEAAALWLVEQFQKQQIPAEGDAAILPPAMYADLVHWWARDAPD
                     ELEQLFPVFFRGLVESARAELDQIFLQRSQLSCLRALGSALEPHEALNAFVSMADFVA
                     VDTRNNVRSLLGPFLTPTALHYEDDRVSRALLPNNVSTESETAERDAISAVQWSLDTL
                     RDGLYRLLMRLLRAGPYPRERVLTWLANQLNQNRERMKLQAATAETCTDGYMLNLTDV
                     LLRLAAPFADPRSPKLQSIPIKCLYDHHRIRLAEQETRVGCDYAEAQRLQADYLQQQQ
                     QQQAGNPYAFIPECFFLTTRALQLTYLPFLQYYREEILHQLQRLEEMREELNLAQQQQ
                     QQQPVSSMQQLEQQLMRSQCERAIAGLRRDRQSCLFYLFDSGSLDRLLQFLAALAAYI
                     MQIAGFAGRLPLPAQDAASVPREYALLPESIFELLAEVLQSIVQLRLPVPLTTVGALF
                     PQFVEFATMLLSNTFYLRNIHIRARYAEWLAQMFPAIGNELRHALGAVHLPPEFEAAF
                     LGNEQVVENLPPALMQLYIDVERTGTHTQFFDKFSMRFYMSEVLVAMWRVPAYARVLR
                     RLASTREGLFVHFSNMLFNDANFLLDESLQALAEIHELERLLEPNSIQGQALEPQARE
                     EKRKRLLQLQRQAKSFNQLANSSIRLMVTLTEEVRQPFLRPELLDRLTNMLNYFLVAL
                     CGPRCENLVVQERHRYEWEPRQLLSQILRIYLSMHDPLRDRDGTRRFCCSIAADGRSY
                     RPEVFERAAQIAATRGLLTPAECQRFHELVESVAICAKELVAEDEELSEAPDEFLDPI
                     LATLMQDPVMLPSSRKIVDRSTIVRHLLSDPHDPFNRQPLRIEDVIPQPALKEQITSW
                     LQERQGTRRVS"
     misc_feature    complement(107172..109742)
                     /note="repetitive element"
     gene            <110312..>112168
                     /locus_tag="CYME_CMS043C"
                     /db_xref="GeneID:16997389"
     mRNA            <110312..>112168
                     /locus_tag="CYME_CMS043C"
                     /product="probable transporter, Pfam sugar transporter"
                     /transcript_id="XM_005538668.1"
                     /db_xref="GeneID:16997389"
     CDS             110312..112168
                     /locus_tag="CYME_CMS043C"
                     /codon_start=1
                     /product="probable transporter, Pfam sugar transporter"
                     /protein_id="XP_005538725.1"
                     /db_xref="GeneID:16997389"
                     /translation="MSREERDGSAGFVEHAATAARSPDPPYVGREPLPSAAERTNADG
                     ACDEFVLPISPEVPGGDPEQPTTGLTPSEPSASLSEKREPSADFGPRKGESRRDYLRR
                     EFQQLRSYIVVTSAYLLFSLTDGGIRMIVLLYSIFLGFSAFATALMFSAYELAGVSTN
                     IIAGMIGSAWGIRAPLLIGLGFQLLGLVMLFVWQADNQHLLGVRGAVYVAAAQVLSGA
                     AKDMVKLSGKSISRLVTPESKQTRLFRLVGFITGFKNTFKGLGYIMGASIVFVSYYAA
                     LGVMVGIVLIVAVIVWFGLDWETGRIPHDYVSLRRMLTVNHNVGFLCLARIFLFGVRD
                     LWLEVPILYFLQNQKYGFSWPDYAVGLFVGLYTVQYGQIQSWAPQYLLRPLGQMPSNR
                     YTLLFWNILLLPVVVFMAAFIQWSPTFANHDVNGMIGFVIVTVFAFSFVFAVNSSAHS
                     YMIVKYTSGDKVAMTVGFYYMTNAIGRFIGTFFGGLLYTYVSSDKVESLAACFWTSVG
                     FILAAEVFTYFLHDNVGGFRCGPCFAYAVDAEDSEVSRSKVDLIEGKPASSFLDSDTH
                     MNNKLEKAELSPAYQGNQFAGVPRTAYSTGSEETQAEIPGSQIRNERDRNER"
     misc_feature    113240..114058
                     /note="possible transcribed region"
     gene            <115575..>116834
                     /locus_tag="CYME_CMS045C"
                     /db_xref="GeneID:16997410"
     mRNA            <115575..>116834
                     /locus_tag="CYME_CMS045C"
                     /product="26S proteasome regulatory subunit RPN6"
                     /transcript_id="XM_005538669.1"
                     /db_xref="GeneID:16997410"
     CDS             115575..116834
                     /locus_tag="CYME_CMS045C"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN6"
                     /protein_id="XP_005538726.1"
                     /db_xref="GeneID:16997410"
                     /translation="MDSDRVAEAKALEAAHEYEAEALYRSIITEPLPENGAEIAQKEK
                     ESAIVALIELLGHRNRIADLAELARWLRPYFDAVPKAKTAKIVRTLIETLSRCPGSGE
                     VLLALCHEVVQWCRDEKRTFLRQRVETRLASLYLERKQYPEALALITSLLHEVRRMDD
                     RGLLLEVQLLETRLHHALRNISKARAALTGARATANAIYVPPALQGEIDLWAGIIYAE
                     ERDYKTAFSYFYESFEVFASIDDSRALDSLKYLLLCKVMTQQTGEIAALLQGRVALRY
                     QGRELDAMRELAAACEKRSVQDLEQVLRTNQQFLTEDPIIRNHLDELYQKLLERNILR
                     IIEPYHRVDLAHIARKLAMPLPQIEAKCSQMILDGKLNGIIDQGAGCLIVHESTQTDA
                     LCQDANRLIKNLDEAVSNLFMLAARLR"
     gene            complement(<118365..>119123)
                     /locus_tag="CYME_CMS511C"
                     /db_xref="GeneID:16997411"
     mRNA            complement(<118365..>119123)
                     /locus_tag="CYME_CMS511C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538670.1"
                     /db_xref="GeneID:16997411"
     CDS             complement(118365..119123)
                     /locus_tag="CYME_CMS511C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538727.1"
                     /db_xref="GeneID:16997411"
                     /translation="MNFVPCACRAWSFPREHTGSSPPKRFSRPSRCAAVYATGRGGDP
                     ATPLTLSTVTAHALQRGVRLLNRSLGPLLRIEAYVRVAASTERAGRSSQSTRGQVTAA
                     TTAATAPAQRRRTDVAPDCENWVLAGYVSALCLAPLLRRTQVERIELVSERPTNTPRV
                     TSKLLAVAAACEALRKGAPHCYFLAIDDGFHRHQKLVRYFERLGFQRGRRVTDGVLDR
                     LLWGGCGTVMVGDLAELATRWWQDLQAGEHKQSL"
     gene            <119156..>119797
                     /locus_tag="CYME_CMS046C"
                     /db_xref="GeneID:16997207"
     mRNA            <119156..>119797
                     /locus_tag="CYME_CMS046C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538671.1"
                     /db_xref="GeneID:16997207"
     CDS             119156..119797
                     /locus_tag="CYME_CMS046C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538728.1"
                     /db_xref="GeneID:16997207"
                     /translation="MAWCLWVFHPSPRCRARSALACAWRPPKRCRLPPCRPETLEACS
                     EPPESPGPREQGQTRTSADLPLSNESSPTGEAEASDGNGHELSFMRSTGVDDLDARLI
                     AEDPSFAELEKAARAWIGDSLDRWLWWERQKARRYRLLQQIKQQEELVAVELAELEQS
                     LGELQSLTGLRFLSEDGKISGLGWVLIAMILLIPCGLIFVSIHLVQQALSNQV"
     gene            complement(<120398..>121081)
                     /locus_tag="CYME_CMS047C"
                     /db_xref="GeneID:16997412"
     mRNA            complement(<120398..>121081)
                     /locus_tag="CYME_CMS047C"
                     /product="mitochondrial ribosomal protein L21 precursor"
                     /transcript_id="XM_005538672.1"
                     /db_xref="GeneID:16997412"
     CDS             complement(120398..121081)
                     /locus_tag="CYME_CMS047C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L21 precursor"
                     /protein_id="XP_005538729.1"
                     /db_xref="GeneID:16997412"
                     /translation="MRVLERVIHVLRRASPLQRASIASASRALAMKAPDTVSGDAQAP
                     RKSILYNELTKPLGFSYYTIKRQVAGMNENALPAIFARHPPGATASTSTPAKRDPLID
                     GRGEGCFAVIAHGPKQYKVTVGDIVYLARIRGQVSEEVRFSTVLALGSVDWSVLGRPQ
                     VPGAEVIAVIEEQSLSQKIYIYQKKRRKGHERLLGHRQPYTRVWIKDIRWEVPDDTEL
                     EPLELALSP"
     gene            <121497..>122513
                     /locus_tag="CYME_CMS048C"
                     /db_xref="GeneID:16997398"
     mRNA            <121497..>122513
                     /locus_tag="CYME_CMS048C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538673.1"
                     /db_xref="GeneID:16997398"
     CDS             121497..122513
                     /locus_tag="CYME_CMS048C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538730.1"
                     /db_xref="GeneID:16997398"
                     /translation="MFADIRILQREPDSHVAFELLFRAAEAVQELMQRRKWVVGVLRE
                     FLPRGSQLLGLNINGGRVICIRLRKHRSGGCRRQSRAARTDHQREERSLTGAPQRVRG
                     LSDIPGTSASNFFAYEEILGTLLHELVHIEISAHNRAFYALLETLWEEVRWSARSGLY
                     GPVHRLSPRGCGDGSCGSRPVLASAPATPGTIALLDCHPEQRRNLLLKAVLRRLEQQR
                     PDPHDATRYSDESQGALALVNWNRPPVIQVAENDPSGLEERVVALESEERTRFSESAT
                     CLEQGDTCQVIQVVDLTVEDADDTLECIDLCATDDEENDERTARAAAAAADDDDDDDD
                     HDRA"
     misc_feature    complement(122474..124167)
                     /note="possible transcribed region"
     gene            <124531..>124977
                     /locus_tag="CYME_CMS049C"
                     /db_xref="GeneID:16997223"
     mRNA            <124531..>124977
                     /locus_tag="CYME_CMS049C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538674.1"
                     /db_xref="GeneID:16997223"
     CDS             124531..124977
                     /locus_tag="CYME_CMS049C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538731.1"
                     /db_xref="GeneID:16997223"
                     /translation="MGEVVLELAGNAPSLTSAGKLQSKTSGENNCNSFRGAHLLQSNE
                     EEAISRLSSAKPNIVRFYRTLMLSGAGTPLQRTEPAYDTTPRWHAPRYSIPKRGSGFQ
                     RGSERKPRSTIPCYAHQGPDIVCVCAASLISGIRSGTCPRPHDWIT"
     gene            complement(<124884..>125885)
                     /locus_tag="CYME_CMS050C"
                     /db_xref="GeneID:16997400"
     mRNA            complement(<124884..>125885)
                     /locus_tag="CYME_CMS050C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538675.1"
                     /db_xref="GeneID:16997400"
     CDS             complement(124884..125885)
                     /locus_tag="CYME_CMS050C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538732.1"
                     /db_xref="GeneID:16997400"
                     /translation="MTATPMLTRMKPTLVTSTPRLIKTTPTCTHATAWLTMTEPPFTP
                     AKVRLNATPPMLMQARRVFSVTNPRLNRTTPLLRLTTPIFFIANPVWCAMKRSLVAGG
                     SGIVVKGASRSQASVCRSWNTHRHQTSASRSSPLMRGKRSQFKGALSLKQQFDDPDEH
                     PVERFVRKRRRPPASPIPWSERLLGILPYLVPLLDSLVYGKYVFERFPIFSMFVLQPL
                     WPLLSIYRGIPFLPLIIFVLMLVLVVRNPRVSYFVRFNTMQALTLDIALILPQLFQGL
                     SNALPVSAVAIQVLQASVFYGMLGCILYVIQSCGRGQVPDRIPLISEAAHTQTMSGP"
     gene            <125572..>126036
                     /locus_tag="CYME_CMS051C"
                     /db_xref="GeneID:16997401"
     mRNA            <125572..>126036
                     /locus_tag="CYME_CMS051C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538676.1"
                     /db_xref="GeneID:16997401"
     CDS             125572..126036
                     /locus_tag="CYME_CMS051C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538733.1"
                     /db_xref="GeneID:16997401"
                     /translation="MPEPPATRERFIAHHTGFAMKKIGVVSLSKGVVLFNLGFVTLNT
                     RLACINIGGVAFNRTFAGVNGGSVMVNQAVACVHVGVVLINLGVLVTNVGFILVNMGV
                     AVMNAGFVLWNPGVVVATASFIHANIGAAAKRVSFSKLRKELGPAFPKTSLA"
     gene            complement(<127837..>129165)
                     /locus_tag="CYME_CMS052C"
                     /db_xref="GeneID:16997402"
     mRNA            complement(<127837..>129165)
                     /locus_tag="CYME_CMS052C"
                     /product="phosphoethanolamine cytidylyltransferase"
                     /transcript_id="XM_005538677.1"
                     /db_xref="GeneID:16997402"
     CDS             complement(127837..129165)
                     /locus_tag="CYME_CMS052C"
                     /codon_start=1
                     /product="phosphoethanolamine cytidylyltransferase"
                     /protein_id="XP_005538734.1"
                     /db_xref="GeneID:16997402"
                     /translation="MDNNPGRSAFSRLLLVFDVALSTRAVYGFLKAYFRWRLTRSKDG
                     GAALTASAPAEPRKKVRIYLDGCFDLMHYGHANAIRQAASLGDELIVGVCSDEEITKH
                     KGPPVMTEEERYETVEAVKWVDHVIRGVPYNVTPEFLETLVRDYEIDYVVHGDDPCLD
                     ASGRDVYEAVKQAGKFRTIARTEGVSSTDIVGRMLLCTTSHHLPPSRSQSAELDGPED
                     AQSPAEERPMLTNGPTAKSEQSQQPEQGYQQPRASCFLPTSRRLMQFSSGSKPRPGDR
                     VIYADGAWDMLTVAHIRFLKQCRELGDFLLVGIHDDHAVNQHRGRNYPILNLHERTLM
                     VLSIRYVDEVIIGAPWKVTEDMIKTMNISLVIHGTHYDELNIRDGDDDPYEVPKRLGI
                     FREIPSSSDLSVPKIIERIVRNRERYLERQQRKGTQEARYYADKTHVEEL"
     gene            <129816..>131417
                     /locus_tag="CYME_CMS053C"
                     /db_xref="GeneID:16997403"
     mRNA            <129816..>131417
                     /locus_tag="CYME_CMS053C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538678.1"
                     /db_xref="GeneID:16997403"
     CDS             129816..131417
                     /locus_tag="CYME_CMS053C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538735.1"
                     /db_xref="GeneID:16997403"
                     /translation="MFTALVSSTGLSLALGRRGFPRTPKGTWTPAIVRHLAAGSRAGK
                     PSQRFGQGRHWANFARMHRKNNHDYVELPQEEMDNLKIQPETHSQRVARVHVPVLADA
                     VRQAFAGRSMTHFVDGTLGAGGHATMIIADHPELEHFIGIDRDRSALELASKHLEEQF
                     AGRHAPQMHFLHGNFRDIMALCQARSINAVDGILLDLGVSSMQLDHPERGFSFGGSAR
                     ARSDFSQGKRTDAPWDAPLDMRMDQHATGALTAQDIVNTWSESELYRILRAYGEEPRA
                     RQIARGIVEARRRAPIETTGQLATIVLEAKGIRRRTHAQHQDALTGSSEQPAIGTAAS
                     KRRLPVMEQVGVWHPGRRRHQHGGTLHPATLTFQALRIAVNDELGCLEQGLQACIRLL
                     RPGGRLAVISFHRLEDRIVKWTFRAFAEGQRTPASGCAAIPAVSRRASGAHEARPATR
                     ISDEDTSSDDACTEGARIAQLCSVEVPRQPANDSAYAEQLEDHECWRIITKKPIVPSP
                     EEVNQNPRSRSAKLRIIENVAGTCG"
     gene            complement(<132658..>133773)
                     /locus_tag="CYME_CMS054C"
                     /db_xref="GeneID:16997404"
     mRNA            complement(<132658..>133773)
                     /locus_tag="CYME_CMS054C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538679.1"
                     /db_xref="GeneID:16997404"
     CDS             complement(132658..133773)
                     /locus_tag="CYME_CMS054C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538736.1"
                     /db_xref="GeneID:16997404"
                     /translation="MVLFHCFQVDQGASTMGAHRDCAFVSVFGALRNESRCSAFNCSG
                     TCRTRRWRHHCAQRTAISPCWMRLDFEEDHAEDADIGPPERRRAFRPRPKQRDPKSTR
                     DLKHPRVPERPSASVTPLPSESSTTSKSEKRKPRTRAALKTPPESKPTSPAVPLPHEP
                     APAPTQRRSSDTQGRHPQGHWSQGTGPPPSDPHPSSIAPSNGLETARRESSASAPGLG
                     RDATAGSRRGSVPGAKPTADKRPDASSSGPGSRSAVGRRTPDQSMAPQELKKLANTSR
                     MTSRGAYRHRYRGNQIPRYSSEPQTLSPRMQELLQRLNFDESRFQEAEIIDDSEGFGA
                     VSYTSCYTRVITETQNETSNASAAPNTDSAPKKNRNK"
     misc_feature    complement(134182..136566)
                     /note="repetitive element"
     gene            <136996..>138315
                     /locus_tag="CYME_CMS056C"
                     /db_xref="GeneID:16997441"
     mRNA            <136996..>138315
                     /locus_tag="CYME_CMS056C"
                     /product="CTP:phosphatidate cytidylyltransferase,
                     phosphatidate cytidylyltransferase"
                     /transcript_id="XM_005538680.1"
                     /db_xref="GeneID:16997441"
     CDS             136996..138315
                     /locus_tag="CYME_CMS056C"
                     /codon_start=1
                     /product="CTP:phosphatidate cytidylyltransferase,
                     phosphatidate cytidylyltransferase"
                     /protein_id="XP_005538737.1"
                     /db_xref="GeneID:16997441"
                     /translation="MWVSTVHGWQALPHLEGVRQHRRAPCRRPPRTARRSDAGVSLPR
                     TALPTRGRFTAGVPTSADCSAVPRLRCLDATPASSDGADTASTPAAAAGAGAQSVGSA
                     VVASERPADARSAALVAAVATTRPARDLAVRVVSGIVMGLVATTWILAGIWVFTAGLT
                     VVAVLGQLEYYNMVRAKGIRPAQRAGIAASILALWVAAAAPQASEAVFPVSATLICTY
                     MLLHRREKFATIADISTTFMGMFYAGYLPTFWVRMRALGGIEQTRFPAVVSRLPDVLW
                     PGWLPPPEGWTVGAALTWWTWLSVASSDIGALFIGRAFGRRKLSDISPKKTVEGAIGG
                     FLCSALVSILGAFLMRWPLWWLTGTLYGILIGVVGLLGDLTASLFKRDAGFKDSPATA
                     FGGRFRWALPGHGGILDRTDSFVFTAPLVYYFVTMFLPALRAFILKR"
     gene            <140263..>141162
                     /locus_tag="CYME_CMS057C"
                     /db_xref="GeneID:16997442"
     mRNA            <140263..>141162
                     /locus_tag="CYME_CMS057C"
                     /product="similar to peroxisomal membrane protein PMP22"
                     /transcript_id="XM_005538681.1"
                     /db_xref="GeneID:16997442"
     CDS             140263..141162
                     /locus_tag="CYME_CMS057C"
                     /codon_start=1
                     /product="similar to peroxisomal membrane protein PMP22"
                     /protein_id="XP_005538738.1"
                     /db_xref="GeneID:16997442"
                     /translation="MIGFVLLLSGQSNAQVSSRLRRSLCKGDTCACLREDELVPVGRA
                     RSPRGHRSVAGPSNVRLRRQRCCHLRTVSEGATGGGGGSGGRGGGSGGGGRGGDASGA
                     SPPQQPGLLLALFERYCRALERRPIFTKSITAALLNFFADLTAQYFEARKHPSDTPPG
                     WQRRRTLSFAIIGLCFVGPGLHGWFSFLERAFPPSRLSLVGKLLIDQTLGAAVFNGVL
                     LVMLYWLEHGGKFQDAWQSMKHRLPPTMIGNWKVWPAAQLVNFAFVPPAFRVLYVNSV
                     SFFWTIYLSEIAHRTITKEEKKS"
     gene            complement(<142377..>143741)
                     /locus_tag="CYME_CMS058C"
                     /db_xref="GeneID:16997443"
     mRNA            complement(<142377..>143741)
                     /locus_tag="CYME_CMS058C"
                     /product="similar to origin recognition complex subunit 2"
                     /transcript_id="XM_005538682.1"
                     /db_xref="GeneID:16997443"
     CDS             complement(142377..143741)
                     /locus_tag="CYME_CMS058C"
                     /codon_start=1
                     /product="similar to origin recognition complex subunit 2"
                     /protein_id="XP_005538739.1"
                     /db_xref="GeneID:16997443"
                     /translation="MRRDDVDGEVAAGAATRQSQLRRACRDAGAAAAARAALRATRSR
                     ARSQRGILGKPRDLREARSSNANDRSRLLGCQTHERAPGAHARSVSSVQCRPAGAENE
                     PPASGGACPEASISAAVEAARAKFHLWYHLLVLGGFSVLLHGEGSKFAVLEAFAADLV
                     KRNAVDAPNIASAVLVVNGFNPFVQVRALVQEIADAAGARRLSPHSRKHEHEHEPHAR
                     RGRPLAAQLRMLGELYKAEAPRRLFLVVHNIDGQTLSTTETQTLLANLASQPRVHLIA
                     SIDRMEVTILWPVGSCYERFQWIWQHCPTHLPHVVETGGHAESAKTLSAEQLVRGAIM
                     LLTGLTPNARRIFQLLAQMQLESAASAEDRTRGDRVKQGISFSDFYRICRSKFFVSNA
                     NSLQAILRELEDHNLLESAVPGWRTGASGLENSRSIPDCLRIPLPSAQIREVLRELHA
                     DPHR"
     gene            complement(<145728..>147680)
                     /locus_tag="CYME_CMS059C"
                     /db_xref="GeneID:16997405"
     mRNA            complement(<145728..>147680)
                     /locus_tag="CYME_CMS059C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538683.1"
                     /db_xref="GeneID:16997405"
     CDS             complement(145728..147680)
                     /locus_tag="CYME_CMS059C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538740.1"
                     /db_xref="GeneID:16997405"
                     /translation="MPLAHDVDADVERDASLKPALYLAQAFCTRHSLEYLDVIERERN
                     AALQELVHQASEQRIPSLAFDPTIEESRAQLYAHRSRLSDLRSDAHMQRWADDLQSME
                     SALHRVQKRQHTLEVLLRALSIHEDDAAQLRRDDLDVAVLDALGRVQRIESRLKELPA
                     EMRSWKLIQDAQRELHIVLESAWDRVQSWVRALDWAKPELPIEAPESHVLLLIRAWLP
                     LLASCLQPIVAGRQQVLLRELQRQWDEHVRNLSPAADRSTAGDEVLRLINDLFAIVHQ
                     QLELEKEQWLRAFAVQHPHENAHNAGRHAAAEHNAARATDLVQTILRQSSDVYADAMS
                     SRLKMWIDNESLPLSALHEVHKFLVLYEHFFQRVLGTEAVLPLALASIRREVLGRCVS
                     GWRERFMRLLQNNLIIPHDLSIPPLLLHEAEHLRACLEIQADPGLPRTSQSVDTAQLT
                     DVVLESVDALVRVLAVRDLDPLGRSVFVGNTLDAIVNVLAHFWTEVQRARLEHLLQEH
                     MAAYIAAAVDSLLQRCRLLEISKLAGSYGDPFSAATEHGQQREASWPSLEALALRMRA
                     FESLLFDAPVSDWFPPPLATRIRSLATRQKLLFGLASALLAKYRQLVSAISESGAFSA
                     EDVERLHLRDVTAVEERLQSLVNRSI"
     gene            <150169..>153786
                     /locus_tag="CYME_CMS060C"
                     /db_xref="GeneID:16997406"
     mRNA            <150169..>153786
                     /locus_tag="CYME_CMS060C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538684.1"
                     /db_xref="GeneID:16997406"
     CDS             150169..153786
                     /locus_tag="CYME_CMS060C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538741.1"
                     /db_xref="GeneID:16997406"
                     /translation="MGGKPPAPAQTDRKKVAVARPKASARNVQRQANRELHRIHAPIE
                     DRSGGDAAPRIVAVVGPRASGKSSIIRALVKHYSHRNLEQVRGPLTIVTSKTRRLTLV
                     EVPPELPSMVDAAKIADLVLLVINAAEGFEMECFEFLSVAAAHGMPRVLSVLTHLDAI
                     KDTEKMRRTKKLLKDRLASEIVQGAKLFYLTGMRENGAYLKREVQNLARFISIIKYRP
                     ISWRNEHPFVLVDRIEDITPAGRTPDEAAADRQLLVHGFVHGSPLRLPTMFHVPGLGD
                     VFVESAVARADPIPPPAATEPDTSNKTGPKRRRTLQQKERLLYAPMSSLDGVFFDPDA
                     LYVNIPDSYVRFTPTGKDSILNTEATDVSVASAVHDEEAGLSVGEQMVRALQNPQHAP
                     LQTLSAKAIRLFGDAHPVTWETNLSAASSEDEGAQVGSLGKYGEHARDGRLAATTASD
                     DTDTSAGSETCSSDTSSARAQDAHVYEAGGARDLGRVHSTPERRRPAERMASRSEPCD
                     WPVVPTLDAIRYPTITKAARLRRSASELGQDAVPVDDTRSLGSDQEDSTSSATQGEFF
                     RTVKRNRFATHERGIRIDDESYVSPSPSSSSDDEEDATESDSSFLARFAGAARPVDRS
                     SDSSKRPAVRIVNGASERTPTPCRGVVSSASSDQSFSTETGAVHAENGDAVSSDSDIA
                     HSPSAASAEGSSTDDALTDASSETDASLGLRKRQPALTSALSEWLQQQPDRSKSEADS
                     SEATFGNMSTGDSATSHDSRRVRPPCMAPDIDSDHALTGERSAKALDESEPTILLDAN
                     FDQRCFAPGTYLRLELRGVPAAFVSNFDPMRPLILGALPLPMERTRAMMRIRILRHRW
                     FRRLLKTRDPLLFSVGWHRFESVPVFCVEDSTGRHRMLKYTLEHMHCEAMLYGPVVAP
                     GTGVVCFQSLGSERSRDFRIAATGVVCEIDHKFRIVKKLKLVGEPYRIFKNTAFIKGM
                     FNSELEVSKFVGAHLRTPSGLRGVIKKSVRDGPPGTFRATFEDRLLMSDLVFLRTWVP
                     VEAPTYYHAVRNLLEPAPWASNDPHRTYRWMRTARELRTAYQTPLEVKADSVYRPVER
                     LPRRFHPLRIPRALEAALPFASKPKQVEALSERKRRRLERAVPGLAERMPTAATAERK
                     EAQFLQMLRTVRRERESQRAEAQKKRREVHQRQLEKEERQRLAARRVRKKQEYASGAH
                     R"
     gene            <155798..>156640
                     /locus_tag="CYME_CMS061C"
                     /db_xref="GeneID:16997407"
     mRNA            <155798..>156640
                     /locus_tag="CYME_CMS061C"
                     /product="probable peptide methionine sulfoxide reductase"
                     /transcript_id="XM_005538685.1"
                     /db_xref="GeneID:16997407"
     CDS             155798..156640
                     /locus_tag="CYME_CMS061C"
                     /codon_start=1
                     /product="probable peptide methionine sulfoxide reductase"
                     /protein_id="XP_005538742.1"
                     /db_xref="GeneID:16997407"
                     /translation="MAFLAPGFLSLRCVFISRTRYIRFTNRALALRQCRYTRTRSSRG
                     TSSLAMGLFSGLFGRESASPAAGSRKPMPVPEKHYVLGTPLKTVPEGMRVAVFGGGCF
                     WGLERRFFQTPGVYSTAVGYAGGSLPDPTYYEVCSGRTGHAEVVRVVYDPQKVDYLTL
                     LDVFWSAHDPTQLNRQGNDVGTQYRSVIIYADDEQKRLAEATRAAFDKTLRENGYGRI
                     VTELLPAADNPFYFAEEYHQQYLAKNPGGYCGLGGTRLYNPEAIRSALKEMEAAAAAA
                     AARE"
     gene            complement(<157035..>160523)
                     /locus_tag="CYME_CMS062C"
                     /db_xref="GeneID:16997408"
     mRNA            complement(<157035..>160523)
                     /locus_tag="CYME_CMS062C"
                     /product="similar to chromosome segregation protein SepB"
                     /transcript_id="XM_005538686.1"
                     /db_xref="GeneID:16997408"
     CDS             complement(157035..160523)
                     /locus_tag="CYME_CMS062C"
                     /codon_start=1
                     /product="similar to chromosome segregation protein SepB"
                     /protein_id="XP_005538743.1"
                     /db_xref="GeneID:16997408"
                     /translation="METIVCHPPGTCSLAVGAQSPGAGASPVTFVFTGGSDGRVLGRS
                     VKTDAGNRLSVTKECDWVWEAEPNGPGAVSAIWSLALSPCCSFLVVADDASQVSLVSV
                     STRETLAVLCRTPVPANYVAFGGAGEYVIVCGREPATVRLVYLDEGPRIDILRPSEED
                     PAYDEVVQYSVIDLAVDPLGCYFATVHEVPSGQGRATSTARTPAAMANVCLWSVDAQR
                     VIGFGVGRIRHACCARFSPDGQILAVGDRTGRVHFLERDSWENAGYPVFDVQVWARAQ
                     CPAGSHVDKPISISTLAWDARSTTRLVVTAKLQEDNGDTIILYDLADAASRQLGVAEA
                     EIRALACCPVSSVTYYLDLLGQLGVVTLPAERGTISSRGSERLSTSLLDNGTVDAHCG
                     HHQSREGAHTGEASTRNAETPGSTTKLVRGTSLQVQTSNSLTFKEAASRPSQGGSTPS
                     DDDSERVSSVSQREPAGETDDDDDDDGNDDSDVGDTTLSSRKRRRFATGLSHGRSSCC
                     CDRTCQQPFQIGSTLDLGAKRRILQWNLTGCLTSLPAGSAVATSEEPARQIELEFSDV
                     SKRSIRFPDRYGFQYGTLNAYGILLGAQSGQGGSDRPALIYYRPHESWSLQSDWIRFL
                     PPQEDPIALCMSKFWVAVATSAQSVHLYSFTGLITDSFHPGLNGSILTMVASENLLCI
                     LSRSHGPDGAGEYMLLRIHQNGYVSECLVRGNLPICPAVRARPRAKRLQHLETSRLVW
                     VGLTDTKRDTSSEAADSTSDASEDCALWIYFASGHLFTLRAWTFGCYRSATWNWTHGC
                     HPLSSLQRGSMHLTWHLALTSERTRQALAEADGEEIFDPDRQWFYPLGVKNRVLHGII
                     LPADATSPLPYPRSQLRQVPLERFPWPLAQDSQYSELEQAYLRTVASIRATRSALFDA
                     IAFSRTTTVDGTQYQHSEHEMLEALAQKARELQRQADKTLLYLIEEACEKQRDRRVLD
                     LASRLSSAAAFKVAVQIANRLKRAILAEKITQFAQIRIEELESSKSVVEQLLAAAHAD
                     AQANIASERAPSFLAQPSGNDDARRSRSTSDPEEAATGTESHPKRPAIDADAAPSADA
                     PARPEETSSNTAVAAGGPSVRAAAALARKSAHLSARVAERLLQFTQSSPAEKGASRTA
                     SSRSLHSLAAWSSNST"
     misc_feature    complement(162789..164796)
                     /note="possible transcribed region"
     gene            <165463..>168189
                     /locus_tag="CYME_CMS064C"
                     /db_xref="GeneID:16997395"
     mRNA            <165463..>168189
                     /locus_tag="CYME_CMS064C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538687.1"
                     /db_xref="GeneID:16997395"
     CDS             165463..168189
                     /locus_tag="CYME_CMS064C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538744.1"
                     /db_xref="GeneID:16997395"
                     /translation="MDAFICVKIHSTALVRSPAWNLSRFDGRHSCVSGWRRSRGRRTA
                     ETLRLLQDEDAVPEPRTQKQSPFSGIATSESVQNVSKYAEVLLQKNKALQKWSEKSLE
                     RENPGAGTTLLEDVAHDATNEETSALSAEESKFAPRGKRGRRPHREQRPAGYWNADNV
                     VREVLEFVRSRPNSGNGPQYMPTSNELREAKRSDLVRAIIVHGGYAKVAERCGLQPHR
                     RSFGYWRKDFKNLEREIWSFIRERDGPEAVPREFRGDSSTRSRRKSTADASASQATPN
                     EPTTRPRMPTYNELVAAKKRILAYAIAENGGFLEVARRMNLQLSSDETPWRDRDALVA
                     ELLRLFPDLMGKQKRFPRQQDLVRLGRYDLDWAIHRWHGGYTRLAAELGYLRSRLPCK
                     PRNFWSDERNLENELRALLQANNMGWRMPNRKELEALDRHDLIYAIRKFGGFLTVATK
                     LGLSRDALTHTRPRGYWSDFENLRTELQAFVQENGYPGIMPRLEQLRMYNREDLINAI
                     HRHGGAANVARRLHLFWYGPKTFWRKFENLGQRLRAFLHKSRFSHDKMPTQQELISAG
                     RVDVAYGVHLHGGVYEVARRLRLQVLDPPRAPFYWNDIQNVETELIAFVNSAVHAAWI
                     QNGVMPTSMTIVRSGRRDLAAAIRRHGGWDAFARRLNLRPAAPKRPKGYWNTLRNVEA
                     ELLLYVQQREQVIAEFVRNYAADFVRRPGDDEDDPDAAGKIAYSDVSEILAGNVGNKR
                     CRTVVGAIRNGAYVPVMPTAEELRLDGRADLVFACERIHGGLATVARGLGWPLLAERL
                     PPESLKKDRNVLVQALMTMWIPIYGTAGEMPTEADLLRTGGIDIHEAIVCHGGYVEVA
                     RSLNLRHPEDPEWTDWSAKRFSKQRMSRPLQPRSKKGSKASPETSGDSADEV"
     misc_feature    168841..169850
                     /note="possible transcribed region"
     gene            complement(<169138..>169416)
                     /locus_tag="CYME_CMS065C"
                     /db_xref="GeneID:16997417"
     mRNA            complement(<169138..>169416)
                     /locus_tag="CYME_CMS065C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538688.1"
                     /db_xref="GeneID:16997417"
     CDS             complement(169138..169416)
                     /locus_tag="CYME_CMS065C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538745.1"
                     /db_xref="GeneID:16997417"
                     /translation="MEPAAVSTPERTLGKYAVRCTRKRTLLRSIERMRNAIVSRIIEV
                     SAAKSRSVHDVEHSRCVDADSVRSGEALAAPEAIAALTQALVDDALTF"
     gene            <170594..>171535
                     /locus_tag="CYME_CMS067C"
                     /db_xref="GeneID:16997397"
     mRNA            <170594..>171535
                     /locus_tag="CYME_CMS067C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538689.1"
                     /db_xref="GeneID:16997397"
     CDS             170594..171535
                     /locus_tag="CYME_CMS067C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538746.1"
                     /db_xref="GeneID:16997397"
                     /translation="MTLLHFRGRRQAETSRASTEINSENRSHSSTGGALNPSEANTEH
                     DEVMAELHDLLVRELTDCGLIDLFTSQSLPQYASEKDTLTDAGSEKQHKATELGNGAS
                     GGVFQHWTGPSRPAPADLLTVESPHGRTEEPSGNRGSFQRDVPPLEDQNEPISRAMQR
                     IRAALRRWKPLHGEVDLETLERLKNSIVERSAWFLREQAEQRARWKAMRQNPAYVVED
                     FTANQRTFFSWIRTSFRMVLTGAAIGKLLHGTSVIILGVLYAALGLICIAAGTMHFYH
                     WQRTLYNHRYLRDSRPFIVVFLGITATSVVALMACWK"
     gene            complement(<172043..>173326)
                     /locus_tag="CYME_CMS068C"
                     /db_xref="GeneID:16997418"
     mRNA            complement(<172043..>173326)
                     /locus_tag="CYME_CMS068C"
                     /product="histone deacetylase"
                     /transcript_id="XM_005538690.1"
                     /db_xref="GeneID:16997418"
     CDS             complement(172043..173326)
                     /locus_tag="CYME_CMS068C"
                     /codon_start=1
                     /product="histone deacetylase"
                     /protein_id="XP_005538747.1"
                     /db_xref="GeneID:16997418"
                     /translation="MLSSQALYGSTDRLRVAYFMDFDVGGYYYGQHHPMKPHRMAITH
                     NLCLAYGLYRHMDVYKPRKASPEECEKFHAHDYIEFLRNTTPDTITDDVLDQLQRFNV
                     GRQHGDCPLFDGLWDFCAVSAGGSIDGARKLMSGTSDIAINWAGGLHHAKKSEASGFC
                     YVNDIVLAILELLRLYPRVLYIDIDVHHGDGVEEAFYTTDRVLTVSFHKYGDNFFPGT
                     GDVWDRGYGRGEGYAVNVPLKDGMDDAGFSRIFEPIITKVIEVYQPGAIVMQCGADSL
                     AHDRLGCFNLTVQGHANAVAFVRSFRIPMLVLGGGGYNIRNVARCWLFETSVLLGISV
                     DAQIPYNDYWEYFAPEYSLHIQPMRELENQNSRDYLEKVKSKVIEQLRQLEGAPSVQM
                     KHMPPSIWPATDEIDSEDEAEDIASEDPVSSPTAS"
     misc_feature    complement(173450..174512)
                     /note="repetitive element"
     misc_feature    complement(174522..175746)
                     /note="repetitive element"
     misc_feature    complement(174960..175762)
                     /note="repetitive element"
     gene            <177891..>179141
                     /locus_tag="CYME_CMS071C"
                     /db_xref="GeneID:16997419"
     mRNA            <177891..>179141
                     /locus_tag="CYME_CMS071C"
                     /product="retroelement"
                     /transcript_id="XM_005538691.1"
                     /db_xref="GeneID:16997419"
     CDS             177891..179141
                     /locus_tag="CYME_CMS071C"
                     /codon_start=1
                     /product="retroelement"
                     /protein_id="XP_005538748.1"
                     /db_xref="GeneID:16997419"
                     /translation="MYGGLPRSYRSSKRTPNPTDMNIYRTMRLIPSIMKLLCANLTNR
                     TQRGLEERNFLAPEQAGFRSREECMSHDLTFIEVVQRRSISCQQPTYVCFIDFQKAFD
                     TVPHEAPFLKMERARVSGKCLAFFRALYADSWMCTRLGDCSRTPSIRIRRGLRQGDRA
                     SPRLFNIFINDLLNNCRQYGLQVSWIDCGEPGEERLHRNRLAGLLLADDVVLLAPAPE
                     TLAASMQQVSAWADRWVMNIGASKCGAMVILGDSQRIRNRSWRLQNQEIPIVEKYRYL
                     GVCLTPTLDEKAQVDEMIAKMHRRTEIARPFLSDPSICIAIRTRALRMCIIQPSTWGA
                     EWCGMKHTNASRLHTAANRAMRLVGVGCSVQRRATNPLALGLELQIASIEAIAAGCRA
                     CIRAKGPTMRTSLSRIFMQTPTHR"
     gene            <182954..>185875
                     /locus_tag="CYME_CMS073C"
                     /db_xref="GeneID:16997420"
     mRNA            <182954..>185875
                     /locus_tag="CYME_CMS073C"
                     /product="eukaryotic translation initiation factor eIF-4G"
                     /transcript_id="XM_005538692.1"
                     /db_xref="GeneID:16997420"
     CDS             182954..185875
                     /locus_tag="CYME_CMS073C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-4G"
                     /protein_id="XP_005538749.1"
                     /db_xref="GeneID:16997420"
                     /translation="MADSGDETEWELAAEKFVATVAPKETTPSRGRPSSRATRSPLRE
                     APPEAAPNAGAGTAGRPGRSAGSSGPSEPTADTTTGTTRVARGAQPKPAGKPSGVGGN
                     RGSDVAAAPSQVIQVLRFSSDASLTATVRGSQANQQALWDRARSAFESALRRNATRLE
                     LDALAAALQTVGVDISLGRNAGTRGGGPATNGPTDGSGGRRSGAAAGGTASRTPQPAL
                     TRGRNAWTPSFLTKTADTSATEGENLVNSSRRKAKAILNKLVPEKFVTLAQQILDMPL
                     HHYDVLEAVISEIFDKALAEPYFCGVYADLCEVLNRALPSIAIESASGTKQTNFRKML
                     LARCQAEFVQRALASEERATDEQELEVCAHNRRRTLGNTIFVGELFKRHLLSEKIIHE
                     CVQMLLKEGENEDSIETLAKLLSVAGSSMDRPEARSYMDAYFTKIEEMANNAQIRARY
                     RFMLKDCVELRKQKWKPRRAQERPATLDEIHGKKSGRAARQASQSLARKAAQLRFTGA
                     DAEAPKPEAESTVPAGQVSASATVQGRVENARNQNVAGETVTDAAHAKSESGPVPDRT
                     VVWTENPELLRTYIRGIIEDYVVNPYPAEVQVALTESGLAAQPDLLALAGVQELFSMV
                     CSARGHERQPLVRSFGDAFQHVLSREKLLEALVSITSNLLTFEDELDMPTAGKVLGEF
                     LGTLCTSHCATFLHDAADIHTVLAAVPPNRQASVLRSFLETLFRQYPSDMRERFGASL
                     RALRPLFVSLPQTEQRELEELLAKYELLELVPEWQLRRQLQYYLEPGKERIADAADWL
                     RSFLPRVRETLRSEDATASTAKSSLNEWYAFCRFTADHILSTYVMEAQSSSTMDIMRR
                     LRLMVPLLRETAGNMPATDETDDDDDDSDPAEDKEWRQAQVAFAVQAGCYRLDFPTDL
                     ISGMFQVLYDADVISEEAFDRWREDVHDTTPGKLKALFHVNAFLNWLKETDEEPEKSD
                     V"
     gene            complement(<186298..>187599)
                     /locus_tag="CYME_CMS074C"
                     /db_xref="GeneID:16997430"
     mRNA            complement(<186298..>187599)
                     /locus_tag="CYME_CMS074C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538693.1"
                     /db_xref="GeneID:16997430"
     CDS             complement(186298..187599)
                     /locus_tag="CYME_CMS074C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538750.1"
                     /db_xref="GeneID:16997430"
                     /translation="MDAPTSKARVSVRPPSSLPLRILFCVLEPGVDLLNGLVEFMNSA
                     SLPMAFTVSSYGVVTCGRVRKPLEPRPETPEAILDEFHQRLGIQQECRTYDAPQRLEH
                     VVGESQWKAWEAERAHPSQEQNRLAFTLEGANAFQPFVIEAADWCTAHGSRYQQPVVV
                     SYIQGGRRRSLGDRFFLFASGHLRPERRSISEEGTHTRGSKAAAAEEPGETQPDRMPS
                     SAETTTTTAAAAAAAAAACSAPNDGPVVDELEAHAVQVGLLDHGTQVAVPGIRVAFGM
                     AVPDDQSNSRMYVSRVRSGSELMTAVRKILTGRQLDAAVVLGCSGHLRGIRFQRYAYH
                     ANNETAAKAASAEEELFAAGEAFLIESLQGCYDSQRDGPAMTAELNWVLSILDDRPWR
                     DTIDGKSDAQVPLLRSYGGLVKQAICDGDVELVIAQVISTA"
     gene            <189905..>190738
                     /locus_tag="CYME_CMS075C"
                     /db_xref="GeneID:16997431"
     mRNA            <189905..>190738
                     /locus_tag="CYME_CMS075C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538694.1"
                     /db_xref="GeneID:16997431"
     CDS             189905..190738
                     /locus_tag="CYME_CMS075C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538751.1"
                     /db_xref="GeneID:16997431"
                     /translation="MQVVRWQPRLPDTFVEERFSTISVSERKTTLVDTEDAEDSTTLY
                     RRAGETPGLRPQSVDTESGFWLWEGALDLVHYLSQLGESCCCKQIGVRHGALEILEIG
                     CGHALPAIYLARQGHCVRVDFQDHSCQVLETITQPNVWRNGIWKQLHHEPQFYAGSWQ
                     SWLEDASMDRRYDLILASETVYSRASTRLCLQVCRKLLKPHGMALFSGKTVYFGLDGG
                     MVELVDILHEIGGQSHLLWCTSQQIAATRREIRSVAFDIGARPTPANPACPISAAPSG
                     G"
     gene            complement(<191744..>193444)
                     /locus_tag="CYME_CMS076C"
                     /db_xref="GeneID:16997432"
     mRNA            complement(<191744..>193444)
                     /locus_tag="CYME_CMS076C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538695.1"
                     /db_xref="GeneID:16997432"
     CDS             complement(191744..193444)
                     /locus_tag="CYME_CMS076C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538752.1"
                     /db_xref="GeneID:16997432"
                     /translation="MNQMDVPRGTPESSDADQERPPGSPGPGACSSTARSASHGTAGA
                     VRVLLKTPNIVSDAAGRSYVLSVEPESTVGDLKRRVHLEHPFHPAPEQQRLVYGGRLL
                     QDGECIREIVGMSRAVVGELGDDARASSCVGSNGTETGESASPPLFAVFHLVVTSERG
                     LTSAERSTGITRDAVVSGQQLESLASIEVNSAPSTNSGEVLTFSDASRERLGSVSDAE
                     RSPALSAVAAGRQEGSSDAALFDEAWALDEGQSQPQSQQQRALDADSATTPATAWRAL
                     SNATAEQETRQPSEEQHNGTEHSRNLQHRLDAARASTNAEQASLHVRLDEQTLQLVQA
                     YARMLRAYEEYNRCLTEYYATHEAGGVPPSYLLANHSQSSGLSASSGHGTGAAARSSI
                     SRSALEAAERHQLPGNMLRAGAAGAIPVRMIAIRVRMPALDWALVSKLTFMVILLSQD
                     GGRDRLLLLIGLAVLIYLFQTGALGPLRRYVESLSSQLWARMQMQTLVPATGESGARP
                     VPRNSSSASGRDASFEAAATSRQEPLSTRVLRFLRGLYLVIIAFVCSLIPTWRPPPRR
                     "
     gene            <194168..>195358
                     /locus_tag="CYME_CMS077C"
                     /db_xref="GeneID:16997413"
     mRNA            <194168..>195358
                     /locus_tag="CYME_CMS077C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538696.1"
                     /db_xref="GeneID:16997413"
     CDS             194168..195358
                     /locus_tag="CYME_CMS077C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538753.1"
                     /db_xref="GeneID:16997413"
                     /translation="MAEQQASSGSHSDETWTLVERRKPSRQAGTRFPLLAGHLRTRLD
                     VACADQELESFWHLFTAKLDQVTQFSRKTFQNFTCYNFERFIGLGIGAFTSDWRAQWQ
                     LAWLVALQRYLKQYTRTAGVASDWVLVEPQLTSLEVTLAKRLGFRVFRADPNAPVRCR
                     HCRRSQSDAAAQAGAHTDRVPASSRLGRSQLPHSTRFHDYIRPDAVRRQSKDSGSGYT
                     LLFMPHCGIGLIELVLQLYWDQDALSRLHFVSSDLVELITSHEQRSVALAAERTSSVH
                     GRGNALVSCSDRQLPLAKDASGSTCETKAAVASATQELPSLTEPCCMLALASQHCIRW
                     IAPVDPEGFRNSNVRQAAFHGLGWQCIEDPTTAALEAIRPGDCSTDRADPAQLAAAMH
                     YIPL"
     gene            complement(<198127..>199665)
                     /locus_tag="CYME_CMS078C"
                     /db_xref="GeneID:16997414"
     mRNA            complement(<198127..>199665)
                     /locus_tag="CYME_CMS078C"
                     /product="3-isopropylmalate dehydratase"
                     /transcript_id="XM_005538697.1"
                     /db_xref="GeneID:16997414"
     CDS             complement(198127..199665)
                     /locus_tag="CYME_CMS078C"
                     /codon_start=1
                     /product="3-isopropylmalate dehydratase"
                     /protein_id="XP_005538754.1"
                     /db_xref="GeneID:16997414"
                     /translation="MFVSPVTLHSRAQGCSARTGVSQEQRRVRIGPKNPLAELKSGIS
                     APTSTKAAPSVAVKAPQTITEKIIAKAAGRSFVKPGENLFVDVDVLMTHDVCGPGTIA
                     VFKREFGSDAPVWDPEKIVIIPDHYIFTADEKANRNVDIIRDFAREQGIRYFYDITDR
                     SDFRANPEYKGVCHIALAQEGHCRPGEVLFGTDSHTCTAGAFGEFATGIGNTDAGFIM
                     GTGKLLIKVPATMRFALNGTLPDYIMAKDIILQIIGDIGVAGATYRAMEFVSDRMEQF
                     SIADRMTLCNMAIEAGGKNGIFPPDEITCAYVRARTTKPFDVFHTDSNASFYTDRQYD
                     LSKLEPAVAKPHSPDNLDLARNCEDVKITRVYIGSCTGGKTEDFVAAARILDGRQVRV
                     PTFLVPATRRIYEDLETRKLNGKTLMQIFKDAGCLPPGAPSCAACLGGPKDTFGRANG
                     PEVVVSTTNRNFPGRMGDKSSAVFLASPYTAAASAITGHITDPRRVYDFDRVRHPLET
                     YGLS"
     gene            <200060..>200575
                     /locus_tag="CYME_CMS513C"
                     /db_xref="GeneID:16997415"
     mRNA            <200060..>200575
                     /locus_tag="CYME_CMS513C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538698.1"
                     /db_xref="GeneID:16997415"
     CDS             200060..200575
                     /locus_tag="CYME_CMS513C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538755.1"
                     /db_xref="GeneID:16997415"
                     /translation="MPLGAADNDDLVPADAPSRQYQEHLLWLRLINALYEWCEGGVGG
                     GYESGTEPETFARTLDGSTHKSLSATEELWCNFRLWSDDRQRESLTGQRDVRAQGALE
                     ERCAAVLRCMTNPLVFDLGKDEPELCPRPRRGSSADIEVNADGIVVQSFADRLPVRYR
                     DTRKLTAIPPM"
     gene            complement(<202916..>203650)
                     /locus_tag="CYME_CMS079C"
                     /db_xref="GeneID:16997224"
     mRNA            complement(<202916..>203650)
                     /locus_tag="CYME_CMS079C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538699.1"
                     /db_xref="GeneID:16997224"
     CDS             complement(202916..203650)
                     /locus_tag="CYME_CMS079C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538756.1"
                     /db_xref="GeneID:16997224"
                     /translation="MPAVQSHGGVKREQSLRPILKDSKSCVSCSTDHENDAEVDNVIG
                     GRVELATAPLPVEADADPEAHREPRNRKHIHFDEGNLQENEAERLRVERMLIDEPKTP
                     YHEPFAESHTGLGSLSASEGSESEYIGRGCFIQTHASQCGSADGRHAPQINGAGMTFL
                     SRSSSTDSSSSHTSGRRLSHEEFEEKRRSLYSNEYRMIRLYRQQSLDSDTDDSASGTE
                     GASSASKASQRRAEPPERARDGKNAI"
     gene            <204149..>204544
                     /locus_tag="CYME_CMS080C"
                     /db_xref="GeneID:16997416"
     mRNA            <204149..>204544
                     /locus_tag="CYME_CMS080C"
                     /product="60S ribosomal protein L22"
                     /transcript_id="XM_005538700.1"
                     /db_xref="GeneID:16997416"
     CDS             204149..204544
                     /locus_tag="CYME_CMS080C"
                     /codon_start=1
                     /product="60S ribosomal protein L22"
                     /protein_id="XP_005538757.1"
                     /db_xref="GeneID:16997416"
                     /translation="MPTKVKKNVSAKKATTRRFVLDCSAPVGDAILDTASLEKFLQDR
                     IKVNGKTGQLGDFVAVSRDGRTRIAVVTRVPFSKRYLKYLAKKYLKKQQLRDFLRVVA
                     TGPDTYELRYFSIHDEDVEKDEEDMEEDE"
     misc_feature    complement(206074..206522)
                     /note="possible transcribed region"
     gene            complement(<208461..>208832)
                     /locus_tag="CYME_CMS081C"
                     /db_xref="GeneID:16997225"
     mRNA            complement(<208461..>208832)
                     /locus_tag="CYME_CMS081C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538701.1"
                     /db_xref="GeneID:16997225"
     CDS             complement(208461..208832)
                     /locus_tag="CYME_CMS081C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538758.1"
                     /db_xref="GeneID:16997225"
                     /translation="MLHSTSVLLAARGLKLFEVARKLPNYGYGQRFTRKTWIRNGHGD
                     DSFWMLTRIIARKEGTRLKAYGRFTWRGVTEEKEREIRGAHKREWKLFAPNAASSPPT
                     GLEGPNDRTRHNRTETPGSSR"
     gene            complement(<209745..>211529)
                     /locus_tag="CYME_CMS082C"
                     /db_xref="GeneID:16997445"
     mRNA            complement(<209745..>211529)
                     /locus_tag="CYME_CMS082C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538702.1"
                     /db_xref="GeneID:16997445"
     CDS             complement(209745..211529)
                     /locus_tag="CYME_CMS082C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538759.1"
                     /db_xref="GeneID:16997445"
                     /translation="MLRYLCILNELGAPLVEKRWSALYEWNGSSRDVIQEFWELIQEQ
                     PQRRSDAAGTLPWSERKGFREAGSRASGFFCYREVNGLWFLAGVDEYPPVSAREWLSA
                     ALVLDSLDRHLLPLLKECSRGHLSAQWLREHFVAVYELLEEMHPRGLPLVTEPSVLLQ
                     LVTFPSSLEQIMVNVAGALDTRLGLDRWTSMNHSISLRGAVASQVRSVPTERPGPTGI
                     MASAASTLWQNLYRTTSSARRSLPRPFERVSGTHSDAVAIQSSASAAQRQSANTVAGH
                     ASVLDTRRGIAPQCEPRAPWRPTRVQHATEEFLVDIVETLSATVSGEQGTPVEWAVRG
                     ALECQSRLSGCPQLEMQLQCHQVGEREMAFHECALRSERNTSGSALTMSFIPPDGSFR
                     LASYWLWRLIPHSGTHVAVNDSSSVFPLEVILRGGTQTSEQGCFIRVVASIKLHMLGS
                     VTLEHLQLRVYLRMLTPTASARRGSSFRAPASHQLYSNIGSVSWDVSSLCLSWSIAKL
                     DTVRVAHMESVLHADGVPFGESISVTHADLIFAPFAYSLSGLRIERLIIANEHQPAFK
                     GMRHVLRCGVIQVLPGKLTDTDRSRRAS"
     gene            <214081..>215532
                     /locus_tag="CYME_CMS083C"
                     /db_xref="GeneID:16997446"
     mRNA            <214081..>215532
                     /locus_tag="CYME_CMS083C"
                     /product="similar to histone acetyltransferase; Hat1p"
                     /transcript_id="XM_005538703.1"
                     /db_xref="GeneID:16997446"
     CDS             214081..215532
                     /locus_tag="CYME_CMS083C"
                     /codon_start=1
                     /product="similar to histone acetyltransferase; Hat1p"
                     /protein_id="XP_005538760.1"
                     /db_xref="GeneID:16997446"
                     /translation="MTSPARGAVRKRLRRATAPDEALIAPNDSDPREAGTEAVANACS
                     DPEVHANQVWKLKFVLNEEDNAVNGAFYQPSFTHQIFPNERIRGYLEPNLYQVYDAVT
                     LHCYLNFKYTAVVNPSKEVTPVMSTLQSLLDECGGYTTDYEAFRQCSRNANEPLETAL
                     KTISTYDLHNETFIISEGVLCSENKSPAQAALRALHRRLQFLTLLYIEAASFIDDEDP
                     RWMIYLCRSRRDQRLVGFATVYRFPAIEKLQEFDPHREKWRLAQLLILPPYQRAGHGT
                     RFLHALYERARCVSEQTGRCVLEISIEDPAPALCCVRDLVDLEKLLTSDDASRQWAQS
                     INASSPVPSRSELKTLAQRLRITAAQVRRLYEILRLHAMVSASAASGDVDPELEREYR
                     LVVKRRLFRENEECFGLKNDDERKQMLAEMYTSLMQESYHPVIAAAMRRGLIAPTRLE
                     RRTGSESELHVLVSGSKELLLRNSAQVSESGST"
     gene            complement(<215760..>217013)
                     /locus_tag="CYME_CMS084C"
                     /db_xref="GeneID:16997470"
     mRNA            complement(<215760..>217013)
                     /locus_tag="CYME_CMS084C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538704.1"
                     /db_xref="GeneID:16997470"
     CDS             complement(215760..217013)
                     /locus_tag="CYME_CMS084C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538761.1"
                     /db_xref="GeneID:16997470"
                     /translation="MPLPALAQWDSRHVHLSAWDALSSGFGRDEPIPLWIDCDPGHDD
                     AFALVLGAHHPRLRLLGVSTVDGNGSVENTTQNAARILKAAGVLGVQVHAGAAGPLLR
                     RQQYYDCPSSGDEAASSAPAPHPEHIHGASGMELADSDGIWPDRSFGNELVSHKPAVP
                     AMAEAIWNEYARLNPSAPLTRNQTVQTLKSGCAAGAISGTTSETDGTKDACSIRRRIK
                     VVTCGPLTNVALLVSLYRELIPLIDVVVLGGALLAAGNVSPVAEFNIRHDPEAFHVVA
                     TAGIQHVVLIPLEVTHSVLAGEHVMRALQSVRSPFGRLMTGLLNYYGERYRRAFGFEA
                     PPLHDPLAVAAVYGAAMGKFAIEHHRVDVELHEGTLCYGKIVVDVWGHTQRPRNVYVA
                     LAVDTEWFWSEMLAAVIRANDPSPL"
     misc_feature    complement(217634..218474)
                     /note="possible transcribed region"
     gene            <218732..>219940
                     /locus_tag="CYME_CMS086C"
                     /db_xref="GeneID:16997472"
     mRNA            <218732..>219940
                     /locus_tag="CYME_CMS086C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538705.1"
                     /db_xref="GeneID:16997472"
     CDS             218732..219940
                     /locus_tag="CYME_CMS086C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538762.1"
                     /db_xref="GeneID:16997472"
                     /translation="MRRESDFSRIPKLLPLLGLHNSRQLKFMLPTVLQESSTGHSLLR
                     GWFRKYHRMSTGNWKGMRLWLLVLAMLVALFCVLRIPPQVLLPDYWKPEWFYAPLNFS
                     YEVELASAVPVQEPPTVIPNIVHFIHGLTPDFGKRPFGLVEYLAVKAAHEVIKPRSIY
                     LHYMYRPEGYWFERALPYVTLSPITELHPLPNVSMQHFAHLADVLRLLILIQHGGIYL
                     DMDVLVLRDFTPLRTQYKVTLGREQVRNTPSVRWPDPGGVANAVIVAPVNASFLHRWL
                     ATYATFQEKDWATHSVTIPYVLARTHRFDAELHVEGPRSFYYPTWAPDDPVHGLPRLY
                     ARAHRRGAREAYRFDEGNYAVHLWRTKAAEVYPSRDLFSVAHICNHRNDPEYALSTFQ
                     RVARAIYGEC"
     misc_feature    complement(219118..221768)
                     /note="possible transcribed region"
     gene            <221966..>223273
                     /locus_tag="CYME_CMS088C"
                     /db_xref="GeneID:16997459"
     mRNA            <221966..>223273
                     /locus_tag="CYME_CMS088C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538706.1"
                     /db_xref="GeneID:16997459"
     CDS             221966..223273
                     /locus_tag="CYME_CMS088C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538763.1"
                     /db_xref="GeneID:16997459"
                     /translation="MALLSPKIFLATLHRKGRGLGFVFPWSSSFAGRAPCIEYPRGGT
                     QASASGCWRHAERSFSQTSWSRLRRLVVQSAAPANQRRRSSKRGVLSAERAAALYRSL
                     QSFSAMTSRSIGTHSGTFHCDEALACYMLRLLPEFRDASIIRTRDPALLATLDCVVDV
                     GAEYDPERLRFDHHQRSFSDTFSTSKKTRLSSAGLVYKHFGRELIRQITGTSDENVLE
                     LLYTRVYDGFIEAIDGNDNGIDATNERPRYVDNTTLPMRISRLNTPWNVDESEQEQLV
                     RFEQAMEMAGTEFVAYVRGLYGQWLPARAVVLEAFHKRFETHASGRMIYLERWCPWKT
                     HLYDIESENSALGEIYFVLYRDHSGMWRVQAVNKPDSFENRISLPIEWRGLQDAALEK
                     VTGIRGCTFVHASGFIGGNETYEGALAMACLALSMNTAPVMPT"
     gene            complement(<224509..>225396)
                     /locus_tag="CYME_CMS089C"
                     /db_xref="GeneID:16997460"
     mRNA            complement(<224509..>225396)
                     /locus_tag="CYME_CMS089C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538707.1"
                     /db_xref="GeneID:16997460"
     CDS             complement(224509..225396)
                     /locus_tag="CYME_CMS089C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538764.1"
                     /db_xref="GeneID:16997460"
                     /translation="MERTKNSEAFGAQHSDQQPNEAAAAENLGPALPNESVRGALVLS
                     YLIERGYERSARALCSSVRCCDAPKVDLVKNVGYKSLADRRRWTASILEDGDIHKTVL
                     EAGMWLAEHTSHAVCFSGEQMGFPVTFPAVWEPFVAIKSLHPWFAFRACLQQYVEYLR
                     DGKAAQAISYARHYLRVALWEQLLPTETEPDAGSWIELLEDHLVLLAFTNPEKSPLGK
                     LMATERRKDIADELNALVVACERNQTGLGSALERMLRHVWAMSALHEEMRTSDANVFW
                     QEIEAKSFSEYMRQPDPAL"
     gene            <227149..>228054
                     /locus_tag="CYME_CMS090C"
                     /db_xref="GeneID:16997461"
     mRNA            <227149..>228054
                     /locus_tag="CYME_CMS090C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538708.1"
                     /db_xref="GeneID:16997461"
     CDS             227149..228054
                     /locus_tag="CYME_CMS090C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538765.1"
                     /db_xref="GeneID:16997461"
                     /translation="MTLFFVTCVGSASISGLQRSSTARSGLRAVPRSKGTAFRMRKGR
                     AKNGLLMSNGPGDAGSGPVGPEGGADGSSGYAADQDYPSDSYRRTPAEAMRSAVFDKA
                     KIAQTKLKLLQLAASTGRGDLASTAQRNLVEDLVTQLESMSPTVSPLESADINGKWQL
                     VYCSKPLYKINPFYLPAATPLGNLGVITQTINMDLGELVNEAEVHSFPAVNGVVVSVS
                     RVLPVSETRMELLVERVTLRAKDVAGRFDLGGLKLDIPVEGFYDRLQGGQPGRPFLDI
                     IFMDEDLRVCRGKQRTIYAFTKLSR"
     gene            complement(<229303..>230319)
                     /locus_tag="CYME_CMS091C"
                     /db_xref="GeneID:16997462"
     mRNA            complement(<229303..>230319)
                     /locus_tag="CYME_CMS091C"
                     /product="probable mitochondrial carrier protein"
                     /transcript_id="XM_005538709.1"
                     /db_xref="GeneID:16997462"
     CDS             complement(229303..230319)
                     /locus_tag="CYME_CMS091C"
                     /codon_start=1
                     /product="probable mitochondrial carrier protein"
                     /protein_id="XP_005538766.1"
                     /db_xref="GeneID:16997462"
                     /translation="MSSAPAERLEPWKDLLAGAVAGCASRFAVAPLDVLKIRFQLQHE
                     QRVLQAWGLGDAPAVHARYTSVSQAFGRIIKEEGWTALYKGNVPALAMVAPYAAVQFG
                     TFYQLRQWWNQLSEGDNRSLQRYMGATPSVIFGALSGLVASVTVYPLDLLRTRMAVQS
                     EPRLYTGLVDAVRTIWRKEGLRGFYAGLGPTVIEIVPYVALQFYIYEHLRHYQARKNL
                     AQRSSGSGALSEHEAVRSSESFLIGALTGTTAKWCTLPLDNARKRMQVQSITDGPRVY
                     RNTVDCLWRITRAEGVRGLFRGAVPSLLKAAPASGVAFFVYEWMKKLWISPVRTYAAQ
                     PDVP"
     gene            <233334..>234884
                     /locus_tag="CYME_CMS092C"
                     /db_xref="GeneID:16997495"
     mRNA            <233334..>234884
                     /locus_tag="CYME_CMS092C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538710.1"
                     /db_xref="GeneID:16997495"
     CDS             233334..234884
                     /locus_tag="CYME_CMS092C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538767.1"
                     /db_xref="GeneID:16997495"
                     /translation="MNRASTNLTSGGNWFQPGTSGASSATVQAGLAAQNPVWAPPRTT
                     PWSTGGATPVTPVGSTALNAGSFPGNVGQSSWDTQTNKYADGAAGFPTSLFSSANGSG
                     TLGATPNATSGTASGAWPSTAASSASTSTLKPATELGNTSTFMSWPNSATTGTQFIST
                     GQGMNLNQNPLNAGTGGAFQSAFRTTGGASGATTAAPAPTEQRVPDWVNFEDLSPFMR
                     QQLQQMEQLCLEMQRFADHGVSEENPRATTALRKQLADVNGQAMSLRTALALSSTLVA
                     ELKRAKDGAIHFMQYVCDLHEALHAALFDNGTRESGVYGSQQLAPGSAALPSSSSWSS
                     SMPLTTARAWYVERDTAVAPSRTIHLPSSFMEAVTTALEQRAALCEEKLTQVTQLLAA
                     MVGSSSQPGILHALGIDVSDAAAANSQPESGSGSGSLTTTTTTTNTNTIQRLHNTLRN
                     EHLLLMQLAGAVAMLHERVQALREWFTLVYQQRRPRAPDPLQNPSTTMTTTQASGLGQ
                     WPFAPIQR"
     gene            complement(<235336..>237744)
                     /locus_tag="CYME_CMS093C"
                     /db_xref="GeneID:16997496"
     mRNA            complement(<235336..>237744)
                     /locus_tag="CYME_CMS093C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538711.1"
                     /db_xref="GeneID:16997496"
     CDS             complement(235336..237744)
                     /locus_tag="CYME_CMS093C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538768.1"
                     /db_xref="GeneID:16997496"
                     /translation="MQRLLQTFHSQEGLCSTLFARLGGVRFRGRLSNSKLRRKERDKK
                     RQHWLERYWFPKQRAAAAAAAREKKLPRYLASFGTENGPSTIREPNLPPLQSYASLYY
                     RLWTCRNPGEARTHLMTATASEASDSAREPTGNASTADAVNKRPEQCTATLLDVSAVE
                     SRLEEAREALRLFIASAQQRAAGPSLNKALHLGRCLLRVQRVLNNDVNNGRRVEAFLH
                     ELGMGSVVSMLPQTCASSAARKHLDPGDRVVSSGTANTTHLTNGQFPGKNSPGNANSL
                     RIDTEPYAQAAVSDSMDARTLRRAVSIAILRSFSAPRSVDDYSASVIWKEDSWASHVA
                     FLRKPSVQQAESLIRPDLNSLGAYTIIMSSLLRAGCDQAVLVVFDLLTRRKGETLDII
                     VYNIAAQAMARLGQVERVLELITTMMRAPATRIATASAAPRCEPDWITWRSAIEACLR
                     RRDVHAAWTMYTQATTYMRQRAPPEQSAMHDAQVGLAPLSVQRVVAAALSSAGQIAPL
                     LQMLHAWQQTAHTDPADTCASRTDPQDAGNASMKPTREHWCTQLAMYALQAIRQAALR
                     VHRQRAADVTAASAGSCREANTVMQEWSAVVDSLQQAYVTRNEEHPGGSVHGREAERT
                     AASGPVPEIPISPDALPPVEYVIQARCALRQAGIVWDFVQEYRICDRTDDGGEYAETE
                     RSLHESTVLAILEMAAAQADVARARQLYAHLERRRVGLGTRAAAVVYLANALVKDGNW
                     QEAWSMVQSLSGFDPVRRARDRHCLRGILDACGDATVRQEILESLGLGARDVDTVAGA
                     QIRL"
     gene            237948..239614
                     /locus_tag="CYME_CMS094T"
                     /db_xref="GeneID:16997497"
     misc_RNA        237948..239614
                     /locus_tag="CYME_CMS094T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461650.1"
                     /db_xref="GeneID:16997497"
     gene            complement(<239944..>240507)
                     /locus_tag="CYME_CMS095C"
                     /db_xref="GeneID:16997498"
     mRNA            complement(<239944..>240507)
                     /locus_tag="CYME_CMS095C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538712.1"
                     /db_xref="GeneID:16997498"
     CDS             complement(239944..240507)
                     /locus_tag="CYME_CMS095C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538769.1"
                     /db_xref="GeneID:16997498"
                     /translation="MQRLSLVDRDFTPQDYELLLELDSGAAAMQEFLHGAPQDAIDLL
                     PCFTYKEWMQRGSATSESKRSKLMDNHENLTTRTEAASPTEPTTAGAHAEPAATQTDT
                     ASLLKPAETADSDANKPASSSCKLQSEEERTEPDDTTSVCVVCLDFFLPEERIRVLPC
                     LHQYHQQCIDPWLRQKARCPVCKSAIL"
     gene            <243321..>244787
                     /locus_tag="CYME_CMS096C"
                     /db_xref="GeneID:16997523"
     mRNA            <243321..>244787
                     /locus_tag="CYME_CMS096C"
                     /product="sulfate adenylyltransferase"
                     /transcript_id="XM_005538713.1"
                     /db_xref="GeneID:16997523"
     CDS             243321..244787
                     /locus_tag="CYME_CMS096C"
                     /codon_start=1
                     /product="sulfate adenylyltransferase"
                     /protein_id="XP_005538770.1"
                     /db_xref="GeneID:16997523"
                     /translation="MRDALYLAFVAPFLQKQSTRRFTGLKVNGASSANQMWTWSRTTG
                     LEGPSCRGQQALPFQMTTAPETSKVSTRSVPGWTVSGSTDDVIELLVPEAMRPELEAE
                     ARTLPRVVLTEETDLQWLHVLSEGWASPLRGYMREEEYLQCLHFNCLRSTSGTLYNQS
                     VAIVLTVDDAQRQAIEASGRNAICITWHERPEEPLAILRNPEFYVHNKEERCARQLGT
                     THPKHPYAEVIYRSGNWLVGGDLQVLKRIKYNDGLDAYRLTPKELRREFHKRGADAVF
                     VFQLRNPIHNGHALLMTSCREDLLRRGYRNPILLVHQIGGRVKADDVPLRERILQNQE
                     VIAEGILDPESTMLGIFPSPMMYAGPTEVQWHAKARMNAGCQFYIVGRDPAGVKHPDG
                     DRDLYDPWHGKKVLLSALGLERLEILPFRVAAYDKKIGKMAFFDPSRADDFLFISGTK
                     MRAFAARGESPPDGFMGVRAWKVLENYYAQKREAQGSS"
     gene            complement(<247326..>248912)
                     /locus_tag="CYME_CMS097C"
                     /db_xref="GeneID:16997524"
     mRNA            complement(<247326..>248912)
                     /locus_tag="CYME_CMS097C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538714.1"
                     /db_xref="GeneID:16997524"
     CDS             complement(247326..248912)
                     /locus_tag="CYME_CMS097C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538771.1"
                     /db_xref="GeneID:16997524"
                     /translation="MVRWRVENLRPDEAVTFPLLLICGQVPLNEHLTCVVVYLANAQP
                     GSLVAEQQRTPWPVRNCDGRFRALVWLQPGVNLVAAGPLSGPAKLQFRVHYLDVPWDY
                     VVRAVYVVPRDAVEVRFQAPPDEDCMLASAVRRFALALRLMQTAAAELLHEQGLGHLS
                     FCIERMSAACATPLPGNIEEIHCAYDVPVHVRRLSRTRAELHALSGDALWGMIAEELS
                     NISNRQQCIDVAVMSFTSKDASTGRVYGHTALGGGTLALFGSSGMYAWPQTLSEVPKR
                     FSDRRRVDSINFFDDSAGRGERWALASTTIGAMLHELGHCLSLPHPCRGGGIMARGFD
                     YFYRLFTVQDPDPEREAHEPHWDRSAACRLHFHRHFVGALAVVEQIEPDWASFTAQPA
                     ASPLPSPERLEHDARVPYQVANAPHASVTRMLPVTNGASASERPSHPLHAVGRSPRIT
                     LDANGFVHIFAPNGIGHIGYYVDGDVADHDEFLDSARPVEYFQIALDDIRRRCRIQKP
                     TSTLRISCIDHLGEINEQAV"
     misc_feature    complement(248905..252075)
                     /note="repetitive element"
     gene            <252336..>252773
                     /locus_tag="CYME_CMS099C"
                     /db_xref="GeneID:16997525"
     mRNA            <252336..>252773
                     /locus_tag="CYME_CMS099C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538715.1"
                     /db_xref="GeneID:16997525"
     CDS             252336..252773
                     /locus_tag="CYME_CMS099C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538772.1"
                     /db_xref="GeneID:16997525"
                     /translation="MSKKGGDVPEYVYEPYQGDGYAPPPPAANSSSVYRYQTGTNAVP
                     PPPPPTQNGVAYAYSPAGAPPPPPPPNFSYAYSEALPDGTSRHYYYAQRTYSNAHGRY
                     QNTNFDQNDQLARGCLYACCEGMAAGLCAALTFECCLGLCGFW"
     gene            complement(<256228..>257370)
                     /locus_tag="CYME_CMS100C"
                     /db_xref="GeneID:16997526"
     mRNA            complement(<256228..>257370)
                     /locus_tag="CYME_CMS100C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538716.1"
                     /db_xref="GeneID:16997526"
     CDS             complement(256228..257370)
                     /locus_tag="CYME_CMS100C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538773.1"
                     /db_xref="GeneID:16997526"
                     /translation="MHQETALASNCTKSEQKGRSWTLAVALPGSVLANAQTPALQTYL
                     AGQIARALAIFEVDEVIIFAERVRATIAGTVSSPSSTAFDTHLARLLQYAECPQYLRQ
                     ALFPHTPELQYVGLLNPLDTPHHPRRHEGTPYREGVVVPAPDTGATSDRSRYVHVGWD
                     APVAVDTDMPLPVGQRVTVRFEKLERSGHYVAEQGSNRKRKRDSHPSLHMQGCWTWTR
                     AVMVARDEPRERLGLYWGYKVRLAANLVQALSTSGADVKIGTSERGTDLFATLWGSSA
                     ERATDSTAAETEIDGASARRASFIPPGGFRKLLVAFGGIHGLEASYGSPDVAKLFDAY
                     VNACPHQGSRTIRTEEALLVVLSAMHPWIRHYGRKSAEQIRASCRA"
     gene            <259418..>260206
                     /locus_tag="CYME_CMS101C"
                     /db_xref="GeneID:16997520"
     mRNA            <259418..>260206
                     /locus_tag="CYME_CMS101C"
                     /product="probable proliferating cell nuclear antigen"
                     /transcript_id="XM_005538717.1"
                     /db_xref="GeneID:16997520"
     CDS             259418..260206
                     /locus_tag="CYME_CMS101C"
                     /codon_start=1
                     /product="probable proliferating cell nuclear antigen"
                     /protein_id="XP_005538774.1"
                     /db_xref="GeneID:16997520"
                     /translation="MFEARFPEALLLKKILEAIKDLVQDANFECTESGITLQAMDNAH
                     VSLVTLLLRGEGFDLYRVDKPESLGINLNSMSKIMRCAANNDTVTVDKLEGADTVRFL
                     FESPNADRMSEFHLKLMDIDSETLEIPESMYHAEIELPSAELRRIVSDLSTMGDSVRI
                     SVSKEGVRFTVRGDEGSGSVILRQSTGVDKPEEAIHIVMNEPVEQSFALKYLNLFCKA
                     APLSARAQIKLSKDAPLLVNFSMNNIGYLAYYLAPKIGDEDIEE"
     gene            complement(<260831..>262501)
                     /locus_tag="CYME_CMS102C"
                     /db_xref="GeneID:16997521"
     mRNA            complement(<260831..>262501)
                     /locus_tag="CYME_CMS102C"
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit E"
                     /transcript_id="XM_005538718.1"
                     /db_xref="GeneID:16997521"
     CDS             complement(260831..262501)
                     /locus_tag="CYME_CMS102C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit E"
                     /protein_id="XP_005538775.1"
                     /db_xref="GeneID:16997521"
                     /translation="MSWSQDLLPTLTSCLDRHLIIPLLRFQEETAPTRAEKRDAQLAL
                     LHTLVRTSMIDYALEVWQEIEQDQPLSEDEQRGLEGRAALAERRESIVLALKTLHIEV
                     RPLLQAVSKVAKEAQISKSDEAGIVDDKAPPRVSLDLSPTSTSDTAKIDGETEASNLE
                     ELPQLDASVLDKVRQIRDVFSEDLFDALYEYARFQFDCGNYAESRELLRLYRALVPDL
                     DWERDLGLHWGMLASEILENRWEPALQEIENLRAFITSLSGSSSPVLNPLQQLQQRTW
                     LLHWGLFVFFQNTTTLNYFIDLVFSLHSSSGAGTDRNVSGSIGNIASERYFTAIETNA
                     AHLYRYVVAALAICNKRQKRNLFAEVVRSIDLDGAKLSKDPVVGFVESLWGNLDLGTA
                     EDMLRECESALRQDYFLRDSVDAFQESGLQLIFEMYCRTHDCIDLHGFADRLNMDRAR
                     AERWVASLVRSARLDAKIDDRRNQVLMSYQPLGIYEYVIDTTRSLTYRTSSLGYALDR
                     DTHPSGGTGRLRGHGRTGRGHGGSGSGTGAAPMGGSSRSGQREARRVE"
     misc_feature    complement(262467..263836)
                     /note="possible transcribed region"
     gene            263256..265064
                     /locus_tag="CYME_CMS104T"
                     /db_xref="GeneID:16997535"
     misc_RNA        263256..265064
                     /locus_tag="CYME_CMS104T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461651.1"
                     /db_xref="GeneID:16997535"
     gene            <265667..>266458
                     /locus_tag="CYME_CMS105C"
                     /db_xref="GeneID:16997536"
     mRNA            <265667..>266458
                     /locus_tag="CYME_CMS105C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538719.1"
                     /db_xref="GeneID:16997536"
     CDS             265667..266458
                     /locus_tag="CYME_CMS105C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538776.1"
                     /db_xref="GeneID:16997536"
                     /translation="MNDDSRRYPNFSAYFRPVQDGEPLPSAPESLALWGQRTVWGLLG
                     GAALGFGQGLQRARMRKAYPMPAGLVNSPSRRLAYFVTSGVVSTSAHLGLFVALYSAV
                     DLGVREWLRSAPAEPLADGCILCNWTRSAGVEQSSGLAAGSITGFLFRLPTGSASLAL
                     SGAAYGAGLGFIAGSIERWLRKLEHAARSKWTAQQAADEVDHKEVEQAGTATASSPKS
                     GAVDAYILALQQRVQPNTHQGLEEWRANGEVSSEESEKNTSPGSP"
     misc_feature    complement(267263..268353)
                     /note="possible transcribed region"
     misc_feature    complement(268982..270679)
                     /note="repetitive element"
     gene            complement(<271714..>272193)
                     /locus_tag="CYME_CMS107C"
                     /db_xref="GeneID:16997226"
     mRNA            complement(<271714..>272193)
                     /locus_tag="CYME_CMS107C"
                     /product="retroelement, dead"
                     /transcript_id="XM_005538720.1"
                     /db_xref="GeneID:16997226"
     CDS             complement(271714..272193)
                     /locus_tag="CYME_CMS107C"
                     /codon_start=1
                     /product="retroelement, dead"
                     /protein_id="XP_005538777.1"
                     /db_xref="GeneID:16997226"
                     /translation="MKLLCANLTNRTQRGLEERKFLAPEQAGFRSREEYMSHDLTFIE
                     VVQRRSISCQQPTYVCFIDFQKAFETVPHEAPFLKMERAGVSGKCLAFFRALYADSWM
                     CTRLGDCSRTPSIRIRRGLRQGDRASPRLFNIFINDLLNNRRQYGLEVPWIDCGDAR"
     gene            <275190..>276041
                     /locus_tag="CYME_CMS108C"
                     /db_xref="GeneID:16997538"
     mRNA            <275190..>276041
                     /locus_tag="CYME_CMS108C"
                     /product="immunophilin"
                     /transcript_id="XM_005538721.1"
                     /db_xref="GeneID:16997538"
     CDS             275190..276041
                     /locus_tag="CYME_CMS108C"
                     /codon_start=1
                     /product="immunophilin"
                     /protein_id="XP_005538778.1"
                     /db_xref="GeneID:16997538"
                     /translation="MLLTNSRQLGFVGPVHGRGSPTRSLVGRFRRVGRTRTPLERLVA
                     TREWERVTNSRQHLVAVVALVALLSGFPEWTGGAAFTSTSTLASQERVEGGVVSPERW
                     ELLPALEGKDYGKPRMRYSDFVTLPDGVQYRDVRIGDTEITPRPGDRVVLNWSGYTIG
                     YYGRIFEAKNRVQGGAFGDDREYSRYVLGRGELVPALEETLLTMHPGGVRQVIVPPER
                     GYPLDGSDWNHDRVGPKPRTFSGMRALNFVLENKGLVDKTLLFNIELIRIDRPGENGF
                     ETVGRRQ"
     gene            complement(<276909..>278456)
                     /locus_tag="CYME_CMS109C"
                     /db_xref="GeneID:16997539"
     mRNA            complement(<276909..>278456)
                     /locus_tag="CYME_CMS109C"
                     /product="similar to geranylgeranyl hydrogenase"
                     /transcript_id="XM_005538722.1"
                     /db_xref="GeneID:16997539"
     CDS             complement(276909..278456)
                     /locus_tag="CYME_CMS109C"
                     /codon_start=1
                     /product="similar to geranylgeranyl hydrogenase"
                     /protein_id="XP_005538779.1"
                     /db_xref="GeneID:16997539"
                     /translation="MYFVALSQGVGARFAKLREPVLEALATKPIPLLALSCVLVALLS
                     IFWVLRTWRKETTLVKPSPKSYPPLPKDAYDVCIVGAGPAGSVTAYFCARAGLRVLLL
                     EKKKFPRQKICGDAVCTLAQDIMERMESATGKGSVLDEILREGKGHPASNGGLVSPAG
                     YSYIGNSVGEGDSGKLARSAVIAIKRIVLDEKLARSAAYAGANLLEEVSVESARFDTG
                     KALWSISGERTGSAPEEASYQARVLVCADGAPSRLAMQLGIVKEAPQGTCSRAYVKAG
                     SHNYAADGTVIYNLNLLPGYMAIFREVNDELNYCCYIIPGNPRVRNDDLSRLHHGFVK
                     EDFYLSRALGPRAELEPMKAGSLRLGGVPRSYADNLLIVGDAAGFIDPLTGEGIHHAM
                     DSGVMAAEVLKEAFKHSDLSARFLSNYQRRWMRAFGYDFKASMRLAQILYRFPILLDA
                     ATLCIEKQGDEFLAEWARIMTGQRPKSQLFRPYIMFAMAKELILLVILRTLGLERKPI
                     DDVRKHQ"
     misc_feature    complement(279882..282348)
                     /note="possible transcribed region"
     gene            281799..283564
                     /locus_tag="CYME_CMS111T"
                     /db_xref="GeneID:16997545"
     misc_RNA        281799..283564
                     /locus_tag="CYME_CMS111T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461652.1"
                     /db_xref="GeneID:16997545"
     gene            <284457..>286820
                     /locus_tag="CYME_CMS112C"
                     /db_xref="GeneID:16997546"
     mRNA            <284457..>286820
                     /locus_tag="CYME_CMS112C"
                     /product="similar to origin recognition complex subunit 1"
                     /transcript_id="XM_005538723.1"
                     /db_xref="GeneID:16997546"
     CDS             284457..286820
                     /locus_tag="CYME_CMS112C"
                     /codon_start=1
                     /product="similar to origin recognition complex subunit 1"
                     /protein_id="XP_005538780.1"
                     /db_xref="GeneID:16997546"
                     /translation="MRNGASCKRKKREEDLQGGLMPRRTQLKRRTVRKTGASSRPSLP
                     TEAEQRRFNCGDYVLLRAPKKESQDTAAGGSLSRTIAATTPRGRRRSQGPEDVAEIDL
                     TTCWIAQILKISRESTGNDERILVKWFYRMKDLYHWHTTVGHEEVFESEHLDENESDC
                     VVGRCHIVCEMEWRMLLEKRTRSSSVSKQEELRVFLCRERYDFITGSFAPSTMTIQWI
                     QEHQPDSNFVASSIQRDSFSHRSLLALLRYMVENSFPVDNDGDCAEQVDLHDTGDEDA
                     WDPAEERALQLRLRSRQRAAAGRSRGNNCSQESDMTPRPRAGGQLLLWPSDVGAHEHR
                     QSRISKNAVEFAEVSEPTGSVPRLLQVSRFGAPRVQLVCRDVETERVLKFLTDCLRGS
                     SERCLYISGVPGTGKTAVVRCAVQQLEQRRQQGQVPHFQYIEINGMTIPDPTRAYNIL
                     LQRLGHRSTGAAGGRRPPAPAEAARLLDQRFRQRRGVHNRKHHSSILVLLDEMDALVL
                     NHSAAAQRVLYDFLDWASRPASELVIIGIANTLDLPERLLPRLASRLGMNRQVFKPYS
                     VTQLQQILRHKLGPQLLQHFDEDALELCTRRVAAVSGDIRRALAICLHAYARSHSEDC
                     SLRASENEHDRLVSAVDIDEAIRELTPSSVQSAVKQLSQIEQQVLMSAALCGRQAVQQ
                     GSETFRFQQIWHRFRQFHASTEGHPAYPLPLQDQIEEVWHILMGLCACNLLSCSVPSS
                     SCAYAGFASTRLPNLHESQFVLNPLFDDIAFAFRENRSFAQAAGELV"
     gene            complement(<287180..>287722)
                     /locus_tag="CYME_CMS113C"
                     /db_xref="GeneID:16997547"
     mRNA            complement(<287180..>287722)
                     /locus_tag="CYME_CMS113C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538724.1"
                     /db_xref="GeneID:16997547"
     CDS             complement(287180..287722)
                     /locus_tag="CYME_CMS113C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538781.1"
                     /db_xref="GeneID:16997547"
                     /translation="MFIAVSALKGQTTRRCGFDWQDFLTSGIHNVERNAALAFFRSAA
                     HRAGRGPRTATREVFALNGNGPGTSRRPGDRKLGPNKDLLSDIERFRRQSPGNAEKIQ
                     VGESKPVAGRLRSWLTNLLIADAFLVFFFMAWLVVGVILQLTSGYSALLDVWYILWQP
                     VVQPLLGLLMAGALASKFLR"
     gene            <288858..>292385
                     /locus_tag="CYME_CMS114C"
                     /db_xref="GeneID:16997576"
     mRNA            <288858..>292385
                     /locus_tag="CYME_CMS114C"
                     /product="RNA polymerase I second largest subunit"
                     /transcript_id="XM_005538725.1"
                     /db_xref="GeneID:16997576"
     CDS             288858..292385
                     /locus_tag="CYME_CMS114C"
                     /codon_start=1
                     /product="RNA polymerase I second largest subunit"
                     /protein_id="XP_005538782.1"
                     /db_xref="GeneID:16997576"
                     /translation="MTHAQQTTGTVLSESETRHLTETLLQILEPHLQSFNSAITQGLQ
                     QVLHDIEPLILEGTVQQAADHVSKERLEVWFEDLRLQKPRLPRARALQSTGNLRARGF
                     ADELELGLDPSAILPHQCRALQSSYTGSLSVVLCWRATRISHGCYRKDSTLCNTALWT
                     NGSYAEDVYRSERHLGEVPILVGSKLCHLDGLSPNERVALHEEEYDYGGYFIVNGVEK
                     LLRMVIMPRANHVMVIARDANVRRGEHFTRFSAMIRCRRADRVRVVTNHLHYLQTGLL
                     RLRFSVKRQEYLLPLGLVLKALYDLADRELFLLLTMPSGCCGTNADENLRYIRERALM
                     TVRELHVLTGGEGTQHAALSYLGARFRCLFPEYLSSDDSDERCGAFILRRYVLIHLDD
                     PLQKLELLAYMSRKLLHYMTGCLAEDDPDSLANQELLLPGQLWLLFLQEKLQDALFAL
                     RDEISRQLTQRANQGSLLDPDFVRKCVSKPRSGIRVGERMLHLLSTGTASLRDGAELL
                     QTSGYSIIADRINFQRFLSHFYSVHRGQYFLNLRTSESRKLKPETWGFICPVHTPDGA
                     PCGILNHLTRMCRVVADQQQVLQEQKRIEWILETLPLEHPLAHNDALLMPPANARPVL
                     VDGRIRGYVHGDVPLGKLLRQQKLEHFPQTEIVDVEIPRLFPSVMVFSTPSRLMRSVW
                     NMPQAGIEWIGTMEQLFMPVDLCKSQSMSRAGNAAIHRELSATNIFSLLASFIPFSNM
                     NQSPRNIYQCQMGKQAMGVPFHDWDRRFDTKSYRLLTPQQPLVQNRSEAQAGWSKVFG
                     SSFNAVVAVISYTGYDMEDGMVINRASLDRGLAHGAIYGCEFVDLDQLNVAKDARFSR
                     LPAVGERMTPGSVLYSIQGRRPHLYRNSETSYVDAVLLAENQRRVAIRTRTPRRPVIG
                     DKFASRHGQKGVLSAIWPAEDMPYTSDGIVPDILFNPNGFPSRMTIGMIVESIAGKAA
                     AVHGAVPIDASAFERETEDASDRSNEPPHDFFGRLLLNTGYTYHGTETMYNGYTGEPF
                     VVQIFIGVIAWQRLRHHIADKFQVRTEGIVHQTLRQPLRGRKRGGAIRLGEMERDALL
                     ASGAAYTLQDRLQSCSDLHTVYVSALDGSLLAPIAAPNERLGATSRISVKSRTNTRSP
                     VVRVHMPYAFKYLVYELAAMNIRVSLPVK"
     gene            complement(<292753..>294636)
                     /locus_tag="CYME_CMS115C"
                     /db_xref="GeneID:16997577"
     mRNA            complement(<292753..>294636)
                     /locus_tag="CYME_CMS115C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538726.1"
                     /db_xref="GeneID:16997577"
     CDS             complement(292753..294636)
                     /locus_tag="CYME_CMS115C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538783.1"
                     /db_xref="GeneID:16997577"
                     /translation="MSRDRIYQVGVVFEHDVLTDSSDEVESTSATCSERDEKLPSAAQ
                     NAPRSLGGVPDSIERARRDQKQERYQRFDASQGTRRMTSMERSGTSFSLAGGVQSERS
                     AGAVSAETADNDEALFQKFCASLLAPSATAALDELLFEDDGDFELRQVDFENSEPNEE
                     YRADTGARISSEELYQLVAEDCQRTLPGNEMKESAESFRSTTTPHRAFTEATPRRPRV
                     HRESPSVGNASCERERLFQMLKFKLFKPEQERELSKQLHIHVQLLLHILLISSQRRAN
                     IDLSPEHVVHRQRAREAAWMMLDDLRRKRDVAREYRRALGGIERTFFDAMPLDLLEQI
                     EQLLVKPALSNPDGLVTAVEAKRAYAVLESHPSMILPEYRLAYGVDIESDPNILRALA
                     SSADAELFWTEAEDTLLERCLSRHGVMWQEHIDDYLPHRNLEECVGRYRLLTRRDAPA
                     NPIKTLKLKAQQPLSVQEIELLRHGVMTYGECWDAIQAFLLPGRDKVLLERVWRRVSI
                     RARKELRRRRRRQEASLRQASGEGLQRTPAPVVVHDSRHVTERPRTDGTEARHAQTER
                     CQELMWEPFSPQEDRELLLLARQYLGSMSESAAFELVAQKMQRKRPPEAYRARACELI
                     ALL"
     gene            complement(<296013..>296216)
                     /locus_tag="CYME_CMS116C"
                     /db_xref="GeneID:16997578"
     mRNA            complement(<296013..>296216)
                     /locus_tag="CYME_CMS116C"
                     /product="similar to protein transport protein SEC61 gamma
                     subunit"
                     /transcript_id="XM_005538727.1"
                     /db_xref="GeneID:16997578"
     CDS             complement(296013..296216)
                     /locus_tag="CYME_CMS116C"
                     /codon_start=1
                     /product="similar to protein transport protein SEC61 gamma
                     subunit"
                     /protein_id="XP_005538784.1"
                     /db_xref="GeneID:16997578"
                     /translation="MEALSLLSKPIVDFAEKSVRLWKRCTKPDQKEYARVAQAVLLGI
                     LLLGLIGYFIRLIHIPINNILLG"
     gene            <296692..>298053
                     /locus_tag="CYME_CMS117C"
                     /db_xref="GeneID:16997579"
     mRNA            <296692..>298053
                     /locus_tag="CYME_CMS117C"
                     /product="similar to alpha-1,2 glucosyltransferase"
                     /transcript_id="XM_005538728.1"
                     /db_xref="GeneID:16997579"
     CDS             296692..298053
                     /locus_tag="CYME_CMS117C"
                     /codon_start=1
                     /product="similar to alpha-1,2 glucosyltransferase"
                     /protein_id="XP_005538785.1"
                     /db_xref="GeneID:16997579"
                     /translation="MPRPERELARKRRFLPWVGFVVLLLLAQVWLQARQPLPYMDELY
                     HIPAANAVCCRVVSVACEQNKLSVEWGRITTPPGAYYFGCPLCLLWRVWRYATCPPWL
                     WRLAVGTIPLALATRELMLFPGMSAEEAITLATFLPLFFSSLLCYTDTLAFMLYVRAW
                     RQQRGQHPTSPLQSAVFGMLASLTRQSYIVWHTFLGLTALGAAASTTAQLEIIFAHGT
                     AGLAYVAFFVWHVLIKGGSIYLGDAERHGLSTHWSNCLYFVTTWFILAGGWRALFLQS
                     AGNSSVGKYLAVRAEAIRQSWRRFICLTTVAAIAVRRGTCIHPFVLADNRHYVFYFFR
                     YFIIPGNLRRYTLVPLYAVSMACWLSHLRSTGRMERLLLFSATALTLVPSRLVEPRYF
                     IPPVVATELLAAQRQRRTLSTIRMILNLLLAFVCLWFFLERPFERTPDLHISDPSPGR
                     FMP"
     gene            complement(<298706..>299761)
                     /locus_tag="CYME_CMS118C"
                     /db_xref="GeneID:16997566"
     mRNA            complement(<298706..>299761)
                     /locus_tag="CYME_CMS118C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538729.1"
                     /db_xref="GeneID:16997566"
     CDS             complement(298706..299761)
                     /locus_tag="CYME_CMS118C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538786.1"
                     /db_xref="GeneID:16997566"
                     /translation="MLPKSRLQRYGPFAYPLVSGLTFCVLFLALDRDLPQKTFPYAAH
                     WHIFCWQVVLFGALLSVSLRDPGTVTAAAVKSAAEREPRYDGVLYVAGVKCEFCGLGR
                     LPRVSHSSVTDRCIECHDHYCLWVNNDIGRRNRPHFILFLFLHVCAVIHGFLISASAL
                     LDQIQRCGPPFEAFWTGSRRVDTQRLECMYFDEFFCVLSFSFLLCVVVYLFGFHLYLA
                     SKNMTFKEYYKWKAVLFAWKELQTTREGLEAPEPQDLIFETFPTLEFVDDSHRSMFQE
                     RDENLGDKHEHAKAADLVSSTHQSWPWNHRGAPPGTGLDLQDSNPPPVHFPYDRGSAW
                     RNFCEVLCNAFERTSRL"
     gene            <301363..>303900
                     /locus_tag="CYME_CMS119C"
                     /db_xref="GeneID:16997567"
     mRNA            <301363..>303900
                     /locus_tag="CYME_CMS119C"
                     /product="similar to Stat3-interacting protein"
                     /transcript_id="XM_005538730.1"
                     /db_xref="GeneID:16997567"
     CDS             301363..303900
                     /locus_tag="CYME_CMS119C"
                     /codon_start=1
                     /product="similar to Stat3-interacting protein"
                     /protein_id="XP_005538787.1"
                     /db_xref="GeneID:16997567"
                     /translation="MGDLSLGFEKSCVEIEQKLVGCRRAGYHALDCIRLKCSSEGAAV
                     TQSLLAFSNDRAVYVTNLTGIRYSLVSHEGIVNCLRWQRLGGQGNLYGTGVLVSGDAA
                     GALCVWRPQGLIHRFDLAKLFSTTDSATDHSLFSIVCLAVPPGAGEVATVGTSGPLFS
                     CTSGGYLYAFEYANTASAVQLTALPESVDCLPLGSGAIRSEQSFDGCYLVFVGNTIGT
                     IEGFLYNSKHQTFARTTTIEGHADCIRDVALHVMDIRNQCADQLQNRRNATGHVLLAS
                     ASQDGTARLWLVASSTHQGHLDLIDDPECLTVLYDHQSAVTTVKFIRGSCCADERPRL
                     LTAAFDRTVKLWELSGDSAPRIQRVAEMGVIGEQSSFHGFYSAAYGEWDDGQSVVFAT
                     TYTGAVFQWRNASSQNLWRNDEPCIRGHNLGVTDLDWCPPDGLMLVTVSRDMTCRLFA
                     KAQVTTAYQWVELARPQVHGHEIFAVRFVGKSGLKLASAAEEKAVRLFDAPQQFVEEL
                     SGILQTTRPEACSDGKPRPVRASRIALSLTNQPEYEASESNEGEEIHRDLSPSAGRLG
                     RFPASGASPRTEATLQQDTLWPECEQLFAHPNNVQRLDSIEQQDGSFILASACVAQSM
                     RESAIQLWEIQDAAVELHDLRCHDLTVTDLRFAYRIVGKTRRNLLLSVARDRSWIVWN
                     VHSREVISRRKNAHARMILTCAWVDPQQGLFATGGRDKCIHLWQVSNFDAPEAESLAE
                     PLQSWRLHSAVTAMDVFSDRPDRAIVLAGLESGALHGFSVSTVAPYCSKALQMSENVR
                     HVRAVSRIRFRPRSRGVFASCSEDGSVMIARILTTEKNEVADTVSTF"
     gene            complement(<304301..>307540)
                     /locus_tag="CYME_CMS120C"
                     /db_xref="GeneID:16997568"
     mRNA            complement(<304301..>307540)
                     /locus_tag="CYME_CMS120C"
                     /product="guanosine-3',5'-bis(diphosphate)
                     3'-pyrophosphohydrolase"
                     /transcript_id="XM_005538731.1"
                     /db_xref="GeneID:16997568"
     CDS             complement(304301..307540)
                     /locus_tag="CYME_CMS120C"
                     /codon_start=1
                     /product="guanosine-3',5'-bis(diphosphate)
                     3'-pyrophosphohydrolase"
                     /protein_id="XP_005538788.1"
                     /db_xref="GeneID:16997568"
                     /translation="MECPSFISVYAPRSYRESNNYATNLSTTKTLFWSPNQRRFERPT
                     IRRPRCRKVLKDLLLSGSDFQITKGSLDGVSPESKPRTLTHAERELFTQSFHSLREKA
                     NYLDKEAIESLHRALEVAFAAHSGQLRRSGEPFITHPVAVALLLAELRMDVDTLIAGL
                     LHDTVEDTDLTLDAVESLFGHVVRNIVESETKVSKIARKMKPSNAVSGANGALMAPVS
                     MIAAAASAAAAAATAAAAAVRSKFKGLRLDHDLAGGEEIDASTLDQNFEIRATVANGT
                     VTEHSPNGAAPNFRKSSKEEQQAEYIRRMFVSMAEDIRVIVVKLADRLHNMRTLEHMP
                     PLKQQSIAQETLGIFVPLAHRLGLARIASELEDLSFRFLHPKEYGLLSEQVRIYKDRT
                     NLEMNLAHAADALVDSLENDSILKPLVREICTKVALKNLFSIYQRILQGARLENIHDL
                     ATVQIIVGLSEEHYDPSFGRNICYHILGRVHSLFRPFPGHVKDFVAYPKPNGYQSLHT
                     LVLLGPKGGFHPVEVQIFTDSMHVQAEYGIAMEFWPETRLRSGQQAAGNGTLHSPQNH
                     WQKHSEDWLRNILEYCKEYSGNSKDCVDAVQKDLLGNRVYVFTPKNYILDLPKGSTVV
                     DAAYHIHSDVGNQMIGARVAGRFVPLDYELSNADSIKIITSPAAPGPSREWLRYARSR
                     TAKQKIRRFLRSREVKEACERGRELLQAAARHLCVDENEIPNDLVLESALPILVPKVC
                     APARALEIRCLEDLLVYVHRFGGLTAAAKILCHFCRDIDPDRIRTLEELHTTAASNND
                     VHAAADTGVPDTEIDGTFAEEETSPLYLRSSARDPPANYQTLEAAEFPEKDAERYLER
                     SLPERERQPGTDSSSSRTLSSGASNAAEACEDIHPECFAACCCNPVPGDRIVAIRIRP
                     ASHGVPAAFEVHRLRCVRCLASLRGDPEACVSVRWCAPRSRYPVRLALMARDGPGLLS
                     RIAGTISSEGISIVGSSSRISRDTAILFFEILVQDKYQIERLRTRLLAFEDVLETCRV
                     RDHLGGNETHAMSSYAQTLARLKSGEVEILSMAGSLLEHEVEDADNEDE"
     misc_feature    307754..309398
                     /note="repetitive element"
     misc_feature    complement(311261..311737)
                     /note="possible transcribed region"
     gene            <312553..>313938
                     /locus_tag="CYME_CMS122C"
                     /db_xref="GeneID:16997227"
     mRNA            <312553..>313938
                     /locus_tag="CYME_CMS122C"
                     /product="probable farnesyl-protein transferase
                     beta-subunit"
                     /transcript_id="XM_005538732.1"
                     /db_xref="GeneID:16997227"
     CDS             312553..313938
                     /locus_tag="CYME_CMS122C"
                     /codon_start=1
                     /product="probable farnesyl-protein transferase
                     beta-subunit"
                     /protein_id="XP_005538789.1"
                     /db_xref="GeneID:16997227"
                     /translation="MAQNVEDARLKAEEEEQLQRSLLSIFLRRRDIWEEVCGDLLFDP
                     LYEWCDYPTAKDQRAVERAIIDVDFGRAVVLLRQKRFTDDDDSILERRLVGLLRCLYL
                     QEPPSSLVQDLEAEFCQEHFTREKHFNFMDGVLDSRRELGEEYLSLEASQTWILYWIA
                     HSLNILGRKLTESEARGITRFCLECRTEQGGFGGGIGHHPHAAATFAATSALFIAGTV
                     LPEAFEVLDRRKFLHWVLRDLKISLPEGAAFRVTRDGESDVRATYCVLATASLLGVLT
                     EELASGVASWISCLRAFDGGFGGEPYNESHGGYTFCALASLRILNDSGFLSEKEFESL
                     VNPCRKWLLLRQRQFEGGFQGRPNKLVDACYAYWIGASCKIVDVEFNASALARYLLRY
                     CQDFETGGFRDKPGSDPDFYHTCYALSGLCLTGWHALGENGTKVELLELDPIYNLTTN
                     ALKQAKEFFAD"
     gene            complement(<315215..>318820)
                     /locus_tag="CYME_CMS123C"
                     /db_xref="GeneID:16997558"
     mRNA            complement(<315215..>318820)
                     /locus_tag="CYME_CMS123C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538733.1"
                     /db_xref="GeneID:16997558"
     CDS             complement(315215..318820)
                     /locus_tag="CYME_CMS123C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538790.1"
                     /db_xref="GeneID:16997558"
                     /translation="MSTKNLLRAIGAAQLTETISLLAQRDTCSEAGLFLLEIASELGE
                     EEALDEACKIIKQHVCQPSPAVTERFLELLPLYPRTLLPYSAHIISGSQEDVNNAFLV
                     YKELVALDRSLLVPVLASASELPLSGKLHAGVVELALQSLGNVEENEIPSLIRALLKL
                     SGSKSGLFFKRIREYLKDASPELLFLVVEVLDDVSRIDRYVLERIFSDSFTEGRDEKK
                     CLDDLGHPRKASNARNGHRNRFRYRPSPDQISPFDFCLWLFMLSRIRMDRIAEIAISE
                     SLIARRLNAMCLRGILATYMSAFERFPTGALRFLRILCSHEKSWDVLEVCLPTFFDSY
                     ASIRSDIVKDLLGVCFSGAVPLQSAKYRSSRKHGGAFRIKAASALLELCRSRTQTMLP
                     FAPLILDRVSSFSHMLQTETMLDMFALVFQTLGEKDSRILSNLSSLIRKQALWQWNTA
                     CSMARLYVRATTRGCDEQERLVVLRSILENVPMDAQEVFAASLLGLIADSAEHGINPD
                     GFAAILEKIIPSDIFHGCRIFRTKSLSKSMPHFTRQALRAYIACTDSSWRDFQVAVPR
                     NVFKLYEASIFAAYEQEPTGPSENFSSVLTELATDICSMQTVEVSKAVECAIHGREIL
                     LGAMEHCRRPVPPELAWVFAHALDQLERAIAVGIFIFLERAPDSRNAMTRIEALYRSI
                     SEETNVPLLVQRIIKSDLLHSTGQIFCLLDELETGITEDLGGLKHFADLWNPAWLSYL
                     CEKTCLCMRETSPLCMALAPALLRLWHLTVWYYIGAGGTEIEQNLVFDVLEYFETLTH
                     GARTVLEAILATNVFETCAKLRIKHWKQTHPSCSFALQLRERCTMLRKYALTRKFDAE
                     PNAKIVRKYLNSPCGGNSRHPFLSERYRVWKWLYSLPESCLPNEVGQLLDVLENWSSP
                     STHPRFNCVTNASIPWIALCLPRLLIRESHGHLRNQLRSSHFSIEVCRRVFAVVQNAR
                     SDRQTCRVVFFSELLAVLPVLRSRLDRLNRVQPPQGMELVTVRDAIAFVFAKALNLCE
                     TLCEATKMSNSFTEVGSFDNSANKRLMKLSPRILLRTEELRGEIISWCKLYSYDIEGL
                     LHGPTSSTRTNNALELIFGGEDRDSTDIVSDASQTDFLDSEDSFSDDIEASERCDIDS
                     VYDEGSDEDGTQASEQSEQEFYVRGGFGCPALEKDSAHATVSIRFNKSITSRNAL"
     gene            <318901..>321063
                     /locus_tag="CYME_CMS124C"
                     /db_xref="GeneID:16997559"
     mRNA            <318901..>321063
                     /locus_tag="CYME_CMS124C"
                     /product="valosin-containing protein"
                     /transcript_id="XM_005538734.1"
                     /db_xref="GeneID:16997559"
     CDS             318901..321063
                     /locus_tag="CYME_CMS124C"
                     /codon_start=1
                     /product="valosin-containing protein"
                     /protein_id="XP_005538791.1"
                     /db_xref="GeneID:16997559"
                     /translation="MPSQTLRHWSGRADSPEFLSFVRQLVEDQGEVEKTSLDQLVTEI
                     SKVFVGFSRLPTRAKFQAAAKALTLVQSVEQNVNTEVYRAAGCARLPSKVGSRIPDGN
                     HFVTSVQESSRETTASVKRHRQVDPNMPHTPPRAPLSRSSFLTARPKQRYEDIGGIES
                     ILSHIRELVEWPLRYTELYKHLGVDPPRGVLLHGPPGCGKTLLANAIAGELGVPFLRL
                     SAPELIAGISGESEQRVRSLFDEAKSLAPSLIFIDEIDAVTSRRETSSREMQNRVIAQ
                     LLSCLDSISLQETGDRLVIVIGATNRAEALDPALRRAGRFDREIEIGAPDEEAREKIL
                     RNVTRRMLLSEDFNFRTIARRTAGYVGADLAALATEAASTAIRRIGNDLLPTDTTVNG
                     AASVDFANISMLRITIDDFLVAIGKVQPSALREGFATVPDVSWEDIGALDDIREELEM
                     AVIEPLREPEKFARFGIGISAGVLLYGPPGCGKTLLAKAVANESGANFISVKGPELLD
                     KYVGESERAVRRLFQRARSSAPCVIFFDELDALAPRRAFGSFGASASADNDAGGSNAS
                     ERLVNQLLTELDGMNPRRQVFVIAATNRPDLIDAAMLRPGRFDKLLYVPLPDETGRHA
                     ILQTGLRGMPLDSRVDLRAVSGATKGFSGADIAALIREAAVRALRSEAPAIGAEHFRK
                     ALENIFPSVSPGDAARYDSMRQNLRRARGHVNENIFTI"
     gene            complement(<321089..>322237)
                     /locus_tag="CYME_CMS125C"
                     /db_xref="GeneID:16997560"
     mRNA            complement(<321089..>322237)
                     /locus_tag="CYME_CMS125C"
                     /product="alcohol dehydrogenase class III"
                     /transcript_id="XM_005538735.1"
                     /db_xref="GeneID:16997560"
     CDS             complement(321089..322237)
                     /locus_tag="CYME_CMS125C"
                     /codon_start=1
                     /product="alcohol dehydrogenase class III"
                     /protein_id="XP_005538792.1"
                     /db_xref="GeneID:16997560"
                     /translation="MSSTQGKVIRCKAAVAWKPGQPLSIEEIEVEPPKAGEVRAKVVA
                     TGVCHTDAYTLSGADPEGVFPVILGHEGGAIVESVGEGVTSVKPGDHIIPCYIPECGQ
                     CKFCRSTKTNLCSAIRVTQGQGLMPDRTTRYSCNGRSLFHYMGCSCFSQYIVLPEIAV
                     AKIRQDAPLDRVCLLGCGITTGIGAVLNTAKVEQGSTVAVFGLGGVGLSVVQGARIAG
                     ASRIIGVDTNESKFPLAKQLGATECINPLKFGEKPIQQVLIDMTDGGPDYTFEAIGNV
                     KTMRAALEASHKGWGVSVIIGVAASGEEISTRPFQLVTGRTWKGTAFGGAKSRTQLPE
                     LVDMYMKGVINIDDYVTGTYKLDDINRAFEEMHNGRSIRSIILMDDDA"
     gene            322404..323912
                     /locus_tag="CYME_CMS126T"
                     /db_xref="GeneID:16997620"
     misc_RNA        322404..323912
                     /locus_tag="CYME_CMS126T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461653.1"
                     /db_xref="GeneID:16997620"
     gene            complement(<323055..>327527)
                     /locus_tag="CYME_CMS127C"
                     /db_xref="GeneID:16997621"
     mRNA            complement(<323055..>327527)
                     /locus_tag="CYME_CMS127C"
                     /product="similar to nucleolar phosphoprotein"
                     /transcript_id="XM_005538736.1"
                     /db_xref="GeneID:16997621"
     CDS             complement(323055..327527)
                     /locus_tag="CYME_CMS127C"
                     /codon_start=1
                     /product="similar to nucleolar phosphoprotein"
                     /protein_id="XP_005538793.1"
                     /db_xref="GeneID:16997621"
                     /translation="MESKCSQGDKHLSEEEAGDSRLHGGRLRNSGLLGALFQFLHSVG
                     LKRTAESLAHESAEKLAKKRARCECDATIHRAESSSEIADNSSDSSSSHTAGLSIQRS
                     KRLSFAIEELDARLLEESGIDARTYKWASETDAKWSVSPVLSLSAAGAALTGRRRSEK
                     VSVRAPAQSIPDSGGPGAVSEAVAISKNESAPQERERRARADSGAVGSAESRFYASAF
                     PRKKGSVLDNERPQPDVFSSSSLKLLPESVVLVESTSESSSSDGERVTRRAGSVQPPH
                     RASAKRALASTATSSSSSSSSSSLEAAEARKVPPRTAGVASSTSESTSESSSSDSERV
                     TRRAGSVQPPHRASAKRALASTATSSSSSSSLEATEARKVPPRTAGVASSTSESTSES
                     SSSDGERVTRRAGSVQPPHRASAKRALASTATSSSSSSSSSSLEAAEARKVPPRTAGV
                     ASSTSESTSESSSSDGERVTRRAGSVQPPHRASAMRALASTATSSSSSSSSSSLEATE
                     ARKVPPRTAGVASSTSESTSESSSSDGERVTRRAGSVQPPHRASAKRALASTATSSSS
                     SSSSSSLEATEARKVPPRTAGVASSTSESTSESSSSDGERVTRRAGSVQPPHRASAKR
                     ALASTATSSSSSSSSSSLEATEARKVPPRTAGVASSTSESTSESSSSDGERVTRRAGS
                     VQPPHRASAKRALASTATSSSSSSSSSSLEATEARKVPPRTAGVASSTSESTSESSSS
                     DGERVTRRAGSVQPPHRASAKRALASTATSSSSSSSSSSLEATEARKVPPRTAGVASS
                     TSESTSESSSSDGERVTRRAGSVQPPHRASAKRALASTATSSSSSSSSSSLEATEARK
                     VPPRTAGVASSTSESTSESSSSDGERVTRRAGSVQPPHRASAKRALASTATSSSSSSS
                     SSSLEATEARKVPPRTAGVASSTSESTSESSSSSGCSRCSARMNMSDFGTSSEPNLPV
                     PPGKISASRTAPGRIEERFQDSLPNTSDHQLIASHCDRNDNISVHSTGGSSCEPSRHY
                     HEINGSLANGNTDGISPSLESREMKMQMNSYHAEDLASGKVQEQRTGNAASSGSQYFH
                     GELHGRNPLGRHATQHIPEGEGKAPRNRGVRTNHAGSEIANGRASRDASSRKGNVAQS
                     QNPAEGTERTSQRKVLIGTDSAPAAVTESCISDDVQCGPSNTSKPHNSSLMVGQNKTM
                     KWDSLEEQYRFHAQDGGDLPVCANQIQNHQKRDTGKPLDKRTRREHGSPCSSWHSLTE
                     NCHTKAQKSNVCAGFRKPERLHSSKDADPRYKPRAAMEDGGNGIAFDGLRACSSNEQI
                     GSAFSASQIDSHPGMLAQSTDMAPRVTKPVSAMGRKSQSSTQTILSDPRDDSAGSIIV
                     EGSGDKSQCDVAGASSSKLNPHPQAAPKSDRAKRVPQANTPFRRIQEERFFSSDVTLI
                     DPTPRDQHAQKTWAELSAYQGKAFRKMKTKRKRSGSFCGKISLEPRSMKFDAYT"
     gene            complement(<330383..>333043)
                     /locus_tag="CYME_CMS128C"
                     /db_xref="GeneID:16997622"
     mRNA            complement(<330383..>333043)
                     /locus_tag="CYME_CMS128C"
                     /product="ATP-dependent Clp protease, ATP-binding subunit
                     ClpB"
                     /transcript_id="XM_005538737.1"
                     /db_xref="GeneID:16997622"
     CDS             complement(330383..333043)
                     /locus_tag="CYME_CMS128C"
                     /codon_start=1
                     /product="ATP-dependent Clp protease, ATP-binding subunit
                     ClpB"
                     /protein_id="XP_005538794.1"
                     /db_xref="GeneID:16997622"
                     /translation="MTSPVTMVALVLRTLRNSSKAPWGGAALLGTSVGRSESWPRALV
                     GDAPAGPLLHASRSLRRWHSVRRLTMFFNHQAGVLALSERCRRLESLRGAVLNRFNVS
                     SRNLERVVGIRGFATGMGHTNDRTGATGQPPGWVHPENVPVGEALKKYGRDLTSAAAL
                     NRLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQRIARGDVPESL
                     KNKRVVALDLGALVAGAKFRGEFEERLRSVLRDVEELQGSVILFIDELHMLVGAGAAE
                     GSLDASNLLKPALARGDLHCVGATTLAEYRKYIEKDAALARRFQPIFVAEPSVEDTIN
                     ILRGLRNRYEVHHGVRIADRALVAAAVNAHRYMTERKLPDSAIDLVDEAAARLKMQQE
                     SKPEAIDDLDRRLIRLRVELEALRLERDPVSRKRLSAVEGEVRELEHQRSQLALQWER
                     ERAQLQAMKQAKEELEKALHEMEMAERRGEWEKVAMLRYKTIPEIESRIPAEHRTILL
                     SDSAQGTTATTLNVAQNEAETSGKLVAEAVTEKDILQVISKATGIPVQALMSSEKERL
                     LHLEDHLSKRVVGQPEAVRTVASAIRLSRAGLHAHNRPIGSFLFLGPTGVGKTELCRG
                     LAEFLFDSPDAMCRLDMSEYSERHSVARLIGAPPGYVGYEEGGQLTESVRRRPYQLVL
                     FDEFEKAHRAVCTVLLQVLDDGRLTDGQGRTVDFRNTIIVMTSNIGADILASLPDGVP
                     SSFARDEVMVQVRQFFPPEFINRLDDIILFNRLGREILKDVVRVQLDALQKLLRERAD
                     LRLDISDDVIQWLVEHGYDPVYGARPLRRVIQRAILEPLSRHLLQGTVRHGEDVRVRI
                     SKQAESLSGATLEIEPNHDVGEAKKEEHDL"
     misc_feature    333231..336004
                     /note="repetitive element"
     gene            <336092..>336799
                     /locus_tag="CYME_CMS130C"
                     /db_xref="GeneID:16997623"
     mRNA            <336092..>336799
                     /locus_tag="CYME_CMS130C"
                     /product="probable signal peptidase I"
                     /transcript_id="XM_005538738.1"
                     /db_xref="GeneID:16997623"
     CDS             336092..336799
                     /locus_tag="CYME_CMS130C"
                     /codon_start=1
                     /product="probable signal peptidase I"
                     /protein_id="XP_005538795.1"
                     /db_xref="GeneID:16997623"
                     /translation="MEGPEANPSCSEVLTPSSALPRAEATRTALGWFWFRVRTCFGQG
                     DAATQKLEQRSFVQRLLPLCTLVLTLCLAFTLWRALVLWTYSESPVVVVLSGSMEPGI
                     HRGDILFLYNRTAAERPLRVGDMVVYSLRDRSLPIIHRIIEVHRRASESIGDGTRASN
                     SSILEYFLTKGDNNFGDDRGLYPADKKWLLRSDVIGRVIFTIPKVGMLTILMNTHKWL
                     KYALIGLLSLTLLFISE"
     gene            complement(<336820..>337782)
                     /locus_tag="CYME_CMS131C"
                     /db_xref="GeneID:16997594"
     mRNA            complement(<336820..>337782)
                     /locus_tag="CYME_CMS131C"
                     /product="unknown protein for iron-sulfur cluster
                     formation sufE"
                     /transcript_id="XM_005538739.1"
                     /db_xref="GeneID:16997594"
     CDS             complement(336820..337782)
                     /locus_tag="CYME_CMS131C"
                     /codon_start=1
                     /product="unknown protein for iron-sulfur cluster
                     formation sufE"
                     /protein_id="XP_005538796.1"
                     /db_xref="GeneID:16997594"
                     /translation="MARLCGGGCSGPAFACNPTALRTQRRFRGCSSSGERPSFSQPRF
                     VRAQRRRTARLALLRACGNEDPGNHSGQSRTTEKLQGLVDAFKKLGDQKLRVQQLLHM
                     ASTLPPFPRERRVLANRVRGCLSVVHVDAFLDKEGKVEFIGDSDSQLTKGLVAFLIRG
                     LSGYSVEEVCAVTPDFIKESGLGVSLTPGRTNGFLNMLRTMQEKARMLGMGEANSMQS
                     TANGKVSMKEVIENKLQVLKPDLIEIRDDSAKHRGHEGAHERRGETHFTIKIVSDTFK
                     DMPEVKRHKLVYALLSEELNSRRIHALSIITLTPIEAHSGPGVA"
     gene            complement(<338867..>340681)
                     /locus_tag="CYME_CMS132C"
                     /db_xref="GeneID:16997595"
     mRNA            complement(<338867..>340681)
                     /locus_tag="CYME_CMS132C"
                     /product="mitochondrial intermediate peptidase"
                     /transcript_id="XM_005538740.1"
                     /db_xref="GeneID:16997595"
     CDS             complement(338867..340681)
                     /locus_tag="CYME_CMS132C"
                     /codon_start=1
                     /product="mitochondrial intermediate peptidase"
                     /protein_id="XP_005538797.1"
                     /db_xref="GeneID:16997595"
                     /translation="MLCSRGLFGLRGLHVPQDWQTIKHQTLKACNDLVYKILSNREGS
                     VLQDFDELSDTLCQVLDASELARNVSAEPEHVEASESVFRELSQYMQELNCDENLCGA
                     LLRKQDAVTCEEQALVRSLQRDFALRGGASLSPSKRKHVAAVQNEILEWSMRVTAVFR
                     DAEKSPGKRFGSANVNIAWNSLTALLNKRSELAQVLSYPSYAHFVALDKLLRHPHGVV
                     SFLNSVSSMLNEVRRKRQHDSLSLQRSRCSSLARRLQPYLGVDSVLEVLSGLLCELFG
                     IRIYRLRQNQVRGVIWHPSVEHAMLVDARNGNFVGEVFFDLFARDGKMPGAAHYALRG
                     SRRLRDGSSQLPSAAIVCDFPPIIRKAGMQHYQLETLLHELGHVLHTIMSRTRFQHLS
                     GTRGPMDFVEIPSHLMENFAWDAAWMRRFAPNGPRQFLAELEEARQEAVVAEIALQTP
                     FAALDLALHSHDHFGWGNEARSKIKRIIAEVVREYGRLEQVLYRDGIPYMPHIIGYGG
                     CYYSYLLARILAAEVWNRLFRDSKLSMAAAGELLRNGFFRFGASKEPREILATVLNGE
                     EPSFRGIAEAIGMADSQYATLPVLASANRSELCAEPSA"
     gene            <342539..>343408
                     /locus_tag="CYME_CMS133C"
                     /db_xref="GeneID:16997596"
     mRNA            <342539..>343408
                     /locus_tag="CYME_CMS133C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538741.1"
                     /db_xref="GeneID:16997596"
     CDS             342539..343408
                     /locus_tag="CYME_CMS133C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538798.1"
                     /db_xref="GeneID:16997596"
                     /translation="MENLSFREIREKNASRGVPSRTVRCTTRWTEAPQVRRQSFSTPE
                     AVFASEKTRFCGERQLQRRRRTQLCAWGLVEGSAVIGILGILVTLNIVSRISDSARGT
                     RLWSREQRGLFVRRRPPPRERCTKCGGFGIVRCSLCRGSGFVLYEKKLQHSDPCPLCT
                     ARRYIRCGMCHGSGRRKLVRRHDPALSSIRLSDPTSLYNAFRAWREEFVRRGSLSVGF
                     LNHEGLLNRAFRVASAFADSLKSGIGRSWCTVQERVRAGIEQHLEARKKARMSRIARA
                     RSFLEERLQKESQ"
     gene            complement(<344525..>345019)
                     /locus_tag="CYME_CMS134C"
                     /db_xref="GeneID:16997580"
     mRNA            complement(<344525..>345019)
                     /locus_tag="CYME_CMS134C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538742.1"
                     /db_xref="GeneID:16997580"
     CDS             complement(344525..345019)
                     /locus_tag="CYME_CMS134C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538799.1"
                     /db_xref="GeneID:16997580"
                     /translation="MNEPKKVWPVQFDPRDNYRRFWPRAGVGLSVGCFVGAGYGVCFG
                     LGRPYRFRRQQCVVVPSLEPFAQDGLVVGCFCGVAFGIGFGSGVARGIGFAWTRKDLL
                     NFRLRSIDYPLSLETSDLETDRLSSDLLNTNQAFNVATAHQSVPAFLRLAVAQWLKQH
                     RAEN"
     gene            <345255..>346571
                     /locus_tag="CYME_CMS135C"
                     /db_xref="GeneID:16997581"
     mRNA            <345255..>346571
                     /locus_tag="CYME_CMS135C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538743.1"
                     /db_xref="GeneID:16997581"
     CDS             345255..346571
                     /locus_tag="CYME_CMS135C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538800.1"
                     /db_xref="GeneID:16997581"
                     /translation="MSNGGSPDRNSLHTVGRNVVLRVRRVGKGKQSVSADEHSSAGHE
                     ESEQPSEVSEFLPNSLLLILGQTNSSLSAGGAFQPIREMQRTLSAHADVDLQVSITDD
                     EAAPTHKSLKLFPLRQYATDIRCEGQPESVEPAQVTGVQWTRSERARMKRSPSGCASS
                     TETGAPASKPLEVEAERSLEHTVDAIGATRSWNWQEQRFYRLRNPRLLLDLVGQPLFV
                     DIQLPPSGASYGQVRRRVQFADDDYDYYVSCDLLSSVQTDSADLDHSDASDSEIVIMV
                     DEPVSTANAGQSASYGHSHEQSSVETQTHRSASVAPWSLLRSRIRRASSECGETVVTQ
                     DADADKCETSTQTSEGSNTDWWEDFEYRGEPYQADDLQPVNGISRDAAYAPGQGLATS
                     TSTSPSIIAAAVTHSLRAWAAYGSDCHDSEEHSPCSSPAWSPDIDN"
     gene            complement(<350034..>351566)
                     /locus_tag="CYME_CMS136C"
                     /db_xref="GeneID:16997582"
     mRNA            complement(<350034..>351566)
                     /locus_tag="CYME_CMS136C"
                     /product="probable N2,N2-dimethylguanosine tRNA
                     methyltransferase"
                     /transcript_id="XM_005538744.1"
                     /db_xref="GeneID:16997582"
     CDS             complement(350034..351566)
                     /locus_tag="CYME_CMS136C"
                     /codon_start=1
                     /product="probable N2,N2-dimethylguanosine tRNA
                     methyltransferase"
                     /protein_id="XP_005538801.1"
                     /db_xref="GeneID:16997582"
                     /translation="MVSGGGAVLAEFREGLASVFYRKGENFINPAQVVNRDLSVLVIR
                     QFWQLVRSEREKHGENGTASAKLHVLEALSATGLRALRYCRETNCIERIVANDIDPQA
                     HTIICRNLQENADLNEILVPNCADAYAYMASHSDTFDVIDLDPFGSAVSFLDPAVRAI
                     RHGGLLCVTCTDSRVLCGTQPEVCFARYHATSLAAPYAHEEAIRLVLGAIAQQANRHG
                     RHMEPLLSLYIDFYVRVFVRIHDDRAAVLNQVAKTGSIYHCMDCSSYWVQPLGRIKTA
                     RATSNCDAKRDRLAVALGPPVHQHCTVCNARDRMVLGGPFYLGALHSLDWVRALRQAL
                     ESGTDDASGELRPPLRELTPHLAAYKRVQALLTLAHEELDTPPFYLHLPTACKALHCS
                     MPPLSAIRHILERRFGYRCSQSHHDPLALKTNAPLRLLWGILRTWAQLEPTKRTPGPE
                     DVRERIQQATADVQFDPPLEPADFARRTTASSSSSGAKKPRFPPHPTKNWGPLKATHF
                     RK"
     gene            353419..354198
                     /locus_tag="CYME_CMS137T"
                     /db_xref="GeneID:16997583"
     misc_RNA        353419..354198
                     /locus_tag="CYME_CMS137T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461654.1"
                     /db_xref="GeneID:16997583"
     gene            complement(<355925..>357754)
                     /locus_tag="CYME_CMS138C"
                     /db_xref="GeneID:16997601"
     mRNA            complement(<355925..>357754)
                     /locus_tag="CYME_CMS138C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538745.1"
                     /db_xref="GeneID:16997601"
     CDS             complement(355925..357754)
                     /locus_tag="CYME_CMS138C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538802.1"
                     /db_xref="GeneID:16997601"
                     /translation="MRNLDPRFSKVVTDRRFRRIKHTDYGTVPDADPRFRVPLEVEPA
                     GPVRAPAAAPRHPSQRPGDEDAERVLYTEVDIWDSTGSEEVSFERADARVDAFAVSAS
                     ASDDSGEAVPRGEPTRRLALVNMDWNHISAVDILAVMRSLAPAGGKVLRVSVYPTALY
                     LSRAEKEAKYGPQFDYDAENLSSDDDLMPKTTHELEEKQKREIELIRRYEKLRMRYFF
                     AVIECDSVVTASALYDAADGIEFERSSNFIDLRFIPDLSHEFESRSPRDTADTVPFDY
                     APQPFATRALQHSNVQLTWDADDQRRLKKLQKRRFTEDELKDEDFKAYLASSTDSEGD
                     HDRDAAWIDAYRKRLLGSDELGESAGSVAEFESSKPDRDVSDGNSDVDMEVTYIPSLE
                     RLGQRIITEREKRELQHEETRLLARENKRSRRAWRRAVPGTTTEVSEQNERNSNEGAS
                     GTESNEHLMNRNVSRDPLLVAYSSREDAASDTETQPATRSDLLSSAASGLSSQHPGRS
                     KQRDASTEPPKAALSMEYDSAHANAGQRRRRRKEKRSKASTDVATNLEMLPFNPDDER
                     FRAIYEDHEFAIDPTNPRFSRSKEANVLLLRKRLEKRRSRSET"
     gene            complement(<358870..>359418)
                     /locus_tag="CYME_CMS139C"
                     /db_xref="GeneID:16997602"
     mRNA            complement(<358870..>359418)
                     /locus_tag="CYME_CMS139C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538746.1"
                     /db_xref="GeneID:16997602"
     CDS             complement(358870..359418)
                     /locus_tag="CYME_CMS139C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538803.1"
                     /db_xref="GeneID:16997602"
                     /translation="MTLSLMLCACRSSITRLPGLCSSGTSLATKSPWNRYGSVFYFSK
                     KSGNLESPAAESSASASDGPAVSKASHDAVAELATARVFGQEWTQSTRGMRPSTNARA
                     WKASELRLKSTDDLHRLWFVMMKEKLALLSERDFCRRNQLLWKGSSDLWKLRKGMARL
                     KTVVGERIRQKQAEQRERKWTE"
     gene            complement(360165..362880)
                     /locus_tag="CYME_CMS140T"
                     /db_xref="GeneID:16997603"
     misc_RNA        complement(360165..362880)
                     /locus_tag="CYME_CMS140T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461655.1"
                     /db_xref="GeneID:16997603"
     gene            <364716..>366851
                     /locus_tag="CYME_CMS141C"
                     /db_xref="GeneID:16997604"
     mRNA            <364716..>366851
                     /locus_tag="CYME_CMS141C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538747.1"
                     /db_xref="GeneID:16997604"
     CDS             364716..366851
                     /locus_tag="CYME_CMS141C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538804.1"
                     /db_xref="GeneID:16997604"
                     /translation="MSTDLEELSAAWQHRLLEEFTVVDAVFSQVVVLVQAGVPVGSPV
                     FRRLIGHILTTLDENVARSRALLWREAVLSARLRERARKPVVRRERLRQQLISEAFKR
                     APSTDHGQQHSVSLESSLKFGLSLLGWPAAADHEDEENRKLSERCTYERSTYGTRFFV
                     SLLRALLNLGLGIERLSENTDALSFYLADVPVEPTELGWSPPSTSSPERSPMLSISPR
                     RFNDGHTAAQLAERSPVKARNVCNGAVRSCKTRSENTEHPAILGANRLTKEPMDPLQW
                     IDICASGSSWKQLIEQEMVVVEHIPRNASIFLECLLGLIARGGEHQETSDAHASETEA
                     SKQCASLSRTLTGVTSLQILFAESVRMECSRKMRSGFFQALPSLLLRALERNTVSPVV
                     VDYELEPQAVPLVAHHGEEEAPSNGAEQLDGYEKRQSYQVAAHSLSKQLDDELSGLSA
                     LLAGVLDLCLAFTDTLATQHLRLSGKKGLRTSFFDESAALLMERGHSFESVAERFQDD
                     VSAAKDFPESAPVVLVPRSAFAVLILYPGSASLKLHICDRILDTFFAVGTAKMTADSW
                     RFKEPSIEKLIWHSMRIRPRDHEGPIRNSDFGMTATIIADAGSSTQAETSHTDTLCVG
                     IVPDSPISSAPKLLEEYLLSMIGLLNGYLGSVLSEREANSASPNIRNAFLETSSSLAA
                     FLEGLIFNPIYASWRWHITDLLESLEREL"
     misc_feature    369272..370047
                     /note="possible transcribed region"
     gene            complement(369748..371249)
                     /locus_tag="CYME_CMS142T"
                     /db_xref="GeneID:16997374"
     misc_RNA        complement(369748..371249)
                     /locus_tag="CYME_CMS142T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461656.1"
                     /db_xref="GeneID:16997374"
     gene            complement(<371904..>372299)
                     /locus_tag="CYME_CMS143C"
                     /db_xref="GeneID:16997610"
     mRNA            complement(<371904..>372299)
                     /locus_tag="CYME_CMS143C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538748.1"
                     /db_xref="GeneID:16997610"
     CDS             complement(371904..372299)
                     /locus_tag="CYME_CMS143C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538805.1"
                     /db_xref="GeneID:16997610"
                     /translation="MSLRSSIWNRQLVRSLQALRSVWTARSERAVVAEPRQTRRHYAG
                     GSDESRIAAGSLGRRWQERETSQENMYFSKEDELVLKRLAAKMARQVAPTEEQLAQER
                     EAIQGVLQKHGIKTTPELVEELVKLRHGV"
     gene            <374068..>374523
                     /locus_tag="CYME_CMS144C"
                     /db_xref="GeneID:16997611"
     mRNA            <374068..>374523
                     /locus_tag="CYME_CMS144C"
                     /product="TATA-box binding protein-associated factor 12"
                     /transcript_id="XM_005538749.1"
                     /db_xref="GeneID:16997611"
     CDS             374068..374523
                     /locus_tag="CYME_CMS144C"
                     /codon_start=1
                     /product="TATA-box binding protein-associated factor 12"
                     /protein_id="XP_005538806.1"
                     /db_xref="GeneID:16997611"
                     /translation="MDNVDRKADGSSPASQSRATVATTAKEPKPGFQQPFAREDAHKL
                     LSRAKLEALLEEVAPGERLDDDVVALLQEHIEDFVESALDYACRLAKHRKSRTIEARD
                     VQLYLQKAWCQRVPGYGVEERVRRRSEVPAHVKRMAEARKQRNIYASSR"
     gene            complement(<374924..>377332)
                     /locus_tag="CYME_CMS145C"
                     /db_xref="GeneID:16997612"
     mRNA            complement(<374924..>377332)
                     /locus_tag="CYME_CMS145C"
                     /product="similar to shuttle craft like transcriptional
                     regulator NFX1"
                     /transcript_id="XM_005538750.1"
                     /db_xref="GeneID:16997612"
     CDS             complement(374924..377332)
                     /locus_tag="CYME_CMS145C"
                     /codon_start=1
                     /product="similar to shuttle craft like transcriptional
                     regulator NFX1"
                     /protein_id="XP_005538807.1"
                     /db_xref="GeneID:16997612"
                     /translation="MPCQSSRESVQVDESLQQSLNRGTFECVICLCRIGRTEPIHTCC
                     ECGNCVHWNCFQRWAKKVPEVAKRNVQDEYPCPACQTWQVLLLEPRCFCGKVVLDGQR
                     RPPSANAHSCGRRCGRKLCIHGGCSQVCHPGPCAPCPGTIEVSCRCGREKFTYRCAEY
                     RKQLVDTCTERLQCGRPCGFEKSCGHRCSKICHPMNAHNGAAAEDEACDETVWMQCAL
                     HDQPFPMRCPGVRHASPVVCTEILQHHCRCGSERFSLTCIDLMDVAYDPGILLCDRLC
                     GKLLSCNRHRCSERCCNDTRHECMRSCNRAADGRRSARCSHPCPLRCHQGACPPCATV
                     SHEPLVCACGRQRIEPPVPCGTLPPICNAPCQKERPCRHPCALGRCHAGDCPKCLHLV
                     LRECIGGHKEHRQIPCSAKPFRCFRACNQLLPCGRHRCKRRCHDWRNPDDSCTKGDPT
                     HPCEMPMSDTRQVCALPCGHSGMHQGGALSAVRPGPSISDVSMEADRPTEDAFARSQP
                     VCKELNANEPAATPGEVAGTCSAPVWTGGSVVVEDIREESCPGSSPTMNRKRDGQEAE
                     AETPYSLFLLEMARNHWEEFLELERLLGMVATATQLRWQVVALNATNARMRAAQHELA
                     SLHYKLHTRSAASHVDRHVVVTHLHGVSRVPKPLLTQVVQQKEFLELKKERDRASRCL
                     AVRVSPFIPAARTGPRSTTGGAANDASNDMPLWSKDFRSHAGNYSIIARNVDGFDFIE
                     FSTPERCQSAWLSLRWKRHLVARKVSESELAKLNSVEMSRQGVTEVRHPLHARTADEH
                     EIED"
     gene            <377927..>379135
                     /locus_tag="CYME_CMS146C"
                     /db_xref="GeneID:16997211"
     mRNA            <377927..>379135
                     /locus_tag="CYME_CMS146C"
                     /product="similar to receptor lectin kinase 3"
                     /transcript_id="XM_005538751.1"
                     /db_xref="GeneID:16997211"
     CDS             377927..379135
                     /locus_tag="CYME_CMS146C"
                     /codon_start=1
                     /product="similar to receptor lectin kinase 3"
                     /protein_id="XP_005538808.1"
                     /db_xref="GeneID:16997211"
                     /translation="MTFVEGLYVRKYPYEHQLCRFSRALCVSRGTRCGQSVRNRRAFS
                     QLTCLFSDLLDWSETENIVVHWEAGELARGSFGVVYAGEHRGTGTPVVIKAAPADDAF
                     ARSLLETERYINRKLRDKAASNGVVESVEPFRWARYVGDVRLPNMSPPTAVARQCAPM
                     ALVWQKEGSGETLEDFLSGKPAAALAQALGTSDTSPGSVRLFRSTFRRVVGELLKALV
                     QLQEWGIMHRDVKPANILVVPRAADDAPLKLIDFGSACDWRSFWKRGFDPDRATCDPL
                     YAAPELFISPLRPDRFDVFSVGLIGLRVLVPTLHSEDRLRECVTLLRTRYQWDIEAWV
                     ADQVKKSARSRPVLQALSTTDNLAEQVALIAEDPALLQLLRAMLRESPFARVSAGRAL
                     ELYNFDAALY"
     gene            complement(<380309..>382279)
                     /locus_tag="CYME_CMS147C"
                     /db_xref="GeneID:16997212"
     mRNA            complement(<380309..>382279)
                     /locus_tag="CYME_CMS147C"
                     /product="similar to nuclear receptor corepressor SMRTER"
                     /transcript_id="XM_005538752.1"
                     /db_xref="GeneID:16997212"
     CDS             complement(380309..382279)
                     /locus_tag="CYME_CMS147C"
                     /codon_start=1
                     /product="similar to nuclear receptor corepressor SMRTER"
                     /protein_id="XP_005538809.1"
                     /db_xref="GeneID:16997212"
                     /translation="MERATGSVARAVSIAAPKGDPGQTERASEPFGEASYKEKKAHLL
                     RRIQEIEEALRQTEEKLRTCQQRAATAQESSVATESYADVGASRGPSAPVDSVLECRE
                     LADIVEQVLGDSRKAVAAAHERLAQHLPGTDQLDALEWETALVAGSTAVADLLVHKQE
                     HAADHALQYWSDTMRSTVIVPSGTIAASGAAGVSPNVGARERHPSESLTSYPKDASLL
                     TAERSVLMQVFRDLYRWHRKYARALRHQYDALTAAWRQRLRRAESQRDERERARTQYR
                     DRYLFLAARSLDTSALSQQRTTVLADLDTYLFEIEMDGGTAGGRSRWSRNLAPIPDQE
                     WLPCSTARYDGGSVLVKDAVAAYQEAQLVNPWTAWEQRIFIEKFLMYYKDFRTIASFL
                     DFKTTADCVLFYFQNKLRLGLRGAFRTYQRLRRANVPVQLCFDADSVPFLVYASQPIS
                     LWVPASDTKTPAVAASSGVVGVLSAFERPWTEDELGLFYQGLSQFGTNFRAIASFLGT
                     RTARECAEFFRMNRRRLGLDRYLPLQEREPEVSQRPEGEAAPTKGDGERDTSVHGKQA
                     ERRGNVAASTALEWSGSRGTAVAGSGRGSAFAIWTPEEEILFAEAFSELGADWRRLAD
                     RIPSKTPEQIYTYWQQQALSEARQSRRSRSGI"
     misc_feature    382468..383847
                     /note="possible transcribed region"
     gene            complement(<382865..>385723)
                     /locus_tag="CYME_CMS149C"
                     /db_xref="GeneID:16997214"
     mRNA            complement(<382865..>385723)
                     /locus_tag="CYME_CMS149C"
                     /product="similar to dna-(apurinic or apyrimidinic site)
                     lyase"
                     /transcript_id="XM_005538753.1"
                     /db_xref="GeneID:16997214"
     CDS             complement(382865..385723)
                     /locus_tag="CYME_CMS149C"
                     /codon_start=1
                     /product="similar to dna-(apurinic or apyrimidinic site)
                     lyase"
                     /protein_id="XP_005538810.1"
                     /db_xref="GeneID:16997214"
                     /translation="MKRLPLRLVTWNVNGLRAFIARKRREHGWRREQLSDDQVLFECF
                     VRELRLAPSGAPPDVICLQELKTRSEDFPDHLARLEHPSYPFWFEGYFSFCASKTQGK
                     TVGYAGVAVYVRCSGRASQFDGCTWEVWRAEEGLTGELPARCLEWPSAPPCARELLER
                     LRSGQISTMRREQQLPTWRALPELHVGDYPEEWSSSGEALGTAEREEHRQLDEEGRAL
                     VLDVCGLILVHVYVPNAANEERLFYKQRFLTCLEDRCLHLVRTQNRIVVILGDLNTAH
                     ERIDHCNPQEAEREAAKLYPKLLESPSLRKAAAGILTGHPAHAPRFTDGAESEQQSAL
                     LGTLLPGSASHTAGVTSRDASAVSTEKVSAPNDRIVFETHPSRVWLHRMLSDDLFRDL
                     FREKWPNRRDAYSCWNTQTQARLTNYGTRIDYILLSCNAGPYLRCTACDLLPNVMGSD
                     HCPCVAELAPVIDTEKWPWTVSNPCVPLRYSYHFHEKQTSLRHIWQNSIRSATGSGKR
                     QRHGLVNRMQQGHLRNEESESVCNVAEESSTQSTEAQLRNETQEALCSVADSDNSLSD
                     HGTKPHRTSVSLVQAIERQVSQKAIQGLAANSPQSIITDAHTAAAAAAASQDAQPQIS
                     SDIYSFWKQHQKPELSASEATNSRLSTRTTRAIIAELLTTGQGQESSEQGQLDVSMRS
                     PHLKRSTNALAACKELPVSVPHHMDRLHLEREGRRACSPPVQAAWSAAAHGLPCGSKP
                     CEAPHASEFAAAAAAAAAAAGTPTDTASLPTIGSARTKNATLSKLHEASAGSKEAADP
                     APASAQQLTLERYIRRTQPQATTTRETPLVVSAQRKLSDPLQADEMSSRPSVRKTDTK
                     AWRALLAVPSADSPRRGTPRCHGHQEPAVLRTVKQGPHRGRQFYVCRRPAGPIERGGR
                     CNFFQWKTALQRESVTATASNSDALVQWDTLPTEPETP"
     gene            complement(<389527..>390813)
                     /locus_tag="CYME_CMS150C"
                     /db_xref="GeneID:16997290"
     mRNA            complement(<389527..>390813)
                     /locus_tag="CYME_CMS150C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538754.1"
                     /db_xref="GeneID:16997290"
     CDS             complement(389527..390813)
                     /locus_tag="CYME_CMS150C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538811.1"
                     /db_xref="GeneID:16997290"
                     /translation="MLSHWTVIQLGFIACLLLLFIRERIQRAVLEQRLWNYIQFGTLT
                     ERQKKPALQLRASRIAGDQAPVLAKQPIPTQSPEESSPQGGRVHSQTGFALLDDTEST
                     EHDTRDTTAPSETESLPRERSAETPDLHISWRNPSSDTHIRPVSAPVSPSGITRELEW
                     RQVAAKEALRRRRAERQSLRLYEEWLEFLAEHSDQQRARHWALERLRWGRQLGASGSF
                     TWSTPEANLRASTSSSTTLNASADEQGIVVSEDEHADALLETSVENLSVLRDVDELER
                     QSERKHLSFTPAFSREPTIARTSSWAEANDGHDADAGAEARANLAAHDAPGAGDNDYV
                     ASDTAAYGKDNNVMAQHVAEAPGSAQQPTGEARPGARAPLCQRELRSSRLSWRWQRIH
                     ESSEIPTGVLVRHLGPESTLDVARATSATRVVGNPT"
     misc_feature    392579..394315
                     /note="possible transcribed region"
     gene            complement(<394655..>400849)
                     /locus_tag="CYME_CMS152C"
                     /db_xref="GeneID:16997292"
     mRNA            complement(<394655..>400849)
                     /locus_tag="CYME_CMS152C"
                     /product="probable sodium/hydrogen antiporter"
                     /transcript_id="XM_005538755.1"
                     /db_xref="GeneID:16997292"
     CDS             complement(394655..400849)
                     /locus_tag="CYME_CMS152C"
                     /codon_start=1
                     /product="probable sodium/hydrogen antiporter"
                     /protein_id="XP_005538812.1"
                     /db_xref="GeneID:16997292"
                     /translation="MNTSAWCPSESDLLRGPATLVRTNLAASAAETDPVGEEIFAICH
                     GFTEWTPSTFMILLFPILAVLLAYAFKSVLDHYRLPVPYTFPLVIAGGIFGVAGCYLN
                     LAQLSASLNYWVDVRNPEVLFYVLLPPLILESALFIDWWTVSNLLLQIFALSMILVVI
                     DAALLAFFTTYVLTDSPWSLNAGWMFGALISPTDVLAVNMALEGSGIRTPLQVMIQGE
                     SLFNDGSGFTLFVLFLTRLQPNASQSIGAIFVQLLRLAGGGLALGIAFALPTLVFLRR
                     VWKDAAIEIGSTFVLSYLVFYVGESPCGVSGIVAVASFGLVLRADRFASLTPEFQDSL
                     LAFWSVISMIINAIAFTYAGFIAVVNLIVFWGRHGIDGKTIAYGLVLYPVLYLSRLIA
                     VVVLYPVLRRSRYGLTWREALLIVHVGLRGAISLIAAQIVFHEPNIQGGTYVNARVQL
                     WTATIVLMTLMVQAPTIKTVAGWLGLLNRSAAQVRTFRAQVRRLHAKALDILLDMQRT
                     SRFTFADWVFVGQVAILPAELSRLLLRVGQVRALVSKATRTPVLMSEHPDSISIASDT
                     NKVMGVSSSSDMEERLPPQKPDEAHWTASAAGPELMDTNSNPSNSITPGTSDTSTNPK
                     STGNLVTMPAPGSTARSTMGSTFGSSFGNAAGNTMNSAFGNNSGNSAGNTILATATAT
                     TAAAAATATSAAWRTSDGTMPGVSARLQGSLPRSSSLPQLVVARPPRVSLAVPRASVE
                     YRMSGSQALRERHSREMQRLSRSLQLERQHQVAKARNRWLPQRPWWLRLDRKQPRTGR
                     SRRMTAAAAGARPRSVRWTTATTNIGPERSAVERSSILQRRRRQQQQHSRRYRRPPAT
                     AVFLHQLNESRRRALLAMRAAVQKQFLIGSMSMTPYRLLNAAIDRSMDEVSNPTNTDE
                     IRVFSHTQAGGWGLSRLEQFIVGICGRFRFLHRFARWLIYRRLFIGYDIVSGLTVALV
                     HALHSRHAQQAERWALEKAERSPPGAATIAADTAAVVMVHSTDWVSADPHGSLTLIAD
                     LQVAIELEAEVARCESYLHSSRVLSPETVRASDSLHAANVLLSRQARLIEELYATGTL
                     TEAESKALLDQLDMRREALQRVSIRFPLPTIGDCLRNSLASWLEVEYRSRVALEHALE
                     QLLAAWRAAGQIRAFAHGEVVQRMDTLVVGVFYVIRGAIEVRTQHVEFAGDDLDDLDE
                     QLLLQRQDMQAVDHQARHGTLGRHNGLRSSYPAVQRTPVDRIQRQSAMIANLLSEEEF
                     PPLRRKPTTTSVWPQAVETAETGSAAPLAGVVAPASSERSTEAPLTLPSHLGQERERK
                     STLWRRWRWWQRRQPEETAATPRDMVEPPYPGEEAVPSATLPSRRRAAEARLRAFISD
                     VFGIAGRRERDDRYTSNSNVVDDDDDDFADDGTIAADAEEVVWHAASAEAGAFPHGLR
                     DAAPSSGALNHEHKHIPPDLEASAPASGFPREDAHEVRTLSNSVTGQSYGMAGSLYRY
                     TSALELVVVSQLAHVFFIPASNFRNLMSSRDDWMRLAVRMAASECARNLVPNVEEYLT
                     ETRMRFMELERRDRPSTERQPERSSTSVQSPADDAETPPESNGLAAARTDTLGADNAA
                     PESAQVTRPGTRAHVETRDTSSRLPDASFAMYENPGTVATETMLFPPEALDYEKRRDA
                     MLLPLRTATLVVWAMPRLLPGTLSGPLHGQCIARRLRSAVVILLQGTVYLQTCDGEGA
                     RQLQHARPLCKRYGCLGQYQSELHAPCETLPVRCRVLVVTPSDTPLFFDTKAQERGEA
                     GLYDEQRAENEALWSLLHSTAAANPAAAQTVSSGGLRWHPPDPNLITVAESEGASSGT
                     LLRRRVDAPALIRLDVAPALPRSVAPETNAARTGTTGEASLLSDANSRSLSMGRLGQA
                     SIRVPKRLASPLDLYSGERKLSSRAKQASASAEQFTLVWFDPADPRIHDLVAAFGVGP
                     GGVSDPLFEDSLRSRPLSRFPAEDSITSVETNAETARVASEAPRTAEREQSASFVSSG
                     PVRLATFPSEGHVALDTGDANTFASSSSESTPDLSADVRLMADRHLLS"
     gene            401091..403773
                     /locus_tag="CYME_CMS153T"
                     /db_xref="GeneID:16997293"
     misc_RNA        401091..403773
                     /locus_tag="CYME_CMS153T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461657.1"
                     /db_xref="GeneID:16997293"
     gene            complement(<403138..>410208)
                     /locus_tag="CYME_CMS154C"
                     /db_xref="GeneID:16997359"
     mRNA            complement(<403138..>410208)
                     /locus_tag="CYME_CMS154C"
                     /product="probable sodium/hydrogen antiporter"
                     /transcript_id="XM_005538756.1"
                     /db_xref="GeneID:16997359"
     CDS             complement(403138..410208)
                     /locus_tag="CYME_CMS154C"
                     /codon_start=1
                     /product="probable sodium/hydrogen antiporter"
                     /protein_id="XP_005538813.1"
                     /db_xref="GeneID:16997359"
                     /translation="MHTSFEGLASKLTALQTQVIHAANSTSEDAAIFNTCRGFRTGTP
                     SLFTVLLFPLLAVLFSYIIRGLFIRYRLTLPYTVPLVILGGVFGVAGCYLPLGELSES
                     LRLWVSVDKPTILYYILFPPILFESAMYLDWWVVKHTIPHQFALSIILVFISAAIVAA
                     FTTYVFGTAGWSFDAGWLFGALISPTDALAVALTLSQTPVRKHIQVMIQGEALFNDGS
                     GFTLFIVFLSRLMPNPNLSFGYLVEQFFRLAGGGFLIGIAMGIPTLLLLRLVWRDAAI
                     EIGSTLVMAYLVFYVADGPCGCSGIVAVSVFGVMFSADRIASITPAFQESLDAFWEAI
                     SHIINSIAFVYAGFISVVNLIVFWGKSGVNAAAIGYGVALYPVTYLCRVVAVVALFPI
                     LRTGRYGASWREAILIVHCGLRGAISLIAAQIVFHTPSIRGSTVVSARVQLWTSMIVL
                     LTLLFQGTTVRQVAAWLGLLSQSAAEVRLFRLQVRRLHRQAKEALREMQKHSRFVHAN
                     WGFVEEAAILPYKLDELLLSAGRVRARIRHLAARYTKAAAGNDPPASLNGEQAPGYGV
                     APPGQATPPTGPREPDCASRSPESSSLDPGDDANSGTTSSSAPVPWSNAEAIWKARLR
                     QPDAAGTPAPDKTATGASRVSSLPPGPVPDTGNPARAVRTPEPEPLPEESLPSLAHWL
                     TRFPLERKLGDSPAFSRLLMESRRRTLLAVRANVQKQHLIGSISRVTYRLLDSVTDYV
                     NDKVCLAPHTGTLRLCEGSQKAGWGLRRYERLAIHVLGRVRFLDRLALALLHRRLFVG
                     YDVLSGLAVALAQAWRSRYSECMRALHSLLRHEKSEPHPRAVLLLTMILHANAQVLQE
                     LEHDLQRCEQHLRSMRILSLETVRSVESLRAAAVMLSRQERLLEIMYAEGLLTKREFR
                     GLLDQIDMRREALQRVSVRFPAPSFEKRIEAGIRRWFQPAAPMFHETQSPGSKPVLAT
                     ASSSAGGTPKTTTTTTTTTGASFAPAGATSVQTSAPAAAATAATTSTSITERLLDGGL
                     NSASAQAYRLYVAFRQAGHVRSLLLGERLQASFQLPDAVILVAHGVLELRWYWSRTQH
                     IASGRARLPLGFGRPRTAVSYPPQQRQAPETHSRRHSQQRRSAHPGPAPHLVLSEPDL
                     EAAQPTSALPAVSPVCTRCRDTAPCHVHEEQQSTCTEATTCLLSPSGTAIDMPMTQAI
                     ARLISRDQHQAEEALRATSERLAVAAATFTGELATDSATGVLVAKAPAADAARQVPDG
                     APATSGLRRWWQQQQQQQQEQQQHHQKQRWWRRRWPWWERLRGRRRQSSQGDGEQRDA
                     QQKQLPARLFEPASRDAEHAVPGTSSEALTVAPHDWISGDGKDASGVTDGKREGAACR
                     RADAMRSNRTWTNNNNISSNNRNHCGDHRNTGAHQSRSSTARCATGTPPSAMRPGTDL
                     VEWDDDEGEDALEGEALETESAVLDATPGALLVASSWSAAAPEQERLTLATSPSQCTA
                     AEGLLPLPEYEVVSLLRHDDPLRNVHGVGGVLFAHRYPYELVVASPVANVLLIPRQAF
                     QQLVSSERGWWQEALRLGAAELVDALIPGLETFFSELYQIAVTEDGNGNSLHALQRPH
                     SEHMAESVTCPELSLRNAALTESEQRAAALVTMTTTAAAGIPSKSAGGNAAIATTPLA
                     ASGVPLDTRAPTRPEPTTPAPTTLVDRQPLVLGERPETGASTEAGSHSAAARPTRRPL
                     LPPRQDSFTMYDYLQRSDQAAPWWLDASRSTDDRANLRYQVYVTGALAWYGLYERVYH
                     VHEGICAVNVPLLEPATPSLILILLTGTLEIRPTSAYGAQILQDAFVPETGSDTPAGP
                     WLQRYRAPLMPTASSQTGTGVERGSASPAAEREHESAVTGEADVQPAGGIRSADASRR
                     VDTKPRRWLLLPDGMPPAKLLVLRGAAIPSLLQFLSNHEKASVASVALHQANDATLPQ
                     QRLRPGSTSSDGNGSTGTGKITDSGGNRSSLSGDAPSPLSEWQTWAGRVSAPAVLRLD
                     HFAASCARPCEDVALFAAAASDRNDAVASAVSKTATSPCFLWMDLNQPLLQKERKRLV
                     QSALRLQRLAAARERVSSRRGRGAQRLSTTTAPMSDTSRISKPSEVDQPGNTVPADIM
                     CAGTDALHPTCSDGSSGERFIGQAAGESGTRPGLLRSWTLPSGMVSLTETFPSESADR
                     ERSEQTRGHAGSIAGPWMRQFEQKHRTETETELEQQLWRHRHTRPPRRSRSELVDILA
                     NYSEEVANPVEDTGLQLLFEESATGTPVVYRGGSTGQAPPWQTRDLRETHRSVSDTVL
                     EGSSSFLSAEQDAGSIPAVTDPASEVLESNTPDRRQLERDAELMAREHMF"
     gene            <413080..>414267
                     /locus_tag="CYME_CMS155C"
                     /db_xref="GeneID:16997360"
     mRNA            <413080..>414267
                     /locus_tag="CYME_CMS155C"
                     /product="probable zinc transporter"
                     /transcript_id="XM_005538757.1"
                     /db_xref="GeneID:16997360"
     CDS             413080..414267
                     /locus_tag="CYME_CMS155C"
                     /codon_start=1
                     /product="probable zinc transporter"
                     /protein_id="XP_005538814.1"
                     /db_xref="GeneID:16997360"
                     /translation="MASSGPVCNTLGVNNYSNPLHIAGLFVILCGGFLGAFLPVAAKR
                     YPWLRIPGMVLQLGRAFGTGVVIATGFVHMMPPALANLSDACLPGFFTDTYNSLGAAI
                     ALGAALFMQLLEFSGRVYIGRYMDRIIAEHAAARKALAFSAKQAHAQVPSEEGTLAAL
                     APDPEAGTLQGASALQPDNAESIQPSPGSELCACAVEEPVVKTQLMHSEGSALCSLAL
                     SDEDRSDEKKLLDKAELRNLKLIVIIFEFGVAVHSVIVGLDFGVSTGQTAVTLFAALI
                     FHQFFEGVALGTTISEAGFAWWLVMLMVISFALETPVGTAIGMGISRAYNPNSVASLV
                     IRGVLDGLSAGILIYTGLVDLLTYRFTLNTELHKQQLVWVVLTIAFVWAGAIGMSIIG
                     AWI"
     gene            414936..417046
                     /locus_tag="CYME_CMS156T"
                     /db_xref="GeneID:16997361"
     misc_RNA        414936..417046
                     /locus_tag="CYME_CMS156T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461658.1"
                     /db_xref="GeneID:16997361"
     gene            complement(<415926..>416657)
                     /locus_tag="CYME_CMS157C"
                     /db_xref="GeneID:16997362"
     mRNA            complement(<415926..>416657)
                     /locus_tag="CYME_CMS157C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538758.1"
                     /db_xref="GeneID:16997362"
     CDS             complement(415926..416657)
                     /locus_tag="CYME_CMS157C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538815.1"
                     /db_xref="GeneID:16997362"
                     /translation="MACSCFCWKRNFARIDRTPLKEYEENKKTVNKIETQLGKLVRFL
                     DQFQTSWVRIGELTVLYANELQQTESQQGDSERREHADRIASLAKTISEEMRNHHLGA
                     GEKGSTRLLQYIKEFQSRLRECRERSVRLEKLAKDYDARRAVVEDKERAKTDEKTLAP
                     LRDLMYEAESRFREAEADVLQRQKYIITHAPTIIDASLVCFAAVESDRVRFLAEKSVD
                     FYRIRDDQLEPMLRKIETEVFPPVS"
     misc_feature    416901..418955
                     /note="possible transcribed region"
     gene            complement(<418810..>420312)
                     /locus_tag="CYME_CMS159C"
                     /db_xref="GeneID:16997426"
     mRNA            complement(<418810..>420312)
                     /locus_tag="CYME_CMS159C"
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /transcript_id="XM_005538759.1"
                     /db_xref="GeneID:16997426"
     CDS             complement(418810..420312)
                     /locus_tag="CYME_CMS159C"
                     /codon_start=1
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="XP_005538816.1"
                     /db_xref="GeneID:16997426"
                     /translation="MPLVRTSHDASFANFAHLTDKSLEKALLEEIRQINERATDVRAR
                     MSEAEQQGFVHLLGRYLETRSSASAALDWDQIQPPSAELLRPYAELPEPNETEARALL
                     SRVAVLKLNGGLGTSMGCSGPKSVIEIRSGQTFLDIIVKQIESINKRYQIKVPLLLMN
                     SFNTDADTLKVIRKYEDLIPIRTFQQSRYPRLVRDTLRPLCLDSEVYDKEDWYPPGHG
                     DMYDALLQSGMLDRLLAEGKEWIFVSNSDNLGASLDTRILKAIADHQVEFTIEMATRT
                     RSDRKGGTLITYQGKPRLLEVAQVDKEHLGDFQNISKFRVFNTNSLWIQLKALKRIMD
                     RGPGSMELDIIPNTKTVKGETVLQLETAMGAAITHFQRVMGINVPRSRFLPVKTTSDL
                     LLIQSNLYNIVSGYVSMNPERPAELGTPVIRLGPEFKKVSDFSSRFESMPDILELESL
                     TVSGSVRFGKRCKLSGTVIIVAQPGASIDIPAGSRLENCVVTGNLHVLDV"
     gene            complement(<421635..>428336)
                     /locus_tag="CYME_CMS160C"
                     /db_xref="GeneID:16997427"
     mRNA            complement(<421635..>428336)
                     /locus_tag="CYME_CMS160C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538760.1"
                     /db_xref="GeneID:16997427"
     CDS             complement(421635..428336)
                     /locus_tag="CYME_CMS160C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538817.1"
                     /db_xref="GeneID:16997427"
                     /translation="MSTRDAFRKRTVLDAIHALHYIAEQQQAVLLGEYEAQIVRFQRT
                     IRACATRLPEIPTSSHEAAAAAARSALDHAIDSLGNTTMPDTNNVASAAASPAEPQRF
                     KVAASYHLPASESSDGCRGPSRETPSIAAPSDDCRDTSSHGSLFRRAESHSISSMCES
                     VAPGTRPPGQGWKTWDPRHSLVGLVRPPAASRKSMMLDARARRRRRLTALHERKTNDS
                     RQNSQIPVVLNAPRKEPDPIRSGAQSPLPSSSSLERAAAAESDQFAFHDENNDQQLMQ
                     DERPNIPSERYAGTREQQRTPAPPESPLGSPASNAGQRQTNQRRGIRERAQRQDRRSH
                     RSPSIQAAERAAPAETDALSIACGRSTRETAGRTSQATKRSRVQRKRAPPQHASEQEA
                     QPVSPKRDAVLNAAAPALHGARASPVQRVGSARFSRPSSTCAADGAEADSGASAVPLR
                     PKKRRDSGLARVAPSSETHANDLATRAPRATARRHQQSTADRARALALELLSPFSRAK
                     AENRTPHKDETYCRRCKGMEDPHLMLLCDRCDDCFHTYCCRPPLDQVPQKDWFCEKCA
                     PSAPNLSAAVDQPNTSRMTPMTNISLGQSTPEQTRRAPRAPMPRRRQRQAPPSRSRSG
                     ADKAARESSVIKRLAPASPERMPTRTRRRRRRPQDALQNTSLPPVSRGMASPRTASSK
                     RAERQQSMHGARRATSRAPDTISPDQGRGANNRRSASLPEKSARLCNRSRPSLPVAIS
                     ESLNGALPGLQTRVQIRDAHNVSFTSPCIIRTRNGAADAPHASAGIHQKQAATEQEPV
                     PIEPSTAGEIHSNWTSAQADDSASAAGSASKALPSPRYDVHHPASTSAAHSESHPERR
                     PSTSQARIDLAAAAAAAALVKQDPAEAASDPVHGSGTSSACPAAALAASPAALSDPQG
                     ENFAPAESTSVDPSGAAAADALRLPGPSTTPTTPRVESARLAVHGSSFVSQKAAAVSE
                     TPPSDMHHRQWTPPRGDIPSSGAAVEACSPCPKHLPTRSLVLGDVSPPSPRQPHDNGI
                     ADEDTAMRTEAASIPLATDPSSAFRCESMPAPAAEQPAAAQSPSPSAADSPLNPLSWC
                     IQGQLPAALRFSPQHAPSENDVDGMAPDVGERCPGVRSSLEQVTGTVASSCEIPAESR
                     AASGGGAAPRSSLQNVTENIADRARWQRMSIRASPAPTPKTGVSPSMSSRRRAASLQE
                     TRFAANVPSDSIRKHRSGSGTMSPSQMMSRASVTIDANSRTHCTVTNPGQDVATETIR
                     GVQASLQAPAGNEWHTPGSLATRPAFDNASGHSPRMNAAEAGDEALPRTPAACSQTKE
                     RSLRTPASHLSSPVHRTAPNRRSSAMLSQSPPMRRSLVDPERNSAQLEYNEPQKVAAP
                     EAIRTMMALTNGAQRAGSVTCSDFAAECHPSDHAESFSTENATETVRARRRSSVHRGA
                     VAPITPLPLPTFARAQHALSASGNATTEASAVDAQASAAMRQLGTSSALPENSAYTME
                     GVTASQAQMKGTRERSASLSPGRHTMHPGRGSASPAPAHRPVAAFAMAPIDSVASPEQ
                     VYRARCASPTASGPGSFVNATDIEGQIFQLEQTLECDPKLATVPSDDNGALAENADAI
                     RAGSCGQDAANGRVGNPDCAADAAQQPAVASDSSSVAMPSCAAPVELAPSAAAAAAAA
                     SLVPDSGQATTANAKLARPSRPRSPLSAAGASDQQARRSRSRSPSDATNAIDGSFHAL
                     ERSQTATEMLLSVRRAPAASTSVAYDGYDAHALRLADPKRAPAAVDETIMPPAHASGT
                     PMPHHTLYAAAAPGGERQPGPGGAPGGVSSRLSRTEALRTRIERLRAMRAGALPVCPS
                     PSRIEAVGAAGDRSSTVQHEMCEDRHRTGRSTSRAAPSPPLEQDVSGYGLPGNAAVAT
                     ASATISAGAVSTRQTHSPARMQVEPLQNATELQATGTNSVLKPSPNKAWATLGHARSS
                     PSRYRIVIATMPQSSKRVRGASPSPETLKSRMDQRASPNCVPASLKQPTAVDTTSLTP
                     VSATPSRTAVKPLVDLNGNPSPRQAPVDAEAPLDVQDAYRQRREEKRRRILEHQRRLA
                     LETERQQARLAPLRQQQVVASGLLKSHGTKPASQIAAAAAAAAAAAAADEAPAEYPLT
                     PERHHSADASDDESAAVPAAKRHLIPEWARSHRLYGALIEQTRVDPDTIFPRVHTCDL
                     VDIFGGGTNRPRYRRRTSSGDWVRDRLTWREEAAYRKALGFDP"
     misc_feature    428345..429881
                     /note="possible transcribed region"
     gene            <430086..>431141
                     /locus_tag="CYME_CMS162C"
                     /db_xref="GeneID:16997429"
     mRNA            <430086..>431141
                     /locus_tag="CYME_CMS162C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538761.1"
                     /db_xref="GeneID:16997429"
     CDS             430086..431141
                     /locus_tag="CYME_CMS162C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538818.1"
                     /db_xref="GeneID:16997429"
                     /translation="MNPSYTGNRQPAAGIQSLRCFCSRLLWALPGFACTVYRAHAPVL
                     MSAGDASNWQRPCMQGILIRFKYFWKMCGCGIERGICRCAIFIGIEGGIYHAAVAQSF
                     MDHHLGFHSKNIVHSYKLVGAEPTMSAYKDASSTVQDTARKRKGFGVPALVRHLKEMR
                     GSYVVNVTVQVSQQFRPANGTTRATFEHLHPYQIRMVWVDSIHKGIYARVRSPSIVMN
                     TRLCGIFLQLTLFPLSRIRHETRWSRFRSSAVVGMQTMLMAACKSRFRRCRLSFKHFI
                     RTQQYRKQQILFVYRVDAQLAPVSLDCGQVFLEVRRSASCFERCTRAGPVQRPRFDAV
                     LRFRARCRTLRSWASSG"
     gene            complement(<432586..>433458)
                     /locus_tag="CYME_CMS163C"
                     /db_xref="GeneID:16997451"
     mRNA            complement(<432586..>433458)
                     /locus_tag="CYME_CMS163C"
                     /product="zinc-finger protein"
                     /transcript_id="XM_005538762.1"
                     /db_xref="GeneID:16997451"
     CDS             complement(432586..433458)
                     /locus_tag="CYME_CMS163C"
                     /codon_start=1
                     /product="zinc-finger protein"
                     /protein_id="XP_005538819.1"
                     /db_xref="GeneID:16997451"
                     /translation="MWITPTGFDDFLTPRVDTGNFDWADLESLFLPGDNQGTAGPVLH
                     ESSGPGANQKPSQGLTSQSHALERAAARPTAGSYASLVSVEGSPRSQVRADDAQPEGS
                     GMDRRGFSPLSLEQVPWLAPTSPLLDELVSSAVAGVVEGDRSFSSAPLDSGASDGESR
                     RSYTAASISCFSAENGRPCHGSGDVADGSEQARSLVPRVDSSSRVGGPWTAREHRYRA
                     YIRYREKKRQRKCWKTVRYVCRKELAEARPRYKGRFVRKSELASCERERTAEAATCDG
                     KPVSVEGIVPTDHS"
     gene            <435901..>437778
                     /locus_tag="CYME_CMS164C"
                     /db_xref="GeneID:16997452"
     mRNA            <435901..>437778
                     /locus_tag="CYME_CMS164C"
                     /product="unknown kinase with aarF domain"
                     /transcript_id="XM_005538763.1"
                     /db_xref="GeneID:16997452"
     CDS             435901..437778
                     /locus_tag="CYME_CMS164C"
                     /codon_start=1
                     /product="unknown kinase with aarF domain"
                     /protein_id="XP_005538820.1"
                     /db_xref="GeneID:16997452"
                     /translation="MTASLLSPGIRRLAYFVSVGAPLITGYLWADSRKKAYGEASVTS
                     HRLEPSYDTSVFGAYRRFARSAITAAAIVADYKLTLARLPPENEHDEFAVTLRGEKLE
                     ATHRRAAAKILELCERNGGIYIKLGQHLAQMDYLLPDAYCEALRPLLNACPIQEFAVV
                     ERTLCEDLQVERLSEVFSFIEPTPVASASLAQVHRARLRTDYREQTQRMLSPRERAWL
                     EEQERLAPEGPLVAVKVQHRGLAEALQGDIATVQFLVSAAERLFPGNFDMQWLVNEIR
                     ENLPKELDFEHELQNGERCRTYLASGCGAKGQRCARPRLNVLVPTFLTSLSTHRVLTM
                     SYETGVVANDVAGIRHLGLRPRDVASIIDDVFTDQIFCFGFVHSDPHPGNILVRPSQE
                     DASKPLVVLLDHGLYRELDDAFRLAYAALWQGIVEGDGASIRREALRMGVPPEDVELF
                     TAMLTMRSWQDVVDQTEQRGDRGLRLSNERTSANKRRVQDYVRAHIMAMNRLLGRIPR
                     PLLLLLKTNDCLRALDRRLGATSLMVEMIARKTTAILAEHQHTQWMEPLHAQRHQGLV
                     RGPMYSFWERIRLSWRRVRLELRLLMFRLLVWWHQLRRSGDALLQRFQATFRSKSPDI
                     R"
     gene            complement(<437860..>439194)
                     /locus_tag="CYME_CMS165C"
                     /db_xref="GeneID:16997453"
     mRNA            complement(<437860..>439194)
                     /locus_tag="CYME_CMS165C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538764.1"
                     /db_xref="GeneID:16997453"
     CDS             complement(437860..439194)
                     /locus_tag="CYME_CMS165C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538821.1"
                     /db_xref="GeneID:16997453"
                     /translation="MPSGCLAHVIRHPLGNCAVRTGQCFLHSLFRGSGSAATASNALA
                     ARLGAGTLCEYRARASGSCLKRPNSSISSSSGSSPRATKSPSAVGTTAVPPRRPQWWR
                     NLVPAFPIGFAAGFGGACAGAGGAIFMIPALVRYVNLPQRVAQGTALLASCGTATSSA
                     YNYAAAGCVDLPAALQLMVCSIIMAPIGVAVGQRVNASLLRRGLGILLILLAPLVPLR
                     DRLLSAVAPTDPIAGANFTGTSNTSTNCAASDAAPAGHTAVSGSRSPASQRAWSRADQ
                     ETQSLLAIITTNVDQALLWTGTCVGFLSGLLGVSGGTLYTPSLALLYASRDRDRERVA
                     RSDRNDAAVPSAPAAAHPEKHGVRTIIGTSMFAMVFPAAAAGIGYARRGQVSFLHLPG
                     VILGTLTGAAIGSRAAMLVDESVLRFGFAIVFATLGVRLIRSPVTIERTMTP"
     gene            <440992..>442782
                     /locus_tag="CYME_CMS166C"
                     /db_xref="GeneID:16997454"
     mRNA            <440992..>442782
                     /locus_tag="CYME_CMS166C"
                     /product="similar to tetracycline resistance protein TetA"
                     /transcript_id="XM_005538765.1"
                     /db_xref="GeneID:16997454"
     CDS             440992..442782
                     /locus_tag="CYME_CMS166C"
                     /codon_start=1
                     /product="similar to tetracycline resistance protein TetA"
                     /protein_id="XP_005538822.1"
                     /db_xref="GeneID:16997454"
                     /translation="MTVLDLRSHTGESAERTGTNEAVAYSRLSAEEDKYGVFVDVSKR
                     VSEANGVHALSAPRLDEPLSAAAAAPAPSSNREETLPCGEPQESHWHQYVPRRTVLLL
                     YALVASDACTLMVIGPFLPAFVEQRLGVPLRNGASTVGIISGAYNFGNSLLAPQLGNL
                     SDHHGRRPYLLFSVVVSATLTCCFPFTRRAWAAAALRFTTGVLNASSTVSKAYLADLT
                     NAERGVPASERALLFGYFGAVWAIARSTGSAVSGALTGVSLPLLGIDASANPFITPCL
                     VMSTFLGMVFLVAVVALPESRTPTERRPRRATDVVGLLPRARVIFEVGGPSLRRLLLC
                     NAIHQFCNGGLLIILVLFGSESRLRGGMGFGPNAVGISFSYFGLTGVLFQLTFFRRVL
                     RRLGSRRMYLLGTSLLAIGTSLVPAALPLSEGVRHLLGAAAVADTRASSIGTQMSDWL
                     PLLVLLTPIGGGFMAGLPILNTLVANAAPLEVQGLAQGLSQFSGGILRTLGPVLTGTA
                     FGYLAARAHLWFSFFGLSLLYVLCGTIVASLPPTIERSYEEAAQIHAEEQALRLAVRE
                     HDAAPNAAAGDSVQKGTVVEASATSVRVAM"
     gene            <443062..>444504
                     /locus_tag="CYME_CMS167C"
                     /db_xref="GeneID:16997613"
     mRNA            <443062..>444504
                     /locus_tag="CYME_CMS167C"
                     /product="similar to N2,N2-dimethylguanosine tRNA
                     methyltransferase"
                     /transcript_id="XM_005538766.1"
                     /db_xref="GeneID:16997613"
     CDS             443062..444504
                     /locus_tag="CYME_CMS167C"
                     /codon_start=1
                     /product="similar to N2,N2-dimethylguanosine tRNA
                     methyltransferase"
                     /protein_id="XP_005538823.1"
                     /db_xref="GeneID:16997613"
                     /translation="MFVGPSGAFAPGVPGERLRRQRLRPEKLLGCERRYREGFATFEL
                     PTANAFYRAASKPVRDLGVLAALVWSEAIGERLRIADLLAGPSAVRALRYATETNARA
                     VLVNDAISGPGRTVLERNTTGVSEDTVWIRRHDNLFELAQSEEWIHSFDLIDLDAFGT
                     GADEVASGVLNMLRCRRMKTAWSGNDDSAAEKDATAGALLYCCSTASVTAAGLNPGKA
                     QKTYGAALVRHAAVHEQGLRLLITVVRKHAQQSGFIAQPLFSYFHRAGGTFRVMFRIL
                     QPRHDELALASTAAADTGLLHLCQQCGQLWCVTSTIKDAVASSVCPGCGNDAAAPQVR
                     TSGPFYMGPLHDGDFVERMLTVSREAPAGHFDRAAIAALKLMIHETRLNAHPFYYRVG
                     DLARRARRSPPPISKLIERLQWYERTYRETRRMPEAVVRAQWQAARASVDPQGVRTGL
                     PIPAILSAVAEASAFRQQQQQQQQRSRALL"
     gene            complement(<444315..>444956)
                     /locus_tag="CYME_CMS168C"
                     /db_xref="GeneID:16997614"
     mRNA            complement(<444315..>444956)
                     /locus_tag="CYME_CMS168C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538767.1"
                     /db_xref="GeneID:16997614"
     CDS             complement(444315..444956)
                     /locus_tag="CYME_CMS168C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538824.1"
                     /db_xref="GeneID:16997614"
                     /translation="MTSQVRYRDEPATTVFSGLGVGSGFYVGCGVGVGKTFGAFYVPS
                     VQLSVGVGCGLQVGFGWGFFLYGWGACIWSLRSMLGIDERDVANMLQQLRRDQRQESP
                     PPSKSSVKPLPFSWRRLRLPSFLLPCTPSSQRRMGAAAGSEHFCLSCPFQSKARERCC
                     CCCCCCRKALASATAERIAGIGKPVRTPWGSTEARAACHWARTTASGMRLVSR"
     gene            <447345..>448148
                     /locus_tag="CYME_CMS169C"
                     /db_xref="GeneID:16997615"
     mRNA            <447345..>448148
                     /locus_tag="CYME_CMS169C"
                     /product="probable dolichyl-phosphate mannosyltransferase"
                     /transcript_id="XM_005538768.1"
                     /db_xref="GeneID:16997615"
     CDS             447345..448148
                     /locus_tag="CYME_CMS169C"
                     /codon_start=1
                     /product="probable dolichyl-phosphate mannosyltransferase"
                     /protein_id="XP_005538825.1"
                     /db_xref="GeneID:16997615"
                     /translation="MERARNTSKGKRTASGSMPAASSLDPAYAVILPTYNERENLPFV
                     VELIHQAFSSVSLADRYHLVIVDDNSPDGTLQVARALQKLYGEERLTLAPRSGKLGLG
                     TAYRHGLQRAPTACSRIFLFDADLSHNPLAIPAFIACMDKTQADIVTGTRYLGTGGVC
                     GWGWKRKITSSAANLLTQWLLDPGVSDVTGSFRLYRREALEQLLEAVHSRGYVFQMEA
                     MVRATRQFQYHVAEVPIVFVDRMWYGQSKLGYREIVEYLLTLWQLVWLA"
     gene            complement(<448558..>450123)
                     /locus_tag="CYME_CMS170C"
                     /db_xref="GeneID:16997605"
     mRNA            complement(<448558..>450123)
                     /locus_tag="CYME_CMS170C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538769.1"
                     /db_xref="GeneID:16997605"
     CDS             complement(448558..450123)
                     /locus_tag="CYME_CMS170C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538826.1"
                     /db_xref="GeneID:16997605"
                     /translation="MARVRTQLRFRRLLWERLGRRSRLLHSLGAIVGCFLCLVLVLKQ
                     QPRLEAPRKGNVLAGLLHLKGPTPAPQSQPTLPFVPTRFLTYAPHSGLANQFMELVSA
                     FDVARVLNRTLVVPPVLPHFALKLGSCEQVAPVASAAFLRKQNRRIWEDLDRKGTYIA
                     FGDIFDLSDLFAGPASPSCRVDGAQTLARAVAWERRRCSLAGAVEARDWMKQAERSTW
                     AWPFSCHEVRIVIDVPHGLLTCADAEQAGAPDWIPPSAFAATWRMMLRSRQHVEAPVP
                     QIHGVCEMLHNGVDGERRLRDEPVIALGSVFHFVNYAGTLAPWTGGWQLPLASRAFGG
                     RLDFMSPRLGGRYGYLAEQIAEALLRRTLHSWRHLSPAFVCVHLRGGDGAFRTRLREA
                     FQNAKKQHDVEAALDALGLRESLRTNRLPVMLVTDMPRSEARSIQRALVTAKLASKVI
                     LSSELFEKQAIPATLRNLPFDLGSTLFDLATCSRAQKLVLSQGSTFSALIQALQRTRY
                     GRERIDQDDTLHL"
     misc_feature    450211..451509
                     /note="possible transcribed region"
     gene            complement(<451402..>454911)
                     /locus_tag="CYME_CMS172C"
                     /db_xref="GeneID:16997607"
     mRNA            complement(<451402..>454911)
                     /locus_tag="CYME_CMS172C"
                     /product="similar to ankyrin 1"
                     /transcript_id="XM_005538770.1"
                     /db_xref="GeneID:16997607"
     CDS             complement(451402..454911)
                     /locus_tag="CYME_CMS172C"
                     /codon_start=1
                     /product="similar to ankyrin 1"
                     /protein_id="XP_005538827.1"
                     /db_xref="GeneID:16997607"
                     /translation="MFRCLRWRELLAPTDEADSEVPRTEQGLSRRPRAGTLRRDSRAE
                     PLRTQGLRWWHRTQPDRTQQPSNWRQTREDQRLRVEGVHRASSNGRNDAADAEHSSTC
                     DDLRKPSSGEGSALKAPPRWTGLLQRASSPADAAELRSWIRDNLEAFTREWDRNEPGA
                     DKARTGWTALKQAAYFGNTLAVELLLEFGAWKELAVTTGPTDNSRRSGMIPSLVRRGD
                     VPSTTLDESERAIPSALYLAAQNDHIATLRAMLRYRSPEQRNQSAPPPDVNCRTSIGW
                     TPLFIAAWNGHEAVCRMLLAAGADPRARDHNDWTPLMVAVSGNQLGIVGLLLEVGKIR
                     PQHVRARRGWTPLHIAAEQGSIEMIRLLLQHGADPSAANGEGWTPLHAAAKFGHLVAL
                     RLLVEEGKTKPSIARHDGTSVLHVAARYGHSDIVLWLVTEAGVSPFQQDCAGRTALHT
                     AATCNRADICNLLVSLSPTKLIDQASHSGETALTIAFSAKRYDLALWLLQLGARLPQD
                     QRRLVIGRKLMHHLATRWWESSIANNPNTNTSTNNTALVRPPGAALVEAQLRSLAVLS
                     GVLDESPDRHFLATVVCIRRLVSLGIDVNIRRKLDGGTPLHTAAALANAEGVEAFVQA
                     VGGGQQGALALETATIGLGTRGETPLHYACALAQQDAGAATVLALLRAGSNPWARDRR
                     RRTPLHVAAAAGAQESVLRALVELGAPRGDLVYARDSRGATPLDIARETGQTQAHLVL
                     TSLLGTRQARQAGCENAFPALAGEPNHRLAAAYSARMGVVDGVSAGETSKPTASASHV
                     YKNMDATTPDTKTGNSFAYERSIHLGDRTFEGVFEANAGTSSSTQPPLLRKRTPSAAR
                     GTSSTGSSMTSLSTAPIYRDSMVEFRYNRSAESDPLVMQQQLADDAPAPPSNNSALFS
                     QITNASTSQSGGDSMETSSHVEVTGGGVDGYGITATVLTSASTRTASAAHQHLSPSTS
                     SSSSSICAPAAANEVSLDNQLTALSGDDGDTLLPTSLRQSGAQPSSYRRSAFLPRLLS
                     RDWWPVRSTATASAPPLDTEGADQDEDSRLLHHSRASSSSDIYSEISAAPSAPFDSSR
                     SAADSVLVLDESDIMRSTHSIEADNTRAHMEPECAVCADSGPCVQWTVYNCGHCTCQP
                     CAEQLSECPMCRVTITSRIRLYL"
     misc_feature    456217..458290
                     /note="repetitive element"
     gene            <458293..>459306
                     /locus_tag="CYME_CMS174C"
                     /db_xref="GeneID:16997608"
     mRNA            <458293..>459306
                     /locus_tag="CYME_CMS174C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538771.1"
                     /db_xref="GeneID:16997608"
     CDS             458293..459306
                     /locus_tag="CYME_CMS174C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538828.1"
                     /db_xref="GeneID:16997608"
                     /translation="MDEEVGSARDGDVTALLRESYALLHQATLVTADERRKCAEAFTE
                     WALSTHRSTPAGTGTPASGGHSRLEPTRSVEGLVPVLRRQNSLPRNVGLGRGVRPQQS
                     SRRVRLRGRGNGDGSPLQERSAHGAQPPRALEQASESDSFISDTGAQSDHDTSSYESD
                     SSAVSAGVRIPRRNDPGFTATRPCRAETVHQRRLPHAPALRTTSAVAAQRGYSTPDQR
                     QVPSDRGRAYNAARELRPATLLEDFAAAGDSLGTTQAENARAAAAAVQAPAALAANPS
                     IECLARRRQLPGLDVGSSALDESAPPATRTVSLGADWLLASFTGASSSSYVDKSPSRH
                     LPR"
     gene            <463211..>464905
                     /locus_tag="CYME_CMS176C"
                     /db_xref="GeneID:16997597"
     mRNA            <463211..>464905
                     /locus_tag="CYME_CMS176C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538772.1"
                     /db_xref="GeneID:16997597"
     CDS             463211..464905
                     /locus_tag="CYME_CMS176C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538829.1"
                     /db_xref="GeneID:16997597"
                     /translation="MNAEDGPRRAPLPGTPGGVAREPSGSAALSFQLASLPMGSRGAG
                     VAPPQPPPQQPWAVPKHQESFVPSGEYVSAGVPFWAAIPPEPPMAGSLTWWAPDASTA
                     TAPPFALRTGAYANLQGYPVPSVAVEPAGWYWPPPPPPPPPPPPPLSEAGFPGGAPDW
                     EEEERRVVAFALLGLRDGAAVSTELAWTAAALLPRSAYSSTRMQHRQSRRRLREAQRL
                     YRGDAPLFGVPYGLPGVFWHASAPDASDTAADDHGIDDADGNAAATETRKCPAPAETA
                     QLKILWREEANRRTMPGRGFLTVFRILGGQGEFLRLFEDIPDWAVTDEAPGSRDVSEP
                     PEPDERDTYPVPEAGVPPPPVPKSGAGGRRRVPNPAPSGTAPAAVRGRGGNLERLLGP
                     GTDVAFRVKDEEGEWNWILGTVCSYLPEERKYRIADRGEEMVEAFEQRGEELSQPKHR
                     LDSGKYRLYQVARSRVRPLPSAAAANLRLRPSMKVLALYPGTSALYPATVVESAETVM
                     QETDAPHGMAYKLIFENEDEEEGSESEHSGEELGSRDLMEAVPYKYVHARFVLPLL"
     gene            complement(<465495..>466184)
                     /locus_tag="CYME_CMS177C"
                     /db_xref="GeneID:16997598"
     mRNA            complement(<465495..>466184)
                     /locus_tag="CYME_CMS177C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538773.1"
                     /db_xref="GeneID:16997598"
     CDS             complement(465495..466184)
                     /locus_tag="CYME_CMS177C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538830.1"
                     /db_xref="GeneID:16997598"
                     /translation="MLFVSFAPQTLYSTNTGFRAARCRRRARTPNTRYCNVVAQVGTR
                     RQRVAITDLVTEIVLSFDQVRIVSATGKTGAAVLETTFPLLAEGAHVRTFETVINRDA
                     GGDPTTSQVVSVLTPDRNFELHLDSSRVKSVQFVRETRPRGTTERAHHARGAGETADP
                     NGGAEDATVFSIRWLDADDNIILNMIVDGPDASSVAVDVDRQRLRASAIAAWTAMRDK
                     YGDWLDIDTGA"
     gene            <468760..>472056
                     /locus_tag="CYME_CMS178C"
                     /db_xref="GeneID:16997599"
     mRNA            <468760..>472056
                     /locus_tag="CYME_CMS178C"
                     /product="trehalose-phosphatase"
                     /transcript_id="XM_005538774.1"
                     /db_xref="GeneID:16997599"
     CDS             468760..472056
                     /locus_tag="CYME_CMS178C"
                     /codon_start=1
                     /product="trehalose-phosphatase"
                     /protein_id="XP_005538831.1"
                     /db_xref="GeneID:16997599"
                     /translation="MTGPLETTDLSSESWLATREQELLAVLEQLQKKLDALRRSQHFG
                     RHPRLWKERVASMLASPERNTLFRSSSEGIENTTEGGLETKLYPIQRIIFVSLHLPSK
                     AEVDLNRALSVTARVTSAILTVLASDPEVPVVWVGLEPPTGDAPPETPGAGTLTSYAL
                     TDALQLTGRVTHSPQLARTFVCVPMEPALASAFVAFAEEQLWSLLHYDFAGLFCGDLS
                     IQDGWRAYCTANALFADTIRGLDIGPGDLLWIHDYPLMMLPGLVRRHLPHARIGFYLH
                     TCFPSTEIFRIFPYRREMLESLLQSNLIGFQAFGYARHLVTASTRLLGVEGTYEKIVI
                     EQRPAHACFLSIYPLGAGVRMVNTILESRAARRRIAELKERFQGRRIIVGLERLDDRF
                     GGIDLKLAAFEEFLARNPLMRNQCVLVQVAVLEAHGHRGKGRSALPAERNSIDPSVFA
                     TSVSTSKRLRHGAQAPSTRSGFGAGGDHHRPILSQGNGQFKANRSRTSTGLVADEDGR
                     RQLIRTVCSLVGRINAVYGSLDASPVHFVNYEPSYEELLALFAVADVCLVSSVRSVMT
                     PVAYEWTLCQHGRGEGPLVLSEFSGANRTFPSAMLVNPYDIEGVAFALQEALSLDARE
                     RKVRHEIAYQYVMQNTVKTWFDNFVEDLQVAAATDHQHANDPVPLSVSESQVAGSLAA
                     ARLPSPEASSADMHPEAVLCSGAAGERAEIAVVARLLELSQKKRLFILQHDGALMPFQ
                     AIAELAGPHPNVLRIVSVLATDPRNVVYLCSGRTRRIVTEWYQPYAHKFGFICEFGLF
                     LRAPGANNIWTVNAEGELSDPDEWKPLMLPLMRTFADRTPGAIVEEAEHTLVWHYRDA
                     DPDFGKWQALELMEELGRILRSPQNNGLSLEVVHYEAVHATGGKWVRVGPRGVRKART
                     VERLLSELSLREFDFVLACGEDRHDDEMFETLQHRTSMSSVLVRIGRSSSGRSRAANL
                     QLDSCREWLDALQQIVLGTPGNAPLVSTAALSPRRQESLPQFASAEPVQSGEATDPNV
                     ASSADTLVYRRSVSEPRIGSAESEPSTSTAVTALLAVASSASGAAGPKRPPSLPRIQE
                     YETQSETESS"
     gene            complement(<472422..>473480)
                     /locus_tag="CYME_CMS179C"
                     /db_xref="GeneID:16997600"
     mRNA            complement(<472422..>473480)
                     /locus_tag="CYME_CMS179C"
                     /product="similar to protein phosphatase 2C"
                     /transcript_id="XM_005538775.1"
                     /db_xref="GeneID:16997600"
     CDS             complement(472422..473480)
                     /locus_tag="CYME_CMS179C"
                     /codon_start=1
                     /product="similar to protein phosphatase 2C"
                     /protein_id="XP_005538832.1"
                     /db_xref="GeneID:16997600"
                     /translation="MDAVEDRKQAVEFDGVEYKETQVGVGGRSRPPSSLPRRAGDTVQ
                     VERTAAAAPVPVTPATSSGDGLTPAMTLGTLSYGFAEDTNERYRRTNEDGHKFIFGFA
                     GRADDMFFAIYDGHGGREAVSEVERRFHEVFAEELSRERQAVEGASGSSAASPPLSLE
                     RTRYPERCFQRAYARMDSELETQRCLYVGSTSITCLLRRDEDGRRYLHTANAGDSRAI
                     LVRRDGNALRLSYDHKASDENEARRVSDSGGFVVCHRVLGVLAVSRAFGDFAMKHVVI
                     SEPFTSTHVIEEGVDTHVVLACDGLFDVLSDEQVAQMILSDTRMRENAQYAAERLVRR
                     ALEDGSTDNVSCLVVKLD"
     gene            complement(<474353..>476350)
                     /locus_tag="CYME_CMS180C"
                     /db_xref="GeneID:16997587"
     mRNA            complement(<474353..>476350)
                     /locus_tag="CYME_CMS180C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538776.1"
                     /db_xref="GeneID:16997587"
     CDS             complement(474353..476350)
                     /locus_tag="CYME_CMS180C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538833.1"
                     /db_xref="GeneID:16997587"
                     /translation="MSTMLGCRFGGVLEGSVFGLRGAVWRRVFSPPRGLCRAAFSTST
                     PEGSDQSASSVESSGPVPQNASETSRIGTLWDREPGGGSPTSAAVVDAILQRAQFETE
                     ALSLAGGTTGEARRRQEQARIENQIRRIMHEELPPHCRLEARDVVWVSDDLCFVGVGL
                     LTNFAGFRYAMSRRLYRARRVAAVRDIFDRNTKDRATLQDVFKIVTDDVAAMLTSIQE
                     PPQARLVNDYMLPANLTPLPSRQHSASSSLDAAGQENAAPTVAEQTPNDADLMTDAAR
                     FLSDQSGPLNTPHMGEFILGRHDVDFVEYLHELGIRIVPVENKTELDQMEPATIPIQQ
                     STNHLLMVAPTAFEPNLYAAHDNYFMHDPSAVVAGLKHQPDDAEQTTSTTGAQDKLVS
                     IRRQVLNEFAQLYYQIVQKIGARVHLFTHDKYHDAPDSVFPNNWFSTHTDLEVGECTL
                     VLYPMKSPNRRRERRPEFLSRLHSFRRYTHVYDLTREEVSKTPRYLEGTGSLVLDRPH
                     RTAYMAISERSDQKLARTWARVMGYEVIPFHATDGHGRPIYHTNVMMCIGTHVAVFCA
                     ESVEDSRERALILDRLRSTGHEVVTITREQMCHFCGNVLEIESRYGRPVMAMSTGAYH
                     AFTPEQRQVLREHLDDLVHADIRTIEVVGGGGVRCSIAELM"
     gene            <476746..>477408
                     /locus_tag="CYME_CMS181C"
                     /db_xref="GeneID:16997588"
     mRNA            <476746..>477408
                     /locus_tag="CYME_CMS181C"
                     /product="rubredoxin"
                     /transcript_id="XM_005538777.1"
                     /db_xref="GeneID:16997588"
     CDS             476746..477408
                     /locus_tag="CYME_CMS181C"
                     /codon_start=1
                     /product="rubredoxin"
                     /protein_id="XP_005538834.1"
                     /db_xref="GeneID:16997588"
                     /translation="MSTDGETRKLAFILAPLLRTGQWQLALRTAPRCRLRAGGWKRSA
                     GRGALRASLSPESSASESGGSTRNGSQGTEGLLQDKSTDGTGAQPATDLSPAEAEQLR
                     KKQEADALRAAERFMERDEGNFACTSCGYVYTPQTGETFLGIPPGTQFEDIDAGTFRC
                     PVCRSPKSAFQPARTVVAGFAVNQKYGIGANALTPAQKNALIFGGLFAAFLLLLSGYL
                     MS"
     gene            <478870..>479325
                     /locus_tag="CYME_CMS182C"
                     /db_xref="GeneID:16997589"
     mRNA            <478870..>479325
                     /locus_tag="CYME_CMS182C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538778.1"
                     /db_xref="GeneID:16997589"
     CDS             478870..479325
                     /locus_tag="CYME_CMS182C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538835.1"
                     /db_xref="GeneID:16997589"
                     /translation="MASVAKKRRRAVLRFQQRRVFLRERLCKKPSPQAAQRAGRRAAD
                     EKAHENSTKPRSSALTTTFDAINDALNLIQEAQRATQVTLDGAASAARAASRGSELGW
                     RVGTRGTVPVRSSEHDARASLDPIQALMNSERFRVDPFRALTETLQTRD"
     gene            <481806..>482243
                     /locus_tag="CYME_CMS183C"
                     /db_xref="GeneID:16997246"
     mRNA            <481806..>482243
                     /locus_tag="CYME_CMS183C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538779.1"
                     /db_xref="GeneID:16997246"
     CDS             481806..482243
                     /locus_tag="CYME_CMS183C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538836.1"
                     /db_xref="GeneID:16997246"
                     /translation="MVFVSIPSQPVTSKKSRMSRLASERPVLRCSKGTRLENSGEPAL
                     LTRRAFLGAAAAAVFGLGSVVAPSASVAAPLTLNPFARKKEAKSSKGSKTQSSTEKGS
                     DTQATPRRKKDALETLSPEDQEDIDELTKRLMSRKSSSEEASQ"
     gene            complement(<482589..>483395)
                     /locus_tag="CYME_CMS518C"
                     /db_xref="GeneID:16997247"
     mRNA            complement(<482589..>483395)
                     /locus_tag="CYME_CMS518C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538780.1"
                     /db_xref="GeneID:16997247"
     CDS             complement(482589..483395)
                     /locus_tag="CYME_CMS518C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538837.1"
                     /db_xref="GeneID:16997247"
                     /translation="MRTIVSRYTFLTPPALHHQQVRGRHTKQTGTSHIRCTHTPNTST
                     NAVFYTRRELCTALLLLLSIDGGRGTNARAETLPRTANDSLVCYRDDSIQFWRPKDWT
                     EDRLRRQQAVRNTLLRREAITTTAKGHPNQGMLVLAAFQSPLFPESDHLSVISAGLDS
                     GAGLESADILANKFVNTLRSRPAVASARVRSARNTRHVDQRVYADFEIEVFGRMGWHR
                     QNACSVIVHENRLYTFTLQSRAEAWHAARFLACRDSFLAGVDPSIPLCPV"
     gene            <483659..>486448
                     /locus_tag="CYME_CMS184C"
                     /db_xref="GeneID:16997375"
     mRNA            <483659..>486448
                     /locus_tag="CYME_CMS184C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538781.1"
                     /db_xref="GeneID:16997375"
     CDS             483659..486448
                     /locus_tag="CYME_CMS184C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538838.1"
                     /db_xref="GeneID:16997375"
                     /translation="MLSSLEGGHSREGVDGDYDAIFLRLLEDEESYTGRQQHRGTVLQ
                     APPALRARLSQEARTGAAPQTETARERSAFDVDRWESAYADTNRGLSCTEQRKPPENA
                     LAPREVAASAGISTKSSEADLPEWIRREIYVRDGELVILRDRLERQQRELIALRNAQA
                     ATTTGSQQLGRARAPSWTADAQRHTRPSQGLPSGSEQEFTSAVVQRLATETDRLRARL
                     AFREREISQLRELLAKVVSSPAQGVADGPVHSSSSSSPSQGPPPPPPPPYTCKSAVKR
                     TANVSVAPTTHPSRSKRAGVFFDESLLLLNQQCGDSLASQPPSPNAAASQARVTVDWR
                     QHEPGEPSSAPALQHSRPCSRTTNLQYSDRTQIFTILTACEDSWRELLRHAAPTNREN
                     PQVKLDNFFAQQMLALLRTEADLRECVRPIQQAMLMSYAAWKRTAEPSQALDKEARFA
                     AALTVLDALLEHSTAFRDYFMDATSQERADGAYSASNTNGLMLEHLIELVVDDSSWVF
                     WQNHPGLLIACFRIVHNLLRGWCVRVRERTSPRAPSATFQVQIRVLIESPVLRHIFAE
                     LTPDHASLRETACAALGSAFAVENALRIYTGTGSAEAQCCGWQAAAVQSGSICRVLRL
                     VQDAPLPLTLDMLGLVEAVFLGPCADTALDEWITHVRPEDRFEALEDLVIALERLWMP
                     LQELQMLFHEPSVAVLDERYQASPKRSGSALRGTLRSALERWQCVAAMSMPRSDSGTA
                     TTAVTKNMPLPEPFQSATVQQLQHGIVGVLALLYRWTQPLTERPSEPDIQRQWTISAD
                     KENRERSEGTSVNASQVGDRPAHDWPHRPEHLRASVRARLRDLLRSLRLAAADQQRQR
                     TPAADNNSSADAADEMVVPWIHWSEAADALEPLLRAIWCWLHPADASSATVHANAKPA
                     AAMPALESTSLAPFR"
     gene            complement(<486556..>487965)
                     /locus_tag="CYME_CMS185C"
                     /db_xref="GeneID:16997248"
     mRNA            complement(<486556..>487965)
                     /locus_tag="CYME_CMS185C"
                     /product="probable actin-related protein Arp6"
                     /transcript_id="XM_005538782.1"
                     /db_xref="GeneID:16997248"
     CDS             complement(486556..487965)
                     /locus_tag="CYME_CMS185C"
                     /codon_start=1
                     /product="probable actin-related protein Arp6"
                     /protein_id="XP_005538839.1"
                     /db_xref="GeneID:16997248"
                     /translation="MSDFIDASIILLDNGADTVKIGLLGDAAPRVHVNGLARVKHSTG
                     ADTDAGAKRSGVTHSPAERKTLCGAALEQCSPLGLRVRRPIDRGLVTDLALQAKIWSD
                     VLAQEKLSLTRKRLVLTVPPLCPLPALERMLKTAFFYFDVSAVYVTCTAYAALMHHET
                     LVTGTAASPSPWSRATGLVIDSGHSFTHVVPVFGGQLLNYAVRRLDVGGRLLNNYLKE
                     LISYRSWNLMKESFLVQRLKERVCYVCADLERELQRSRLHSEETRIRYLLPNETDRGE
                     FRYGRVLAPEHTSITTTAAIDKEDADADGADETATLGSVLTLTNEHFLAPESLFAPQD
                     TIQIPQAGIPEVVLQSLERIPKALWPALLQHVVLIGGNVRLRGFAARFQQELRSLLPA
                     WTPVQVWIGERRIDAMTSEADADTPDPLHTGWFGLQTLVRNIPDHAAHRFWLTRDSFE
                     RNGLSAMMELQLGMHFGAS"
     misc_feature    488579..491733
                     /note="repetitive element"
     gene            complement(<492119..>493669)
                     /locus_tag="CYME_CMS187C"
                     /db_xref="GeneID:16997249"
     mRNA            complement(<492119..>493669)
                     /locus_tag="CYME_CMS187C"
                     /product="similar to TIA1 cytotoxic granule-associated
                     RNA-binding protein"
                     /transcript_id="XM_005538783.1"
                     /db_xref="GeneID:16997249"
     CDS             complement(492119..493669)
                     /locus_tag="CYME_CMS187C"
                     /codon_start=1
                     /product="similar to TIA1 cytotoxic granule-associated
                     RNA-binding protein"
                     /protein_id="XP_005538840.1"
                     /db_xref="GeneID:16997249"
                     /translation="MGRVKCMAPTPVWFSHGAASSRMLGFGFPLLVRQQQQQHALKPS
                     AQAANWRALHRTVHCHRSTSAARKSLPRITPLEPMMRMKGTKNRAFYDEDDGEWIGSE
                     LDQLWRPSAAPARYPNAPPQDESATIHGSAGPHASFPTTAANSSQALTDSPPDAPHYA
                     EQSSTPESASQPVYEEVPAQETDPIQPPVSASASAATSNTDPSLDSPESKTEDADEYV
                     GPLLDPDAVYLQCPECAMCYQVEASLFETARICRCTQCLHEFVASAMDLISADTLVSD
                     RPTMGVRPLPRIEATARAEARLKPVRKVIADALAAEAARATKADADTFSAGNAYIDVM
                     LYVGNLAPMVTESDLIAAFSPYGDLLSCRIIRDRQRGHSLGYGFVRFTSKADARVALN
                     QLQGTCIMGQEISIGYARGTVQRDAADPRRPFLDKSAGREGRFQQEDWRRFRSPEGRP
                     GEGTQAALRPRPENSNATTRQRVDLASRRAASPRSRWTDRHERAHSPDQDERLHDSSE
                     TEPVDDQE"
     gene            <494686..>495636
                     /locus_tag="CYME_CMS509C"
                     /db_xref="GeneID:16997141"
     mRNA            <494686..>495636
                     /locus_tag="CYME_CMS509C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538784.1"
                     /db_xref="GeneID:16997141"
     CDS             494686..495636
                     /locus_tag="CYME_CMS509C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538841.1"
                     /db_xref="GeneID:16997141"
                     /translation="MFRGHWWMQRFAAPDSRRLKRRDVVSWTLVHQLMPRVRRNGLRS
                     NDRFRSKHESAALHGYRRNIVRQQHEPLTGYAFEGSHRFHLHEQRSWTRSRDVAGIAA
                     SGALGTVRHERDVDGSKAFWPACRPGLDAYGTCCTVDGIAFPKPSFGWNALHLRVQRT
                     PYSPMRSALTSARDRSVRHRARKRRSAYRGSRGTRQDRVSSDEARLQMTQCRVWRRTC
                     RAHTGTRDTSQESRLHPRKARESQLAPVHEVRRRYRGAAKSGRARWPQHRSTADVGAG
                     CAGGTGVYHSAGNSEKRKRQAQKAHDDDAWIRSNRKNRER"
     gene            <495955..>496776
                     /locus_tag="CYME_CMS188C"
                     /db_xref="GeneID:16997205"
     mRNA            <495955..>496776
                     /locus_tag="CYME_CMS188C"
                     /product="probable chloroplast chaperonin CPN21,
                     precursor"
                     /transcript_id="XM_005538785.1"
                     /db_xref="GeneID:16997205"
     CDS             495955..496776
                     /locus_tag="CYME_CMS188C"
                     /codon_start=1
                     /product="probable chloroplast chaperonin CPN21,
                     precursor"
                     /protein_id="XP_005538842.1"
                     /db_xref="GeneID:16997205"
                     /translation="MFVQGSILRHSCTLGKRNSSFAGGVAVSTAAPTAGLAAARTLRL
                     RTRGFRSLVAVHQATSGTHSINSYTTGGPVQALGRYVLVRLDRKETQTVGGIVLAESA
                     QEKPSRGTVVSVGGGAWHPNAPVKMPMAVKPGDVVLFGKYGGTEVKMDDEDHVFVSMD
                     DILGVYDGGKVDDPQALKPVFDRVLVQMEKKTERRSASGIIVAPTASVDEDAKAGRVV
                     AVGPGRFMVNGEYEPVPVQVGEWVMFRKYSGSEVKFGDQEYNVVRIADLLAKWKA"
     gene            complement(<497305..>498114)
                     /locus_tag="CYME_CMS189C"
                     /db_xref="GeneID:16997142"
     mRNA            complement(<497305..>498114)
                     /locus_tag="CYME_CMS189C"
                     /product="40S ribosomal protein S3A"
                     /transcript_id="XM_005538786.1"
                     /db_xref="GeneID:16997142"
     CDS             complement(497305..498114)
                     /locus_tag="CYME_CMS189C"
                     /codon_start=1
                     /product="40S ribosomal protein S3A"
                     /protein_id="XP_005538843.1"
                     /db_xref="GeneID:16997142"
                     /translation="MAQGKNKRLSKGKKGSKKKILDPYSRKEWYDVKAPSYFSVRQAG
                     KTIVSKTSGTRIASESLKGRVFEISLADLQKDEDLAYRKIKLRCEDVQGRNCLTQFYG
                     FDFTRDKLSSMMRKWQTTIEAHVDVKTLDDYVLRLFCIGFTKRRQGQIRKTSYCKKSQ
                     ERAIRKKMVDIMVQETSKGTLRDFVANIIPEAIGKEIEKACKNIYPLQNVYIRKCKLI
                     RAPKFDLTKLMEVHGDAPEDTGVRLEQGAAISGAASLQAETAQADAPVVGI"
     gene            complement(<502040..>503233)
                     /locus_tag="CYME_CMS190C"
                     /db_xref="GeneID:16997143"
     mRNA            complement(<502040..>503233)
                     /locus_tag="CYME_CMS190C"
                     /product="similar to sugar fermentation stimulation
                     protein, Sfs1"
                     /transcript_id="XM_005538787.1"
                     /db_xref="GeneID:16997143"
     CDS             complement(502040..503233)
                     /locus_tag="CYME_CMS190C"
                     /codon_start=1
                     /product="similar to sugar fermentation stimulation
                     protein, Sfs1"
                     /protein_id="XP_005538844.1"
                     /db_xref="GeneID:16997143"
                     /translation="MQRCRGIRKHPIPERNSTGPPRLTKTSFKRAGASCPAALSPVVS
                     SDSNMQTTRMSALLRGVLLERYKRFLARVRLDDGTEVTASVLNPGRMTGGDEGAPAKG
                     YAVPNESAVYLAAVDRGAKAKHPFRWIIATEPSTGALVCVHTLAANRLIGEALESRAP
                     CLMEAIGEALSDVEAGDNAMEPRAVPRFHFHEVERETSLPRQDPDTERRRRENAPPDT
                     GAWQASTTKTRKTSRCDFCLDHRIFIEVKSVTMRGSAEGLVLFPDAVSDRASRHLQEL
                     ASIARGSAKYPRARPEMPVQALVIFVVQRSDPPRALCPAESIDPAFAVAMRHAACCGV
                     RFLCLWVKPSVTREEAVPFRWTVEWSWMPAQGPAEPPPGCVSASRSIPVFLSQEAAME
                     YLRNV"
     gene            <504709..>505365
                     /locus_tag="CYME_CMS191C"
                     /db_xref="GeneID:16997616"
     mRNA            <504709..>505365
                     /locus_tag="CYME_CMS191C"
                     /product="similar to methyltransferase"
                     /transcript_id="XM_005538788.1"
                     /db_xref="GeneID:16997616"
     CDS             504709..505365
                     /locus_tag="CYME_CMS191C"
                     /codon_start=1
                     /product="similar to methyltransferase"
                     /protein_id="XP_005538845.1"
                     /db_xref="GeneID:16997616"
                     /translation="MTCRDNSDLSPDQPVYWRDRWEKGVTPWDCGCAHPLLVHLAPRL
                     PSGRALVPGCGSGYDVIALAKQDPARQVTGLDLSELACKRGESMRDEAGLSSKQVQFI
                     EGDFFKFDYEEPFDLVYDYTFFCALPPHLRKQWAARMAELVKPSGILFTLMFPVRDSG
                     TGAEGGPPFSVSHEAYASVLEPAGFKLLECGDVPSAYRRPKTPSPGAELYGLWQRVGA
                     "
     gene            <508787..>511078
                     /locus_tag="CYME_CMS192C"
                     /db_xref="GeneID:16997617"
     mRNA            <508787..>511078
                     /locus_tag="CYME_CMS192C"
                     /product="glutamate--tRNA ligase, chloroplast or
                     mitochondrial"
                     /transcript_id="XM_005538789.1"
                     /db_xref="GeneID:16997617"
     CDS             508787..511078
                     /locus_tag="CYME_CMS192C"
                     /codon_start=1
                     /product="glutamate--tRNA ligase, chloroplast or
                     mitochondrial"
                     /protein_id="XP_005538846.1"
                     /db_xref="GeneID:16997617"
                     /translation="MEQRARGLAAQQPCISGFVLVAQSRMPFLRSLTGPLQPRGALFA
                     RTGSPIARSVAPQAALRFESLRGTGTRAVMGFAPVSSVEAALPRPPSRYAGSIAGSRS
                     SFTSCEELCRKPVWTRLPSPATLGRMPRYASIIVRSRSSNTNRALRFLDMHRGGTAKA
                     SQEVTPWYQYDARWSQVLSNPTNVLELPPLPPHLVRVRFAPSPTGNLHVGGARTALFN
                     WLYARNQGGYFIIRIEDTDQARSSRASELAVLRDLRWLGLDWDEGPAYPDEPTTEPYR
                     GERGPYRQSERSAIYEAAAAKLIESGAVYPCFCTEEQLERKRRLAEAEHRAPQYDGTC
                     RDADPALIRKRLQRGDPYTLRFRVPAGTRVEIRDVIRGDIAWDANATIGDFIIVRSSG
                     LPVYNFCVAVDDALMGITTVIRAEEHLTNTLRQALILDALGYDRPQYAHVSLILGADR
                     QKLSKRHGATSIDQYAREGFLPEAMMNYLALLGWNDGTEREIYSVEELIKAFSLDRIT
                     KSAAVFDANKLRWMNGLHLRSMPPEKLCGVLIRFWLDANVIQRPAEEIDVDVPTRAAA
                     GVAQSASALRFWVFTSRATELLRGSIELAKDCVPLLQDILEYPLEETIESGDSDELLT
                     PQGGFLDIATAVLERYRKGEIPFGDEIEPDPEMMVPNAPSLTSEDPFIEDWKAWVKGI
                     GTQLGRKSKRLFHPIRLVMTGRMTGPDVGEIMRILGLAKGVVQVPYVPLSERMRILER
                     VVKKLRTEREATTSSPSSPNAAR"
     gene            complement(<512459..>513562)
                     /locus_tag="CYME_CMS193C"
                     /db_xref="GeneID:16997618"
     mRNA            complement(<512459..>513562)
                     /locus_tag="CYME_CMS193C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538790.1"
                     /db_xref="GeneID:16997618"
     CDS             complement(512459..513562)
                     /locus_tag="CYME_CMS193C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538847.1"
                     /db_xref="GeneID:16997618"
                     /translation="MRDVNSLLVSRKLARTLVCWSHVNGFCSSGGRIGCQSRSDLTQL
                     VQRRKLTFGSVVLESENQKRCLSSMQRRRLVSLVIYSDPDALDGRHSRTPNELDFDDG
                     TAAAAADIGSEATAAAAAYDPSRFGFIEIGTIAGPHGVRGECKVRLNTDFARERLPKE
                     PAQRYIKLAHRVYPRPVWVQDGRPASQANVWIIRVRGVEDRDAASQLRGACLYVHESE
                     QRPQSLGADEYIITEWIGRPAILRETLEKLQAQADFLWTREWVFKHCLGRVAGVILRN
                     EHGGAHDALELLLFEGNRSLEVPFLEAFVQEMDIAAHEGAADAETQPPSLTKLAVLDL
                     PPGMLDLARPRERKKRLRIRGYLPPCRTIVHAA"
     gene            <513873..>514868
                     /locus_tag="CYME_CMS194C"
                     /db_xref="GeneID:16997619"
     mRNA            <513873..>514868
                     /locus_tag="CYME_CMS194C"
                     /product="similar to cell polarity protein alp13"
                     /transcript_id="XM_005538791.1"
                     /db_xref="GeneID:16997619"
     CDS             513873..514868
                     /locus_tag="CYME_CMS194C"
                     /codon_start=1
                     /product="similar to cell polarity protein alp13"
                     /protein_id="XP_005538848.1"
                     /db_xref="GeneID:16997619"
                     /translation="MVPAGTQQDFAEQENVLVYHGPLLYEAKVLEALESRTEPGARCY
                     LVHFIGWNRCYDTVVSREAVLPRTSANLELAEQLYVDFVEKRGPAATAAVEAASHTTQ
                     RIERVAQGNTEAPLSASTTGCESAISAAHVRNDEVVIDGEDDVDEHVAIYNCRGLRSI
                     LEHVDPDDPLRWFELPTVLKRTVLDDFEYVSESGRLYPLPAQVTVAAILHAWVRHRKR
                     TQDTDAGQIRALAESLQRYFNEALSSMLLYEDERPQYAMVTTSHPGKRASEIYGGEHL
                     LRLMVKLPWFLEQLPITRDEVRQFARLFQDLCRFLLRNHYRFFSVVDGSALEESR"
     gene            complement(<517364..>518860)
                     /locus_tag="CYME_CMS195C"
                     /db_xref="GeneID:16997196"
     mRNA            complement(<517364..>518860)
                     /locus_tag="CYME_CMS195C"
                     /product="6-phosphogluconate dehydrogenase,
                     decarboxylating"
                     /transcript_id="XM_005538792.1"
                     /db_xref="GeneID:16997196"
     CDS             complement(517364..518860)
                     /locus_tag="CYME_CMS195C"
                     /codon_start=1
                     /product="6-phosphogluconate dehydrogenase,
                     decarboxylating"
                     /protein_id="XP_005538849.1"
                     /db_xref="GeneID:16997196"
                     /translation="MNKALDSDHPNQAVADVGLIGLAVMGQNLVLNMADHGFKVAVFN
                     RTVSKVQEFLETVAKDRETIFGARTIQEFCALIKKPRKVILLVRAGPAVDDFIEKLQP
                     HLDPGDVIVDGGNSYYQDSTRRMKHCAEHGLLFVGCGVSGGEEGARYGPSLMPGGTEA
                     AWPLLRPVLQAIAARADGEPCCDWVGSGGAGHFVKMVHNGIEYGDMQLISEVYDVMRR
                     GLGLSVEECGDIFAAWNETELCSYLIEITANILKYKDDETGKPLVSLILDKAEQKGTG
                     RWTVESSLEHSVPVTLIAEAVFSRMLSSRKAERVRASKVLQGPPAQPPLNEQDRQNMI
                     EKLRLALYASKIVSYAQGYMLMKEAAAAEDWNLNYGGIALMWRGGCIIRSRFLGKIRE
                     AYQDEPNLENLLLYRFFRDALLAAQQSWRDAVVFAVSRGITCPAISTALAFYDGYRAE
                     TLPASLLQAQRDYFGAHTYERIDKPENQYFHTNWTGTGGTTTSNAYSA"
     misc_feature    519247..522303
                     /note="repetitive element"
     gene            <522456..>525371
                     /locus_tag="CYME_CMS197C"
                     /db_xref="GeneID:16997197"
     mRNA            <522456..>525371
                     /locus_tag="CYME_CMS197C"
                     /product="isoamylase"
                     /transcript_id="XM_005538793.1"
                     /db_xref="GeneID:16997197"
     CDS             522456..525371
                     /locus_tag="CYME_CMS197C"
                     /codon_start=1
                     /product="isoamylase"
                     /protein_id="XP_005538850.1"
                     /db_xref="GeneID:16997197"
                     /translation="MHRVRSRASFSNRSSEDLVQVPPGLELDEEELALLEQQRQLENA
                     LARHEHGNVPRSLSRRILDYMVQSSDGADLRTNQSILGTESRAFPEWSTFQRPVARKG
                     PRYDELRLGELLVRRGHPLPYGVSLSPEGTNFAIFTDEEEHVALILYPAKSRRQLRHE
                     RLQSAAAASIESATPVTSNTEKSAPKTDSHSGEHVMDKQTETAPPSDASQETGARESS
                     ESTPARTESAASALLRRNRAPFIVRESSTDDEDRFEDVRSNAGSTGGSTPRAMSEGLE
                     DPSNNDAVMTTSALQSSTRQAKSVLATAQILPHQSGLLFPMDWFLPVPSIDDAKPLII
                     ELDPVIHRTGHVWHVQIAPNVEHYAYAWRIGDRPTRWGSNIVLDPYAKCVFSPPSADF
                     NRPPGPYRPICGVPAIGELDFDWDGVLPPRYPFKDLIIYELHVRGLTKQTTSPYAGTY
                     LGVIEKIPYLKQLGINAVELMPCAEFNETEWDMRNPSTGERLCQFWGYSPISFFAPMN
                     RYAMQGFTSAVREFKTMVRELHRHGIEVILDVVFNHTGEFGDDGPPPLFYHFKGLALS
                     TYYILDRKNQFANYSGCGNSLSANHVVTAEFIHECVRYWALEMGVDGFRFDLAAVMCR
                     DPQGQPMASPPVIERLSKDPCLRHLKLIAEPWDLGQYLVGHFPHYGCWAEWNGRFRDT
                     VRRFIKGDPHLIGDFATRLCGSEDLYANGRRPWHSINFVTAHDGFTLYDLVSYAEKHN
                     WDNGEENQDGESHNNSWNCGFEGDGTPNPNIFFLRQKQMRNFLVALLISTGTPMVLMG
                     DEYGHTRRGNNNAWCQDNELNYMDWDKVARDERGLVRFTRLMILFRRVNTFLCRQNFV
                     TRHDVSWIHADWSSAYNFLVMRIIDPGNDDLLVGFNAGPERRTVTVPPLSSDRQWLRI
                     VDTNLAPPLDFCNGDNPTKIYGTYVMQPWSSIILQSHRRSVLIQSLEEHLRGREAAS"
     misc_feature    complement(522873..525418)
                     /note="possible transcribed region"
     gene            complement(<526091..>528994)
                     /locus_tag="CYME_CMS199C"
                     /db_xref="GeneID:16997199"
     mRNA            complement(<526091..>528994)
                     /locus_tag="CYME_CMS199C"
                     /product="U3 snoRNP component PWP2"
                     /transcript_id="XM_005538794.1"
                     /db_xref="GeneID:16997199"
     CDS             complement(526091..528994)
                     /locus_tag="CYME_CMS199C"
                     /codon_start=1
                     /product="U3 snoRNP component PWP2"
                     /protein_id="XP_005538851.1"
                     /db_xref="GeneID:16997199"
                     /translation="MVAFGYRLVNVLGKSFTGGNLVFTPDGETILSPVGNRVVAFSLV
                     SAGSRTLDAISRADIEVLALSSAASGDYLLAVDVDGRALFISLVSGAVLHRFRFCGGA
                     VQQALFAPDGERLAVGVGSSLQIWQVPTDRAFLPEFAPFVRVKTIAAHPDQVTALAWS
                     PSGQLLLSGARDHSLRLVHANGGFDAPISLRGHRDVILWTAFGQDDTQAYSLSVDGTL
                     ITWRIAREATASIDERERAMESVHEPDGILEDAPPLPALNGLSETLAKKRGNDATASN
                     GTGTRTRSGRRRNAHRELVRCLNKTNLFIGSEGSRQPRHVRVTCAHALMKRRLLALGL
                     SNGVLMLVELEPQPEPGVMTRLVQQFSVSAAPLSAITIHPDGEWIALASALTSALIVW
                     EWTSEKYVLKQQGHWLDLTCLAYAPRGDVIATGAADGLVKLWSTFTGFCALTLDDLHT
                     QRLTGLAFSQRSGVLFSCSTDGTVRAIDLKRYRAFRTLRGPAGASSGVSYPFTCLAAD
                     ESGDLVAAGCKEPFVVCVWHVRTGQLLETLAGHEAPISAVAFNGVTAEAEGLRLASAS
                     WDGTVRLWALLATGSRLDAQVLRHAKEVLTMAFHPDGRELVSATADGTLTLWDTRLAT
                     VRATLETRRDCEAAGARDAPYVSTLCYTTDGQFLLASGGDATGVLVYSRATLQCIRRI
                     ELFPTFICERRSAAKAAPATSAAPASENKLLRALAAKTPSSETRTHRLALRILHEHRD
                     RKRSARMLRVQSIQVAPGTETWAAATTDGLFLFAHALGSFATAAPLWRGSLGAAFDPV
                     DLAVDVTPSNMLQAIREGRWALALSLALRLNEPGYVYDMLGHVPADQVDIVVRALSAV
                     HVPTLISLLAEALVGSLRLKRSRHWEYLLRWCSALLVWHGEAATRATGTKGEPVPRRQ
                     LRVGRNYRLDAALLALHRALLHYRDTLERLCDENRALLQLCVDSAPVEQVTST"
     misc_feature    528299..528940
                     /note="possible transcribed region"
     misc_feature    529116..530757
                     /note="possible transcribed region"
     gene            complement(<529836..>531404)
                     /locus_tag="CYME_CMS202C"
                     /db_xref="GeneID:16997202"
     mRNA            complement(<529836..>531404)
                     /locus_tag="CYME_CMS202C"
                     /product="flavin adenine dinucleotide synthetase"
                     /transcript_id="XM_005538795.1"
                     /db_xref="GeneID:16997202"
     CDS             complement(529836..531404)
                     /locus_tag="CYME_CMS202C"
                     /codon_start=1
                     /product="flavin adenine dinucleotide synthetase"
                     /protein_id="XP_005538852.1"
                     /db_xref="GeneID:16997202"
                     /translation="MLGVGKDDSQTENEEPLWKQLECIEQVAPDLAPGVTSSLQLLRG
                     VLRIFEPEEVALSFNGGKDATVVFHLTRAAFQSLYKERKPAPHIQAVFFEEPDPQEQF
                     PEVLEFVADWSRRYADQLVFDRVPGGIFHGLKTYLTEIRPRVRCFLLGTRWIDPDGPS
                     QEHLSPSSPEWPSFLRVNPILHWSYRAVWRFLRTFHLEYCSLYDAGYTSIGRVSDTER
                     NPLLRRESALFDDFTHLDRDEDERCGRKQKTKNQVQQLAIAHVEHRHASQDPAQAALQ
                     RLLSVRLLLLGTDASRWFDGMIRANLVSRFLRELESYPWKPQLVQVVTDWLEGLRLAL
                     ATSLHGESAESQCPTLPVILVAYDGSGSDVQLLRALVEALACERLPAEDAIRSAPNQA
                     SPDDDNQTSRLRLLVCPLGSTWGNPRHAAEALHRAIDLSTASPARELTPPARFTLQCA
                     SLRRCNVQTARLHEGLISEPLQSTILFTDLVDLRLNLDGHISIAVSGDARARFSQVFQ
                     QFGWPFQEASAPAQ"
     gene            <532680..>533858
                     /locus_tag="CYME_CMS203C"
                     /db_xref="GeneID:16997203"
     mRNA            <532680..>533858
                     /locus_tag="CYME_CMS203C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538796.1"
                     /db_xref="GeneID:16997203"
     CDS             532680..533858
                     /locus_tag="CYME_CMS203C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538853.1"
                     /db_xref="GeneID:16997203"
                     /translation="MKMLCFLYTTPGGFCANTATDLFVSNCTGRRRHAPLARRCWNAH
                     HRQPQATLLARLRLSANEGDFRHADQAPLEQSVTRPARLSKAVLALALGLFGATLGAL
                     SAYSAPKRLSMEGSNAALAVNLSSFRRRRSGVETVRLVAAKKSAPVENLTLYDPVGEQ
                     MARNRFIASIVVGVTVAALYLYSTERCKRDNEEEEKRIRAEVARLEKWKSEFVDAQQS
                     NDVNDEDLLAALRERLQQQQKGGSTDIADPDQQKQNTSESDADNDDDNDIKLRRGDDS
                     PSEHPDSDKRGGKHGPSMPPSTEQPRAGSGGAATLDRPGADRGRRSSRGRSMDSRSGR
                     HSSSDDKNPNANDGRAGNDSQRDSTANWDLERERLRKLFNLDSGSSGTGSDDTRKGDR
                     "
     gene            complement(<534815..>535840)
                     /locus_tag="CYME_CMS204C"
                     /db_xref="GeneID:16997219"
     mRNA            complement(<534815..>535840)
                     /locus_tag="CYME_CMS204C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538797.1"
                     /db_xref="GeneID:16997219"
     CDS             complement(534815..535840)
                     /locus_tag="CYME_CMS204C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538854.1"
                     /db_xref="GeneID:16997219"
                     /translation="MQCLRWRLRCSKRASITRSGTETLDVSTGNVSTQRILNSVIGTT
                     GILFGIPGRFFWKGRHGSPSGSRQTLRRRCSGVRLRRQRFRTGEHGRRLHVRPLKSKV
                     NAVSELSASANSKNQPLMAPHPGVDSLPRTSDRVLRSVQRKSRERRFLLYILGLSAVT
                     LLGLLFWPPESRGAEQSENSWGPRRYGLAVRAPRPSTVGHGTVSRCRPNAQNCVSSRD
                     MPNTSCFEPPWRYPSTMGALQALQRVYEAVQRYPGPETSKIITYKPGKYLYAEFQTRF
                     WGFVDDVECLVDDATHVIHFRSASRIGRSDMGTNRARMRKLFDMLAQEGFTEAAQVVT
                     NAHSKRS"
     misc_feature    complement(535935..537724)
                     /note="possible transcribed region"
     gene            <537259..>538599
                     /locus_tag="CYME_CMS206C"
                     /db_xref="GeneID:16997221"
     mRNA            <537259..>538599
                     /locus_tag="CYME_CMS206C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538798.1"
                     /db_xref="GeneID:16997221"
     CDS             537259..538599
                     /locus_tag="CYME_CMS206C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538855.1"
                     /db_xref="GeneID:16997221"
                     /translation="MDRHSTTQLPYLCNWCLGQVSNQDQAVFTDCACLFCSGTCASQL
                     RRGPLCSVCAQPGCRLYRVGKDGSGLPLTHRRCLFASAASLIDEMQRALAFREAQLQR
                     LRERILDRGVTEGMRSTAQAEKRAQRSSRAPEASVFALGMPGHIHQIHAAVSQNGSKD
                     IAHWEAQASTATPISRAQQQQQQQQRAALSCVRRNAAAEKAETLRSADVRSAVAALER
                     STQASGVSSSVRTVRSQQTVRSYGDRLERIREQMLYGPYRRQLQSERTPLVPPVPRSG
                     ISYIGRARLGLPPAGDRRQSALHRANIPGLATKRIWKQRSASASNWMHAPGSAAVQAS
                     SSGAGSIVSTHCQGSRVVSSEVQRVPSEISTIRPTALSMNPLHWLNWKSADRRPANVQ
                     HQAYEEEQQQQSQQQDACAQSVQTPRSASSTIRSTKPSPTCEHPSAAYTAHRSP"
     gene            complement(<539184..>541409)
                     /locus_tag="CYME_CMS207C"
                     /db_xref="GeneID:16997222"
     mRNA            complement(<539184..>541409)
                     /locus_tag="CYME_CMS207C"
                     /product="similar to plant adhesion molecule 1, PAM1"
                     /transcript_id="XM_005538799.1"
                     /db_xref="GeneID:16997222"
     CDS             complement(539184..541409)
                     /locus_tag="CYME_CMS207C"
                     /codon_start=1
                     /product="similar to plant adhesion molecule 1, PAM1"
                     /protein_id="XP_005538856.1"
                     /db_xref="GeneID:16997222"
                     /translation="MVQTRSLADAHLRKPSCGVLRADVTTSPSSMFTESDVDRGLKTR
                     DNFPEHGKQERFRVERNDVHVTISPEPVAYGRAPDERPLPLADSVISEIRELIEDESH
                     VDLVKLAEIARGGLPAALRGDVWRYLLGVAKADKSEELTHEKELAAAYQRLRRSALAA
                     LGQIGQGLTETLHGAEVSERGGFLSAGGAAASAPLPALPRSQTVSEDTGRDYLSVQAS
                     SPRAGRAVGHSDLETDCNAFGRGSLEYTGMQGPEPALLNDAGEMHVALTLEQSTNWDG
                     SLARRIRNDAKRRIERERLRIEHSRWRRSRLTMSSQHGRMFPSQKRAPDVQVVDKPRE
                     QQDRSLRNVGSETNLVNPRLVRAAGPYHGLSDGDESVKAPSRPPSAPTQSGVMEYTLP
                     QQLDHDEAVLCSSPESTSSATNSMRSAEAATLQTIGEGSVLEARDGMEVPAGTEVLVE
                     NDVTCSGSRLERASGDSITTGISTTRGLASAMRTPHAALVRCYVSVLCTYLYVVELSV
                     RHMVALPLIMPLDTKHGSTTELEKVNDVLMSLGTPVEYAPTMVSLVHVFVQVFTSARE
                     MDVYYGFCALMHRFGHVLLFTTHGDGLTRATAHFLMLFRTLLPDLADFFESEEIEHQR
                     WLHGWLQGLFSRGEMPVESTLRIWDFYLSSGLEMHPYVCLAVLDLLQEEITELDGPEV
                     VTYLGKLPDNLDPEKLLTRAVTIRETALGSGLVPPRLSEEQPDDSNRSFGIASLRYRD
                     D"
     gene            <544956..>547169
                     /locus_tag="CYME_CMS208C"
                     /db_xref="GeneID:16997242"
     mRNA            <544956..>547169
                     /locus_tag="CYME_CMS208C"
                     /product="threonine--tRNA ligase, cytoplasmic"
                     /transcript_id="XM_005538800.1"
                     /db_xref="GeneID:16997242"
     CDS             544956..547169
                     /locus_tag="CYME_CMS208C"
                     /codon_start=1
                     /product="threonine--tRNA ligase, cytoplasmic"
                     /protein_id="XP_005538857.1"
                     /db_xref="GeneID:16997242"
                     /translation="MEHEANLNDLSLDDRGKRERPAPESEAPPYVNHRISCWERFRQH
                     KQGTLLGSNGSSDEILIKLPDGTSTRGKRYETSPWDVAQSLGRDLAERSVVALVDGEP
                     WDMNRPLEADCSVDFRSFDTPEGRAVFWHSTAHMLGEAMEYKYHGELCIGPPVEDGFY
                     YDIFLGERAITPEDLADLERRIQRIMKDKGRTFERMELTKSEALEMFGYNRFKCELIE
                     KLGEGETITAYRDGPFIDLCRGPHVPSCGRVKAVKLTRLGQAYWLGKAQNPSLQRVYG
                     ISFPDKQQLKEWERRIEEAAKRDHRKIGRDQELFFFHPYSPGSCFFLPHGTRIYNRLL
                     EFMRREYWNRGYEEVLTPTVFDFALWEASGHAANYRENMFSFEVEQRAFGLKPMNCPS
                     HCLIYASRVRSHRELPLRLADFGILHRNELSGTLTGLTRVRKFEQDDAHIFCTPAQVE
                     SEVLGFLKFLEHVYQIFGFKFELELSTRPEKFMGDPALWDRAESMLAQALCQFTGKQR
                     DEPGGWRLNPGDGAFYGPKIDIKLFDALQRRHQCATVQLDFQLPIRFDLRYTAAGAST
                     EDGNAAASGPVLAPVAERSLDTTDATPEDAKVVPASHDVHRPVMIHRAIFGSFERFIA
                     IITEHYGGKWPFWLSPRQVAVLPVSDRFLHYAQQVHQRIHDAGFFVDVDSSDRKLAKK
                     IREAQLAQYNYILVVGEKEQADGTVNVRTRDNEVHGERTIDQIISEFRQLTERFQ"
     gene            <548168..>548719
                     /locus_tag="CYME_CMS209C"
                     /db_xref="GeneID:16997243"
     mRNA            <548168..>548719
                     /locus_tag="CYME_CMS209C"
                     /product="mitochondrial inner membrane insertion complex
                     subunit Tim22"
                     /transcript_id="XM_005538801.1"
                     /db_xref="GeneID:16997243"
     CDS             548168..548719
                     /locus_tag="CYME_CMS209C"
                     /codon_start=1
                     /product="mitochondrial inner membrane insertion complex
                     subunit Tim22"
                     /protein_id="XP_005538858.1"
                     /db_xref="GeneID:16997243"
                     /translation="MSAGTSPVSRKSEEADVVKPRLPPNLQFPERNPSEKFAEMVLES
                     CAFKAVAAAIAGGGLGVALGLFIGGFSAELDRAVEAQSPWREQLRAYGKALAAQIRTY
                     SKNFALWGATYTIAECSVEKYRARHDLWNSLIAGCATGAVLASQPRASMSARTRGQQM
                     SVGCLGVAAFSCAIDYWLEHRHA"
     misc_feature    complement(550331..551861)
                     /note="possible transcribed region"
     gene            <551399..>552877
                     /locus_tag="CYME_CMS211C"
                     /db_xref="GeneID:16997245"
     mRNA            <551399..>552877
                     /locus_tag="CYME_CMS211C"
                     /product="similar to D-aminoacid oxidoreductase, DadA"
                     /transcript_id="XM_005538802.1"
                     /db_xref="GeneID:16997245"
     CDS             551399..552877
                     /locus_tag="CYME_CMS211C"
                     /codon_start=1
                     /product="similar to D-aminoacid oxidoreductase, DadA"
                     /protein_id="XP_005538859.1"
                     /db_xref="GeneID:16997245"
                     /translation="MTAWLLAPSPVHARKMFSASSRVCALGTGRQLPVQVPSAPQRAA
                     RRTRSRKRLSCSTETHVHLVGFGLAGAALAFYLCERASQSQRLTISVVDSAGAGCAGG
                     ATHASAGILHPFTPRGRKIWLGDEGLICMREILGVISEKDSSPVARRSGLLRLATTDR
                     EAADYAAAATQMYPQQLYWDAARSQLYIPDAWVVDAPAYVRAIRRYLERNHSDKLTLW
                     ETREVRSVADECRRLQSLAEASCAAVTFLVIAAGASSRLLIPSLPLTWCGGHNLVFRS
                     QDLTWPSPEFAAASTLTAGFSSTSAPGSVPLIGHGSYLVPTPDGTRVIGGATKEYGMT
                     ATEVLKAQSRSPSEQMARATSALRQPLSALLGRYANLAERYAAGESPLSNTGILRDPL
                     EALYGVRALPPRSALGAVPLLGEIQHEALSMLASTSIPENTRVLYFTGLGSRGLIHHG
                     IIGRLAADAVLRGESVVSLGSVASPTVLSSVRRAAAAAVAAS"
     gene            complement(<552742..>553497)
                     /locus_tag="CYME_CMS212C"
                     /db_xref="GeneID:16997250"
     mRNA            complement(<552742..>553497)
                     /locus_tag="CYME_CMS212C"
                     /product="mitochondrial ribosomal protein S17 precursor"
                     /transcript_id="XM_005538803.1"
                     /db_xref="GeneID:16997250"
     CDS             complement(552742..553497)
                     /locus_tag="CYME_CMS212C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein S17 precursor"
                     /protein_id="XP_005538860.1"
                     /db_xref="GeneID:16997250"
                     /translation="MYSALTALTRIVRRNVLSLASASGVGLQGPRTGPLCDSGTRRAG
                     LLLVTNHAVLPRYCSESTKSRGVVQGPVYTAPYFGAPIEQVQSLSLDELKQALRAYGG
                     LVRPTDNQEVLCKRLLSLTRRRRAQCIHGVVVSNAPQKTVVVAARRLRYEPKIKTYRF
                     VTRRFMAHDEEDRCLLGDKVTIRLCRPLSRRKRFVVVENFGSSERRRQEAATAAAAAR
                     RTEESTVGLATLPSETTDSPRSTASAASRPIMP"
     gene            <553881..>554204
                     /locus_tag="CYME_CMS213C"
                     /db_xref="GeneID:16997251"
     mRNA            <553881..>554204
                     /locus_tag="CYME_CMS213C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538804.1"
                     /db_xref="GeneID:16997251"
     CDS             553881..554204
                     /locus_tag="CYME_CMS213C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538861.1"
                     /db_xref="GeneID:16997251"
                     /translation="MSCQTAADSIATGVVGVSLLLLVYFLNLFGYLHVQRWPDSAVYA
                     SLNAIGSGLSAVASGLIRYWPFVVLEGVWCLTSLAGLGRILYRHWKGNHSTASADGSN
                     TKDTG"
     gene            complement(<554493..>555011)
                     /locus_tag="CYME_CMS519C"
                     /db_xref="GeneID:16997252"
     mRNA            complement(<554493..>555011)
                     /locus_tag="CYME_CMS519C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538805.1"
                     /db_xref="GeneID:16997252"
     CDS             complement(554493..555011)
                     /locus_tag="CYME_CMS519C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538862.1"
                     /db_xref="GeneID:16997252"
                     /translation="MTVKMKSSTKSEEKKSQKIPHKKAATAALPSRAAPAGPTTAEAP
                     LPTPRRTPARAAAAAAAAARAAKREPIPLKLERESKLSRKSKATAQRRPDKIEKKKPK
                     SQKAPKSTGAGASKPKKKDKGSKLPHSKEAAAAAAAAARTSGSSTGTVAQPATTAEVV
                     KPYFSRGWCSVQ"
     misc_feature    complement(555210..558670)
                     /note="repetitive element"
     gene            complement(<560010..>560786)
                     /locus_tag="CYME_CMS215C"
                     /db_xref="GeneID:16997376"
     mRNA            complement(<560010..>560786)
                     /locus_tag="CYME_CMS215C"
                     /product="similar to CDK7/cyclin H assembly factor
                     MAT1/TFIIH subunit:"
                     /transcript_id="XM_005538806.1"
                     /db_xref="GeneID:16997376"
     CDS             complement(560010..560786)
                     /locus_tag="CYME_CMS215C"
                     /codon_start=1
                     /product="similar to CDK7/cyclin H assembly factor
                     MAT1/TFIIH subunit:"
                     /protein_id="XP_005538863.1"
                     /db_xref="GeneID:16997376"
                     /translation="MERSVGGSEQTSDWVSRLEEELEREKSIRRRILRDFNKLRDDFT
                     SDQEYEDYLEMVEELIFNLVHGIDVERTNERIAAYRKENAALIRRNQLKWQEREQAEA
                     AQLAADERARQTRLAALAREDEEEERQRRLAEEHERTRRLQAALRNDTGRGGTRAQQS
                     ALSKAPGAQRPPQLGADDKVRVNVHPAQGSRGGSALDQRSPTDGKRIVVDMPSARALD
                     IAQSPEERYPDPLVRNETARKAAGFDPNAWIRRARAQLCV"
     misc_feature    560876..561527
                     /note="possible transcribed region"
     gene            <562435..>563211
                     /locus_tag="CYME_CMS217C"
                     /db_xref="GeneID:16997319"
     mRNA            <562435..>563211
                     /locus_tag="CYME_CMS217C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538807.1"
                     /db_xref="GeneID:16997319"
     CDS             562435..563211
                     /locus_tag="CYME_CMS217C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538864.1"
                     /db_xref="GeneID:16997319"
                     /translation="MRSEWPFDYASEADAMLHRITPENFEKLVRFAARLLRVGEIIAL
                     PTDTVYGLAAAARNSHGIELLYQTKQRDLRKPLAIAVPSVEDVSVYLHTEHLPPGLLE
                     AILPGPLTLLLRQREDYVGIDLQDVRIDQYRGWERAKRLAPNLNLRRDGLLGVRVPDA
                     SFACAVSRELGDPLALTSANVSGRGDCGSVDEFRALWSACAAVFDGGAMPKPVMPSTV
                     VDLSVPGTFRITRAGWMATDLVRILENKFGLTNKSANTSN"
     gene            complement(<563731..>564882)
                     /locus_tag="CYME_CMS218C"
                     /db_xref="GeneID:16997320"
     mRNA            complement(<563731..>564882)
                     /locus_tag="CYME_CMS218C"
                     /product="similar to mitochondrial distribution and
                     morphology; Mdm38p"
                     /transcript_id="XM_005538808.1"
                     /db_xref="GeneID:16997320"
     CDS             complement(563731..564882)
                     /locus_tag="CYME_CMS218C"
                     /codon_start=1
                     /product="similar to mitochondrial distribution and
                     morphology; Mdm38p"
                     /protein_id="XP_005538865.1"
                     /db_xref="GeneID:16997320"
                     /translation="MTARLRRQFVHQWALGLVVGSFEGCGSRRGAELVQRRPLALVYS
                     GRWSLRNPRLFCPVRTERQFSGRVLLSEASGREGDAKKSQAVATEPSQQTPAGRDSAA
                     PWWRRLQRAWETFREGARTYTRGSLQLYRNMKQAGQLEKRLSKGGHEALSYPEHLLLI
                     QTRHDRLRAFLLLSVSLISTALIPVLAEAIPGFKPTTFTTEEDRQMQLRMQGIRYIEA
                     HLVLWRALATRTDPEVSANALGTFPCVESIAAETLDGALRSCSRPELIALCRLFAQPA
                     FPISFSRSLRKRLARHFTELACLDDALQRDGLQTLTQSQLEDACLMRALPAYDRSGDE
                     MRGDLELWLQRSRHGTRELFQMIADTHLQNAALLGWSAPLLRHALGEHR"
     gene            <565120..>567048
                     /locus_tag="CYME_CMS219C"
                     /db_xref="GeneID:16997321"
     mRNA            <565120..>567048
                     /locus_tag="CYME_CMS219C"
                     /product="similar to dsRNA-specific ribonuclease"
                     /transcript_id="XM_005538809.1"
                     /db_xref="GeneID:16997321"
     CDS             565120..567048
                     /locus_tag="CYME_CMS219C"
                     /codon_start=1
                     /product="similar to dsRNA-specific ribonuclease"
                     /protein_id="XP_005538866.1"
                     /db_xref="GeneID:16997321"
                     /translation="MPRRSRTAAFTVAGSVGRRVNALPTRKRRRRTAPATAPEASSRA
                     LLVPVRHLSLCGCVKHPDFNLANLEQRLRYRFSRYPELAKLAFSHPASSNGDGHQRLL
                     NNERLEFLGDAILSAVVADSLYRQLPEAREGELSVIRAAVVSRDACAKYFARLGLEEF
                     LEFGPVPPPVYERLSRTQNIRANAFEAILGAIYIDGGYEAALEFFLMHFAEDLIHKQI
                     HPVPNYKSVLQEWASQQKEVVTELPSYEILKKSGAAHSPHFDVRVCMRVRGAPEPIEC
                     HGSGRSRKQAEQVAAKALLQLMGVPIDRNEPRDSQHEAPSALVEATAPLLGSAAGTMH
                     PSRLSHSNGQQTSSAREQRVLWDGRQRRQSIDDVRRSTDLEMVIPAAYGGAAASLATV
                     CQWIADAYTVPVAMACLSHFALTGSIAANQTWMQHPLIPQLFWAVVLDRSLLTLADDA
                     PVETVQEMLPSGQRMIRVYSSSDAGDGALQLDPLAPGAESANFFVARRLVVPRSEKTL
                     SMGMFVRFQGCLVPQRNDFETDFISDDITQAWLTALVATVALMFVNESSSASETAERT
                     EPTVPHSHWTGTFVREAVQEWSDAPGQRALARLRLACSRILQELSGYGLLRWNRRNTV
                     LSLHASLLLQFARTWLLI"
     gene            complement(<568324..>570159)
                     /locus_tag="CYME_CMS220C"
                     /db_xref="GeneID:16997322"
     mRNA            complement(<568324..>570159)
                     /locus_tag="CYME_CMS220C"
                     /product="probable phosphate transporter"
                     /transcript_id="XM_005538810.1"
                     /db_xref="GeneID:16997322"
     CDS             complement(568324..570159)
                     /locus_tag="CYME_CMS220C"
                     /codon_start=1
                     /product="probable phosphate transporter"
                     /protein_id="XP_005538867.1"
                     /db_xref="GeneID:16997322"
                     /translation="MRPGKCGGRPPHLAYVVSGPAQRALCLPVHPGRLAVRSELSGST
                     RAHRSSISCFSCRNYGIRAAQLSPTWLRVRESLRERARWTAPRQTTQRGFRLNASLVA
                     DAASAAAGTLSGHILSPFVLVCLSLCIAFLLSAALGANDVANALGTSVGTGAVSIGKA
                     LAIGAVCEFAGAVLFGSTVTKTISTGVVSISGAVATSPSLYMLGMLCVLVGCTMWLGL
                     ATRYGLPVSSTHSVVGSLIGLGMISGWKIQWEAVLRIVLSWIISPLMGGVVAWLLFRF
                     IRQTIIDAPRPTRAMRRWLPTLCGSMLFILTLFLQLESEHSTGWTLFQAVASSFGVAA
                     LGAGVSGALTSFIHSKQFVRRSIPRENIRGNGRKIDASEAAAVALAAFGALQANEEST
                     NEDEYSSGAHWSEDIQLLPTCEYVPTTMDIVMSSTSLSLTTYARKRQHDIIEQVFSIL
                     QLLTACFVSFSHGSNDVSNAIGPFASILAVYRSGGSAAVSGEVLVPPWALVLGGLGIS
                     FGLGVWGRPVMDTVGKKITHLVPTRGFCVELSTALTVLMATQIGMPVSTTHTLIGSIV
                     AMGLATGRGSVNRRVLLNILLSWFVTVPVSAALTALCFLSLRGFV"
     gene            complement(<571802..>572833)
                     /locus_tag="CYME_CMS221C"
                     /db_xref="GeneID:16997347"
     mRNA            complement(<571802..>572833)
                     /locus_tag="CYME_CMS221C"
                     /product="similar to nuclear receptor binding factor 1"
                     /transcript_id="XM_005538811.1"
                     /db_xref="GeneID:16997347"
     CDS             complement(571802..572833)
                     /locus_tag="CYME_CMS221C"
                     /codon_start=1
                     /product="similar to nuclear receptor binding factor 1"
                     /protein_id="XP_005538868.1"
                     /db_xref="GeneID:16997347"
                     /translation="MATHIPSTQKALEIVSFGDPLKGALRLNTTASVPKPGPGQVLVK
                     MRYACLNPADVFVVQGVYPGVAAVRERRPGFVGGLEGVGEVVAQGPATSLPVGTRVIP
                     TLLDRSGCWQQYLVVDENLCIKVPQDIGDKEAAQLIVNPLTVVGMLEQIEAEAPVHGN
                     PWIGQTAANSTLGRMFIQLAKKRGLCTVNFVRSKASVAELKQLGADEVIVFGEEPNLA
                     ERLNAITNGRGLAAVVDAVGGEMGSAALAALSPGGLFVGYGLQSGKPTCVMNSDLIFK
                     GIVVRGFWLATWLKKQKQTIFEEVLDMIRKGEMRPQVEQEYTLEKYEDAFRAQFAPDR
                     KGKILFKLE"
     misc_feature    572884..573459
                     /note="repetitive element"
     gene            <573639..>574379
                     /locus_tag="CYME_CMS223C"
                     /db_xref="GeneID:16997348"
     mRNA            <573639..>574379
                     /locus_tag="CYME_CMS223C"
                     /product="NADH dehydrogenase I iron-sulfur protein 23kDa
                     subunit"
                     /transcript_id="XM_005538812.1"
                     /db_xref="GeneID:16997348"
     CDS             573639..574379
                     /locus_tag="CYME_CMS223C"
                     /codon_start=1
                     /product="NADH dehydrogenase I iron-sulfur protein 23kDa
                     subunit"
                     /protein_id="XP_005538869.1"
                     /db_xref="GeneID:16997348"
                     /translation="MNRFTRSLLQSVYAIPQTGLSRCCFGSWSSRAVLDAGQRVSASL
                     LGTRQELRLTQQREQRVLRHSFSTQLNPGGTERAQRSLESLLDRPAQVLFLTELWRGL
                     GNLLDIFFDPKAMYTINYPQEKTPVSPRFRGEHALRRYPTGEERCIACSLCSAACPAL
                     AITIEAEPRPDGSRRTTRYDIDGSKCIYCGLCQEACPVDAIVESPTLESAVETHEELL
                     WNKEKLLSNGDRWEPELARAIEADAPYR"
     gene            complement(<575010..>575936)
                     /locus_tag="CYME_CMS224C"
                     /db_xref="GeneID:16997349"
     mRNA            complement(<575010..>575936)
                     /locus_tag="CYME_CMS224C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538813.1"
                     /db_xref="GeneID:16997349"
     CDS             complement(575010..575936)
                     /locus_tag="CYME_CMS224C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538870.1"
                     /db_xref="GeneID:16997349"
                     /translation="MTERMDVDEDATYRDETLVDEYGLAAGVISTPRRTVGLVEQGVF
                     PNANPVLKDVALRPFSSREPDQVPVERLNSSGARSTLTPPASYPGERSLAGRRRDPCT
                     SQARPTREPSVLALVEQVYWPYVVVGYVQLALNIVLLTVLLFVFVFFGRSFYTDVSRK
                     VAHQYTQAARHIEQCQRSFQMNRCFDDAQVVPHMREQCQSWERCAGQTPTQLVMNRAS
                     LIMETLAEAVNGFMDSISYKSVACLMLLAVLAVMMGGTTLGIARQRLTHDVYQLLAMH
                     PQRAWRRKSPPRTRSLVVGESRSIDTSEDETY"
     gene            <582327..>583322
                     /locus_tag="CYME_CMS225C"
                     /db_xref="GeneID:16997350"
     mRNA            <582327..>583322
                     /locus_tag="CYME_CMS225C"
                     /product="similar to glycosyl transferase"
                     /transcript_id="XM_005538814.1"
                     /db_xref="GeneID:16997350"
     CDS             582327..583322
                     /locus_tag="CYME_CMS225C"
                     /codon_start=1
                     /product="similar to glycosyl transferase"
                     /protein_id="XP_005538871.1"
                     /db_xref="GeneID:16997350"
                     /translation="MNALRMHQLQTAKKHLMTCTWMWNAFGVSEHVIRSLSGICWRPL
                     PLLGAAKPSMSIYVGLFAVTVVLGIVLIFSKGVLLSSANLSRRSCFAREAERRRTQCS
                     SPNKRVFEELWARRPFEELRIGADQPLHLLVVLGSGGHTTEMHRLLSRDGGLLSERWV
                     DAPVWVTFVYAKTDKRTPRWIERFQSDLPPGFRVLNWVAVPRAREVGQSWITSVFTSI
                     HACASAAGLFLSSHSLATNDRMRAPAPNVVLCNGPGTCVPFCLIAFIVRIWNSLTRTR
                     PASAYPRIIFIETVARVYSLSLTGKILYRFADRFLVQWPELARRYVYAEYYGRLV"
     gene            complement(<584402..>585733)
                     /locus_tag="CYME_CMS226C"
                     /db_xref="GeneID:16997351"
     mRNA            complement(<584402..>585733)
                     /locus_tag="CYME_CMS226C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538815.1"
                     /db_xref="GeneID:16997351"
     CDS             complement(584402..585733)
                     /locus_tag="CYME_CMS226C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538872.1"
                     /db_xref="GeneID:16997351"
                     /translation="MGTPPEGQVTGECLTFLALRFGKTALHAAQLLSKIVDLLGVKAA
                     ARAAGTEWSPGFVLVDAHGAWLLETASGFWALSKTSKEICLYRDQLYIEEPLTYSTSL
                     ESLVAVGSSSSASGRGRINFRMLFHPTGAESSRDLNASVNRMKELKSRAALSPLDLAS
                     LIQMVREHDLPSSVLPEASDTQHTIRAGAFISVLTPDAPRRFHLFTCEHYTECAMFKP
                     IFLDRAASSQISTVHASYLGETGTLHRRRRYALERKRLDLERTTVRVLQYRDQEERRC
                     AYQPADICERLRFLEMICVEKALSVCGYSTSFMQAEHAALCRGFEQRLLQMGKKYFKM
                     DTKMLYPTEVSQKDWPDLFQRYAEDTKESLFEKTLMREEYEYELFMLDGGDPLAQARR
                     IRGLQLAPSPGEHFCMPIVRDIPEQPDASMPHVYVYKPDTRDSANAQNNAQ"
     gene            complement(<586515..>587573)
                     /locus_tag="CYME_CMS227C"
                     /db_xref="GeneID:16997352"
     mRNA            complement(<586515..>587573)
                     /locus_tag="CYME_CMS227C"
                     /product="ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /transcript_id="XM_005538816.1"
                     /db_xref="GeneID:16997352"
     CDS             complement(586515..587573)
                     /locus_tag="CYME_CMS227C"
                     /codon_start=1
                     /product="ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /protein_id="XP_005538873.1"
                     /db_xref="GeneID:16997352"
                     /translation="MPNEAEGRKVALAAFLAVLFYRLQDDKCRAARQRLSRETVRDGS
                     GAMFELVAPRYDFVNNVISLGLHRGWKRTAVDAALKPFLVASSERAELQVLDLATGTA
                     DLAIDIAQRYGSYVKQVVAVDPCSRMLDIASRKLARAQVSDKVLLVKGVAEELPQEWT
                     NRFDVCIIGFGVRNFADRKKGLCEVWRVLKKAEASTATPTDPVSRLVVLEITEPRGRS
                     IAAPIARFFLRTCVPLLGALFSLRLREYCYLQRSARLFPPLDEFLEAMRDECCLETIR
                     AQRLAPFGLGPALIIAKPAPKQASVEAAALAPEDAFVNSSATPSRSSTDAPWHVESAP
                     RNDERDASGVAPPSSVVA"
     gene            <590701..>591855
                     /locus_tag="CYME_CMS228C"
                     /db_xref="GeneID:16997353"
     mRNA            <590701..>591855
                     /locus_tag="CYME_CMS228C"
                     /product="similar to monoglyceride lipase"
                     /transcript_id="XM_005538817.1"
                     /db_xref="GeneID:16997353"
     CDS             590701..591855
                     /locus_tag="CYME_CMS228C"
                     /codon_start=1
                     /product="similar to monoglyceride lipase"
                     /protein_id="XP_005538874.1"
                     /db_xref="GeneID:16997353"
                     /translation="MGKTDLEQVVHATYYFPSPTPSGHKLFGQAWVPESCLLDQERTR
                     AEIERSLAKAPPAQKTASSNNAKASDYGDFGRTLSVDELKVLRHDPRNVRAYVLFLHG
                     LHSNSSFGTMDPIARGELHRKYQGSVPHRLNEHGMVVFAHDHMGHGRTLTASGKHDHR
                     VIDRFQTLELDALQHIELIRSLASSDSATEDNAAMQNKPLFIIGESMGGLLAVCLALH
                     HHEKVFPTRESTGGLVLIAPAVLPPSNMFGIKGRILYPLSGLVSALFPRLDAVKIPGC
                     GLFPEIQKEFDSDPWTGRGMLKARLGREIIQAQKQVEKHMKELKCPFLVLYGTEDTLT
                     DPQKGAELFQQASSSDKQTIILSGMWHILLYEPRADEARSAVYSWIFARC"
     gene            complement(<592132..>593355)
                     /locus_tag="CYME_CMS229C"
                     /db_xref="GeneID:16997487"
     mRNA            complement(<592132..>593355)
                     /locus_tag="CYME_CMS229C"
                     /product="similar to quinone oxidoreductase"
                     /transcript_id="XM_005538818.1"
                     /db_xref="GeneID:16997487"
     CDS             complement(592132..593355)
                     /locus_tag="CYME_CMS229C"
                     /codon_start=1
                     /product="similar to quinone oxidoreductase"
                     /protein_id="XP_005538875.1"
                     /db_xref="GeneID:16997487"
                     /translation="MSCSATPLRLYAGRLATGSSAYASSWCTCSAHKSFDKTVGRAMS
                     TTAAGARVMQAAVPTTENGSAGSDAPVLRLQRVPVPELKGPNQVLLKVLGTAVNRADL
                     LQKRGRYPPPPGASEILGLEAFGKVEASNVDSFRPGDEVIALLQGGGYASYAVTDSAT
                     LIKLDPYPEYYLSFDASLGKFERRGPDRVAACAGIAEAFLTAYQLLKFDPSLGNASPG
                     ETVLIHAGASGVGLAAIQTARELGLKVLVTAGSQAKVQACMQLGASRGWVYRTQPVEM
                     LVDFCGGPESVDIVLDCVGSSYVEIHPQVLRRHGRWVLFGTLGGTRGNLDLSQILRKN
                     IRLVGTTLRARPLAYREALVREWSTFASPRFASGVLLPVVDANGIFPLSESEAAHTYV
                     EKSSNIGKVILRVDV"
     misc_feature    593425..594777
                     /note="possible transcribed region"
     gene            complement(<593958..>594602)
                     /locus_tag="CYME_CMS231C"
                     /db_xref="GeneID:16997489"
     mRNA            complement(<593958..>594602)
                     /locus_tag="CYME_CMS231C"
                     /product="similar to carotenoid biosynthesis protein, crtK
                     gene product"
                     /transcript_id="XM_005538819.1"
                     /db_xref="GeneID:16997489"
     CDS             complement(593958..594602)
                     /locus_tag="CYME_CMS231C"
                     /codon_start=1
                     /product="similar to carotenoid biosynthesis protein, crtK
                     gene product"
                     /protein_id="XP_005538876.1"
                     /db_xref="GeneID:16997489"
                     /translation="MEALREKWSSWFASEQGSNGLAGILSSKEKFLYAVAAAAVVSST
                     SVLDNLVMYRRGGQKAEGKSTQGNGTMNEVASPATDPWYRSLRKPWFHPPNWVFPAVW
                     IPLKALQTGALYLVWTSEDVSLLKRLTATGLYVIHISLGTLWNHLFFGKHKIRKSLYA
                     MGGFYATLAGSIGMYWTVNPTAAALLAPTQVWATIAAALNYQSWALNPDMDADG"
     gene            <596897..>599695
                     /locus_tag="CYME_CMS232C"
                     /db_xref="GeneID:16997490"
     mRNA            <596897..>599695
                     /locus_tag="CYME_CMS232C"
                     /product="K efflux antiporter KEA1"
                     /transcript_id="XM_005538820.1"
                     /db_xref="GeneID:16997490"
     CDS             596897..599695
                     /locus_tag="CYME_CMS232C"
                     /codon_start=1
                     /product="K efflux antiporter KEA1"
                     /protein_id="XP_005538877.1"
                     /db_xref="GeneID:16997490"
                     /translation="MPVWSPSAFIPQVSPHGSWLATQIKYGLGKDLVCVRNGVAKRPK
                     LRRASRVRDGGALPVRLTAEVGAGQREQELDALIVRNGSSGLRHALTAGPRVGYANFK
                     ELLLTLVCGMVVALVLWPTRRPRFVHSARESIWTKVLFSCRSSALGSRREPVATSRRV
                     EVPKSLLACASPAPTAIQTTDIASERTLRGKLIKVGREATHFEMHEPVADALAVLIAT
                     VIVVPIMKRLRMSPILGFLLAGVVMGPNGLKIVKEIGASKALAELGVVFFLFEMGLEL
                     SVARLKSLFMDVFGLGLAQFVVTGVALGFACTSAGLDIRAAFVVGGALALSSSAFVLQ
                     MLNERGEIGTRFGRGAFGILLFQDLAVVPLLVVVPLLGASGGGMSLATALSVAAAKGL
                     IALVSIYFAGHFLFDPVFNATAGAKSPEAFVATILATVLGMSALTEGFGLSDTLGAFL
                     AGTLLAETRYRHQIEADIMPFRGLLLGLFFMTVGFGIDMRLLVGNLRVVLLLILGVLA
                     LKAGIITALARLFGFSFANSQRTGLILAQGGEFAFVVLGLAQRSSVLDPALTQLLNLV
                     IALSMACTPILFALGLRIASAIEQRRGLIGTRSEDVSAASDFVLVAGYGRVGQAICDM
                     LSARFIPWVAFDTSPTRVIEARKKGLPVFFGDACRPDVLRTAGAGKARAIVVTVRDPD
                     AAFRAVTAIRQEFPEKPVFARARDERHRKMLSMAGATAIVPEILESSLLLGGAVLHAF
                     NVPAEEISRLIEDARKRAVSEFGLEMFGELSSEKMGMWRYKAEETSRQSPNGSISTAA
                     SAVGSLLAAAPTAQAHGDRDGDFSESTDSQLENEGRDKSRSTDDEQNGADSDAGRERI
                     RADTHLDVETSDEELEVDEGELIPESALRMPGPITPSSSKQVRHEDEYPEYPPYPLDE
                     DISTTGSPADARREGGNL"
     gene            complement(601569..604301)
                     /locus_tag="CYME_CMS233T"
                     /db_xref="GeneID:16997491"
     misc_RNA        complement(601569..604301)
                     /locus_tag="CYME_CMS233T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461659.1"
                     /db_xref="GeneID:16997491"
     gene            <602761..>603780
                     /locus_tag="CYME_CMS234C"
                     /db_xref="GeneID:16997492"
     mRNA            <602761..>603780
                     /locus_tag="CYME_CMS234C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538821.1"
                     /db_xref="GeneID:16997492"
     CDS             602761..603780
                     /locus_tag="CYME_CMS234C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538878.1"
                     /db_xref="GeneID:16997492"
                     /translation="MERCTGGTLFHALCRGTAPGIDISAVRELTFQIVFTLAVLLRFH
                     PNWKHNDLSLANVMLRRRGSLTTACLGTCQVLVGLAGAGARTPASTLQLVRPSSAPEA
                     GPVRYRRYAFEGHIWYLGLRPEQPYEAVIADFDFACIEPLISNATVDFFERQSRYHCY
                     RINSERDWYGDIQMRLSNLREVVQHLIRRRWETQRPSGTSALSTSVERGAQDMLLPEE
                     RDAMEFFERCVHPNCRDTADRSLRGRLPPNTVDLDERYNPIHMLLFDPYFDPFLRTPE
                     WGSGAMLEASYAWPIECAASIDANGASRVEGAGLRTHASLWSASSPIRCDWEHIRGSW
                     AADGA"
     gene            604465..606372
                     /locus_tag="CYME_CMS235T"
                     /db_xref="GeneID:16997493"
     misc_RNA        604465..606372
                     /locus_tag="CYME_CMS235T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461660.1"
                     /db_xref="GeneID:16997493"
     gene            complement(<605512..>608865)
                     /locus_tag="CYME_CMS236C"
                     /db_xref="GeneID:16997494"
     mRNA            complement(<605512..>608865)
                     /locus_tag="CYME_CMS236C"
                     /product="probable excision repair protein ERCC5"
                     /transcript_id="XM_005538822.1"
                     /db_xref="GeneID:16997494"
     CDS             complement(605512..608865)
                     /locus_tag="CYME_CMS236C"
                     /codon_start=1
                     /product="probable excision repair protein ERCC5"
                     /protein_id="XP_005538879.1"
                     /db_xref="GeneID:16997494"
                     /translation="MGVRGLWELLAPAGQRVGIETLSGRRVAVDASIWLNQFVRAVRD
                     TEAMTTVRNAHLLGIFRRCCKLLYYGIEAVFVFDGGVPSLKRRTRERRRHIQNRHRAR
                     LRRAAERLLLAQLHLTRTARQKEQASASLAPADALETALQSDTAREKHPTMPRRTSAK
                     RLTGDETRVPSDGNQPEVQRSHYANTNGRQRDELDFMAGDSTEFGLPCATSEEIISDD
                     GSNCEAFELPDLENIDADAVVALPASVQKEIIASIRRRMHTELVETVENLDELRSPSD
                     FSQLQVDRFLRTSQLRSKLRDARQRASHGTHLGRRLASDATREYVLVENERNLDTARN
                     RDLAADARGTERPGACVRASVPDAPSRSAAVQSMTVNAISGTEWASEISSGFRFALKT
                     PHDARDGDAAADCRHRVRHAELSASDVVGMPQDTRRTMFTTSNEAPSSDGRLEPARAD
                     EQSDAEFLENIEWNEVSTEGSDQEAQFASAEELTDRRLSSEHNLQKRTAQAKHLSNAT
                     LDRSGAESNTEAPMKKLSSVAKYTEMVSTEHADSLTRPAIEPRETADTPSIDIGSAAN
                     DAVGPAAFEATQPARESSNVRAVPLLADEQIDCRRPVAANTWNSAAPADAAAYHEPGR
                     NSISQELPPGSDAGISPDDRSEDSRQEASVDACGTLDGGIAARTHHECDHSEWRSQQR
                     AKFGAARGLIPAHRSFLMDTTEAANNAAGTGEHRGALAMNARADDATERQRMEPMFAE
                     HEEMDLAKLRSEYAAAARHADSVTEQMFADTKRLLQLLGIPYIEAAMEAEAQCAFLDR
                     AGIVDAVVTEDSDAFLFGASRVYRHIFEDSKYVEEYEMNRIERNMGLSRDKLICLGLL
                     LGSDYSDGVYGVGIVNATEIVEAFCRDPDPACPDTSPEREPFRGLQDFREWLDAVHLG
                     DDPASVSDPEPRRAAFKKLHINMKRNWNLLDKTFPNRHVIEAFLRPQVDTSWLHRRRE
                     LFPNCGPDPVALRAFCHDLFGWDSAKLEQALGPVVQAFQRHRERQTRIDSFFQPHRFA
                     RIRSTRLQNAVRKLACDGLSAGASQVSGAEKQPPDANGDRDDDSLALSLLAETEELML
                     RTTSECMDGTGTSFGSGSKTKRRRMSARS"
     misc_feature    610637..611528
                     /note="possible transcribed region"
     misc_feature    611965..614748
                     /note="repetitive element"
     misc_feature    complement(613733..614815)
                     /note="possible transcribed region"
     misc_feature    complement(615246..617149)
                     /note="possible transcribed region"
     gene            <615311..>616945
                     /locus_tag="CYME_CMS239C"
                     /db_xref="GeneID:16997257"
     mRNA            <615311..>616945
                     /locus_tag="CYME_CMS239C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538823.1"
                     /db_xref="GeneID:16997257"
     CDS             615311..616945
                     /locus_tag="CYME_CMS239C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538880.1"
                     /db_xref="GeneID:16997257"
                     /translation="MDQEAEAPRIQTPNDRPESEGAPGSEQDGNSPYYPRIHIKSFAF
                     EQEPHSDMGSACSLSPTAKTEVNKHAVPAEQPAGAVHMQPDDQGKTQRSVQKNDDRPS
                     ENSGGSEMKRAGVETTRPSRAAKYRTASPTPSTKGHNRGTGATRGRPRKYPVASSPSA
                     AEARITKRPYGASNSMQQHHTDRHVVPASDAPQPETPTDIVLCACGNVIDFGPMIQCS
                     RCKGWSHKVCTGLSDAEWEQLQMQHARYQCWLCAPRNARPNSIAADAVQALASVRTGS
                     KWNTIMGRIIESAAMENAEIVGMPLSKPRKHRMVENIMTGTGPGRTHRSSGPRVASTE
                     GSVPLVRDSAKENEFFEALAAHWQRKTGQPWQTPMFRGKLLDLYALYWGVKARGGIDA
                     VIASKRWPEIWRTMRNYYRESTDHSFRLRVASQQYLADFLRQYAGPQPWDVEVLHSEE
                     NADEAVTQQKKRAPSDLVPAGYKASRRERVVTTEEFVKPELALPSSEPGQTSAKKSET
                     NGPRSARSPAGSAVRKASDAVKPAPPQSDDDELSLG"
     gene            complement(<617733..>619832)
                     /locus_tag="CYME_CMS241C"
                     /db_xref="GeneID:16997256"
     mRNA            complement(<617733..>619832)
                     /locus_tag="CYME_CMS241C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538824.1"
                     /db_xref="GeneID:16997256"
     CDS             complement(617733..619832)
                     /locus_tag="CYME_CMS241C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538881.1"
                     /db_xref="GeneID:16997256"
                     /translation="MTDTHTAAPIPDQLMEIDVRSGTEVGSNGRNEPREELHDSAGTV
                     TRRAASLSQRWSDPADMELDRREITRLMLQELEDLGYHRTAQALEREAGILARSPDVR
                     RLKTLLLSGEWEQAAELLPGLVGRTTYQKEQAAAETPEEALSPEASRLVDEARFLIYT
                     QKLYEILLELLGQVEEGDEAAPARVLRCQRLEALQQAAVDCLCRELSPNAVAQQEAWR
                     LHRLTIAVLRVSHARGSLSKAIRESLRSVLQGEDVPETTKTVPLGATDGVELRRCMRE
                     QLFHKLQPYIRKEKTIEKWRLETLLRRALRENLQQACFPYTYQERPSLLEDLVFQPMA
                     IPSETWRILKAHRDEVWLVQFSHSGRWLLSAGKDGLIVVWDVARLSQSNEQIVEHRAD
                     LAAADVRALSNGVEPATDDASSANGSDAFEHAGCLVLDGHSDAICAVSWSPDDEMILS
                     AAGDHVLRLWETRTGRCRFASERQTQAITACAWLHDGERFVTSLTDSNLYVWRVDGLR
                     ERTTLGMDRVRAHVVLAFHGRIFNDIAVNYFYNEIVGICTARCICRYDADGATALGPC
                     IEESENMTALCVSRLKSIPVVLVSTSGDGCPRPEIHEWDFEHNALVQRYIGHQQGRFV
                     IRSCFGGFRECFVLSGSEDAHVYIWKRRSGQLCARLAGHTGTVNAVAWSPTDLALFAS
                     ASDDGTVRLWSTANRCM"
     gene            619997..621499
                     /locus_tag="CYME_CMS242T"
                     /db_xref="GeneID:16997258"
     misc_RNA        619997..621499
                     /locus_tag="CYME_CMS242T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461661.1"
                     /db_xref="GeneID:16997258"
     gene            complement(<621865..>624774)
                     /locus_tag="CYME_CMS243C"
                     /db_xref="GeneID:16997479"
     mRNA            complement(<621865..>624774)
                     /locus_tag="CYME_CMS243C"
                     /product="DNA gyrase subunit A precursor"
                     /transcript_id="XM_005538825.1"
                     /db_xref="GeneID:16997479"
     CDS             complement(621865..624774)
                     /locus_tag="CYME_CMS243C"
                     /codon_start=1
                     /product="DNA gyrase subunit A precursor"
                     /protein_id="XP_005538882.1"
                     /db_xref="GeneID:16997479"
                     /translation="MQELDSYKHGCSYCALVFVGVLAGPEQRNLGALPTTDLSVKRGI
                     TCRVTLRQGRVSAPFGRQPRALGWFSIPARSGASSFVGSGGCRRRASRSLGASAYQLR
                     AQLAPAAGEEPSEAGSAGTLEASPHESIINTEVSSVLARSYLEYALSVIHARALPDAR
                     DGLKPVHRRILYAMNQLRLDPDGPYRKCARVVGEVLGKYHPHGDSAVYDALVRMAQPF
                     SMLEPLVDGQGNLGSVDGDKAAAMRYTECRLTSLSKRVLLADIDQDTVDMVPNFDASD
                     QEPVVLPARLPQLLLNGASGIAVGMATNIPPHNLRELVSALIALIKNPKLLEAELEAL
                     IPAPDFPTGGIIMGLRGSRDLHRTGQGAIILRARTSFETVRAKNRPVREAIIVHELPY
                     QVNKAQLLERMATLVNEKKLDGIADLRDESDRDGMRIVIELKRDADKNVVLNQLFKKT
                     ALQAAFNGNMLALVGRRPEKLSLRRALEVFLEYRVQVIQRRCTFELNKARDREHIVQG
                     LRLALRDIDAVIRIVRNARDVSFARRALVDPDGAFGLSERQADAILGMQLRRLTQLEM
                     GRLDQEHQELLAQIAELENTLARRELVMAMITRELQEIQSQFGRPRRSAISPEEPELS
                     DIDLVPNEESVIIATKQGYVKRMAMREFEAQRRGTRGKAAARIREDDQVAHFFSCRDH
                     DTILAISQRGTAYAIRAFQIPQASRVARGAPLSALLPVFDASIGNAETSLAALVPISA
                     FTPDRYLLLLTQQGWLKKTPLSAFANMNARGLIVMNVRDTDTVRWVRLCGNDDSVIIS
                     STTGLAVRFSLSEAQLRSTGRRTQGVRSMRLRKNDAIADMDVVDGCADVTTSERYLVA
                     ITEQGYGKRLHVDAFRIQRRGGGGKRATSFKMDTEDRLLCLRCVEPDSEIILITERGT
                     VVRVPCDSIPIQGRWATGVYVQRLDTGDRIAQVSFTNGSEAEPMPSPAWDLDSRG"
     gene            624897..626661
                     /locus_tag="CYME_CMS244T"
                     /db_xref="GeneID:16997480"
     misc_RNA        624897..626661
                     /locus_tag="CYME_CMS244T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461662.1"
                     /db_xref="GeneID:16997480"
     gene            complement(<627714..>628688)
                     /locus_tag="CYME_CMS245C"
                     /db_xref="GeneID:16997481"
     mRNA            complement(<627714..>628688)
                     /locus_tag="CYME_CMS245C"
                     /product="phosphoribosylformimino-5-aminoimidazole
                     carboxamide ribotide isomerase"
                     /transcript_id="XM_005538826.1"
                     /db_xref="GeneID:16997481"
     CDS             complement(627714..628688)
                     /locus_tag="CYME_CMS245C"
                     /codon_start=1
                     /product="phosphoribosylformimino-5-aminoimidazole
                     carboxamide ribotide isomerase"
                     /protein_id="XP_005538883.1"
                     /db_xref="GeneID:16997481"
                     /translation="MLLFCFPSTSSGIHAPPLTRRITGISPEGARHPPVARVRARPRL
                     TAGTPTARATAERVTRFRPCIDIHNGKVKQIVGSSLSADGSRASVVNFEATQPAAYYA
                     SLYREHALPGGHIILLGGDREASERAALAALAAYPQGMQLGGGITEENAERFLEAGAS
                     HVIVTSYVFRDGRLDESRLLRLAHRIGRERLVLDLSCRSHISGSESAYYVYTDRWTRR
                     TDLRISGQLLEWLSEYCAEFLVHAVDVEGKQIGIDEALVHELAVGSPVPATYAGGVRD
                     LADLERVRLVGCGRVDVTIGSALDIFGGALSFDMVVEWQRRLEKMLAR"
     gene            complement(<630384..>631805)
                     /locus_tag="CYME_CMS246C"
                     /db_xref="GeneID:16997482"
     mRNA            complement(<630384..>631805)
                     /locus_tag="CYME_CMS246C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538827.1"
                     /db_xref="GeneID:16997482"
     CDS             complement(630384..631805)
                     /locus_tag="CYME_CMS246C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538884.1"
                     /db_xref="GeneID:16997482"
                     /translation="MVQTMYITIPCSFRRTNYGPSRSLRHADDAVYRKAGSRRHRVVL
                     AQQVNGPEGQQRALVTSARDLLALRPQIDVEKIGNSSEENLRAFIKTRASLVPDQEVV
                     FWFGGEIHAYIADAGARHILGFEGYNIARCVKVEGGWRILTREVGLYRDPDNRRILHG
                     TWNNPFTGMENQVVHVWNDPVNLQFLEKNPRDGKPFLVPFTRVGADLCWHIEIFLRYP
                     NPLPPSEFPAESASPFYESAELFQLYARVDDLHDSNLVSVPCQGSWVRMGQWLPWMEM
                     GERPGRLVYHCFTKKLENGYQDLPEDVRAYVEEHHPEYMHAPSNYMTPNETSWTYFRK
                     LLAQKGSPRADGTIAKRDAGAWERTASPLERVPSVRPFTTEELAMFDGSQSERPIYVA
                     VNRRVFDVTQAAHHYRAGEPYHILAGRDASRALVFADLSAEMVDPTKPPLDIKMLTSE
                     QRHSLEQWTQYFAKTYPEVGYLV"
     gene            complement(<633814..>635526)
                     /locus_tag="CYME_CMS247C"
                     /db_xref="GeneID:16997172"
     mRNA            complement(<633814..>635526)
                     /locus_tag="CYME_CMS247C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538828.1"
                     /db_xref="GeneID:16997172"
     CDS             complement(633814..635526)
                     /locus_tag="CYME_CMS247C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538885.1"
                     /db_xref="GeneID:16997172"
                     /translation="MRRASVYGASDGHQPIAVRRWHGAIMASRGIQVRLHTQRLDAIH
                     SLPDAFRLSCFTGPSPDGRRFYGVDAGHRFLNGEIAPCILEFERDGDFMRERRILRCP
                     VDYFPVSASGPGRSTEETEQGPVAGLVEAINYLTCGVMPCLGFVVVACCGDFLEDAGS
                     IVIFRPYASEQSSGDCFPVKIRTAASTWSASVCAEAPLLVYGSNAHTVNLLEFSLAGA
                     EGTQTCAYEAERVMPATMAPNDASCLPYVASQIRIRCRVLAQHAHNIPCVSFGAKCFA
                     VDDAHVRMVASVSLDCTAHWTSVVPGVERDPPHESRGSVRFRVSLGTGGMQRDGGWFI
                     EPIPWYFWHAGAIVLLSPEAAANTRVAASVPASASEAAPSELVAIDTCLDAFEQAHIA
                     AAVDDVHQGFLTEKPFDGHIRAYQETSVWLIGTGSVVSVWRIRRHPNAVHPERIAALD
                     LARDVRVRQVSLFGIRYHAFSPALGILVVGIGMLLPRDGGLLILAVDRWSGRVTRYLS
                     HDAAAHNQRGSRSELQRLYDRIQAPVCAIFFVDTTLYVLDRNRELHMVTFKRSAGLVY
                     QATS"
     gene            <636355..>638634
                     /locus_tag="CYME_CMS248C"
                     /db_xref="GeneID:16997173"
     mRNA            <636355..>638634
                     /locus_tag="CYME_CMS248C"
                     /product="DEAD/H box protein"
                     /transcript_id="XM_005538829.1"
                     /db_xref="GeneID:16997173"
     CDS             636355..638634
                     /locus_tag="CYME_CMS248C"
                     /codon_start=1
                     /product="DEAD/H box protein"
                     /protein_id="XP_005538886.1"
                     /db_xref="GeneID:16997173"
                     /translation="MAAAFAELGLMPELIQAIDDMGWVFPTPVQSEAIPLILGGGDVC
                     VAAPTGSGKTGAFCLPTLQIVHETLNYTSAADQSRSGASSNPDRWKMSALDRAPHLIL
                     DASGLLCASTELHQWSGGRAAFGMLPSARGKWYYEVQVLGDGLCRVGWSAACSTLALG
                     EDDLSYGFGGTAKKSHCGKFESYGGAFGKNDVVGVALDWENGEIWFSKNGEPLGRAFS
                     INRKTLGDRALYPHVYLKNSQVRVIFSDTSYLPGAGFREVGSAGPQERTTPEREGAVD
                     LQGTHRPSNAPLMLILEPTRELALQVHQELHRFSRFLDEDQTSSSEKVQCVLFTGGSA
                     SQNEALGAPQSRIDIATCTPGRLFDAIRTKQLDVRAVRFLALDEVDGLLTMGCGSQIM
                     QLLGMIPRQGRRHRLQIIMFSATVNAPRVRQLSDRIQEHATWVDVRGPETVPSTVDHL
                     VVRIDPGTALQLVQEEEGIAPAPAASLPATDAVHVGVDYRDAETASLSQRIKLAKPIL
                     CLRLLEVFQMDQVMIFCRTQLDCDLLQQFLEQHAAIRGATATLHAGLADQQRRQHFTA
                     FKEGQVRILICTDVAARGIDISGLPFLISMTLPDEVENYLHRIGRVGRADRLGLAISL
                     VSTVPERVWFHSSCRKRAKGKCQNRALTTEGGCTIWYDESEILRRLEAQLGEANMPEI
                     LDVNQVLQAKDPAALQAYVRGLAQYGRKRGEIGAACVNAVDPELEQRLHHTQQVARRV
                     QELEKNVQWRFLRRLQNAR"
     gene            complement(<639277..>641391)
                     /locus_tag="CYME_CMS249C"
                     /db_xref="GeneID:16997174"
     mRNA            complement(<639277..>641391)
                     /locus_tag="CYME_CMS249C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538830.1"
                     /db_xref="GeneID:16997174"
     CDS             complement(639277..641391)
                     /locus_tag="CYME_CMS249C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538887.1"
                     /db_xref="GeneID:16997174"
                     /translation="MARERAVDGSRQSLERHLEARAVLYKKHASSASTLSLPPRMSAH
                     ILAARVTLDEPEASTGATQRPLSRMSFQFQGTSLAFGKTRHSCWPKSNACNRAREQSR
                     LLTRFSIQRQFLARGALVFALKPEAALEQPNPAPPKTATRANKTATSSDAAPAAPGAP
                     LRTALLRRARIASLSLIPRLLLQREKAPNKPHHPWQSYADDPVLMALHQRRAHGSRPG
                     QRHDPYRIGLVIEGGGMRGSIAAGMCAALGYLGFADAFDVIFGSSAGAICGAYVVARQ
                     LPGYGPSVYFEDIANDRFINKRALWQPLRSSSRTRPVLDLDFLLDEVMVHIKPLDWNK
                     FAQNNAVQPLRPVASSLTHARSVAFDGFRTYAELRECLRASARVPGIAGPLVPIGDDI
                     YADGILFEAIPFRSALADGCTHLLVLRTRPVGTRVPRIAGFYERMIAAPELEAFPHVR
                     DYIVRGGHFKQYLEDIRILEDRKSARHVHVRSILKERWCSALPEQASILAIAPPRGDP
                     EISQLETRPEVIFEATRYGFGLAYEMLVAPYQRPAGDGARFAARVFSDEKLDEILRAR
                     ETALKYRRSVRRNALALSRLRRTSFLQRFQKSSRSDPFLIPSNPHFTTDAYLSSLKTA
                     RQAPERSSVQEPAADPATSRPDQRIAPALAGDAATSAGALDRLHQPNVTELAADNEAR
                     HRRGFLFLPRFTGLRLVQRQSR"
     misc_feature    642283..644094
                     /note="possible transcribed region"
     gene            complement(<643683..>644705)
                     /locus_tag="CYME_CMS251C"
                     /db_xref="GeneID:16997157"
     mRNA            complement(<643683..>644705)
                     /locus_tag="CYME_CMS251C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538831.1"
                     /db_xref="GeneID:16997157"
     CDS             complement(643683..644705)
                     /locus_tag="CYME_CMS251C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538888.1"
                     /db_xref="GeneID:16997157"
                     /translation="MRRPGSRSNAPLCWLTSTIGVPFRRCAAPFACSVGIARFPVCRG
                     ASVRLLSRPRRYHMSISREPFENDDHLWIRRIDGNNDGEYRGALENLFIEALRSYYEG
                     NPVLTDGEFKTLRDELEHLGSSSLRLNDLEKVWIQAAQQRDMDRRLLNELRLSPEELD
                     GLKAKLGASRTSTLDMQSILKSDSSMDKRLMYLLFGDAVEDRFKLLLLYAPAVLLCLS
                     SILGFALLDLICLGHIQLTFDDQVAVRASVLFVVIAVVTAWFSNYLTPRMLSYLDLGS
                     PEVVRGPCPNCGNDVTCLFSSASDRKRDERRCKRCGAIVGFNVAQRKVFLVARPQDRK
                     KLSAPD"
     misc_feature    644975..647247
                     /note="possible transcribed region"
     gene            complement(<646812..>647789)
                     /locus_tag="CYME_CMS253C"
                     /db_xref="GeneID:16997159"
     mRNA            complement(<646812..>647789)
                     /locus_tag="CYME_CMS253C"
                     /product="similar to cytidine/deoxycytidylate deaminase
                     family protein"
                     /transcript_id="XM_005538832.1"
                     /db_xref="GeneID:16997159"
     CDS             complement(646812..647789)
                     /locus_tag="CYME_CMS253C"
                     /codon_start=1
                     /product="similar to cytidine/deoxycytidylate deaminase
                     family protein"
                     /protein_id="XP_005538889.1"
                     /db_xref="GeneID:16997159"
                     /translation="MLPKVHRCSFSIVSTLSFACRRRTSSSSSTRQTPKRASINRRPS
                     ASLCISDPQFNERKDGLNLPRETEGHLHAVGERVEAAHCRLTCKRAALARSTPTSLEY
                     RIPAPSAGSVRRNVAAEPHEHYMRMALALAEEAYTNNEVPVGALLVVRNGPETDAPDV
                     ILARGRNRIEECCDATAHAEIECLRAASARLRSWRLNRAGSRDHPVPYHVTLYCTLEP
                     CAMCLSAMQLARVTRLVYGAPGLRLGAIESYVPLLTVAPPHPFHRFSEIIPGVLANES
                     ASLLRRFFRERRKCTESIEPTALRAVREERSPGVGALADDSWGVLPSLP"
     gene            <649343..>652696
                     /locus_tag="CYME_CMS254C"
                     /db_xref="GeneID:16997160"
     mRNA            <649343..>652696
                     /locus_tag="CYME_CMS254C"
                     /product="similar to triacylglycerol lipase"
                     /transcript_id="XM_005538833.1"
                     /db_xref="GeneID:16997160"
     CDS             649343..652696
                     /locus_tag="CYME_CMS254C"
                     /codon_start=1
                     /product="similar to triacylglycerol lipase"
                     /protein_id="XP_005538890.1"
                     /db_xref="GeneID:16997160"
                     /translation="MVAVGKFLVRKIRSFFGAVDRALFFITCWISVNPVRETSLSEQD
                     ELVDGGNLFLTRLESGLEPKLRHSSVQKIRGDEALAGGIAPGHDVSTKGTCSGPHDLP
                     QKPSDAARFPTFRAAQKATKDGRGPSLDKHPVVDGRSSPAAHGARPKHARTPTRKVWR
                     QHRFRRVDADAVDDAYPRNKAPAAPSETFSRTDTKQWIREIRDIYASRISFPRHKYEV
                     FRPSQLNFVVITLWGLIFVAVALVIAVIIYTRAVNSDYFLYSTTFLYVATIGSMTESA
                     ISLLLYLFFYARVALVPARERTRIQYVIAAMTLVLFWQTEPLTALLRLADKGRLTTRV
                     PRVVVAFQLVGNSAFYIGTIGFMLVVCHLYRIRETLPLNWLIFLGPKLVLVCTLLALS
                     FVLFFVGRVMPSRLPLLSLIALARAGRATGLWARKALSIVAVLTLCELYALVAVLYEI
                     RRTWRCLNTEPYTTSRARQLGFRLFLYTTGLAYFVLWILLILIVSICPMSFSIAYYYI
                     MLSYDRLPSFYTDNSRVERFLASVYFNPLFSSSLYFILNSITIAIMICNVLIYLPPET
                     PALFAKIVCCLATSRKDVLSNYLCCRDEPRPFFRWGPRQTSHGTVDAPPSIASLPTGQ
                     GVTRCDAYPVSCPIEAQVQAPNIMAPVGSSKPVAGTSLDTLTTNDATMASTNENQLHR
                     AQAGLWKPNGDTPSRDSGTAGALATRIPVLRRYVFSVETMVEQFNLSWLAYVLDPARC
                     SGRFIQSQRFWRDSLELFYDAATDTLGYILEADDRIVLSFRGTRSRRNLQTDMQTRLV
                     PLRFPNGDMDHALYQYLLRCGKYYNRKDARWSPVMHISDTALRLERYLRFRARSDRPR
                     VHEGFLASYLTLCEALERALTQRYQRNPRPVLISGHSLGGALANLAALHLAIHLQLGQ
                     DSLMLTTFGSPRVGDLHFARLLDYLVPIHFRVTNAADVVARLPFTGLGGWFACGGAAY
                     AHAGVQVLLNKHGLLRVDPSVVELEFQFRVGAYIEPHLKRGYKRSIEAWAQRSGNDGW
                     QPDLWVFPKKKRMFGLGSGPQEENDIVLDTGEDEIKEDESTSKVHEMIEAEAALEENM
                     DVLANEGEIRNLVRGMTWRVLSQGWLSSS"
     gene            complement(<653860..>654615)
                     /locus_tag="CYME_CMS255C"
                     /db_xref="GeneID:16997149"
     mRNA            complement(<653860..>654615)
                     /locus_tag="CYME_CMS255C"
                     /product="26S proteasome non-ATPase regulatory subunit 10"
                     /transcript_id="XM_005538834.1"
                     /db_xref="GeneID:16997149"
     CDS             complement(653860..654615)
                     /locus_tag="CYME_CMS255C"
                     /codon_start=1
                     /product="26S proteasome non-ATPase regulatory subunit 10"
                     /protein_id="XP_005538891.1"
                     /db_xref="GeneID:16997149"
                     /translation="MSNPIWVNTKGLPAIFDALNRDDTAGLENVLETSPESVNDRDTE
                     GRTALHWAAALRRRLVPLLLSHGADALLQDDAGWSALHIASTVSGPEGVAVVRALLQA
                     LAGRRQLSAALLAETHTGATPVLLAASKGNLDTLKELLSSGVPVDLEKTDTYGNTALM
                     RATSAGHLEAVQLLLELGARISNVNEKTGQNVLHVACSEARMPVLQLLVSYADEEAWQ
                     LLDRQQHRPRDLLPKSMQLELASLEGNLSMLKP"
     gene            <654958..>656775
                     /locus_tag="CYME_CMS256C"
                     /db_xref="GeneID:16997150"
     mRNA            <654958..>656775
                     /locus_tag="CYME_CMS256C"
                     /product="similar to transcriptional activator GCN5, a
                     bromodomain protein"
                     /transcript_id="XM_005538835.1"
                     /db_xref="GeneID:16997150"
     CDS             654958..656775
                     /locus_tag="CYME_CMS256C"
                     /codon_start=1
                     /product="similar to transcriptional activator GCN5, a
                     bromodomain protein"
                     /protein_id="XP_005538892.1"
                     /db_xref="GeneID:16997150"
                     /translation="MHSLSELFLKARVVVQRALESDVLMKECPQLGVTATRYDAPGQA
                     GGAPAAAPAAVATADGLGPTNVVHVTISEREPDPSCTTPGLTGTPDQNGDRLRHDARA
                     EAQAPVVVCSRGITLNLVLAALEAQEKPPLSFALGVLGWDLQQTPDFGDKPNELVDLQ
                     LVLAGRRCLAEQCAKLLRGAGLVAEHTNGDVCQVASMLELRIDLPLGSLRFTDGPVMD
                     WEAWCGALPLDRCFRWQSSQTALQSAATAARESSRSDQQLEQSETSPKAPLSPQRSAD
                     GRQAKRGLDETHVFPMTDTAALAPEKQQRSARRYRSSQGAASSPHKSAPKQAVETLRK
                     RGRSRASPVAAADPNHDESTRSAHQSEVPELVHKAFPSSDEHASWRETARVWLNELLH
                     DPTWEPFWAPVSKEEVPDYYEYIRKPMDLTTMRQRLESGQYPSLEKFMEDANLVWRNA
                     VSYNRPRSAVWHTAKQFKKVVATQLASMKESALTQTTRKARSAHSLRTHAVQQGPPGS
                     GASGGIHHQNMPRKFRGDRHPSTVEAEAPALSSSPVHGERRPRSARKSSATQADPEPA
                     APTGTTARPEAGTRKRSPDTSRTERHTMATRQDRRLRKR"
     gene            complement(<656929..>657633)
                     /locus_tag="CYME_CMS257C"
                     /db_xref="GeneID:16997151"
     mRNA            complement(<656929..>657633)
                     /locus_tag="CYME_CMS257C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538836.1"
                     /db_xref="GeneID:16997151"
     CDS             complement(656929..657633)
                     /locus_tag="CYME_CMS257C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538893.1"
                     /db_xref="GeneID:16997151"
                     /translation="MADDGHFHQHHGAEGHSGCGCSTHGTDGHAPPPPTEEEARSLLQ
                     QSNLYPYIDLSRVTALNDGGAASRALVPYHQRRPGETYLCRSVADQQLIIVVPFSVTV
                     KITHIGVTGPAAEEARWPATMRAYVNRDDVDFATVEQMACTQSWELAGPHRPEVEPLY
                     ATRPAKFQNVQRVTLFFPGNLSGDDGSTAIEHIGFYGKATGYRRAPVAAVYEARPLAT
                     DSRSRVEVNHASQYGL"
     gene            complement(657440..659339)
                     /locus_tag="CYME_CMS258T"
                     /db_xref="GeneID:16997152"
     misc_RNA        complement(657440..659339)
                     /locus_tag="CYME_CMS258T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461663.1"
                     /db_xref="GeneID:16997152"
     misc_feature    657643..659422
                     /note="possible transcribed region"
     gene            complement(659638..661716)
                     /locus_tag="CYME_CMS260T"
                     /db_xref="GeneID:16997145"
     misc_RNA        complement(659638..661716)
                     /locus_tag="CYME_CMS260T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461664.1"
                     /db_xref="GeneID:16997145"
     gene            <659656..>662472
                     /locus_tag="CYME_CMS261C"
                     /db_xref="GeneID:16997146"
     mRNA            <659656..>662472
                     /locus_tag="CYME_CMS261C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538837.1"
                     /db_xref="GeneID:16997146"
     CDS             659656..662472
                     /locus_tag="CYME_CMS261C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538894.1"
                     /db_xref="GeneID:16997146"
                     /translation="MVSADAPASRRVWPQRLQPTASHIGGCAELISTFFGPAGKPDQD
                     NFGTTLKSGSIRPTHKLEEATTSNAGRGRRGVLQPIALENTPCATASHPRALAAESAH
                     ENSGLWAGDLVLSPGTKATLQRAALLSRNANREAPIPANDPAPSAMVRAPTGQSDAPP
                     SPPPEEDFIDTSVVDDSSSLESNMLIQTTSFTQTTIILSERKRKTTRNRNESPQRTHN
                     GCENVRLSQQDFQAAQILKDQNKSDHTNSLAVTIGDSSAPSLTGISSPGRPDTLEQPS
                     LGDKKEGSNRLERTKETLNATADMSAILAVHAGLVQKYANMPPCDSDALTRAKHNESE
                     FLMDNSIAAKQESCLSTMSPMLHGNAVHTVSAAWGASPVVFWESSALRSRRESRGPLT
                     ILTWRSRQQLRDNKLALAQVSPDAVLNARAPVASSTSSDGIAPLSGVALDATHHVQRV
                     EVARSANLAPTSAVHVSVPRRVAQVVSSPADASPPEERRRDRSRKTLERRTGYLADEY
                     GSEAVAALTLAPAAVTEDQEHGLDHETYGHTKTDRIPVQKRQGASAVALKSHGGIVRR
                     PEVCTNADAPANKRSGLALPATRGFPERTSDAAEPVRNRDLSPRACKDGTKDPVSSPR
                     GRALQRHRALEPLTLPPQVSSAAQKTCIPPKTYQGLPPRISRRPPGDERAPPRLPAFS
                     KHLEHERYRASAEQALYRVSVDAAAARERPPPRRHTLPPGAAHRPPTVAKTPHLETER
                     RARLRAAADAAAKAASIHQSRTQGARETQKPANSWKPRITVPQTPNVLRHTSVCRRER
                     PKTKEEMDLEEMERGRQAILRMREANERSRRRCLRVQTCTVYRGALDEQVMHGSDDCA
                     SAAPGMSGQSSRARSVGTGALFPPWFDKPSTPEPRRRTMPAPSDTTYRTASPLDANWQ
                     TSSPTKCAHPAAPSTLGLFRKWRS"
     gene            complement(<662599..>663258)
                     /locus_tag="CYME_CMS262C"
                     /db_xref="GeneID:16997147"
     mRNA            complement(join(<662599..662723,662961..>663258))
                     /locus_tag="CYME_CMS262C"
                     /product="60S ribosomal protein L23"
                     /transcript_id="XM_005538838.1"
                     /db_xref="GeneID:16997147"
     CDS             complement(join(662599..662723,662961..663258))
                     /locus_tag="CYME_CMS262C"
                     /codon_start=1
                     /product="60S ribosomal protein L23"
                     /protein_id="XP_005538895.1"
                     /db_xref="GeneID:16997147"
                     /translation="MSKRGRGGAAGTKFRCTLGLPVGAVINCADNSGAKNLYIIAVHG
                     VRGRLNRLPAASIGDMVLVTVKKGKPELRKKVMPAVVVRQRKAWRRKDGTYIMFEDNA
                     GVIVNPKGEMKGSAITGPVAKEAADIWPKIASAASAIA"
     gene            <664714..>666099
                     /locus_tag="CYME_CMS263C"
                     /db_xref="GeneID:16997148"
     mRNA            <664714..>666099
                     /locus_tag="CYME_CMS263C"
                     /product="similar to ketohexokinase"
                     /transcript_id="XM_005538839.1"
                     /db_xref="GeneID:16997148"
     CDS             664714..666099
                     /locus_tag="CYME_CMS263C"
                     /codon_start=1
                     /product="similar to ketohexokinase"
                     /protein_id="XP_005538896.1"
                     /db_xref="GeneID:16997148"
                     /translation="MAGNHTLNCGTECPFTASAVAGANESVERLGFQLPPGGRAKANT
                     PTLRRSARCLLSSSEHRCGTWSSQLDVQKVKRCNTNRVRRQRFAGVRMDHRKPTSGPV
                     VLGLGATALDYLATVERYPQPDEKIRSQSLTIQGGGNVANTLTALARLGVATRLATKL
                     GDDAIGRDILAELQHEGVDTSFVAIKTNMNSPITYVIVDASTRTRTCIHTPAAEELLA
                     SDVVNRDALWERVALVHLDSRHTSAALALAREAVQRGIPVVLDIEKDRPHALDLVALA
                     DYIITNATYPLHFSAQPGMSANRLTALSGLVAIMDYGRAAFAISTQGAEGSLMVRRRH
                     NVDGLYALGHETEEPAPTGLPILVQSDTYPPATACGSCEPQYDVLRCPAWPLSRPVVD
                     TTGAGDAYIAGVIYALLHGLSDGQAMALGSFVAAEKLAGPGARSALPRLEQVPPALRA
                     RVQAPSNWRSG"
     gene            complement(<666972..>668261)
                     /locus_tag="CYME_CMS264C"
                     /db_xref="GeneID:16997161"
     mRNA            complement(<666972..>668261)
                     /locus_tag="CYME_CMS264C"
                     /product="unknown dehydrogenase"
                     /transcript_id="XM_005538840.1"
                     /db_xref="GeneID:16997161"
     CDS             complement(666972..668261)
                     /locus_tag="CYME_CMS264C"
                     /codon_start=1
                     /product="unknown dehydrogenase"
                     /protein_id="XP_005538897.1"
                     /db_xref="GeneID:16997161"
                     /translation="MGSLPKLTFLERTPSWLDAPPLRAARELLTEAQRRAGNALCLLL
                     AFVVASFLMALIQGLFHRFRIFQSSRADRDGLRSKPQKRKRWDCSQPIRWENLRVLIT
                     GGTSGIGFEIARMLCEASVSPGPPRHLTIVGRDASRLETAKQVLLSSRPKAAQGSDSG
                     HQPVIETIQADVSTPGGVARVFGNKRETYDVVICCAGGALPGYFEEFTVEEFRAQMEC
                     NYMSAALVAQAAFREWKREVLEAIVAEHTHRRGDVRIRVPYCSERPRHIVFFSSMAAF
                     AAIFGYSAYAPAKYALRGLAETLVYEGRPYGIGVSVVFPPDTLTRGFDVENRRKPPAT
                     RACTEMSAGAALPADEVARVTLRGITKRKFWITFGLDGYLMGALNAGFAPGNFGVLSI
                     ALLPILRCVVAYYVVRFHRLIARDTERRLRDEIRQSI"
     misc_feature    668508..670120
                     /note="possible transcribed region"
     misc_feature    670069..672966
                     /note="repetitive element"
     gene            <673086..>676529
                     /locus_tag="CYME_CMS267C"
                     /db_xref="GeneID:16997163"
     mRNA            <673086..>676529
                     /locus_tag="CYME_CMS267C"
                     /product="phosphatidylinositol 4-kinase"
                     /transcript_id="XM_005538841.1"
                     /db_xref="GeneID:16997163"
     CDS             673086..676529
                     /locus_tag="CYME_CMS267C"
                     /codon_start=1
                     /product="phosphatidylinositol 4-kinase"
                     /protein_id="XP_005538898.1"
                     /db_xref="GeneID:16997163"
                     /translation="MSDVSLQGAENVSPVREQFQQPTSSAADPREPAVGSRDSAGYPR
                     EHNVTPGVRSSSGTQHERQRTAALAACVRALGCFGGARNSQWTQAQAKRETTTGATDQ
                     SAEPSVPCESKVGSAVATENTEDVLGAVDGDHGAPADVDAERSSEVSSASEELPFRSL
                     YRRAQVKWARRRLEKQVQKLLAFTSTQLSNLQHVRSGQKLDAEFAILARIYTNAHIDE
                     DFARFSRQEFRTFAEHLPLFLNYLLHSRPLDAPATSAAQRNAWREVASSTRERIRRHQ
                     NTRKLIETHLLRRCSESVRFALFVYWYLDGCLQLGPESDRKDTLRIIIEIENIMSRSI
                     TCATPSSQVAGARPPVKSFMASDTPDAATADSAPATWSPGAALAAPAGEVLSPADAAD
                     VGSVERIVHQRAIVHEIGNESRGEGVFRDRMLQDETCLAGILPAEHTIAVDLDADAAD
                     CAVRSADCSFPEAPGVQSTTEQEPRMLAQSSLMSNTRVFPRESIETGPEREISFAYVS
                     RGNLFHAQLDFMRALISISELALGLNRSQRSRFVVRELGRLNALVEAERRYVFLPTER
                     IPHRVLRILADESHVFSTKEHAPYLAIVEVQDLESTKLAEREPRKTLARTIGDWLHRA
                     GEYRPRAPRSEQRHTMTWFASPRGTEAVKSPESGLAAATSPATTPDPPTSPASRSAPA
                     VDTPSPAGEELSQSRGGKNASVSEKRSARTRLHAQERHARNRALHGVANAAAHSLTFP
                     GPNQAEAPFPFSTRTGTDAAELPPMTHRSQQQQQQQQQQQQRLRADGVGSSHPNLETA
                     AASATGDGMTASMPACSEAQDARDLGAELESGEIKNALAESREACSTPTSVGSDRWRR
                     LFGERWAERVQRLQQTSPFGRMPGWRLTSVIVKSKDQLRQEMFATMLIAEFARIFESA
                     RLDVWLCPYRIVATGADCGFVQVIPDAPSIDQIKKAFHGNMTLSGYFEERFGARGSAT
                     HRLAVRNFVKSMAAYSVITYLLNIKDRHNGNLLIDAEGHIIHIDFGFFFTNSPGGNIE
                     FEKAPFKLTWELADVMGGPDSNAFRLFRRLCGHAYAEACAHRNKIMLMVEFMMMGNES
                     LPCFRGGADLTLEQLRERFMPRQTRVKRIAHMNALIDRSSNHWTTRFYDRYQRCCTGI
                     Y"
     misc_feature    complement(674640..677166)
                     /note="possible transcribed region"
     gene            <678262..>679452
                     /locus_tag="CYME_CMS269C"
                     /db_xref="GeneID:16997153"
     mRNA            <678262..>679452
                     /locus_tag="CYME_CMS269C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538842.1"
                     /db_xref="GeneID:16997153"
     CDS             678262..679452
                     /locus_tag="CYME_CMS269C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538899.1"
                     /db_xref="GeneID:16997153"
                     /translation="MYRNCFVSQGFAGKCSAPAKHRTASAWCRCRGARGASWAPCFRN
                     RCAPRRTARETRLGRLAAMFPSEDAGENVFEKHIGRPLFHENPTTLQINIGLTCNMAC
                     SHCHVESSPNRRETMSFEVADRILELLRNSWFIETVDITGGAPEMHDAFRYLIRQIRT
                     HIPHVRTIYDRCNLTILRQIEQYDLVEFLKRHQVDIIASLPCYVEENVDRQRGNTAYR
                     RSIAALLELNRAGYGLPNSPHHLHLVYNPLGPYLPPNQLGLEIQYHEYLYRNFGIFFN
                     RLICITNMPIKRFLDDLCRTGYYEAYMELLVNSCNLAAVDGVMCLDQIHVSYDGTLHD
                     CDFNYALEMPVCWGHPDDPGPQTIFDLQRSFDEVAGKQIRTGVHCFGCTAGNGSSCTG
                     AIVT"
     gene            complement(<680207..>682348)
                     /locus_tag="CYME_CMS270C"
                     /db_xref="GeneID:16997154"
     mRNA            complement(join(<680207..681712,682079..>682348))
                     /locus_tag="CYME_CMS270C"
                     /product="chaperonin containing TCP1, subunit 4"
                     /transcript_id="XM_005538843.1"
                     /db_xref="GeneID:16997154"
     CDS             complement(join(680207..681712,682079..682348))
                     /locus_tag="CYME_CMS270C"
                     /codon_start=1
                     /product="chaperonin containing TCP1, subunit 4"
                     /protein_id="XP_005538900.1"
                     /db_xref="GeneID:16997154"
                     /translation="MNNHQATALIRSGQQGRTGDNSTSATTAKARDVRVANIAAAKAL
                     ADAVRTSLGPRGMDKMIEGARGDVLITNDGATILDRLGVQEPAAKMLVNLAKSQDIEA
                     GDGTTTVVVICGALLAASQLLLERGIHPTTISDAYQSACTEALRIIDSIAVPVSLSDR
                     DELVKLATTALNSKIVSQHASLLAPIAVDAVLHVAERRFIESEATEAPPQAVDLSRIR
                     IIKKLGSTIEDSFLYPGLILTQSVVKSAGGPSRIVNAQVALIQFCLSAPKTDIENNVV
                     VQDYAAMDRILREERQHILQMCKKIKATGCNVLLIQKSILRDATNDLSLHYLAKMKIM
                     VVRDIERDQVGFICKTLGCVPIAGLDTFTADKLAKVDVVEEVALDSGDEKIVRFVQGP
                     AAAATAAALASNTNGLSMLPDGSSERPAFWTSLPAGTSNLPQTMTIVLRGSNQLILDE
                     AERSLHDALCVVRSLVRKRSLVPGGAAVETEVSVRLGEWAKTLSGAKAYCVKSYAEAL
                     ETIPYTLAENAGLNPIQVITELRNRHVRGEKSVGIHIRRSGGVVANMLSEHVVQPTLV
                     SSSAFTLATEAARMILKIDDIVVTR"
     gene            <682577..>683104
                     /locus_tag="CYME_CMS271C"
                     /db_xref="GeneID:16997155"
     mRNA            <682577..>683104
                     /locus_tag="CYME_CMS271C"
                     /product="thioredoxin family"
                     /transcript_id="XM_005538844.1"
                     /db_xref="GeneID:16997155"
     CDS             682577..683104
                     /locus_tag="CYME_CMS271C"
                     /codon_start=1
                     /product="thioredoxin family"
                     /protein_id="XP_005538901.1"
                     /db_xref="GeneID:16997155"
                     /translation="MFVHATLSFPRGFVGLVRPSVQRTLGETFRRFASPGRGERPRVA
                     LGRAHQALQRLARRPLCALAGRQTFGSFDEMLKAAPEPALVDFYSNTCGPCVMMGRTL
                     DQVAGRLKAIPCRVMKVDVDKYPSIADRFQIQALPTLILFRDGKELKRFLGYRDGTTL
                     EQEVRESLAQTSPAA"
     gene            complement(<683783..>684949)
                     /locus_tag="CYME_CMS272C"
                     /db_xref="GeneID:16997156"
     mRNA            complement(<683783..>684949)
                     /locus_tag="CYME_CMS272C"
                     /product="isocitrate dehydrogenase subunit 2,
                     mitochondrial precursor"
                     /transcript_id="XM_005538845.1"
                     /db_xref="GeneID:16997156"
     CDS             complement(683783..684949)
                     /locus_tag="CYME_CMS272C"
                     /codon_start=1
                     /product="isocitrate dehydrogenase subunit 2,
                     mitochondrial precursor"
                     /protein_id="XP_005538902.1"
                     /db_xref="GeneID:16997156"
                     /translation="MRTLQRTLTCLRACAQRAFVARWRHGLEGSPIRAATSEGHAGLA
                     RRHHWRTLSTANTMRTVALIPGDGIGPEISDAVKKVLAAAGVPIQWEEYPISTKNVVP
                     GQDLIPSNVLDSIRRLGYGIKGPLETPIGKGHKSLNLTLRQALGLYANVRPCRTIPGI
                     QTKFPAVDVVIIRENTEGEYVGLEHEVVPGVVESLKVITRVASERVARFAFEFARQNK
                     RRRVTAIHKASVLKLSDGMFLDCCRRIAAEYPDIEFKEALIELCSGYLISQPERYDVL
                     VLTNLAGDIISDLAAGLVGGLGLTASLNKGEHTVLAEAVHGTAPDIAGKDLANPTALL
                     LSAVLLLRDMGLQEHANRIEHAIYTVLREGQVRTRDLGGKALCSEYTQAIISKL"
     gene            complement(688128..690241)
                     /locus_tag="CYME_CMS274T"
                     /db_xref="GeneID:16997165"
     misc_RNA        complement(688128..690241)
                     /locus_tag="CYME_CMS274T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461665.1"
                     /db_xref="GeneID:16997165"
     gene            <688237..>689628
                     /locus_tag="CYME_CMS273C"
                     /db_xref="GeneID:16997167"
     mRNA            <688237..>689628
                     /locus_tag="CYME_CMS273C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538846.1"
                     /db_xref="GeneID:16997167"
     CDS             688237..689628
                     /locus_tag="CYME_CMS273C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538903.1"
                     /db_xref="GeneID:16997167"
                     /translation="MEARKRARFLERVAKYGFPCVLCPHRGGALKPLTASSTTEHENE
                     PEHVTGASKPCLPVSTPETEKHDPDAVQRRSQASRWEHQDPRFAHVACLYWLLAKPKA
                     DETVATSVQRLLEELAASEDPCLTQRIRANAAVRCIVCKQRGVGLCMRCNAPSCDVGY
                     HITCAQRAQLFMDVHTHQSLCPKHTQLRVIAETGNALLLSTKTSGGIAPEGIPPRQRR
                     GRSSRTELQHRHLSVHDAPDRTRMTVRVPQSIELGFLPTRVDAVPLSEAAECYANLRQ
                     CRQSLEHLRTLADLVWRRESMKLGHTEVFFKLLRRSIAAFLATERILGHDASAAAELV
                     SAARLAEASNTDSHGNSATTEDVVVRRPRRRGRRARQPMPSSVRERNESPAVQTCLDA
                     SSPTFPRAEAAVPTSDSPMDESEAAGCSEEARPAAGVGMPPSLRFSGFVENALRVAGA
                     AFRFSRGNGKQDT"
     gene            complement(<690430..>694053)
                     /locus_tag="CYME_CMS275C"
                     /db_xref="GeneID:16997166"
     mRNA            complement(<690430..>694053)
                     /locus_tag="CYME_CMS275C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538847.1"
                     /db_xref="GeneID:16997166"
     CDS             complement(690430..694053)
                     /locus_tag="CYME_CMS275C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538904.1"
                     /db_xref="GeneID:16997166"
                     /translation="MSAGRGRRRGRPRAVSKPHEVQVNHECKRRPKWSRAHREEAVLS
                     WQTRPLRVGPGSARKVEELESAPQTDAAELKTSRTKDVERGNVLEPIVAGHGPSRDSS
                     CATLMSSVSTSSVQAFPMDPRVSASNDRNMSQADSSKAKDATDAPERSVSSRFGRSTG
                     FTVNACGRGGHTAATNDDLDLKTSSLKAATAYLRAYNALMSEDPSADREWLSRFAESH
                     WPSSCEELWKWQPVSLCFKSLDATDLQIIQIPLASSDMQNALLASPADVPYLWKWLTE
                     DAHELVQATGHARRILNEPKMPAASATETLQLLGTTTRAKHDHRRGIVCETCLLQSRL
                     RAQQSRLNLRLHAEQDSRPDEPAPNMRFRLETARCSGGGNASGGSVGYEATESWLGSE
                     RSGSAFTHAVFFNAHALFPRSKQVSITEMAGTELKQARDNHPVEVAERSCDVCMSDEY
                     SPENRLWRCNGCGTVVHQMCYGIQADSVTQNDTVDFNWLCRPCQQTYMNAPSRRAASI
                     LRRSIRCSLCGAAAGALKPGLNGEWAHIFCALCAPDTTIGEIREMEPILGLDEIPVQR
                     RHLRCVICHKSTGCGGVVRCHWLHCSAAFHASCGRRAGYLFLIGERESLRKLLQKTEL
                     VQVVDRHVLEKRGSIVAVCLCREHTQSALHRISASAQRTNVAEEVVHRAVKDAQHSSS
                     RESTYWEASPSLKKLRELHRRNELRAYLRLLRMRTMAGLETFEKAKQRMRHIHSNGFS
                     CQACLCKSMSRKLYDALCRFNRVAATFETSRGAVGRGIRGLSAFERLAAVISSVEEML
                     SQQNMLHSMEKPDAVTGQSIPSSPQGGAPPGTVSQDALSATDTLNWLSSHARWEQLDD
                     PTSSSWVHGEDDHADDESPELAGAPRKRMRKQPPNADSTLSALHFRLVLDQSGLAIEG
                     AYRWQKQNLSGAPETPSSAQNDLVLLGYRLVPPASPAGAATFLAPDATPGTFGSSPAS
                     SSSSSSSSSSSSSSLECLLRAKWEALQRVNAENHAYRLLLLERSKTDQAERAQLAASE
                     RELEAHIQRLNQISGIRRYGSVMDSTSIRVRGLKREAPAVAASAPAPPAIRHGGLANL
                     DSCPPQTLAEVEADLALHQLERARAIAPHRRLMDSLSGATEATVSLPSDARMLLAMNA
                     RCDVCGDGDCDGKENDIILCDRCGVGVHQQCYGVTEIPAGDWFCDACQVLLHLEANAP
                     VLP"
     gene            <697738..>701079
                     /locus_tag="CYME_CMS276C"
                     /db_xref="GeneID:16997168"
     mRNA            <697738..>701079
                     /locus_tag="CYME_CMS276C"
                     /product="exportin 1"
                     /transcript_id="XM_005538848.1"
                     /db_xref="GeneID:16997168"
     CDS             697738..701079
                     /locus_tag="CYME_CMS276C"
                     /codon_start=1
                     /product="exportin 1"
                     /protein_id="XP_005538905.1"
                     /db_xref="GeneID:16997168"
                     /translation="MATSDATFGAVESDTAGSLLNFELPDQDFLLQLEAKVQQLYGAR
                     SETDRKSAQEELTALQMHPQAWMRVDKILDSSTTSEPSKFFALQILESLIKYRWKTLP
                     TETRESIKLYVQNKAILLSSSAESLVRERTFLSKLNLILVRIVAQEWPSRWRSFISDV
                     VNASKTSPTLCENNLHILRLLSEEVFDFSAGQMTQDKIDELKTTFNQDFSEVYDLCQY
                     VFAQRVILQQMQPSLLVTTVQTLEKFLSWVPLGYIFETDLLETLLELFDYSAELRNSV
                     MRCLVEIATLSVGPEYDERFLFLYMTLLSKLAVAVPLEVDIAAHYDQASEATQSFIMD
                     LALFLTGFFGAHAALLEQSSDPAHRQALVTGNMYVVKIARVNDVEVFKVCLEWWRSLT
                     ESLYRALFSMLDYAVGERTPLTLDADRPNFERLEDQHARRQLYASVLYQIALVMIQRM
                     AKPEEVLIVEDENGEIVRETTKDTDALALYKTMRETFIFLTHIDPLDIETIMIEKLDR
                     QLDGTEWSWQNLNTLCWAIGSISGTMSEESEKRFLIHVIKDLLRLCEEKRGKDNKAVV
                     AANIMYVVGQYPRFLRAHWRFLKTVVNKLFEFMHELHPGVQDMACDTFLKIAQKCRRQ
                     FVIVHAGEHQSFVNEMLDNLESIIGDLEPHQVHSFYQSAATMISAETESSTRELYIRR
                     LYDAPNRRWRSLLEEATLDQSLLRDRNRMKELVHVLRLNVRGAQALGPLFYPQLVHIY
                     MDLLALYRQFSQMVSNAVALGGMIATRSTDVKNMRAVKKEALRLLETFFELVDRDPEV
                     LHAAAEQLVEPLSGPILGDYAQSVPDARDAEVLTLYAVIIEHLRPYANMLTPLIPVIF
                     RSCFNATLEMITTNFEDFPDHRIGLFQLLRAINTSCFSALFSLDPDPAVAEQSFQLVI
                     NAIVWAFKHTERNVADTGLQTLLELLRNLDSSGFTEYFYERYYLFILNDILAVLTDTL
                     HKPGFSLQAQVLMHLFTAARRGQVRLPQTDGGEATGSTTAMASETMVREHLQTLLENA
                     FPNMGPVAVRQAVDGMFLFLDDERLFKQHLRDFLVRTKEFLAGDNTDLYDEDRRSLET
                     NAQRALAVVPGMSKPSQAADSDDED"
     misc_feature    complement(700590..702695)
                     /note="repetitive element"
     gene            <702878..>705142
                     /locus_tag="CYME_CMS278C"
                     /db_xref="GeneID:16997169"
     mRNA            <702878..>705142
                     /locus_tag="CYME_CMS278C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538849.1"
                     /db_xref="GeneID:16997169"
     CDS             702878..705142
                     /locus_tag="CYME_CMS278C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538906.1"
                     /db_xref="GeneID:16997169"
                     /translation="MVSLCYLTGVWTSDSDSKKRCWRCVQRNETVLPFVTRLQRNSPG
                     ACLVPRRRAGLPQAGVAGATFWTMNQSMPHETGSELLEKLCGLRLAQPSEAEKRSFGL
                     NLARLQQELDWRRDRLSLAQLRALLDASETLLPAEALPSLLDWVQGCLHSTVPRAERD
                     ALFWGLVAAWERLIIRLPVSSLVQVLQRSPTSATTYNALLCALSRRSRRSDAEQLWRS
                     LLAKRVPLAPHAISCVLEMYLRANMPEHIPMLFEKLAVHGVHLDTIALNALLHCMCRM
                     SRVRESLVLFRIMRAHRVADTPSYNILLSMCRRLGLVSSALALKADLDSQPHLEPDAL
                     TYSLLMTLLTTADRPLETLALYREMEARKLPLTGPALNAYVGFLFGRGKFETVWIVYA
                     KAVQACEARLQMQRTEELGHGTATAANDQVVWKRPVPPASSDETDPVPDRERSGLAKL
                     SEPAARRQAALAGLGASAETFAHVVLACVKSLQKPEAVQAYSDMRLCGYRLNSGGYNA
                     LVELCCRSADIARGLELFAEMRRIGLEPNVTAYTLVIRDMANVATDVQRQLNAISRAD
                     IATQRSALDAKVLQERVQLLVKQALHYFAEMRSRSYAPSRMLYKALVRACAVSGQSKR
                     LADLLLEGDSAAPAIEQLVAGELVESLLDEGHHATAVQLVEHFAALGVRLSVITCRTL
                     IHTLYRIRDAQGILRICSLMLQHGVEINHITLRMIERALMHHELPPNIPAEIGERAQI
                     LLSRLRASQGYARP"
     gene            complement(<707110..>708414)
                     /locus_tag="CYME_CMS279C"
                     /db_xref="GeneID:16997170"
     mRNA            complement(<707110..>708414)
                     /locus_tag="CYME_CMS279C"
                     /product="transmembrane protein FT27/PFT27-like"
                     /transcript_id="XM_005538850.1"
                     /db_xref="GeneID:16997170"
     CDS             complement(707110..708414)
                     /locus_tag="CYME_CMS279C"
                     /codon_start=1
                     /product="transmembrane protein FT27/PFT27-like"
                     /protein_id="XP_005538907.1"
                     /db_xref="GeneID:16997170"
                     /translation="MTRCTARAKLCSGNELLNRDSFATSEANKQLASRCCGEHLRPGG
                     YLDPQPSSGRVRKRPAASVLERTCNYRLILAGLLICALTLVCLLNVEAAPQNTAAGGS
                     ASESGASVRARNDMQDPVQTADTLTRKSGVHITLAKREQHAHGRSVLKELKARSFSVA
                     TYQSLGMILVTELGDKTFFIAAVLAARHSRFTVLQGALGALVIMTVLSALLGRTFPTL
                     FSPQYTSILAGVLFVYFGVQMLRDYWRLCQKRNRAGGEIDTESNDGSTTCEVAAEGAN
                     GSEFDLQALEEKLSRDRERPSWTPGDDGRPLPDAGTRTEQSSMPGPSTWLNIARDKIR
                     VIETLAQLCFSPLFLRAFTLTFLAEWGDRSQIATIALAAHRNIHGVVLGAVLGHLLCT
                     GLAVVGGRLVAHKIPERFIALCGGILFILFGVLSFANDHDDA"
     gene            708780..710791
                     /locus_tag="CYME_CMS280T"
                     /db_xref="GeneID:16997171"
     misc_RNA        708780..710791
                     /locus_tag="CYME_CMS280T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461666.1"
                     /db_xref="GeneID:16997171"
     gene            complement(<710479..>711897)
                     /locus_tag="CYME_CMS281C"
                     /db_xref="GeneID:16997180"
     mRNA            complement(<710479..>711897)
                     /locus_tag="CYME_CMS281C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538851.1"
                     /db_xref="GeneID:16997180"
     CDS             complement(710479..711897)
                     /locus_tag="CYME_CMS281C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538908.1"
                     /db_xref="GeneID:16997180"
                     /translation="MFSVQGDGSSTQRQLRINSDACRVRSSATTRWKRAVREAQRHLT
                     NKRRGACLHKLQRRVSDTPAVPLVQKRAIGVYARAAPENIDDVSGGEPDGFAEVAARL
                     EPRQLHFKQGSPGTVVDALPRSLTRLEHSLILRELVPSQISLDALLEKLCEGTLPVIE
                     RFAGTRKMRILVCAGPWLTGLYGIELASALARAGHAVCLIADFDPSAPWFSVSLSKED
                     EQWFSAQRELWQVPARRETGLANARGVGVDTLGFVPRTLDFYFDLVIDALVGADMDLY
                     GSEKLGDAGATTPDATWSDPIGGLEAAAAAFQPLIQTLSESQLPLISVDVPSGWDVLR
                     GPRIPDIQRDRFLKPEILLCLGTPKTVVRYFGGNYVYLVGDFVPRRLEERLRLRFPSK
                     LRAEGYCLVSVNPYLELMRRQRENAGLPDKYPEFILSWGKANTGELYGHPGEYLATVF
                     AERVQRQWVDVDASPDLWDEID"
     gene            <712626..>716006
                     /locus_tag="CYME_CMS282C"
                     /db_xref="GeneID:16997181"
     mRNA            <712626..>716006
                     /locus_tag="CYME_CMS282C"
                     /product="DNA repair protein REV1, deoxycytidyl
                     transferase"
                     /transcript_id="XM_005538852.1"
                     /db_xref="GeneID:16997181"
     CDS             712626..716006
                     /locus_tag="CYME_CMS282C"
                     /codon_start=1
                     /product="DNA repair protein REV1, deoxycytidyl
                     transferase"
                     /protein_id="XP_005538909.1"
                     /db_xref="GeneID:16997181"
                     /translation="MSASLSRKRAHTAAALASAGEVSVKRAAAFESFGDYMAVKEHKL
                     REQQRKDAQAATGCQNLDSGPMRGVCIWVDGRTDPPREVLRTLITRAGGRFETYLHRD
                     LVTHVVATHFAKGRAKELRRAAQKLGGGAGRALNVVSPAWVVDSVRAGRPLPEWKYSV
                     DDVSRDAQQTTLPGQTLRSIDALVRCETNVASHVSAATTQKQQRETTVDPSGALKADE
                     VPSSPLNTRLDQVAYPANHEESFPHLGELALPETTMRGLRSSRETPNFVREFFAQSRL
                     HLIGSFRETYEGILRKLQRDLHSIVADAPRTLPHSSCFVLHVDMDAFFVSVSLAKYPH
                     LRGKPVAVCHSGSGEHSRAEISSASYEARARGVRANMFFGEALRRCPDLVMIPYDFAA
                     YKEACERLYRILFTEADVVEGVSIDEAYLLLQHCENVTQAEAMAARIRQRIVTEIEGC
                     TASIGIGRNKLFARLATKHGKEKLGQGSQFVLVDRAHPLGFGTPMGADLRSFLDELPV
                     RFVSGVGWSTEERLRAAVEAVAPESLQAQQPLKVGTVRAHLTLSMFEKSLGAVNGNRI
                     YRLLHGEDPRPVQPMGPRKSVSAQIGWGVRFLATEEDKVRKFMTDLALVVAERLREAR
                     IARCSVVTVTALRRQTGAGMPYKPLGHGLCDEFSATSPVEWYVCAGDPCLQSKVDADF
                     ADIVWNLYQGLQIAPDALRGAGVHARKLVEVPAHSGIVQPACASGKDGPLSNVPQQLP
                     LPAAWRSRSSTNAADMSCADAADKQQPPPPPPPPRTIPLAMPAAVTPRDRKRSLASLP
                     SNAVSMRSTRRTPASSGAFHIADAASADKAGNSKEGQKLFKQAHGGEWNEATGIRNTR
                     PPTPPDVDQEVWHALPIEVTRQVWKENLAQEQLRRWKLHRSRHANGVLDPTVPMFQPS
                     LPLFSEIRSRQVALNGAVLYARDLQSFWRTTKPVRTAERPSGKTYGFEDRLRGRVPTV
                     AAAAAAASVATATEPMLSLAQWSSLLHAYLQKLSSQRAYGSDLGSSWHQFHVKVLAFV
                     EEVAYSRRWAFLCAFLELLRGKLSTFSRDIRPIAALLVKTYEKCVELVQIAWMKHQSD
                     RIVPGASTLPPLAIQSLTSKSEAHDAWKFLLLNTQIPE"
     gene            complement(<716934..>717674)
                     /locus_tag="CYME_CMS283C"
                     /db_xref="GeneID:16997182"
     mRNA            complement(<716934..>717674)
                     /locus_tag="CYME_CMS283C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538853.1"
                     /db_xref="GeneID:16997182"
     CDS             complement(716934..717674)
                     /locus_tag="CYME_CMS283C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538910.1"
                     /db_xref="GeneID:16997182"
                     /translation="MIRALYLISYYTRGILYGSIFGDFPAGKAARPAHSALGVERRTS
                     GNLTPTRQASDAGERSAPGTAHILSARLSPLELNERLLRTLEELLPPVWAQLGLSEAA
                     ADREQVLRLEDYTILVRRLGDVVAVIIGEREHESLLLLEFGQRFEQCLRRTLHLEGGS
                     VLPFTASQARSNVATTLEPPLLSSGTSEEAQNGTSVGYLGAGVDNHQKLEQILVERYE
                     ELCHIIATMVSEAGIVNTMDPETVSSLV"
     gene            <719157..>719654
                     /locus_tag="CYME_CMS284C"
                     /db_xref="GeneID:16997183"
     mRNA            <719157..>719654
                     /locus_tag="CYME_CMS284C"
                     /product="60S ribosomal protein L12"
                     /transcript_id="XM_005538854.1"
                     /db_xref="GeneID:16997183"
     CDS             719157..719654
                     /locus_tag="CYME_CMS284C"
                     /codon_start=1
                     /product="60S ribosomal protein L12"
                     /protein_id="XP_005538911.1"
                     /db_xref="GeneID:16997183"
                     /translation="MPPKGDPNAVTIVYVRVVGGEGAAASSLAPKIGPLGLSPKKVGD
                     DIAKATKDWKGLRIMVKLTVQNRQAQVEVVPSAAALIIRALKEPPRDRKKVKNVKHDG
                     NLTLDEIKEIARIMRERSCARELSGVVREILGTCHSIGCMVEGRHPREVIEQIRSGEI
                     MIENV"
     gene            <720527..>721456
                     /locus_tag="CYME_CMS285C"
                     /db_xref="GeneID:16997176"
     mRNA            <720527..>721456
                     /locus_tag="CYME_CMS285C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538855.1"
                     /db_xref="GeneID:16997176"
     CDS             720527..721456
                     /locus_tag="CYME_CMS285C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538912.1"
                     /db_xref="GeneID:16997176"
                     /translation="MNRLSINSNSCVCRKQIDLAASGRHALRRCEGLRPATARLAQVC
                     GFVAGPATTWNRDQGKTQQCRTCARCCFKYGLRGANFSLAARARSHSRLVCCEGQSVQ
                     HGRTERSPVGCSSELRRNNKGGGSGPETEITVEPEVSTATIAREVERSFDTVLQELAA
                     IQSDSPRNVAILGTRHCSYLHQQIIELLTFANVLLGNHVITSGGIGSNMAVIRGALRA
                     DKPELLTVVLPQSVEKQPTEVRELLERVTQVVEMKQNDSLPLDVASRLCNSDIISRAD
                     RFISFAFHDSEVVLEAAREAKALNKVVTLLYLD"
     gene            complement(<723924..>724376)
                     /locus_tag="CYME_CMS521C"
                     /db_xref="GeneID:16997177"
     mRNA            complement(<723924..>724376)
                     /locus_tag="CYME_CMS521C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538856.1"
                     /db_xref="GeneID:16997177"
     CDS             complement(723924..724376)
                     /locus_tag="CYME_CMS521C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538913.1"
                     /db_xref="GeneID:16997177"
                     /translation="MSDNDYAAVEKQLVECIRLWERLNRAAVFYREASSQAGPDALSA
                     TIQALAGAYQRLRALCMEQRTKCATLSATEASLAEPGNWRVPLELLQWLDRGENPDLF
                     LLRLLYDVYDLEYIGREKENALKKFRAVLETSGLPPEAPAASGHTSDQ"
     gene            <724593..>725465
                     /locus_tag="CYME_CMS286C"
                     /db_xref="GeneID:16997378"
     mRNA            <724593..>725465
                     /locus_tag="CYME_CMS286C"
                     /product="cytochrome-b5 reductase"
                     /transcript_id="XM_005538857.1"
                     /db_xref="GeneID:16997378"
     CDS             724593..725465
                     /locus_tag="CYME_CMS286C"
                     /codon_start=1
                     /product="cytochrome-b5 reductase"
                     /protein_id="XP_005538914.1"
                     /db_xref="GeneID:16997378"
                     /translation="MFTFLASSTIETNTSFASLVLVSVVVLASAWLWHRYSNRAGERA
                     PALKPDTFTRFRLVAKTVVSHNTRLFRFALPFPDQLLGLPPGQHVVLRARVPDAEEPI
                     LRPYTPVSKPETRGYFELLVKVYPAPSGKMGRYLDALEPGRDFVEARGPSGTFSYQRN
                     MVAELGMIAGGTGITPMWQLIQVILSDPSDKTRIKLIFANVKEEDILLRSAIDAAAAQ
                     YAERFTRFYVLNEPPAEWSMGIGFVTQEHIRSFIGLPDASKMVLICGPPPMNKAMREH
                     LEALGYDKAAVFRF"
     gene            complement(<726398..>727144)
                     /locus_tag="CYME_CMS287C"
                     /db_xref="GeneID:16997178"
     mRNA            complement(<726398..>727144)
                     /locus_tag="CYME_CMS287C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538858.1"
                     /db_xref="GeneID:16997178"
     CDS             complement(726398..727144)
                     /locus_tag="CYME_CMS287C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538915.1"
                     /db_xref="GeneID:16997178"
                     /translation="MTQRDEQSESWMHVRELSAKGNELDRITTDAGTPFSFEKFLEAF
                     ERIRYDEPPAQEPWPLPYLLDFIAALSAVAGMFQHLGAAFSFAHQDVVEKRDTLYRIY
                     RSDPENYATIRKVIERETREGCLETGSGKQGAARNILRMMWCLKFIQVLMRELARCPA
                     ASYSKRAATRECVWTAYQEALREHHGSVVIAAVRAAVFFLPPIEQFLTSIGVEASRKD
                     EYMRRVKLSLDPLVERLYAYYEHRNMLALP"
     misc_feature    complement(728462..729089)
                     /note="possible transcribed region"
     gene            complement(<729207..>731954)
                     /locus_tag="CYME_CMS289C"
                     /db_xref="GeneID:16997184"
     mRNA            complement(<729207..>731954)
                     /locus_tag="CYME_CMS289C"
                     /product="glutamine--tRNA ligase, chloroplast or
                     mitochondrial?"
                     /transcript_id="XM_005538859.1"
                     /db_xref="GeneID:16997184"
     CDS             complement(729207..731954)
                     /locus_tag="CYME_CMS289C"
                     /codon_start=1
                     /product="glutamine--tRNA ligase, chloroplast or
                     mitochondrial?"
                     /protein_id="XP_005538916.1"
                     /db_xref="GeneID:16997184"
                     /translation="MHCTRVHTPGSQRSRKPDIEAPGQQRPAGAIFPRLAFRRRLRTA
                     LPLAPVVLCRGCVAAALVVMETNAVAAAASGDDGLLDQLRALGLEDRNLRAVARSAKV
                     QAALTEAVQVAKRSALESTADRLPEEQALTPQKASLLYVAVSKLPTKLRCFRELIFEA
                     IGDGRIDNTAKLEAAFAYLEALLESAPGTAAEGKVDRDDFNAAVGAGVVVDDSTLSAA
                     VDEEIRTIMDDLLVRGYKYPLGPIIAGVQRRVRFVEGRRIKEAVDAKLFALLGPRSSE
                     AGAGSRASTTTSKEAADRPSDDRCKTNRRMLNTATSASSAPKTKDGHAGIGSGSAIDN
                     ETDAQLAENPFAALPAYFDARSLDSMRNTPELLALQRANTDGCSVVTRFPPEPNAHLH
                     CGHTKAMLLDFGYAMRNGGRCILRFDDTNPDTEEQAFIDSIIETVQWMGYQPYQITYS
                     SDYFDRLHELAVELIRRGKAYVCHQRPEEMARDREEKRPSPWRNRSVEENLDCFERMR
                     LGLYDEGAAVLRMKIDMQHPNPVMRDPVAYRIKYAAHPHVGDRWCIYPSYDFTHCLVD
                     SLEWITHSMCTLEFEIRRDSYYWLLEALDMYRPFVFEFSRLNLSHTVLSKRKLTQIIE
                     RGLVRGWDDPRMPTLIGMRRRGYTPVAINHFVASVGFSRAENNVHLRKLEACVRQYMD
                     QHAPRRMVVLEPLPVLLKNFAQALSAAEAVTVQVPNHPKRPELGTRTLEFTPMIYLER
                     TDFRLQDAKDYYGLAPGKAALLRHTGFAIRVLAALTAQHAPATSDDQVQLLHAEILTQ
                     LPQPRPKGVLHWVSEKSMPCECRLYEPLFCVEDPLQAAAEQNLSERDGWLTFFNPKSE
                     RILQQARCESADDWQPGAIFQFERVGFYCVDPDSQLEASPPHLVFNRTVTLRESFPKF
                     A"
     gene            <733086..>734222
                     /locus_tag="CYME_CMS290C"
                     /db_xref="GeneID:16997185"
     mRNA            <733086..>734222
                     /locus_tag="CYME_CMS290C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538860.1"
                     /db_xref="GeneID:16997185"
     CDS             733086..734222
                     /locus_tag="CYME_CMS290C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538917.1"
                     /db_xref="GeneID:16997185"
                     /translation="MACRNLWRLPLSRRWTGPSFARRRALSFEYIADEAPGCFEWFLD
                     WTSQLSTLCARYTGPVFVCLGLALISLIVFSYFRHMLPALYELATRSPYSGWAQTALL
                     VHLVIALYLLYCVVYAYAKTVTTDPGSPPLAETVQMAALDPHIDVAVVDAKQGRCAAR
                     AATPNCTWTVCGRCRRWRPPRTHHCSVCRRCILHMDHHCIWMNACVGYRNYRFFLSTL
                     YFLVVGAADTVATVLFLWWRASHRRELRTNIWLLYSFALALCLGVALLLLLVFHIRIL
                     SLGLSTIDYLAGGARGAESVAAPVDSGERMQPGSQLDPTIGRHGRAPRQSRFFERLRL
                     NARKVFGIERPLWSVFLFPPVRGGSKESLAGERHQPALLSGLVV"
     gene            complement(<734691..>736421)
                     /locus_tag="CYME_CMS291C"
                     /db_xref="GeneID:16997186"
     mRNA            complement(<734691..>736421)
                     /locus_tag="CYME_CMS291C"
                     /product="similar to FKBP-type peptidyl-prolyl cis-trans
                     isomerase Mip"
                     /transcript_id="XM_005538861.1"
                     /db_xref="GeneID:16997186"
     CDS             complement(734691..736421)
                     /locus_tag="CYME_CMS291C"
                     /codon_start=1
                     /product="similar to FKBP-type peptidyl-prolyl cis-trans
                     isomerase Mip"
                     /protein_id="XP_005538918.1"
                     /db_xref="GeneID:16997186"
                     /translation="MLTLQVRCFNGKKISVVPKKGVHTSVYEIQNEVEKSAGIPVTNQ
                     MLMYRGQVLDNPQQTLSAYGIDEALTEVTMSVVRNVRPGITADSATVSSSSSSSRATK
                     STAAGASSDSRNSRTATSGTASAASAGTGGAGAGSGSRAGLADVESLARQLRNLGTGS
                     SGRGSRSSGANPAMADPNALLQSLLAGNSGAAGGDQADTMNWLQQMTQLMGGLWESPA
                     MQEYLSSAEKQEESRQALLNNPFLRQWMDADPQFREVVEDPQKWAESMRAARELFAQQ
                     GGLSAATEAAGQTSGAARAASALHAAAGSDRRHHDGVHQTSSRLMVDTGDDERADDAE
                     AENPAKESARLRDERTRELARAQGLNLNELSIGYGFALGQALLNSGFGLDHELVIRGF
                     RDALAGKEFPVNIAKYERQMGILQGIANDVVGEINLQEAEAFFETAKTMPELFNVLEP
                     DRIVWEEVDDAEPSATAGGSHKKCESDDVNVMMVLQGRLLDGRFFFTCPSDENGEMVN
                     PITMRVGDAPPALRKIVLDMHEGEARTVYVHPESCENMSEMFGQMLPKNALLIFDIEL
                     VQVDVPMEEE"
     gene            complement(<738641..>738976)
                     /locus_tag="CYME_CMS292C"
                     /db_xref="GeneID:16997187"
     mRNA            complement(<738641..>738976)
                     /locus_tag="CYME_CMS292C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538862.1"
                     /db_xref="GeneID:16997187"
     CDS             complement(738641..738976)
                     /locus_tag="CYME_CMS292C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538919.1"
                     /db_xref="GeneID:16997187"
                     /translation="MPMAVVRANGFIRGSGILDRVSRVTCSTLSRWHRHVTVINATRD
                     ASRVRFIKQPISVSRAYLQASVTLLCECGACSNHARFTCSMVPRQGTAWTQRLAPLGA
                     HRAHRDVAQ"
     gene            <739455..>750644
                     /locus_tag="CYME_CMS293C"
                     /db_xref="GeneID:16997208"
     mRNA            <739455..>750644
                     /locus_tag="CYME_CMS293C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538863.1"
                     /db_xref="GeneID:16997208"
     CDS             739455..750644
                     /locus_tag="CYME_CMS293C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538920.1"
                     /db_xref="GeneID:16997208"
                     /translation="MLERFVVQRLLRFLGDFIEGGLQEEQLSLLFGTGNSVELRDVRI
                     RSDRLKSLLAGIGSPVYVLCASVGTLRVSIDLRGRVAVIVRDLVVVLADQYPEAETRR
                     STARERYRKAILRIDQAQRHLRLQQAFEARPQRSAATASDDDSTTVSSSSLAGQRSSA
                     SPRRQNDRRDSQTQQQQQQQQQQQQPGSGWAFFGSGVIESLIAYVADRLSIQVERVVL
                     GFADQGVVMRRAKEVSPRGYHWITVAFLDRMLTSDWSPEKQEAPSLEPANVPGTAANR
                     SKNLFGSAQTTIVRKRLALSGLRLSWIPDGSKSLRNISWSDPELVRESLWRTREENDA
                     DILGPIEFGIGLYVSGFRDSFRTCIQATGNNLDCSLSQLQYLDMVSAALRLGVGQIAK
                     LSLLSEEMTRGSQESADLGPGMRKTARGEGSAPGRAAARERWVQVVRHVRQSVRRRHV
                     PWTREHLSMQWTRRKQYLATYLAANVRSDNHSWRLVQALEETMDLEQILALRATAEAL
                     VQRSPQEALALCDEVSIAALVVVSTPRFQRLRQQRLVSWCLWMLSCIWRLGALLWSVL
                     ERRIWGLRPLAHKLVQIGRTLRPPILQVLAGQWLLSAPTLLPATSEEDADLSQTTEHI
                     LGSLHSYIHTDYERFLQQRDLRSKRASSPTAALAPTRTSSMLSGEHGGRRTAWESALA
                     AESAVFQLDVSVNRVQLALFQEHQLVAFTGARAFAARSKLLSTAAVQHIGCQLFISSA
                     QNLAVRAWLAQLQLRDEANRILVCNRYCPGNHESAHGTQQPQARNAEESVPESDLSLT
                     GRDEAPEAFQLRLWNPRQGLVDLELDFAPLSVRISAVLVQALLRFWIPETLASFAMQG
                     RRYAARVLHGLQERLVRSDDATLVQKLSSMFMQLRFGGMFIVFDEDFRLLEGAAVTSA
                     EQSSTSPEASPASLVLCVQLAGAEFLMGEETALTAHRQPADQAVLLGIDAFASSVQKA
                     QQVFAFLSSSSSETRVDLQGTGTDEPAQQTPPETPYVVDSRVVLRFPGLTIGWCHETS
                     VEAASAVVPVRTLLQLGTLRIGNTIEHCLVTQDQRPKLLARILVGILLERLAVTAGLS
                     DIWALVQVALRYQRVIQDIQVILRENDADLSTTSHQNSLDSLREASISSNASSSSPVR
                     SREATNSISRELGAAKMHPPQLQQKRMRTREREPHLRTALSLRLNEPLHVELALDHGK
                     SATMTRHWLLRSRIGVQGRLLLYSNQSMLSQLQASGISVEADASGERPRSCQVLLVAP
                     FQGELEAIFEAAASTSTCTTSDATALPTLDCALRLDAIDVVLPFSFIRELVDTGLAFG
                     ALLHQEVTRAAPPGSLETPVTITRTRAADDQEPFLWSADLSALPGNASLVFEFATSDR
                     AGYLGVDHQGRVHGPVPLEQAARFRVQRVRRKGAPVGVMLKLETDQSSGMTSTFTVQV
                     LADLSDVSFDGRTTKPTPAGPHLGIRRIAPELRDEVCQRSLERLSTNGTESSVLEATA
                     GSEAGESSGTLPAAAAAAAAGTLGSSGSAGNRPERSRSLRRWLGNSDSSTRSSTEVGS
                     AAADKADRRQQRSIATSATKRKRWRTRVAAGAGASTASADDDDADADDDFGNERNDQV
                     LRACTWESVPVHGVAEAVLLRHEKSGHWIGRTPAAGPVEAHDASSPDEALHLDLLPGA
                     SAALPLRPLLLQRAQHLAQFQPLIRIRAQVAAAGVLVRLYEWMDEAARYRLPLLALSA
                     VPIDVQSEVCVYPSAAGVEPELSLALSLCPTVSSYRLAQRRWRDLLEPVPLSMQASLR
                     GKPRFVAFQLQLGTAEQPLRLHAYPRGVHLISQLLMDLMDRTAASRLTTDWWYFHNET
                     EATLQLQWDLKNSTQNVDNDDNVDVDEPVVVYPGQSVCLYPPRALLRRALVRLADLEA
                     AARQRSDVPEPFTARIQVVGFGTLPPVPLQTSDVVSLPLEPDPVCTTSATPSARTPVP
                     ADTTEKQTRGGRVTAACSAPAERSVSIAQRSGTEYPAERAGADPTTLTATRAALSQRV
                     SAEQRLPTDAPFEVRASIDTMQRGNAAAQPRLRLPGAAAAPAVATDSTRRRVDDSERA
                     APVVLYWVRLSDGYRDHFYLYSRTKVANRCRSIALYVHGFLPEHERRHAETVLRRQGR
                     SPALVLLQLGRTATALRSASKEPWRKLGRGLRSFFGIRSKTRAIPERPAPLPGLPAES
                     SGSWYALMPVNMPQSESSASAAPVSEPAAGVLEPEQALFLGTFLRPTRLRLLPVTSTS
                     QRVFNEEASAIGGLEFPLVAGQLSLTRSYFLVAAAVDASCQRFRVMEVGARTSSSSSS
                     NSSSSSQRLANEYNIRPALTILHELPYPASLQVVDADGNLHSTYALDAWGSVEVCELW
                     GPPRENLLVHRLLGSAGSTRAPSTEPSRTDGNFAPAPAPAPAPAPAPAGDDDEDDHDD
                     TDVTARTVAIVRLQNASSAGKRPSTRTGATGKASLAANLALHCEVERHTLSFRFGYFR
                     ARLVRSETRGRILVLYAPFLLCNQVPGISLCFRHVQGNRKPLPSAQRQLRRIGSQATS
                     AVQRLAGQAGAAPKRLGAHLRPREEATMPERGTSRHPAPVLSSPSTSTTTTLSSAAAS
                     APVDTARHLGTDVQADNDDNDGTVLTSASAASPEVVAADDPDPEAVTTEIAPAASETA
                     VVFDAASEPESASTVSADTLTQATRSDTTAVAATLNKPQRLVHRKKAEASRQFLVPPV
                     NLAEESGAPSSDAYLYCWKSQQALIWVNGAPRRNTQHPVRLAPFGRGNKGFGVPDALV
                     GHLLELVTQVTLHSYRDRTAVLDTPLPNARILQLRPRFEVRNTLTETLSLCDAVDWER
                     FRLEQAQHEEHKATLPVCAVSGLVPGMQQVPAAVSSPKQPGRAAVTFHEANKGRFARI
                     RLDDTGWSGLIDFTDLNGTSVALPRARRNADQYWVDEHVPVYGSVRMDNGRLIWTFQS
                     KHVAAKGIRFVNRTRFDLVVRQKAKRADRLRSLMRSATRDASHMMVQTLRGVTSGAAS
                     AAASAFGMGMRNRNTGTGTGTGTGTATATGTGTLSTSGSRTLAAGEQQQQQQQQQQQQ
                     VTAETSIMPQTPQGQRTDPGKPLRITPDTSLDNAAWMIFHVPPKSERVFYWPEPLGSS
                     KLLLKLLPGEAGLATALANPQLFADAVVVPTRQLHPEPRWLAQRRGHQPAFLYRMIAQ
                     GPERHLVVDEGTTSTLANEPAWIPRFRLDAQLSLPTLYLNLYNLQARPLLEVQLQQLE
                     VLANAGLRPDQQLAIMTRLDDLVLLNRMDRARSQRVVSKTAGSLTSGDDRSTPAPATN
                     NKGVANETPSELLVVALVLRHVQRDLLHVSALQVELTPLRVNLEPALLYETVLTLVSC
                     YDRARCSSLTATQRRSAMSSSSSSSTNAGAGIGSSVTSPGSCSVHEAQTGRREVRSTR
                     AVSSGALASLALPAERTRSLPAVYMEQGAIGDLQILLTWRKSSAKLLLARVEAAASPR
                     LAEAVQQIRDLLAYVPAVRDAPMRLSGIMLTEYLATMEQLVHRIVQHYIWSGIRNGYA
                     LVGSLDMLGAPLNIWGHTSGRVQAISQDISHGRLGKAGKHMVTFIGGTVGDVGQSFTG
                     ALSSFGGMAWRRLKWLQRAPSHAMNPSSSSSLLPTDWGEGDDNDNDDGAGRDAVENAR
                     PGGSLPLRAGQGGSRGAKTRQRAPWAARFVARWLPGGAGRRPASATTGAPAPAPTAEP
                     SVQPTVPPSPLDWRRALLGYASASDARSGST"
     gene            complement(<750935..>753037)
                     /locus_tag="CYME_CMS294C"
                     /db_xref="GeneID:16997209"
     mRNA            complement(<750935..>753037)
                     /locus_tag="CYME_CMS294C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538864.1"
                     /db_xref="GeneID:16997209"
     CDS             complement(750935..753037)
                     /locus_tag="CYME_CMS294C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538921.1"
                     /db_xref="GeneID:16997209"
                     /translation="MRVAIIGGGFCGCVSAYQVARALKTLRDNGECDPNQAPADHEVV
                     LFEQHDRLGGSVRSVSVQGVNVEVGLWDSFTADDLRVLELIKRCGMRVQPRRAASPAH
                     GGLYATAVLDWPTKTDTGTLVRLSAFGGLPWLNALTSGLEDTGLAQLLPFVLAMLALR
                     MALRYTRWLLRLGWALIGISLMWMSLSQMPYITYGHKFLMRTWQRLQHRRRFGRSAQL
                     ATQLGAGFADQWRRIYRQGVAYCWSVAQFLQAADMWSWAVTNVAQLCRDAHIRLAFAE
                     EILEPVALREVFGTASPGQVHDRDACLLLQVNGFAGLRAMASLNLCDADEYGALEGLE
                     CLCQRLVEKSGARVMHHARVIRIHAVPADAAASELPRWRLEFPADATPSCDVCFDAVV
                     LACSEPPPVDSVDLAPIEKPPLGDATMPAEAATVASDAGTGHSNAAQAPVVSSAAAFA
                     RVPGTSAASGVRAVALVVGRLANSVLRQCGYHTEAQFPDLVTFKTPLCVDPQSVDTPS
                     EDAPAHTAQRGPRLRPASASEFGLVRLERLARFDTSASPGSSKRDIQRYLYRLLFLAP
                     EEEEVEEVLADRITNGFVRPLFAESTCGDASSAAHECTFTCYGVYFSRLHAFRCYPVR
                     RSADANKALATVLGARLLYPAMIKRLAPGLEMMALGARMTCTLLEDHIRWILPSPTDM
                     PRYERIMQSPFNRIGWVE"
     gene            <754350..>755489
                     /locus_tag="CYME_CMS295C"
                     /db_xref="GeneID:16997210"
     mRNA            <754350..>755489
                     /locus_tag="CYME_CMS295C"
                     /product="MAP kinase"
                     /transcript_id="XM_005538865.1"
                     /db_xref="GeneID:16997210"
     CDS             754350..755489
                     /locus_tag="CYME_CMS295C"
                     /codon_start=1
                     /product="MAP kinase"
                     /protein_id="XP_005538922.1"
                     /db_xref="GeneID:16997210"
                     /translation="MHAPIVQEAGDINRSSKTFLVGNTKFTVPAHYELVRPLGQGAYG
                     LVVAARDTRNGAGVAIKKISRVFAHVTDSRRTLREIKLLRHFHHENIIDLLDLFTEPG
                     ATAATFDDVYLVSTLLDTDLHQIIASGQKLTDDHFQYFIYQVLRGLKYIHSANVLHRD
                     LKPSNLLVRANCDLVIADFGLARAAQPRVDDTSHQMLLTEYVATRWYRAPEIMLSWRH
                     YTSAVDIWSVGCIFAELLGRRPIFPGRDYLHQLQLITQVLGTPSEADLMEIASERAKR
                     FMRSLPVRTPLKWKDLFPRCENPLALDLLSRMLCFSPDQRITVEEALAHPYLEKCADV
                     NDEPVCDRPFDFSFEERADRGGAPEIRQMLWEEIKEFQCIRREKQ"
     gene            complement(<758265..>759083)
                     /locus_tag="CYME_CMS296C"
                     /db_xref="GeneID:16997188"
     mRNA            complement(<758265..>759083)
                     /locus_tag="CYME_CMS296C"
                     /product="probable C-4 sterol methyl oxidase"
                     /transcript_id="XM_005538866.1"
                     /db_xref="GeneID:16997188"
     CDS             complement(758265..759083)
                     /locus_tag="CYME_CMS296C"
                     /codon_start=1
                     /product="probable C-4 sterol methyl oxidase"
                     /protein_id="XP_005538923.1"
                     /db_xref="GeneID:16997188"
                     /translation="MILEFTVIAIATRWSAIQRLWLAVYQRTTDFQMTVGGLFAALVL
                     GYFLGCIPYLILDLVRPSSARAAKVQKQWYPDARALSRCFLSLFFLFFGVMLPLIAFS
                     YPVFRWVGVRREPPLPRADEVVLHVLTCFVIEDFGNYWIHRWLHTPWLYRHIHYWHHQ
                     WNTPFSLAATDAHPLEVILLGIPTIAGPVLLSSHLLTTLIWMMLRQYEAIDIHSGYEF
                     RWNLNAYLPFYGGTEHHDYHHYLYSGNYASIFTYCDEVYGTNLAYKQRKQVKSR"
     gene            complement(<761600..>767242)
                     /locus_tag="CYME_CMS297C"
                     /db_xref="GeneID:16997189"
     mRNA            complement(<761600..>767242)
                     /locus_tag="CYME_CMS297C"
                     /product="similar to cleavage and polyadenylation
                     specificity factor subunit"
                     /transcript_id="XM_005538867.1"
                     /db_xref="GeneID:16997189"
     CDS             complement(761600..767242)
                     /locus_tag="CYME_CMS297C"
                     /codon_start=1
                     /product="similar to cleavage and polyadenylation
                     specificity factor subunit"
                     /protein_id="XP_005538924.1"
                     /db_xref="GeneID:16997189"
                     /translation="MDLIHKSLIPASRAVAVASGRFAPELVHSGSPASESAEEATELE
                     PLDLVVAHLNRLELYRVDARGTLTLVAQTEVAARIGSISRFPSPVWISGQKQPVRKDW
                     LLVAIDSGFSGGAVARSAGQVSMIAMIVEFKPLLATWYAQAVYSFAQECVYVLQDDGI
                     RDAALTIDKALEHVVLRAGAVLGDGMWRRGGGYGEERPLTCVDAVEAAVDFLNESSRE
                     SNFQWNDGRCGALVVPAWRKAYILAPPLCSGTGAALAHCGIRDDVVNEGALDADPTAG
                     RDAHTRTSYGPGAMLWTEDVQETPVSERILPGIPAAETRGRKLLITERDQGIQDAHRV
                     YYYAVELEALLGHVRILDCCFLTGTALPTMVMLYEERPTWAGRVEAVSNSCALAAIVL
                     PPLPAGAAGEEPLVAWRIQGLPFDAEKVVPLPSVEWDRAAEQGLLLIAANVLFWIRGN
                     GQIGASLSGNHFGDTFMELDGCQLPGALYGGTDSDIISRCRTSQVLHFRGACIAPVRL
                     HRYGLFLADGNVYQLALHADAEYPLRLEALRVRGESRLAPAPLDAKLLSRDLLFVAAH
                     LGSSVLYRMTQVHPHGRRTRTSAAENGTLHKNATTKEAQWELQQRDTIFQLGPIVDLV
                     VIPPRYSPPAGTLLDPGEILAATGHQHQSCLARCTYQVQTREWQRIPSAGCRRVWSLY
                     ADHDGTGMHQEEQAFLLLSLSKSSVILDIRRGFEQAADTRVLLPSPTIAAGNLAQRRL
                     IAQVHRTGIRLLDANLDVVYEEDMLLAALEPGTAVSGASVVDPYIAVWFTNHRLQVWR
                     LEHFSEAEAERTTYRLSLVFSREHVLCASLYDGVLCRDFQAACRPPRSTGNLRTSGRP
                     MRLRRRGASAAPGSAATAAATQSSRETHRAVPPSALSRGQRALAGADLPPELGAEETF
                     LYGALALSDAVSDATPEGASNGTPETTARGSQPEEPVVPALHSMLAVVSVDGALYLYA
                     LGSEKNLLLLRCKRFFLGVHQVLDDRSRQAASFTDAASAEADAEAESSAATTTITTTP
                     PTSPRGGTTGMLHRMPGEATLEVSALESGTRTTTPSQGAGLTSLSSSSSSSMPRKRTA
                     TTGEDAPKGLGSMPANGRELGPRRTRQGKVLDVCLVDIGERTCPVLAAVLASGEVVLY
                     RGYVVNRGILCFARVGSDALSTVLTPSVGVSANAPPMSLSTSIGTTAPERDSKASSRR
                     SVSIRLMPFRRIQGKSGISIIGQRVILVLGDTGYPTIHPVRGPGLLALADLHHEGVCS
                     QGFVSVATDGTVRIGQWPVLARAQAVGNFLVQKHAWPQPEYVERLLHDPSTDTILAIV
                     GRMVPATEAAVKYLLEGNRYESMLRHARRKQQQQQEQQEQQQEPGLQEAEESAVRVTR
                     SSGMQPPQPLLLNADARRVPASRGDTAGIRARGDSSTAEPMDMDDVANGASAMTTPGG
                     VNGTAETPWPSTTARSVDESVAGDVADDPPKALAAFEEQKLRPFDSGRERDLPLLIDQ
                     HAVVLLARNSLEVLARYDLEQTEVGLAMCATRIRHFQRTGDDEAPRFTERDVLVVGTC
                     FLRGEDTSIRGRLLVFEISRQEGRQHHQHQRTLYQMQTLAATEVKGAVSAVAPVKGGF
                     VCCSAGPRLEVYKLIEDEMSCISFYPGINLFFSHVGTLKQYILASDMRYGVSFLFWRS
                     RNVSQNFLCRDEAQRELVASEWLMHGTKANVLSADMLGNIIELSIPSPVDPESAGGTR
                     MTFEAGFHVGSRPNAVRRVRIDDPSAETPPPNEPSSLWNTHVILLGTVDGMITMVSPL
                     LRGVAKKLELAAQDLMLEPELRKWCLYARSWRVMRSLTVAAGLRKPKRSILDGDVLQL
                     YGSLDTPRRKEIARRIGMPQEALFEAIFGTIDEVLQVF"
     gene            <767906..>768982
                     /locus_tag="CYME_CMS298C"
                     /db_xref="GeneID:16997190"
     mRNA            <767906..>768982
                     /locus_tag="CYME_CMS298C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538868.1"
                     /db_xref="GeneID:16997190"
     CDS             767906..768982
                     /locus_tag="CYME_CMS298C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538925.1"
                     /db_xref="GeneID:16997190"
                     /translation="MVQLLPGRRAVRLMHPEQERALREPSKKGKRVPFRSDALPSWSP
                     GTHAAFVSGAGLPNAVRSWVRHGSARCSSSTCLLARGLQLCFITRVPEVPLTGVYSRR
                     SRRAAGVALPRLALRAAANELPSQARTRGAELAEAVRREYPQMFNPSYTPDWALYDER
                     IVFEDPITRLEGIGAYRRNIEFLRQSPVFGDGRLLLHDLSMPQPCTLCTRWTLSLRAK
                     FFPFQPLVTFTGTSTYEWGADHGRIVSHIDRWDSIQRQAYFSPEGLRDLLMQLFRQPF
                     RNLEGTILYRFRDIMIVQQRDGAVIARGVYRALSLAELEAQLEKTFPVHGYRAVSEEN
                     DAERSNATGRVRVQVRKADPSRKP"
     gene            <770620..>772272
                     /locus_tag="CYME_CMS299C"
                     /db_xref="GeneID:16997191"
     mRNA            <770620..>772272
                     /locus_tag="CYME_CMS299C"
                     /product="biotin carboxylase, chloroplast precursor"
                     /transcript_id="XM_005538869.1"
                     /db_xref="GeneID:16997191"
     CDS             770620..772272
                     /locus_tag="CYME_CMS299C"
                     /codon_start=1
                     /product="biotin carboxylase, chloroplast precursor"
                     /protein_id="XP_005538926.1"
                     /db_xref="GeneID:16997191"
                     /translation="MEQSSAFIATLGAGRSRGSYALSRHACATAGNKNLWQRKKSLSI
                     LGLKVGRGRLCLRAQTSTGAVSNATEATAERPFKVLIANRGEIAIRAIRTCQELGIRT
                     VQVHSTADTDSLAVRMADERICIGPPAPRESYLNIPAIISACEVTGADAVYPGFGFLS
                     ENARFADLLEQHEITFIGPSARAIALMGDKSTAKATMRQAGVPIVPGSDGLLRDVSEA
                     RRVAREIGYPVMLKATAGGGGRGIRLVRSESELENAYVTCEQEAKGAFGNGALYMEKF
                     IESPRHVEIQVIGDSHGNVIYLGERDCSVQRRNQKLLEEAPSPAVTPEIRQQMGEAAC
                     KAAKAIGYCGAGTVEYIMSSTGEFYFMEMNTRIQVEHPVTEMITGLDIVALQIAVARG
                     EPLPLRQEQVGLNGWAMEARINCEDALQAFRPMPGVVTNFLAPGGNGVRWDGCIYPGY
                     NIPPYYDSMLGKLICWAPTREAVIRKLRRALGEMQIEGIPSTVPFHLALLDNPAFQEG
                     KTVYTNFIEREGILDQLKARVQSASQPSGRDAVAAVPAAASK"
     misc_feature    complement(773286..775156)
                     /note="possible transcribed region"
     gene            complement(<775169..>776485)
                     /locus_tag="CYME_CMS301C"
                     /db_xref="GeneID:16997193"
     mRNA            complement(<775169..>776485)
                     /locus_tag="CYME_CMS301C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538870.1"
                     /db_xref="GeneID:16997193"
     CDS             complement(775169..776485)
                     /locus_tag="CYME_CMS301C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538927.1"
                     /db_xref="GeneID:16997193"
                     /translation="MFASQLTFTSVTLLRSVSATGGLSGGSRERLSATRVDAHLRGWQ
                     APLWSLPMCGSCLHRFVTPTRSRLGWARGTQRLHRGQHARTGVLYMAAPHEEASRPPN
                     FDDPKWLPEYDQDFLEARVLTLIENGACWLLVLQPFLTPSYILPMFIGDTEAQAIKNV
                     RSGQKTARPGTHDLAKNALEACNIRVVRVAVTHVLGGSFVARIWLRAEGAVKEVNIDS
                     RPSDAIALALRFKVPIWVRRQVLFSSGCPIEKYYVVRPANPEGGRSLGTSARKSRSLF
                     DPRPVIGPDDPILNPPQTSMSSKTILALFRNNSPFKTDAVHKLERELKECIAREDYME
                     AARIRDELRRLFPLDAMRDAIRKAIEEQRFDDAARIRDQIITWKLENDPNLPATSEWK
                     PDLDLSSLGGTRDPKNISDLPSNDSKDSQQPQQRPESEEGPNDSML"
     gene            <777791..>781882
                     /locus_tag="CYME_CMS302C"
                     /db_xref="GeneID:16997194"
     mRNA            <777791..>781882
                     /locus_tag="CYME_CMS302C"
                     /product="5'->3' exoribonuclease"
                     /transcript_id="XM_005538871.1"
                     /db_xref="GeneID:16997194"
     CDS             777791..781882
                     /locus_tag="CYME_CMS302C"
                     /codon_start=1
                     /product="5'->3' exoribonuclease"
                     /protein_id="XP_005538928.1"
                     /db_xref="GeneID:16997194"
                     /translation="MGIASFFRWVVARYPRALQAAVEEAPVTDQAALENGNYLDDNDY
                     LHVDVSLPNPNGEEFSNLYFDLNGVVHMCTHPEDRPPPATEEDMFQDVFRYMDRIVAL
                     VRPRRLIYIAIDGVAPRAKINQQRTRRFRAAKEAREKTEEEEKLRALWREQGLRVPPK
                     PKKPFDSNVITPGTLFMERLAVALRRYIRERIRSCPAWRSLVVILSDASVPGEGEHKI
                     AEFIRTQRAQPGYDPETRHVLYGLDADLIMLALATHEPHFFILRERIYFDSRADKAIQ
                     AVKAMNAQQTPAGDRIDHKTGTSAGPGLPLPERPFDFFRIDRLREYLQAEFRDALQHD
                     AVRQPREPLDVEIALDDFVFLCFFVGNDFLPHLPSLEIREGAIDFLLEVYKYKFQRIG
                     HLTDGHGGIHFDRVRELLRDVAHVEDSVFRERARAAGEPPTPVSQHAAVVSGASTAAA
                     RTHTVPEVSAKKESVSASTLSIKADAETPPSPGVHVDELDAGVSAPHRQKRHASEQHQ
                     KRAATEADPGLGLVPLPRKHVKENRATSLRDWKQLEHHRSEAAVSNEIDKIEAESSRI
                     TAAGGDAEQALQAHCEQVLASVAAPVEPSARDDDNDHDDDGVDGTRTAAAAAAESTGD
                     SNRKRADGVRGKRRRIVEEDSEDASPLGHGTRQTSTLSPSASTDQCLACPDDANATDT
                     IRTALGDHSKTSKKSGEGVDASLATGRLAAAEANTAASLETATLPAAAERHQSVTEAS
                     TETLSVPETFGEAPESDDTDDDDNEDDVLDEVLDHYTDAAGRQFEHILRERLKQRQTR
                     PPTEEDPVRFHLPGWRERYYQSKFPHWPPLDTEAGAQALQRLCRAYYEGLLWVYRYYY
                     AGCPSWGWFYPYHYAPLASDLAQCCVDQKDIVFERGAPFTPLEQLMAVLPASSGAQCL
                     PRILYELMINPHSPIIEYYPTDFAIDYNGKRFAWQGVALLPFVDEQRLRLAIQSVLQD
                     GRAADREHDPDKRRMLERADPTRAFGTAILFAHRDSELGLHLARVWTDATLSRIGLKL
                     NRSVGNGVFGRVLPLNETPVGDQHQHEAQRCASDCTPDANDEHQERSVLQGIWTNAKH
                     LPHVPQLLPGSKQPPSVLGDADLQALFAGRAGWKCARFGVLGHAAETWRRKRLAESAQ
                     TPNVPSVDTGMRAALSGTWSSAWPPVPENGTTMTWPWSTGAFPQASASSSSGAETASM
                     QWWQQQQQQQQHAMPAFGAAASALMPQYNPSGFMPSYTAAMNGTIASGSAGYPASQDA
                     ILAAYYGYGNPWMPLDTRTTTTSNQAMSSGSVLPLGYGATVPTYSGWGAPHALGGIQG
                     SLHQAPYASAWQPAVETQTATTRRSRPRRGRRPSTNNGGRQAP"
     gene            <783263..>785188
                     /locus_tag="CYME_CMS303C"
                     /db_xref="GeneID:16997195"
     mRNA            <783263..>785188
                     /locus_tag="CYME_CMS303C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538872.1"
                     /db_xref="GeneID:16997195"
     CDS             783263..785188
                     /locus_tag="CYME_CMS303C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538929.1"
                     /db_xref="GeneID:16997195"
                     /translation="MFTNVATGASERFTQRASSVKAHSEKPRTPLVGRRPRVARSRRP
                     GAAAAAAAASCLQVQHGKRILRLVLVGGGHAHCHVVRALRPQQIGFIGVLISVEEHAL
                     YSGMLPGRIAGQYEKTAVRIDLLQLTHTTSWLFLRGQVVGICHREKCLEVELVASGPY
                     PERIQLYYDVLSIDVGSSTRVPAGLEEVPSQFVQYTRPILDLEAFFETSWGTDVPSRQ
                     VTGSASASQRVLVMGGGAAGAELCFALHRRCQVVGKSAFRIYWLVTEPQPFPAKVQQL
                     VRKLARERGIRLVQVPADARFRLEPNSPCKVQPVHDLSATDALVTEARDSRFVLSWSA
                     DGSALERLACDVLILATGAAAPKWLAEQTDLAVSPDGFVLVQPTLQTLSSADVFAAGD
                     CIAWSEHPEMHLPKAGVYAVRQAPILTENLRCRLVQLIQQHLKEESSRETRNCRLRVY
                     RPQKRYLSILNTADGHGIAFRGQWMAYGRWVWLWKNMLDLLWMAKYPKPASAEIFKAD
                     QHPTLDASHGALQAAVEKSHVEPGSSRQRSLRAQVELALILYFCATADAFPPRNIGDE
                     ALEEQIGDQATRALFESLWQRNEPAEAWHRELSVLTQRLRLRVQYPIGGSGLQITHQQ
                     LTRRNEEPPLNDSGCNR"
     gene            complement(<785520..>786191)
                     /locus_tag="CYME_CMS304C"
                     /db_xref="GeneID:16997215"
     mRNA            complement(<785520..>786191)
                     /locus_tag="CYME_CMS304C"
                     /product="probable ubiquitin conjugating enzyme E2"
                     /transcript_id="XM_005538873.1"
                     /db_xref="GeneID:16997215"
     CDS             complement(785520..786191)
                     /locus_tag="CYME_CMS304C"
                     /codon_start=1
                     /product="probable ubiquitin conjugating enzyme E2"
                     /protein_id="XP_005538930.1"
                     /db_xref="GeneID:16997215"
                     /translation="MSLCENLPPGVITRLFREVQSLRDEPVHGVELLNDSGQDVLTEL
                     HAVITGPEDTPYEAGSFRVKLVLSGEYPYQPPRGYFLTKIFHPNVSEQGDICVNTLKR
                     DWQSSYGIRHVLTVIRCLLIDPNPESALNEEAGRLLLEDYAAFAARARIWTEVHASPR
                     TGGGGAAATREDMAPKSWPASERKTPGTTPGSKHHSSPSGFGLGNQGAMSASMREKRR
                     SLKRL"
     misc_feature    786587..787978
                     /note="possible transcribed region"
     gene            <792338..>792913
                     /locus_tag="CYME_CMS306C"
                     /db_xref="GeneID:16997217"
     mRNA            <792338..>792913
                     /locus_tag="CYME_CMS306C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538874.1"
                     /db_xref="GeneID:16997217"
     CDS             792338..792913
                     /locus_tag="CYME_CMS306C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538931.1"
                     /db_xref="GeneID:16997217"
                     /translation="MDTSLVFSSSADVFGVDVRYTYKVDDKTNFVLRGLANKEKPKPF
                     DHHSGEYIRGCLVHHFRTVPDWPVDVKLIAWAAQGKNQDRWGVKAVAMKTLAVDEDTK
                     AEARLVFSNRPLAENRNSLLYGTLKRTFRIADDEWVGGLQCRTDGRCVLGVRNGMLSV
                     QKVLSQGGPTGEPGEWRAKYSLSGNAPRLFF"
     gene            <794336..>795628
                     /locus_tag="CYME_CMS307C"
                     /db_xref="GeneID:16997218"
     mRNA            <794336..>795628
                     /locus_tag="CYME_CMS307C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538875.1"
                     /db_xref="GeneID:16997218"
     CDS             794336..795628
                     /locus_tag="CYME_CMS307C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538932.1"
                     /db_xref="GeneID:16997218"
                     /translation="MSDRELGLPALMKAHSSLGYLSGGVCLLAGTLVARYARFWRHWY
                     VAHVVLQVTGFLLTLLGFCLTEIWHQGFLVMQDLHAWNGFAFLCLYFGQLWLGMLRPH
                     AASRWRPLWRRAHAAVGVLLVADYIVQLYSGIHRLFRMFNLPNARYFIVWSVALGVFA
                     VSIVLLEPTRWPPSRSVVKHWRLDAQRYAYRTRVLLITITALCAAFLVFLVLLLTNQS
                     FAPWSNDGGMSGMPAMPMHTTFFWYDERGFNLWFSSLVVIGVGRLIAAGILVATLAYT
                     ASFALHVVMRSGSPRGPQPAQTNAPKMSWVARALVHVCLVALHYLLMLAVMTYSVPLL
                     LSILIGHGLGALGSNFWRSSGDTAAFNSDTEEKLLEPSAERYASPKIPDGKQDLRVLL
                     NADCCASSTCCGSKCTCEPGRCFCGIEVCSDKRSSCCT"
     gene            complement(<797695..>798789)
                     /locus_tag="CYME_CMS308C"
                     /db_xref="GeneID:16997228"
     mRNA            complement(<797695..>798789)
                     /locus_tag="CYME_CMS308C"
                     /product="unknown suger epimerase"
                     /transcript_id="XM_005538876.1"
                     /db_xref="GeneID:16997228"
     CDS             complement(797695..798789)
                     /locus_tag="CYME_CMS308C"
                     /codon_start=1
                     /product="unknown suger epimerase"
                     /protein_id="XP_005538933.1"
                     /db_xref="GeneID:16997228"
                     /translation="MPAPHPSQVPDSMKVDGKIRVCVTGAGGFIASHLAKRLKQLGYY
                     VVAADWKENEYMRKEDFCDEFHLVDLREYENCKQISSNCHTVYNLAADMGGMGFIQSN
                     HSVILYNNSLISLHMLEASRVNGVKRFYYASSACVYPEYAQMKEDMQQGLKESDAWPA
                     QPQDAYGLEKLMSEQLCMHYRKDFGIETRIGRFHNVYGPQGTWQGGREKAPAAFCRKV
                     IASDGEFEMWGDGKQTRSFLYIDDAVEAVIRLTDSDFAEPLNIGSEEMISMNDMAELI
                     MTFENKKLKIKHIPGPEGVRGRNSNNDLCRKVLGWEPQIPLAEGLRRTYLWIKEQIEE
                     ERKNGVVRDYAKSVIVPTHAPSESKAARRK"
     gene            <799318..>799749
                     /locus_tag="CYME_CMS309C"
                     /db_xref="GeneID:16997229"
     mRNA            <799318..>799749
                     /locus_tag="CYME_CMS309C"
                     /product="similar to microsomal glutathione S-transferase"
                     /transcript_id="XM_005538877.1"
                     /db_xref="GeneID:16997229"
     CDS             799318..799749
                     /locus_tag="CYME_CMS309C"
                     /codon_start=1
                     /product="similar to microsomal glutathione S-transferase"
                     /protein_id="XP_005538934.1"
                     /db_xref="GeneID:16997229"
                     /translation="MFENSNLVLPPYYGYVLLDLVGVFMEQMYFSVQVMRARRRYNVP
                     YPNQFEQKTEGVSRFNCIQRAHMQFMETCIFFVPALLFAGLEHPREAAAFGLIFLIGR
                     LVFFHGYASGDPQKRLRGAFYVIGVLGNLALCVRSALKHLA"
     misc_feature    complement(799666..801264)
                     /note="possible transcribed region"
     gene            <802258..>803027
                     /locus_tag="CYME_CMS311C"
                     /db_xref="GeneID:16997231"
     mRNA            join(<802258..802562,802679..>803027)
                     /locus_tag="CYME_CMS311C"
                     /product="similar to bacterioferritin comigratory protein"
                     /transcript_id="XM_005538878.1"
                     /db_xref="GeneID:16997231"
     CDS             join(802258..802562,802679..803027)
                     /locus_tag="CYME_CMS311C"
                     /codon_start=1
                     /product="similar to bacterioferritin comigratory protein"
                     /protein_id="XP_005538935.1"
                     /db_xref="GeneID:16997231"
                     /translation="MFISSTPCVRGSVRSLSVHSLSRQLGTRYFVQSKHQSRVRLRTC
                     VIPTGPGSLQRTVWCMELQVGDAAPDFQMPTDQGGQVSLKDFRGRPVVLYFYPKANTP
                     GCTTQACDLRDNIEDLNKVDAVVIGVSRDPVADLAKFRKDHGLNFYLASDADGSVTEA
                     YGVWKLRKMMGREFMGIERSTFIIQDGVIRKLWRGVKAPEHIAWVKRSLEEMKAGAK"
     gene            <803850..>805256
                     /locus_tag="CYME_CMS312C"
                     /db_xref="GeneID:16997232"
     mRNA            <803850..>805256
                     /locus_tag="CYME_CMS312C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538879.1"
                     /db_xref="GeneID:16997232"
     CDS             803850..805256
                     /locus_tag="CYME_CMS312C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538936.1"
                     /db_xref="GeneID:16997232"
                     /translation="MCERRSSCVRVLPRRLLVLLWCFVYLCDALQPAESEKVDSKALF
                     DQVGTTLVSIERVQRNHLRTEYGSVLQHCKVTLKTLDNFCRRSYVACNQTRTCAEQLE
                     PWKARVHDLSVNLERLTSERIREREAHAVRVRELEAKLSAARQTTVNSIDEQRLMRTS
                     GTAALFGNKWMPTVGNRLHLPAVLLLVSFGYLLCVFVGRASSWLRYQRSCAVVGHFRA
                     RNSTRFDAAFRWVRAVDLLCAGLFLMAVFFPGPIARTMMESERSLPLWSSLCYWAQCI
                     ACVSGTSLNAFVLFSVFWRARSVGALSAFISLCLVRSIHLVASVSVLYHSSFHWRMPA
                     TTGLFNTTVEAAHSYDMMTHRLRIYFLTYGFIFMLMAWDTHQQLTDHAPLRAAVLTVE
                     RVRRLSKSRRPRAAPEKALCYRSLVSSPRRGMQPSLESGSSRSFSTLESGDWKTPPLR
                     RVVAEKRTCARTVVSTPD"
     gene            complement(804150..806466)
                     /locus_tag="CYME_CMS313T"
                     /db_xref="GeneID:16997233"
     misc_RNA        complement(804150..806466)
                     /locus_tag="CYME_CMS313T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461667.1"
                     /db_xref="GeneID:16997233"
     misc_feature    complement(807000..808231)
                     /note="possible transcribed region"
     gene            <807301..>808367
                     /locus_tag="CYME_CMS315C"
                     /db_xref="GeneID:16997478"
     mRNA            join(<807301..807777,808023..>808367)
                     /locus_tag="CYME_CMS315C"
                     /product="similar to electron-transfer-flavoprotein, beta
                     polypeptide, mitochondrial precursor"
                     /transcript_id="XM_005538880.1"
                     /db_xref="GeneID:16997478"
     CDS             join(807301..807777,808023..808367)
                     /locus_tag="CYME_CMS315C"
                     /codon_start=1
                     /product="similar to electron-transfer-flavoprotein, beta
                     polypeptide, mitochondrial precursor"
                     /protein_id="XP_005538937.1"
                     /db_xref="GeneID:16997478"
                     /translation="MPPPCFRVLVGVKRVVDYAVKVRITPDHSGVDTANLKTSMNPFC
                     ELAVEAAVQLRERLGPERVPEIVAASVGPTACQETLRTALAMGVDRAVLVNTDAAPVS
                     DSKAGSALQPEPLDVARTLAALQSRLQSNLILLGKQAIDDDSNQTGQLLAGILNWSQG
                     TFLSKIEAEKEQDLLQVDREVDEGIERLRLRLPSVLTCDLRLNKPRYITLPNLMRAKT
                     KPIETLSTSDLGVALRTYWQIVRVDEPPARRQVTMLKTVDELVAKLQQLGVLDRA"
     gene            <809625..>811034
                     /locus_tag="CYME_CMS316C"
                     /db_xref="GeneID:16997239"
     mRNA            <809625..>811034
                     /locus_tag="CYME_CMS316C"
                     /product="similar to rotamase/parvulin-type
                     peptidyl-prolyl cis-trans isomerase"
                     /transcript_id="XM_005538881.1"
                     /db_xref="GeneID:16997239"
     CDS             809625..811034
                     /locus_tag="CYME_CMS316C"
                     /codon_start=1
                     /product="similar to rotamase/parvulin-type
                     peptidyl-prolyl cis-trans isomerase"
                     /protein_id="XP_005538938.1"
                     /db_xref="GeneID:16997239"
                     /translation="MRKMLRFGSDFSELRTPSPEYEHASSQEAKLRQSVHELYASVSC
                     HPLQQLPNFIPPAAKKHLPHSPYKRPVSNTARRQGSSDRTISSIPWACSRWGRRRPVH
                     RTCVREHSRSASGTRIRNRFPPRCRSTTRSERLTRTSSIFLGLFRYQRMSKHLNRGLR
                     QASLVAYLVPLTQQLWRGRSARCLSCSTRFAYSDLTPNRYSKSLYGLDGRQQFRRKLS
                     AAQRDRELRNESARMTADGAQQQERVPAASRQAVTFIRARHILLESQQMANTILERVQ
                     LAEPGPARTQLFASLAQTLSTCETRTRGGDLGWFRRGQMVPAFEEACLAAEANVPFKV
                     RTEFGWHVVEVLEFGHQRGVISVKEFAELYQNSERRKLYQLIDVREPGELEIVQLEGF
                     MNLPLNEYSRWRHLVEGSETQPPVLDRNRPIVVMCHHGIRSATMCAYLCQQGFSNVLN
                     LLGGIDAYAAEIDQGLRRY"
     gene            complement(<811464..>813956)
                     /locus_tag="CYME_CMS317C"
                     /db_xref="GeneID:16997240"
     mRNA            complement(<811464..>813956)
                     /locus_tag="CYME_CMS317C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538882.1"
                     /db_xref="GeneID:16997240"
     CDS             complement(811464..813956)
                     /locus_tag="CYME_CMS317C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538939.1"
                     /db_xref="GeneID:16997240"
                     /translation="MSFMGPDFDGVVQTLEAYRTNEKENEPGASPGVGFSGNTQKQNR
                     GEPLNLLLAPPLQERSEALAQLARGLESSIPESLHDQEIFLVLLAEHGPEQIGNPSRL
                     GICMQPLTCAGLGFQRELFPQRRDLTGFPTLDSIRRQLVTMHYVPYLLDSAGRLQHYR
                     TAVQREHRPVVASQIALVAALLLEAGLKQALGIAAALLERAEAQDRRITELEHECTEA
                     SVERVFREQLCSGSESITDSADLERMTTAALALHTGAPKVPEKDQSTSEGSNCSTRVD
                     GFRIKQLLRPPAVSRDAKPDPSALDGSTDQEFITAIMKDLDDVHPLSNCEKENGQDAS
                     HWTNSFHADAEICDQVGDSARSQPSSGGIPEAHTLDAAKGTKDATQIPTTSLQHASIG
                     CLQAMSTPRADTDESLGQPHKAALAHASAGALAAWPPVSVQEETSSIDATEAQTQALY
                     KQIHNLQEALITSRRQYVELREQLVDKMKEVREIAQVLGEYRASRESLNERESAMSRL
                     LSSMEAHCEQQQKIIRMLQSSYVEAEMRAQQVDTLRAANEELSTHLLCMQARFLERDE
                     RIAELEKALWTTRQRVGKAVPVDPDGSNSFVTDQSSSRSESADAPDLSQSNSRDWPAV
                     CTHRSIRRGHNRPELLPSVESRHQLPLLGKQDHEQHVRVLPPMWLLFYISWAFYANHY
                     YSLWLRLQQCLVREAQQRTKATKCIVALSRQRTGLVERLERLSWEAKAAEYKNAQLHA
                     QLHEHKAQLYRVKRLHQQSLWHWLGRLAPSCVSDAKPSRIPPRELHILRSMSASAPCE
                     AHASTDGLASKARHVRPCRYRSRHARASGSER"
     misc_feature    814231..816060
                     /note="possible transcribed region"
     gene            complement(<816891..>818486)
                     /locus_tag="CYME_CMS319C"
                     /db_xref="GeneID:16997235"
     mRNA            complement(<816891..>818486)
                     /locus_tag="CYME_CMS319C"
                     /product="cytochrome P450, family 51"
                     /transcript_id="XM_005538883.1"
                     /db_xref="GeneID:16997235"
     CDS             complement(816891..818486)
                     /locus_tag="CYME_CMS319C"
                     /codon_start=1
                     /product="cytochrome P450, family 51"
                     /protein_id="XP_005538940.1"
                     /db_xref="GeneID:16997235"
                     /translation="MGTILAALANQFQALLARARDGDTDAIGWLALGVAALVWLMTRA
                     AQALATLLSPAKPAEGLELAYPPLYTEGFPVVGNVAAFARNPLQLAKRAYAQLGDVFT
                     LRVGPKRFTFLVGPRAHEVFFRANDDELDQGPVYGFSVPVFGRGVVYDAPLAIRLEQF
                     RFVSTALRAARLREYVPLMVAEAETYFKRHWHGTDGTADLLKSLSELIILTASRCLMG
                     REVREQLFEEVSTLYHQLDQGMQPLSVFAPHFPCKAHWQRDRARREMRRLFASIIANR
                     RKRYQEIAAQAESVGQDPQQALEAAKEVDVLQVFMDSQYRDGSRLTDDQITGLLIAVL
                     FAGQHTSTITGTWTGLLMLRKPELVTRVRAEQEQVLYDDDGCFKIDYDALLRLDVMHR
                     CIKEALRMYPPLIFLMREVVIPRTYRDYVIPKGDIVVVSPPLAMSLPEVFADPDRYDP
                     DRYAPPREEDKRVPFSHIGFGGGRHACMGEQFAYLQIKTIWSVILRDYDLEPVGPLPL
                     PDYSAMVVGPKPPCLVRWRRRTP"
     gene            complement(<820985..>822733)
                     /locus_tag="CYME_CMS320C"
                     /db_xref="GeneID:16997236"
     mRNA            complement(<820985..>822733)
                     /locus_tag="CYME_CMS320C"
                     /product="similar to inositol 1,3,4-trisphosphate
                     5/6-kinase"
                     /transcript_id="XM_005538884.1"
                     /db_xref="GeneID:16997236"
     CDS             complement(820985..822733)
                     /locus_tag="CYME_CMS320C"
                     /codon_start=1
                     /product="similar to inositol 1,3,4-trisphosphate
                     5/6-kinase"
                     /protein_id="XP_005538941.1"
                     /db_xref="GeneID:16997236"
                     /translation="MPATTGLSRRREGASAEARRARTSLERCRTGRERPDLVKRTPDE
                     DGKSENADTSPQAAVPGAEAIKPATLLPSQASKTEGHMRTCLVRTEGVQAPIVVAYTC
                     NTKKQKPFFDVLQQLALCEEERFQTSAEANANTEYQRAFLRPILLVEMDLEEGPYALE
                     NNQKKQREPLAYCPECWDMVIHKRTDDMVMAQRGDKNAQRRLAALERSFKAFAVQKRI
                     RGRRPVIVDPVDAVWTLTDRTLFSSVLDHLLASEQAADEHGTLAGASGILDGHSSVIR
                     LTKWCAGSADRGARTFSRAASEAFTRQQRTTLNARFGNGGAAGPAGCEQGPVSGGLTD
                     PATNPCPETASRRDADLDIEGSFYETKWGTIEFQRAIPWLQACRLAKMHFPLVVKRRT
                     ACGPRSSHDIALVYDEDGLERLLTSEPASRHHRDSNASRLFAGDEVYLQEYVPHGEAV
                     FKIYVLGSDKQVSIHARSTLPIPRGTDRGYRILNTYDFGKCAVSEPQIRATDRIATDG
                     GYPEPPTPADAACLVRLVMQNLHVTLFGLDVLRSVVDGALYVVDLNYFPSFKDVPDAH
                     HGLLTYLRELYLNSTG"
     gene            <824758..>825699
                     /locus_tag="CYME_CMS321C"
                     /db_xref="GeneID:16997237"
     mRNA            <824758..>825699
                     /locus_tag="CYME_CMS321C"
                     /product="probable non-canonical ubiquitin conjugating
                     enzyme"
                     /transcript_id="XM_005538885.1"
                     /db_xref="GeneID:16997237"
     CDS             824758..825699
                     /locus_tag="CYME_CMS321C"
                     /codon_start=1
                     /product="probable non-canonical ubiquitin conjugating
                     enzyme"
                     /protein_id="XP_005538942.1"
                     /db_xref="GeneID:16997237"
                     /translation="MKRSDNGKRPAVSASAKRIMQELAELAREPSTLFEVRALDDDLF
                     EVHFTIRGPADSPFEEGLYHGRILLPPEYPYKPPEIMLLTPNGRFETGKRICLSVTQH
                     HVETWQPSWGIRTILTALIGFMPTRGDGAVGALDFTEEERRQLACASRRWSCARCGMD
                     HSSWKSSASTSAEAHRVSSEETSNEGYVGNLPGTDGHESRCISHEPAASPGTEPIASA
                     MPTTPAAPEELPEASTSWHHEKEAQASGSQLMLPAMQVPETARHSSASDCSSTEKSMP
                     HDSRTTATTETMLESVDRLLTYVIIALVCALTTVWFL"
     gene            complement(824913..826999)
                     /locus_tag="CYME_CMS322T"
                     /db_xref="GeneID:16997238"
     misc_RNA        complement(824913..826999)
                     /locus_tag="CYME_CMS322T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461668.1"
                     /db_xref="GeneID:16997238"
     gene            <827196..>830243
                     /locus_tag="CYME_CMS323C"
                     /db_xref="GeneID:16997281"
     mRNA            <827196..>830243
                     /locus_tag="CYME_CMS323C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538886.1"
                     /db_xref="GeneID:16997281"
     CDS             827196..830243
                     /locus_tag="CYME_CMS323C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538943.1"
                     /db_xref="GeneID:16997281"
                     /translation="MNTTKESAAGRRQSWNLHHSRRKRSSTASLLESREYTDTNHFSK
                     QTAWTAEQLHRKGFRRHSYDVPTPPCIFRRFTPNGRFLLALDRNGTDLLVFPYVHWSS
                     SVPFSTQLKGADCCSAEDPANKVNLSESGGSASFSDFFREPLRISVVNAYTTGFLAYN
                     RARAFGMDTPLEAEWDPTGVYLRDLLLCTPCGRFVLLGAWRAPSTPALTHRGESLRTG
                     SQITAAVSENSHSNRERSSTDSHMESATTGSGQRGSFRRLAARHVADSSSPASLAGCP
                     VVPSVYLFLVDMELQRVVDVFMLRNDLVLLDGNSGVQLFDADLVAVTSMAHQAVHLLR
                     IRQGIGGLNQQCGCFQYLTSFGPHCFSDDALLIAKQYRRERDFRRQGRRVFALQLRDL
                     LQTENSSAESEPLDDVPVQPSEANNDASAAGACILPSHPQETSVLPVGMQKEPVGGIV
                     ESGIPQRRCRRQRPQSDDNSEREASPFVMPCTSAAAVAGTAMAAAACRMAYRPQEKEC
                     FITGLKQRLLTFLYRSYTQGKPCSYYERFAASFESLQSFVIQRAALISKKHFLVRMVP
                     ARLALKHFLGRTACSLFHQPWYVSGVAVTGLVDSDLALLHAAEAHSTADSEQIPASAE
                     PGSYRQQLQHLLHAPCPVLADNIVASKRRQDALSALVAQLRTTFYVIYDYLSTQIEAV
                     FSPGSVEFLALARHHPEWFGLRSGVPLYRIESAVERLEELKLVCGAVYCPVCHREHRC
                     GSVAARNTPRNMAHGTDERAALVKAEIALLSAGAPLDTSQRHERWSMAVKPEAGAGET
                     SSTGKRADTRAVTGNCTTLGQDLTERGPVMDVAHLYREPLLTMFLLLPLPCQPAIFSP
                     WLNRRFFSYDESKLWSRDLFHPAVCDEYPMVRVFHRVRGTLSWRIYPAAKNERERLSA
                     RPFVQQQQQQQQQQRLEASRTHTPVEGARTSTTHAGAPDHSQRTVTDTMLQATVSYLP
                     DAEAEPRSRVRQYASYIFHPQDAFCLSILWSSERAPVVNLHYA"
     gene            complement(<830801..>831331)
                     /locus_tag="CYME_CMS324C"
                     /db_xref="GeneID:16997282"
     mRNA            complement(<830801..>831331)
                     /locus_tag="CYME_CMS324C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538887.1"
                     /db_xref="GeneID:16997282"
     CDS             complement(830801..831331)
                     /locus_tag="CYME_CMS324C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538944.1"
                     /db_xref="GeneID:16997282"
                     /translation="MQVYNFYLFSRHGTCLYYREWQRTRPGSDTQQEQQNLIGLLFAV
                     KQLCRSLAPANDDSLPIDTATRYMPRGPSNFCSYSTEKYQLHCFESSTGLRFVLTTSP
                     TASDLTRILQRVYREAYVECAIRNPLYTLGTSIVSESFRKRLDSVIRTLAVESTVFRP
                     ASEKALRGNGSPATKS"
     gene            complement(832770..835479)
                     /locus_tag="CYME_CMS325T"
                     /db_xref="GeneID:16997283"
     misc_RNA        complement(832770..835479)
                     /locus_tag="CYME_CMS325T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461669.1"
                     /db_xref="GeneID:16997283"
     gene            <835594..>836406
                     /locus_tag="CYME_CMS326C"
                     /db_xref="GeneID:16997284"
     mRNA            <835594..>836406
                     /locus_tag="CYME_CMS326C"
                     /product="arogenate/prephenate dehydrogenase"
                     /transcript_id="XM_005538888.1"
                     /db_xref="GeneID:16997284"
     CDS             835594..836406
                     /locus_tag="CYME_CMS326C"
                     /codon_start=1
                     /product="arogenate/prephenate dehydrogenase"
                     /protein_id="XP_005538945.1"
                     /db_xref="GeneID:16997284"
                     /translation="MDQVNSSNSLTIAIVGFGNFGQFLAKAFVQAGHRVIGHSRTNYE
                     AIARQLGCGFETSADALMDLHNPDIVVLSTSILSTEEVLRRFPTAKLRSCLVVDVLSV
                     KVYARELMLRYAPEEADILATHPMFGPESGRGSWRGLPFVFERTRVRQHERCEAFLSI
                     FRERGCTLIEMPCQEHDHYAASTQFITHTTGRMLAELKIASTPINTRGFEALLAVVET
                     TVRDSFDLYYGLYRFNPNAKQELEKMQRALEQVRAQLEAYDRKCREAEARSA"
     gene            complement(<837375..>838553)
                     /locus_tag="CYME_CMS327C"
                     /db_xref="GeneID:16997285"
     mRNA            complement(<837375..>838553)
                     /locus_tag="CYME_CMS327C"
                     /product="pyruvate dehydrogenase E1 beta subunit,
                     mitochondrial precursor"
                     /transcript_id="XM_005538889.1"
                     /db_xref="GeneID:16997285"
     CDS             complement(837375..838553)
                     /locus_tag="CYME_CMS327C"
                     /codon_start=1
                     /product="pyruvate dehydrogenase E1 beta subunit,
                     mitochondrial precursor"
                     /protein_id="XP_005538946.1"
                     /db_xref="GeneID:16997285"
                     /translation="MVATQFITRFGRANTLIHRSPLGQTVRRWASTGGDVEVTVREAL
                     NTALDQAMERDPRVVILGEEVAQYQGAYKVTKGLLEKYGTERVIDTPITEQGFAGLGV
                     GAAFTATRGSEPRGGALRPVVEFMTWNFAMQAIDQIVNSAAKTHYMSGGRIKVPIVFR
                     GPNGAAAGVAGQHSQCYAAWYGHVPGLKVVMPFDAEDAKGLLTAAILDDNPVCVLEDE
                     IMYGRSFKVSEQVMKPDFVVPLGKAKVARSGSDCTVVALGRYVGLALQAAEELQAEDG
                     IQVEVINLRTIRPIDDQTIIESVMHTHRCVTVEGGFPQSGVGAEICARILESPAFDYL
                     DAPCERVTGADVVMPYAKNLEERALPSVDDVKRAVRRQCSRPGLEAAANRAAVLAGQS
                     "
     gene            <839016..>840014
                     /locus_tag="CYME_CMS328C"
                     /db_xref="GeneID:16997271"
     mRNA            <839016..>840014
                     /locus_tag="CYME_CMS328C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538890.1"
                     /db_xref="GeneID:16997271"
     CDS             839016..840014
                     /locus_tag="CYME_CMS328C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538947.1"
                     /db_xref="GeneID:16997271"
                     /translation="MYVLVGWVGSISSKSRTRRFQGGGYDYLCFELQSRCVARSRGRQ
                     RAPCQRATARAPWLMTGGTASSGKPEPSDEREGKSSSEPPAPKYRAEELLAWLESADP
                     TTRLRAVLACRHLTAVEAAPVLEKAVRINEPEVQNRSFAALALGYLPNERSYELLSGI
                     LRNDISGEVRSSAAAALGYLGERRAVPELRIALLEDFHWSTRISAAVSLGLLQDERAF
                     DALVDGLRLARRYRREEGNALKRACLGSLGELGMPQAVSHLVFYAQERDFLTRQVLAE
                     ALGRLLHRTRRLEADRMTQRQLQLARECLEYLARDDHENVRRAAQLALANLSVVSD"
     gene            <841928..>843175
                     /locus_tag="CYME_CMS329C"
                     /db_xref="GeneID:16997272"
     mRNA            <841928..>843175
                     /locus_tag="CYME_CMS329C"
                     /product="similar to 3-beta hydroxysterioid
                     dehydrogenase/isomerase family"
                     /transcript_id="XM_005538891.1"
                     /db_xref="GeneID:16997272"
     CDS             841928..843175
                     /locus_tag="CYME_CMS329C"
                     /codon_start=1
                     /product="similar to 3-beta hydroxysterioid
                     dehydrogenase/isomerase family"
                     /protein_id="XP_005538948.1"
                     /db_xref="GeneID:16997272"
                     /translation="MARGTRKVNSSSKTGSSSVGNAGPGTRVAVVIGGAGFTGQYLVR
                     RLLQGLEKPFCEPYGEVRIVDTLQPSADVAGDARVHYFQGAVGAGTDDFLREAFAGAT
                     SCFYVASTDSRTLSRSRAWRTNVYGAMQCLEFAQCSGLKAFVYTSSHNVVCDFRTPIR
                     GADEVTSRIPSRHCDVYSASKAAAEQLILARDTPGQLRVCAIRPVGIYGPGEQVHFNR
                     LFQLSRYLGMHWIETVPHDPFCMDWVHVESVADALLLGAAALMDPERQPLVAGKAFFV
                     TDDGGPTSVQRVFDPVLEAAGIRLPKQRFRVHWRLLYVFALMCELVAWVLDDKPLLMR
                     MEIRKAHIAHTFRTDAARQALGYAPRYTTAAGIQAWAELVRKQLAGRVLETDPIEIRR
                     LCRQVASISSIFIIVTAVAASVA"
     gene            complement(<843291..>845981)
                     /locus_tag="CYME_CMS330C"
                     /db_xref="GeneID:16997273"
     mRNA            complement(<843291..>845981)
                     /locus_tag="CYME_CMS330C"
                     /product="probable metal-transporting ATPase"
                     /transcript_id="XM_005538892.1"
                     /db_xref="GeneID:16997273"
     CDS             complement(843291..845981)
                     /locus_tag="CYME_CMS330C"
                     /codon_start=1
                     /product="probable metal-transporting ATPase"
                     /protein_id="XP_005538949.1"
                     /db_xref="GeneID:16997273"
                     /translation="MSTWAFQVKWVPISRLHCGWELDRRRFRGCHPFHQRRTRLDGEH
                     ATAATKLSRRRGAVTIRYAVQCHNDSEPTKKRHALESSGTRSATASPRSSEAQAYAAP
                     CCGAQDAVGAGSRTTGLLRVLGPLQPTFERLVGWRDSLQLQGLSAGLWCAACTLTLLQ
                     HALPRVTQRAAIYFSWIFMQRAFVLACLVLSGLPSLLEMLWTLLSKPSLSVDVLMNLA
                     ALLLLAVGHLLEGTLLFVLFSVSRAAEGAIRARARRDLDALRDSVPEYAWRLRRASDT
                     DTPLELVAENGTLNTVDAHQVPVTELTPGDLILVKAGEVVPCDCQIARGDAYVSLEPI
                     TGESVPRRVRDGELIAAGARTVDGSLYLRVQRPVHESAVARIARLVTNAQQNKPTLER
                     WIDRFGQLYSRFVVTGALLVFIVAGLTPVRTPKHSGHGVRAVAPQEQPVRWRAQRQAF
                     ERALGFMVVASPCALIIGAPVAYTSALGVLARRGVLVKGGARTLEASARCDKVAFDKT
                     GTLTKGEPELHQIQVFRVPRQSAVTVASMAATGDAATDTSTASEDLPYRWDLRAEHPP
                     AEHASAIARVLALAAGLEAHVVHPLGRAVAASVAELGIEPLLVHDVKVCAGAGLEGRI
                     FQAPHSESEVTSNGGGSDQHLDAASADALSHRVRLGRLDFAATLLEHENAPQSPTPTT
                     RELDQKLEAYQREQAALGRSTALLCCEDGTVAMLVFWDQMREEAPACIAQLRTQGYSV
                     QLLTGDSKETALAIAEAVGVPADCVRYALRPEDKMLFVKQQPDRLVMVGDGMNDAPAL
                     ALATTGISIGFHSATAVSAADVVLVDGYPEGIRRIAWYLQKSRQTQRVMTQNVAIALI
                     LIVSTAIGAVSGGLPLWAAVLLHEGGTLLVGLSGLRLLMD"
     gene            complement(<848367..>851618)
                     /locus_tag="CYME_CMS331C"
                     /db_xref="GeneID:16997267"
     mRNA            complement(<848367..>851618)
                     /locus_tag="CYME_CMS331C"
                     /product="similar to inner centromere protein"
                     /transcript_id="XM_005538893.1"
                     /db_xref="GeneID:16997267"
     CDS             complement(848367..851618)
                     /locus_tag="CYME_CMS331C"
                     /codon_start=1
                     /product="similar to inner centromere protein"
                     /protein_id="XP_005538950.1"
                     /db_xref="GeneID:16997267"
                     /translation="MRPRRKAAREAERNITGVLKGGDNIQEEQYGSRSRKVDGQLRRS
                     ARTRRTNQEAAASSSSESSSEHSSVVSSRARWRLPATSRSSSSDEASEPTESEVSTPE
                     EDSEEAATWSPGQRRKRVKESASISTEPRQSLIYTSGLRKLENISMHELDERSLEGLE
                     PSAMWQLPATWRLLQVFSKRLGIPDVTPMELEHALETPQYAPILAEIMASLAGYRTGS
                     GTRTEHDGSRAVAALQRADWVQRADALWFPQFVRFFQQHLAEMINLGLYPEERSTSTE
                     SADAASIMDALEAGGWEAFLQLRASQRLLILYALCEFVLCSPNEDNRYLKDLRQLHHD
                     DLRILPVGIDRNGALYWYFDDNCRLYRELLDDTETSALKSTKGRRRGAKPSPHYEWCV
                     AAQGPDALRDLIETLDDARPRSRERALRQWLKQELLPVWEEHSRKLERLQRRRERLER
                     LLATKRTSSRVQELELARQREEELRKQREEEAKELERQRRREELERRRELERIERLAK
                     RQRAEIERALRAAERERAEAEAQLQRRERTSSRLQERENGVAEEQTMAATKSSSSVND
                     DAMVLEEHIPPEMNLPATDASSSHHNAADATNTESALPQRLLTWFRILDECTGEHACL
                     DALELEQTSAKRNTGGGPGALETPNSLVAEGLLIPGAGPGSVKLRPTMIRTSRILEWC
                     IDYGEVCIWIRTARAWYKLVTPHPSHEPYFATTRRKFELSIRVSILCASFPNSKACSF
                     RNLSKLLVLPYGEMRGYAPEEVIAEARFLLNQAEMLGRPEMRDNAFMRRLRRETEAAA
                     LRERARQLRSQQRAAQKRHRVASWAPALPFVSEGPHSQQQPRILIRFDTRATGDGETR
                     VRTPQDSEARNRVDGSVAIRPERPSWSVAASYGPGLFFSKTPKDLYASQTAACAPGKR
                     PSRRRHWWVAASYGPGIWWLRVRRPRRRPVDQAASVAEVTAAPPAFAAEHVERYPRES
                     AIRATANLVTETPAAGDCVGVGDGVAAPNFTNAPAATFGWNIAGYEYEPDQRSVASTH
                     CATSAVRQLHPSAAEQDTTSPAHSDRENAPTLRETSSPGASPSLFSSERRSMH"
     gene            <852401..>852988
                     /locus_tag="CYME_CMS332C"
                     /db_xref="GeneID:16997268"
     mRNA            <852401..>852988
                     /locus_tag="CYME_CMS332C"
                     /product="V-type ATPase V0 subunit c"
                     /transcript_id="XM_005538894.1"
                     /db_xref="GeneID:16997268"
     CDS             852401..852988
                     /locus_tag="CYME_CMS332C"
                     /codon_start=1
                     /product="V-type ATPase V0 subunit c"
                     /protein_id="XP_005538951.1"
                     /db_xref="GeneID:16997268"
                     /translation="MQPNGAAPLNCLWRWVLPECWGPLGILFEQISPYWFAYVGVALA
                     IGLSVLGAAWGIFITGSSLVGASIQAPRITSKNLVSVIFCEAVAIYGIIAAIVMATRI
                     GYASVAESDPVTKFGGYALFAAGLVVGLSNLFCGLSVGVTGSSCALADAQDATIFVKL
                     LIVEIFASALGLFGVIVGIIISSKATLGGDASAGR"
     gene            complement(<854815..>856482)
                     /locus_tag="CYME_CMS333C"
                     /db_xref="GeneID:16997269"
     mRNA            complement(<854815..>856482)
                     /locus_tag="CYME_CMS333C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538895.1"
                     /db_xref="GeneID:16997269"
     CDS             complement(854815..856482)
                     /locus_tag="CYME_CMS333C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538952.1"
                     /db_xref="GeneID:16997269"
                     /translation="MSVRAPRSNQNNLRCGFTQVTLAWRSCRRASFQQGFFHGHALHS
                     GGVEAWLPARALLRRRQTDLNDLKLQQRVRRVPRFVRVLKRKSTCRFRWFASAGKDAA
                     DNTSERQSSEPSAGAASFAQPAASLDGIDRSVSQQARGFFSSIAVVMHQLRQMALRLW
                     TALCVLVTLRGPILRRYFAEYAWFMLVLGVRLLVLMMTALLSPIIYVWVRLFPRYKAG
                     VLWTEPHWPRRVCFLGGAASPFLQEMARVICMEAMRERSEQSNESKPQHSNICISWVD
                     CHLAALEEARAVCTEVAPGLHFRLLHLTDLDMQSSGTRHAVLALREELGTFDLVVIAP
                     ALSSMTGASAMTSFSTLGKLDEQPRLERGSRLDTICTATELCYRRVVLAGSIATDLIN
                     TNGQIIYITGTTKRFGTASESDVWIEHAWNAARMHARDARRFDRAVSGRVAVITAPAA
                     YVLDRHGALADTYTRSMMDTSPKSEPVSTAIADAPPNAALDAPLRAVVAKLARYGISR
                     VLLGEAEVVVPFRSAVLLLWQEALPCLVFETFSAFHRGASEAPPSNA"
     gene            <856617..>859943
                     /locus_tag="CYME_CMS334C"
                     /db_xref="GeneID:16997270"
     mRNA            <856617..>859943
                     /locus_tag="CYME_CMS334C"
                     /product="similar to regulator of nonsense transcripts"
                     /transcript_id="XM_005538896.1"
                     /db_xref="GeneID:16997270"
     CDS             856617..859943
                     /locus_tag="CYME_CMS334C"
                     /codon_start=1
                     /product="similar to regulator of nonsense transcripts"
                     /protein_id="XP_005538953.1"
                     /db_xref="GeneID:16997270"
                     /translation="MPQGSLLSSSSAASAGTSVTAHREPTRWRRRWQRQASDNETEHH
                     VNLELQLPEPPSPEAAEAQLVATLLQSWERSLQRPVPESSDDEPAWVQTDFACVHHYR
                     EYWIRRIENEWVAAVAESAALRVEVNAWAVTIASVEPTCTDYADRAVLQWAAGVDPPP
                     DLDSQDVYFLQVERGRNAASGAGPIVPALRLTRLGFASCSGNVHEFSVWIPRNCLHMQ
                     QRTGTVARLWRAFSDEREWRTGLVPFVRQLQAVTRLGQIHRPLLYALIRPQEHFSSGR
                     NVPPNALPGFQTRKQQQQQQQQQERYANIREMNSGGSVKPDFSLGLLNDGQMRAITRI
                     VEARPGSVTLIVGPPGTGKSRTIIGALRRLTGETPAPRLLVCAPSNHAVRLLYEQFRS
                     QSDTTRPVGIAWLQAQSQRQEHANNAPNSNNDGQIGIEWNALVHDVPIRNADVVFATL
                     NSAAGLGFQGTGRMRERPFQYVIVDEASQAVEPDTLIPLILESFCPTNFPHGDRMEPE
                     TIAPSRLVLVGDARQLPATVRSRLNQASGYDKSLFERLSEAAERVHGAALCWLDEQYR
                     MHPSIAAFPSHFFYGDRLRTACQVCERLRGVDSPIELLDMSGDAEHREIRVATSLANP
                     YEAARLVRWLAENQPKLVGSRKDPLTVLLITPYRAQVRFLEEALQEFHLWTPAAAASS
                     QPTRSRQEYRVATVDAAQGAEADLVIFSPVRSARHGVSACTTPRALSIGFVADTRRLN
                     VALTRARSQLVVGGDLLTLVRASPVFAAWITFLCERKLVPNPEALWERLCEGLEHPPN
                     ERTTLVDTSDPVASGFADASEAAKARKPDVVARQNRRNEAACAPIYPCKICRQASTRI
                     SAAVARKQTLGSLQEPRSTRHSPTAGLPPAVASISCAKMKRTQKDARIAAARAEAATA
                     RIIHSDDDASSDAGSLPTRGGRAAQLLRRHRTNGGGYATTRPQPVHKGVDRRWRSSSD
                     AIAGTNADHFTKRIRAARPAPSSVPGLTGGSAPSAAALATVFESPWPRERVSAEQQRQ
                     LDRVSSVQRFALGGATTTPVTLAVGDRFREPSLHTGSVARNSTAVQRIASRLAERAKD
                     TLENVRRSAIFDKEGSGDAR"
     gene            complement(<860700..>863396)
                     /locus_tag="CYME_CMS335C"
                     /db_xref="GeneID:16997259"
     mRNA            complement(<860700..>863396)
                     /locus_tag="CYME_CMS335C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538897.1"
                     /db_xref="GeneID:16997259"
     CDS             complement(860700..863396)
                     /locus_tag="CYME_CMS335C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538954.1"
                     /db_xref="GeneID:16997259"
                     /translation="MHTGAVGTMELASVSDVFSYTLQKTLRELGETRTLRGKGPVLNT
                     LKNLLIGNTERKAWVVESGALAKLLAYCAEDAVRMDSSVKEALLALLGTLCYGDCPPA
                     EAEISQQQRLPRFIADSLQQSSPNALKVAALRTMRQFTAARLRVGCDRARFAWRSADA
                     EALLRCVQQDQGLVRLEALKTIAVWARHHEGRTQLLQAGAMDVIVADLKRMPDSNLNT
                     ENDADVRTVDSDGSEEDADDPGSLSTTMLELISTFIEDAPAAAALLAETFARNSRSAK
                     RFWRGLYDPVPLRRFFSVKILAHLYIAGMLNDASKLAATALPVLLALLASPSQPQPGK
                     SWTQFGIYFDPKVPAQQLRQAEVVELVEKLLASSSHFRRVALDVGAIPVIVNVIEQSC
                     DRLASLPESVRSQESKRSRLELASPTRCGRTSAAASLPSANPGAQSERESTSALRALA
                     LIASNGEHTQPILVDDKLMALLLKLLEWVRRAPPELSFGVAEATAQALASLMALIPNR
                     QRQGLHPSLSERLLDMILTSSAPYVVRCAACDALAQCAMPPCPLGTALMNQERALQNL
                     VSLVHDYLHRWDLSHDSGARAANPEALNAADVWRGCSPALGSAVGHGIAESKQSGPNA
                     RHQTVARTEQHLVAKIIKIIRILALAASSSEKKSLMDLLTWRSLDMLTDVRQAADVCA
                     QSWALLHNIVYSNGDQSEHEACLFLVLQSPMGLSERLDAALHPDTHVDVRVHALNFLT
                     VVAAADAIPLRAQVLARRELLQRLASFLKSSEVLERFLASWCFTNLLRYMPHRLDTLS
                     VQGFHRKTTAAPLPPAGAAEPPQEPDQTTKQVMRTIRNHLAQLEVLVLLRQVAEHDAA
                     PDVRERARMALWNAQLWRRICDDDSSSSDLDARFTVPLVPAR"
     gene            863527..865258
                     /locus_tag="CYME_CMS336T"
                     /db_xref="GeneID:16997260"
     misc_RNA        863527..865258
                     /locus_tag="CYME_CMS336T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461670.1"
                     /db_xref="GeneID:16997260"
     gene            complement(<864705..>865658)
                     /locus_tag="CYME_CMS337C"
                     /db_xref="GeneID:16997261"
     mRNA            complement(<864705..>865658)
                     /locus_tag="CYME_CMS337C"
                     /product="probable tRNA-specific adenosine-34 deaminase
                     subunit TAD2"
                     /transcript_id="XM_005538898.1"
                     /db_xref="GeneID:16997261"
     CDS             complement(864705..865658)
                     /locus_tag="CYME_CMS337C"
                     /codon_start=1
                     /product="probable tRNA-specific adenosine-34 deaminase
                     subunit TAD2"
                     /protein_id="XP_005538955.1"
                     /db_xref="GeneID:16997261"
                     /translation="MESLHRLSPPSTRCSVADGHCCEDAAANGISELVLSRPILPEQS
                     QRLQCAQVSVDVPSYSGRGRLTEVPEHKDSRTDTSPVLVASSSSDATAAAKYGEALGP
                     PLSDGAVRPAQCAQRTAQLARNLTAADPTDTTFNPKFMLIALEIGKRAMERHAEVPVG
                     CLLVQRYSGEIIGYGANRCNELRNATKHAELVGLVDVLHRYPHMERREALLAKSDVYV
                     TCEPCIMCTAALIAHGVGGYVYFGCRNERFGGCGTVLRVHDGSCGLPSNRKPLRVSGG
                     HFAQESIALLHRFYEMENMFAPEEKRKVKRTQCKEQASLTP"
     gene            <866152..>868080
                     /locus_tag="CYME_CMS338C"
                     /db_xref="GeneID:16997262"
     mRNA            <866152..>868080
                     /locus_tag="CYME_CMS338C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538899.1"
                     /db_xref="GeneID:16997262"
     CDS             866152..868080
                     /locus_tag="CYME_CMS338C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538956.1"
                     /db_xref="GeneID:16997262"
                     /translation="MAESSVHSKATVGRSHSGSALNERQEELQADVPRLERLLELGVC
                     TRLPAARQEAFERLRRWINGSANQDAAVIAACAVIFRQMQRCLRCELTPNSKRRRTCH
                     SGAFTSDPDSRTLVHLLTFLARIVGLYARRQGTPTSDALSAASTVESRPALLRWLAAR
                     LFHLIDAIIVSGVERTALASLPGPLAFAKAARDRVIALVCRWRDLFADVDESFQQAYL
                     YTFEILRVPQLQCTEAILRPRFFRNQQELEASLRVQIPALIERLTREHLHYNDENFLG
                     TLEREFGMRTSGYLGIDDASDPGAMQRLVPNQQLSANQELLKLWSRHRDRLRDTLKWV
                     KSARTDLEQRQQLWTGLATPHITADEVSVHTSLRGLDARLSAFETRVQLLWSQAETLG
                     IEHPAATSADDNPTENRVPSGYAFDDHMAISEQELDANNDFADIDFIAIQETFTGTET
                     SENALTFSPIHSEGARENTITDSTEIYDERLPQDAPSLPTDAYATSTASNQHALQHAV
                     DFTLPEQINQRGFSEIERLLQRRISSNSENVNEEVLQAFEAAELHLLRAQTTSDATTT
                     VAVAADPLEGFLPADLRPNRRRSTVSSKVSAQARTALRASRHRLETHLRRVLPRAQRQ
                     RMQQAESIFEHRQRDRRA"
     gene            complement(<868182..>869318)
                     /locus_tag="CYME_CMS339C"
                     /db_xref="GeneID:16997263"
     mRNA            complement(<868182..>869318)
                     /locus_tag="CYME_CMS339C"
                     /product="probable pyridoxal kinase"
                     /transcript_id="XM_005538900.1"
                     /db_xref="GeneID:16997263"
     CDS             complement(868182..869318)
                     /locus_tag="CYME_CMS339C"
                     /codon_start=1
                     /product="probable pyridoxal kinase"
                     /protein_id="XP_005538957.1"
                     /db_xref="GeneID:16997263"
                     /translation="MLRHTTKFQQATPPTILSSGSGSLLVRYSGYIACREHSPRLLSI
                     RCFASAFAHGHQGARVATSRASWCTLFMPRVLSVQSHVVHGYVGQKAATFPLQLLGWD
                     VDPVNTVHFANHTGYRHKAGESLTAEQLRRIVWNGLLPNGLLKSVTHLLTGYIRSREL
                     LEVVRELIDLLNSERAGQEPVWYLCDPVLGDNGRLYVPPEMVEAYRDILIPRAHLIIP
                     NAYELQLLVPHETDIERACHWLHTHYQVPVIVVTGAEADEHQRPCVYLSEALRKQSKW
                     FQLPSRLPGSFTGTGDLSAALLLAWSARVPNLQQAVEYAFSTVYHVLRRTLDEGEIVE
                     AGVPPELALIQSAKDILEPKLVCQVSDMRPEPDRESNDCEQSLT"
     misc_feature    868847..870375
                     /note="possible transcribed region"
     gene            <870072..>872837
                     /locus_tag="CYME_CMS341C"
                     /db_xref="GeneID:16997265"
     mRNA            <870072..>872837
                     /locus_tag="CYME_CMS341C"
                     /product="puromycin-sensitive aminopeptidase"
                     /transcript_id="XM_005538901.1"
                     /db_xref="GeneID:16997265"
     CDS             870072..872837
                     /locus_tag="CYME_CMS341C"
                     /codon_start=1
                     /product="puromycin-sensitive aminopeptidase"
                     /protein_id="XP_005538958.1"
                     /db_xref="GeneID:16997265"
                     /translation="MVERQLLPKTVRPLLYDITLEPGLEPRLHESVATSDGVTSETSA
                     PAGPPAGSPQHPGDTEDEDAAFTFQGQETVELEVLEDTSSIVLNALELKIHSARLNGV
                     EAHSITSDPDAQTARLEFGQKFAAGTRVRLELTFQGILNSKMVGFYRAKYQDPESGTV
                     KYMAVTQFEPTDARQAFPCWDEPALKSRFRITLVIPSDRQAISNMPVEQETVRTSDGR
                     KVVRFEETPLMSTYLVAFVVGEFDYVEGRTAEGVQVRVYTQKGVAHQGAFALDCAVKV
                     LSYFTEFFGTPYPLPKEDLIAVPDFAAGAMENWGCITFRETALLLDPERSAASARSRV
                     AEVVAHELAHQWFGNLVTMEWWTHLWLNEGFATWAAELAVDHLFPSWQQWMQFVSTTF
                     AAALRLDALRSSHPIEVEVARAQQVNEIFDAISYCKGASVIRMLANYLGLEVFRNGLC
                     RYLNKFTYGNASTDDLWQALEEESGKPISHMMRSWTRQTGYPVIYFDDANMIVRQERF
                     LADGGSVSHTSRVNTNADSDSNTAPTHWVVPLGMMDSSQPAVPRYFLLDAKQAELQSI
                     LGTASNASEQRWIKMNPHQTGTYRVNYTPEMWQRLVEPIQTKVLGATDRLGLAMDAFA
                     LTKAGILPASVALQMLAAFSKEDDYACWLDVVGSLGELGAVFASDEPSLRSQFDRFAC
                     DLMRYTAERIGWKPEPNEEHVTALLRSLLLGALVKHADSSTVNEARRSWKAEQDGTDR
                     VPADLRLAVMSAVVQYGTDADFDAVLQAYAQAVMDEERVRCIRALGCTRDPAKIRWLL
                     DWGLDRSQVKSQDAIYVYSTLAANTDSGRRATWQYLREHWSTFYQRFGKGNFLLSSFV
                     SSILRDFSSEEAAEEAEAFFASIPDKERESIQRTIQQSTERIRANAAWRQRDMHAVRA
                     WLAERCG"
     misc_feature    complement(873454..874827)
                     /note="possible transcribed region"
     gene            <874914..>877009
                     /locus_tag="CYME_CMS342C"
                     /db_xref="GeneID:16997379"
     mRNA            join(<874914..876127,876373..>877009)
                     /locus_tag="CYME_CMS342C"
                     /product="V-type ATPase V1 subunit A"
                     /transcript_id="XM_005538902.1"
                     /db_xref="GeneID:16997379"
     CDS             join(874914..876127,876373..877009)
                     /locus_tag="CYME_CMS342C"
                     /codon_start=1
                     /product="V-type ATPase V1 subunit A"
                     /protein_id="XP_005538959.1"
                     /db_xref="GeneID:16997379"
                     /translation="MVATDKARGVVQAVSGPVVVARDCPASMYELVRVGHERIVGEVI
                     RLEGSSVTIQCYEATDALAVGDPVERTGMPLTVELGPGLMSSIFDGISRPLEKIATLS
                     GSVFIPRGVDVPSLDRERQWYFEPDPALSVGRLVTGGDWIGSVQETPLILHRIMVPPG
                     TMGTVEWIAPSGWYTITDTVLKVSHQGVSKALSMMQRWPVRQPRPIAEKLVANTPLIT
                     GQRVLDTLFPCVQGGTCAVPGAFGVGKTVISQALSKYSNSDGIVYVGCGERGNEMAEV
                     LRDFPELTMSLADGEQVSIMNRTLLVANTSNMPVAAREASIYTGITIAEYYRDMGHDM
                     SMMADSTSRWAEALREISGRLAEMPADSGFPAYLAARLASFYERAGRVKCLGSPERTG
                     SVTVVGAVSPPGGDFSDPVTTATLSTVSVFWGLDKRLASRKFFPAVNTNISWSKNIQA
                     LEPWYDAHYPEFPSIRQTVRQILQMEEDLSEIVALVGRDALAESDKVVLAAATMIRED
                     CLQQNSYTSYDAYCPFLKSMLMLRNIVLWYELAQKAVAEVDRDAGATSASNRLTFAGL
                     RDVQMDLLNRLSRMKFLEPSMGDDALRRHLDALRDDIVKSFRERDWALTA"
     gene            complement(<877575..>880298)
                     /locus_tag="CYME_CMS343C"
                     /db_xref="GeneID:16997309"
     mRNA            complement(<877575..>880298)
                     /locus_tag="CYME_CMS343C"
                     /product="molecular chaperone of Hsp110 family"
                     /transcript_id="XM_005538903.1"
                     /db_xref="GeneID:16997309"
     CDS             complement(877575..880298)
                     /locus_tag="CYME_CMS343C"
                     /codon_start=1
                     /product="molecular chaperone of Hsp110 family"
                     /protein_id="XP_005538960.1"
                     /db_xref="GeneID:16997309"
                     /translation="MSVVGIDLGNVNCVIAQARGGGIEVLTNEVTQRQTPAVVTFCGG
                     NERYVGEAAATRYLQNVQRSITESKRILGRSLLEDEVQHIEAARALYSITEEYAQGGS
                     AEAPTDYRVRRAAVQIHYSAEQLGTDALELWHLPPEERARIPKHSVNGKASDLHVLPV
                     ESVTAMILQKLNEIVAASNHGIQARDVVLSVPVWYTDAQRAALLDAAAIADVRVLRMV
                     HEHLAAALAYGLYRATELPENDKEPVQVIIADVGHSQTTAACVAFWRSRLEVRAVAFD
                     RNLGGRDFDEMLFHHFAKLFAERYRISVGNHKKAIARLRQQCEKVKKILSANALAHLN
                     LDCFVDDIDVEAMIQRAEFETLVRPLAERIVRVVQQVVASTPEPKAIQSIELIGGGSR
                     VPLIQSLIEQTTGLTVRRTLNTDECIARGCALQAAILAPGYRVREYEAVDFTVFPICI
                     AKSGATGTKETLVFAPKSAMPSLKRVTYSYTGQPFELRLFYGDDAGAAKQQGGACSLP
                     QGCVRDIALVEIGVLPNKSPNCGRVHVKVRLDANGMVSIVGAQLVEEVSVAESAAAEA
                     QEASQDAGATNQHGGEAPDTAATRMDQEIASDGAAADDSARSGTDAHANGQGTAPARK
                     VIRTELPIRQLRGTRLQHYALNALIEIEQQMQAADRYRVERAEALNALETYVYDMRSR
                     VSTDGPWAIYMDDASQSAFLRLLDETEDWIYSEEGSETAPKSTLIERQQMLERRYGAA
                     VKARALEYENIADAAHVFRRAAASLQAECASAATEKPHISVEDIQKLEREIASSMAWL
                     EGALHKVEKAPKHKDPPLKAADIEKRRNELVQRGRQLLDRPVPSRTAAGESGSAPNTA
                     SGPGAKTSTSSSPNTEQADTASASEPGSTETAAQTAEPMEQDYKPDAPPNP"
     gene            complement(<881970..>883697)
                     /locus_tag="CYME_CMS344C"
                     /db_xref="GeneID:16997310"
     mRNA            complement(<881970..>883697)
                     /locus_tag="CYME_CMS344C"
                     /product="probable O-sialoglycoprotein endopeptidase"
                     /transcript_id="XM_005538904.1"
                     /db_xref="GeneID:16997310"
     CDS             complement(881970..883697)
                     /locus_tag="CYME_CMS344C"
                     /codon_start=1
                     /product="probable O-sialoglycoprotein endopeptidase"
                     /protein_id="XP_005538961.1"
                     /db_xref="GeneID:16997310"
                     /translation="MPFLEKPAESRVFAFALLQPCRGHSRFVRTAVSPRLVTSPTAPF
                     HHSTGTYWRTPAPSRSLGTLVSMASGAESFRHDRSRVGQPKGTDYGEFDRSEQALRVQ
                     QTTTGSAPLGFTDTQKERLLKMPLPSQRGLSLVLPADAAPVTDERLTVLRLTGGGARP
                     HLVLGIETSCDDTAVAVVNSKGCILSEAVVKQDSIHARYGGVVPGLARQAHEQVIDEL
                     IERVLCEAFTCSQNEVWARSANGLDAVAVTMGPGLEICLRVGFRAAQRLLGRLKEASS
                     APGPVFISTHHLESHCLVPRLFGGYRPSFPFLVLLVSGGHCMLLLARDLGNFEVLGGT
                     LDDSVGEAFDKIARLLGLDVGGGGGPALERLAREGNPNAFDFPIPLRKRPDCNFSFAG
                     LKTAVRVAIERELERYGSRDETATLLQVNRQAAADIAASFQRVALEHLFEKTRRALLW
                     CRTHEPDVQSLLVSGGVAANSVLRARFQQLASEIGWRLHDEEVERTAAWSTDPGAPAC
                     DLKQAIIFPPLRYCTDNGVMVAWAGVERLLRLGDAAGEPDIDQIEVVARWPIGRRLAM
                     DKLEQRLCA"
     gene            <884910..>886565
                     /locus_tag="CYME_CMS345C"
                     /db_xref="GeneID:16997311"
     mRNA            <884910..>886565
                     /locus_tag="CYME_CMS345C"
                     /product="Sps1-like serine/threonine kinase"
                     /transcript_id="XM_005538905.1"
                     /db_xref="GeneID:16997311"
     CDS             884910..886565
                     /locus_tag="CYME_CMS345C"
                     /codon_start=1
                     /product="Sps1-like serine/threonine kinase"
                     /protein_id="XP_005538962.1"
                     /db_xref="GeneID:16997311"
                     /translation="MSFAATATMTSAGRATPATFDGNPAPDRKLLVEPGDAAALSRVE
                     ADPRVRYNPLAPIGEGAFGMVYRALDTETQTVVAVKVINLDECHDEIEGIQQEVTVMA
                     QLNTAHVAKYYRSFLVGPELYIVMEYVDGGSVRELMEFLGGRLSEDIIAVIARGLVEA
                     LVHLHAQNKLHRDVKAANVLLTTTGDVKLADFGVSGTLTSTFRKRNTMVGTPYWMAPE
                     VIRESAYDEKADIWSLGIACYEMATGLPPYADLHPMRALFLIPKSEPPRLPENDDGSS
                     PWSATFQNFLSCCLQKSPTERATAAALLEHPFLRCGPEAKSQLSELVQRKVRNQQILT
                     MPLAAGKTGTEPVPSKSSSSSASVSYHPPTSHSSSGEPHPSASVGGSLSRWDDSLGLD
                     EYLAASQRALDRTQWRYMSIPRPNTIVAGRTASLMATNSRQTGPPHEIQSWTFDSNES
                     GSVLITNAPGCTWTGENSQLTPSPSHPMFCYLLEPAIRRLVAKYANEGTDANGPELAR
                     LLHSILAQFQRMECIRPGASCAFIKELMAAVQQTRLPEGDHAQ"
     gene            complement(<886737..>887405)
                     /locus_tag="CYME_CMS346C"
                     /db_xref="GeneID:16997274"
     mRNA            complement(<886737..>887405)
                     /locus_tag="CYME_CMS346C"
                     /product="small GTP-binding protein of Rab family"
                     /transcript_id="XM_005538906.1"
                     /db_xref="GeneID:16997274"
     CDS             complement(886737..887405)
                     /locus_tag="CYME_CMS346C"
                     /codon_start=1
                     /product="small GTP-binding protein of Rab family"
                     /protein_id="XP_005538963.1"
                     /db_xref="GeneID:16997274"
                     /translation="MASAYAYLFKFIIIGSSATGKSCLLLRFTDDRFQVTHDLTIGVE
                     FGTRTLTARNGQRVKLQIWDTAGQESFRSITRSYYRGSAAALLVYDITRRETFLDVTS
                     WLNDVRAYATRNTTVVLVGNKSDLEDQRQVAREEGEAFARNHGLLFIETSAKTGSNVA
                     EAFAIAADAVLERIVRGELEGNMEQYGVRIGTGAGSTNRPAVVQLERGTTSSSTRRSS
                     TNCC"
     misc_feature    complement(889053..889694)
                     /note="possible transcribed region"
     gene            <890247..>890942
                     /locus_tag="CYME_CMS347C"
                     /db_xref="GeneID:16997380"
     mRNA            <890247..>890942
                     /locus_tag="CYME_CMS347C"
                     /product="probable mitotic spindle assembly checkpoint
                     protein MAD2"
                     /transcript_id="XM_005538907.1"
                     /db_xref="GeneID:16997380"
     CDS             890247..890942
                     /locus_tag="CYME_CMS347C"
                     /codon_start=1
                     /product="probable mitotic spindle assembly checkpoint
                     protein MAD2"
                     /protein_id="XP_005538964.1"
                     /db_xref="GeneID:16997380"
                     /translation="MATAGSEQAPISLRGSTDTVIEFLRCAIYSILYQRGIYPPEMFR
                     RASKFGTSVLVAQEAQLDSYIERILQRHLRLWVLRGSVHRVVLAFAATADPGRILERW
                     HFDLHMEQRATEDSSVPRDESVVMREIQAIIRQITASVTFLPLLDEPCSFDLLVYTDP
                     ALEADANEWEESDAKLITAPRCEQVKLRSFTTNVHRVETGVAYACKELTDTSYPFRKP
                     ILPQTFHVATALA"
     gene            complement(<892013..>893341)
                     /locus_tag="CYME_CMS348C"
                     /db_xref="GeneID:16997276"
     mRNA            complement(<892013..>893341)
                     /locus_tag="CYME_CMS348C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538908.1"
                     /db_xref="GeneID:16997276"
     CDS             complement(892013..893341)
                     /locus_tag="CYME_CMS348C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538965.1"
                     /db_xref="GeneID:16997276"
                     /translation="MVETHQTSFILCGTSSFCQSRSTNRCQRHHIVSRSACGRVQVPR
                     VRLWAEQRDLPAGAGPGRAPASGAARAKGSEPPPENEPQPVQRGTARSFENLERTADR
                     AFSTNVSAHNDSDQVTDSTSSELDDGLVRPDDPSFLRTELERRRNQPVRTIAERRRLW
                     RETQRRRATTEEQRALREAFETEQGLPPDINVEQLESVPLVRESLSGRERGEDYWLDL
                     SELTRQPGEIRMHERPRLALLSEILAGRWRTLGQKNNANNQMSVMEEELEWRRLLQEL
                     KRSDRVSMQFQELTEEVPMLPGESVEEALSRSRLASDQAVVRSPSAANDSDELDLAML
                     FQLKELEPVFSRITTSVERRGSSSVLVIRRYVPRISARVLELRDRRLRRKLRQEQGRL
                     SARMQNRVRAELVLPYSQNWIALMVVLIGILALLTWRFGQSGPVIELPDL"
     gene            <894805..>895527
                     /locus_tag="CYME_CMS349C"
                     /db_xref="GeneID:16997277"
     mRNA            <894805..>895527
                     /locus_tag="CYME_CMS349C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538909.1"
                     /db_xref="GeneID:16997277"
     CDS             894805..895527
                     /locus_tag="CYME_CMS349C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538966.1"
                     /db_xref="GeneID:16997277"
                     /translation="MRRFHLPYAILLLLSIFFFAPCMQAAPLIEIDSDTLLRITTPAP
                     SLPPLPPSVLAQVEAAEHRGRNVTGPHINATVAAALNYTQFEYTLVNALYEIDQSLCL
                     NEALTMGAADVAAMLSECTVDQVNNGSCSYATKSAVESMFQTVGWSSPDFAGVALARK
                     FPAAFFNWSGPAGEGGDGLRGIRAYAAALEVTDIVTRELGPAVRSGLYKLAAAGAVEL
                     LNDEVYAYVVIGKAAGQTCYEP"
     misc_feature    complement(895597..898049)
                     /note="possible transcribed region"
     gene            <898424..>898906
                     /locus_tag="CYME_CMS351C"
                     /db_xref="GeneID:16997302"
     mRNA            <898424..>898906
                     /locus_tag="CYME_CMS351C"
                     /product="eukaryotic translation initiation factor eIF-5A"
                     /transcript_id="XM_005538910.1"
                     /db_xref="GeneID:16997302"
     CDS             898424..898906
                     /locus_tag="CYME_CMS351C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-5A"
                     /protein_id="XP_005538967.1"
                     /db_xref="GeneID:16997302"
                     /translation="MAEQHDLEVLATGDAGASDVTPIQAGAVKKGVYVVLKGQPCKCV
                     DVSTSKTGKHGHAKANIVGLDIFTGKKYEDVAPTSHTMYQPVVVRSEYQLIDIDAENF
                     CSLMDDKGETREDLKLDPDNDPVHAKIKEDFEAGKQLTVVVLKAMKQEKIMQSKELNE
                     "
     gene            <900901..>902475
                     /locus_tag="CYME_CMS352C"
                     /db_xref="GeneID:16997303"
     mRNA            <900901..>902475
                     /locus_tag="CYME_CMS352C"
                     /product="diaminohydroxyphosphoribosylaminopyrimidine
                     deaminase / 5-amino-6-(5-phosphoribosylamino)uracil
                     reductase"
                     /transcript_id="XM_005538911.1"
                     /db_xref="GeneID:16997303"
     CDS             900901..902475
                     /locus_tag="CYME_CMS352C"
                     /codon_start=1
                     /product="diaminohydroxyphosphoribosylaminopyrimidine
                     deaminase / 5-amino-6-(5-phosphoribosylamino)uracil
                     reductase"
                     /protein_id="XP_005538968.1"
                     /db_xref="GeneID:16997303"
                     /translation="MFQVLTGTSVAGNNGWLTTDVVSGVPQRSPAWGAYSGSWPAQKR
                     SSFEAQSLHLPSSNEYRLEPSWFGGGARKRAAQRGRCPNCYSPQQTTRQSPRCAVSDE
                     TYMDRCIQLALMARPSPNPPVGCVVVDPDTGRIVGEGFHPRAGYPHAEQYALQATFTT
                     LRNASSHQNQHLAATVSEPVAALPGSARGMHVYVTLEPCNHYGRTPPCTESLIQAQVS
                     RVVIGTRDPDPRTAGSGAERLRRAGIEVQFGPRAAECLKLYEGFQHRIHHQTPLGILK
                     YAMSLDGKIATETGDARWVSSATSRRYVHELRARCDAVVVGAGTVRRDDPALTVRLEE
                     SIDVPELGYGQPLRVVMCTSAARLWRDRPDAKLWDTSVAPTVLAVSSAGEVSSSKELD
                     AAEREAILALRSRGVQIAYLDALLPLPPTRALMQWLYDYGCTTVLWECGGTLATSAVR
                     ESAVHKILVFVAPKLVGGRSSPTPIAADLGVRNMEEALALRLGRMEVIGSGQDVLIEA
                     YLDSNKLSPDAASGTT"
     gene            complement(<902841..>903209)
                     /locus_tag="CYME_CMS353C"
                     /db_xref="GeneID:16997304"
     mRNA            complement(<902841..>903209)
                     /locus_tag="CYME_CMS353C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538912.1"
                     /db_xref="GeneID:16997304"
     CDS             complement(902841..903209)
                     /locus_tag="CYME_CMS353C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538969.1"
                     /db_xref="GeneID:16997304"
                     /translation="MAQAIRRFIPWYLLGVNGISAGCIIEDKRRALQHQWRIPERDLI
                     ALGAAGGFPAGYLAMRYAHHKTQKKSFREKYDKAALFSATGWSLIFLGLRRPRLGLKQ
                     APKASSSPLTSSRRPMTPGR"
     gene            <903576..>905156
                     /locus_tag="CYME_CMS354C"
                     /db_xref="GeneID:16997305"
     mRNA            <903576..>905156
                     /locus_tag="CYME_CMS354C"
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit H"
                     /transcript_id="XM_005538913.1"
                     /db_xref="GeneID:16997305"
     CDS             903576..905156
                     /locus_tag="CYME_CMS354C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-3
                     subunit H"
                     /protein_id="XP_005538970.1"
                     /db_xref="GeneID:16997305"
                     /translation="MSSEQNQPSFESDGLKISSVRQPVGAYLAATTAGTSAASSGRRL
                     ASHGTRDADPGRGSAEDDRVMSDSELLLRRNVGRPDTLTAVGTRLLPTRSRETLLEKL
                     PKVRSVVISGVALLQLVKEWQRAGKGSASKRTGVRSMEGAASEAYCTGQLVGYLEVER
                     RSDPTSDDAKTADALVWGDVMHVTAAFPAPRLSVIAGGRSTSGSAPTSLPAAVIANQM
                     QQRGTYLWERCRLLREASRENLIVGWFCVGDTRQLSSFVNAEWTETQFQHQFWLKNAV
                     CVVFDPLRRHSSGTLGIRVVRLSDAFMREYSRLMDYRVGGSGSSNKGSAALQAYGRGG
                     GRVAAGSTFVSEVLRDLGLCSQTMIEDVPFTVHASALSEQYLAWSALQHPQARENAKF
                     TEHAAACDSDVQRLSLRRDGVLVEETAGGLIQDLDEVTREQSRYHHFLRNYIRIQNQQ
                     HEWLRRRRAENEHRRQQGQEPLPEEPLPAHLSSYSEPSRLEPMMTFRDLSETLRDLEL
                     VIGGRCEKQVTLESFKTV"
     misc_feature    complement(905467..906775)
                     /note="possible transcribed region"
     gene            <909459..>909857
                     /locus_tag="CYME_CMS356C"
                     /db_xref="GeneID:16997307"
     mRNA            <909459..>909857
                     /locus_tag="CYME_CMS356C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538914.1"
                     /db_xref="GeneID:16997307"
     CDS             909459..909857
                     /locus_tag="CYME_CMS356C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538971.1"
                     /db_xref="GeneID:16997307"
                     /translation="MDATSATSGHATEITLPSAKQLIVNTLRRAWRTPRTHRAKACVW
                     KAKAQRQRTWADKEADRERLQAVKKLERSLKEKARAQRAAEAERRAQMRAEREANALR
                     TGTKVQIVRDSNKIKRMSKKQQKLLRKMAL"
     gene            complement(<910166..>910606)
                     /locus_tag="CYME_CMS357C"
                     /db_xref="GeneID:16997308"
     mRNA            complement(<910166..>910606)
                     /locus_tag="CYME_CMS357C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538915.1"
                     /db_xref="GeneID:16997308"
     CDS             complement(910166..910606)
                     /locus_tag="CYME_CMS357C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538972.1"
                     /db_xref="GeneID:16997308"
                     /translation="MTGALWRGVLLLVSNLERSLEFYTQGLGLRVAQRTEQWAALDAP
                     NGLLELHETDTLACSLTGYSPLLRFQVHDLDQTVRECLAQGAVMDGPVRRTVYGATAV
                     TLRAPDGHMLALYNLETGPAQKSVPADTVKELMAAAAAKRRAPE"
     gene            <910961..>914584
                     /locus_tag="CYME_CMS358C"
                     /db_xref="GeneID:16997312"
     mRNA            <910961..>914584
                     /locus_tag="CYME_CMS358C"
                     /product="chromatin-specific transcription elongation
                     factor"
                     /transcript_id="XM_005538916.1"
                     /db_xref="GeneID:16997312"
     CDS             910961..914584
                     /locus_tag="CYME_CMS358C"
                     /codon_start=1
                     /product="chromatin-specific transcription elongation
                     factor"
                     /protein_id="XP_005538973.1"
                     /db_xref="GeneID:16997312"
                     /translation="MAAVGQAAASEAALRSPTANILFKGDLEARLARVGDAWLDASRT
                     FDALFVYTGALAAGEPAGYRKSYALVMYILGVEAQQTALVLQHTDAASVLWIGTADAE
                     IWAALETAAPALGLSAGHHEADRHQNGVEVNDDRSGASSTPKATLLRGNLGSDWFLVA
                     AWIATKRDLEKTLAVAGVPARSSLNLGALVKERNVHQGDFAAKCTAYVFGDAAGSDVA
                     TPPPVNAAEWIGNLLIAKLPDEIQNIRKASYLCAKVCQAYFVERMESILDEDTPVSHD
                     RLSEEVEARLLAPATVGVQLVASECEAAYPPIIQSGRDGPFDLRPSAISNEQNLSTGL
                     VLASIGARYHQYCANVVRTFLIDVEKPIRSMYAKALQALEAVRRALRPEQEAWVAYNA
                     AIQELGEELAAAHLAGKHVGFGIGLEFRDSTWLLNEQNHKILRSGMTFQIQVGLERLG
                     ENSTLALMVADTVLVGGADPEGAEVLTQAASKSPAKVTYFLDMDADEEADDGTVGNAG
                     KNSEALASEQVAGEPSAPSIVTRRRAQQSSAPDDDDAAAEAERIRLHQQKLAEQKLRE
                     SRTRILGKSASSAGDQYSAEGKGFRALNAYRAYERVEDFPAGLRPRQLFVDMEREVVL
                     APITGIPVPFHIATIKNASKSDESGFTYLRINFLVPGTSASTASASGAGGLTAPAGVS
                     GAAARLSLFPDNPGFVLKELSFRSASAANLSEVFRKIKELRKRFTSRETEAQEKETLV
                     KQAPLILETDPRRIPHLVDVSIRPSLGAGGQRANQGVLEAHVNGLRFRSRQQRAVDIL
                     YRNVKHAFFQEARNEVIVLVHFRLHTPIMVGKRKTIDIQFYTEVMDATVRLADTRRNP
                     FDIDEIEEEQRERENRHRLNKLFFKFTKEVEAKANEELEFDMPYRELGFEGAPDKMQR
                     FLMPTRDCLVDLIEFPPVIISLEDIEVAHFERVTYSLKNFDLVLVMKNFAQEPSRGET
                     QWIRISSVPSTELDAVKKWLDSVNIPFYQGPSNLNWNTVLRTIREDLEGFYEEGGWRF
                     LDAEASSSSSEDEDEEEGDDAGAGAKTRASATKASAGGAAADLSDQDEEYVPSDEDFE
                     AESSESDYDEDDDDESFEADEEAIDLAEELGDDDAGEAELSSSDEGLDWDELERRTKE
                     EERQKRKRWHDDDDDDEDDNDGDDDNENDGDARRRRHGRKQRARAPSGQTALTHGPKR
                     VLR"
     gene            complement(<914586..>915908)
                     /locus_tag="CYME_CMS359C"
                     /db_xref="GeneID:16997313"
     mRNA            complement(<914586..>915908)
                     /locus_tag="CYME_CMS359C"
                     /product="similar to putative mitochondrial carrier
                     protein"
                     /transcript_id="XM_005538917.1"
                     /db_xref="GeneID:16997313"
     CDS             complement(914586..915908)
                     /locus_tag="CYME_CMS359C"
                     /codon_start=1
                     /product="similar to putative mitochondrial carrier
                     protein"
                     /protein_id="XP_005538974.1"
                     /db_xref="GeneID:16997313"
                     /translation="MLFESEKVASPGSGHNGSWAFDADVAPGPWLHTLIGQQPLRRRS
                     STSSTRWCAHTPIWSLERALVMPSSPPDRRKRPADSGASPSAHTRTSSHAPATPAQKT
                     PLGLGRRLLMEASAGAIAEALVEFLLYPLDTLKQTQQLPTAHRRLIHSRHATAAAAST
                     LAWRSASGLHWLGPVRAFQHAVRRMADGRGFRQLYAGVLSGVIGSLPTAALFAITYES
                     VRRTLRRTRPGASHYHDQGLRANSDAGPRLFWESTTAAAMANIVSSLVDTPAELIKQR
                     VQSCLQPNIVAAARHLWVHEGGLMALWTGYGSNLLRNLPFDALEFGTFEQFKQITQRV
                     QGRERLAEWELLLLGMSAGGLIGVITTPLDVVRTRMLVSGTQPGRPATSVLQAIRALL
                     GEGGVPALFRGVMPRATWEAVSSGIFFMFFDSLKTCFGVQLEPANDSD"
     gene            complement(<917035..>921792)
                     /locus_tag="CYME_CMS360C"
                     /db_xref="GeneID:16997314"
     mRNA            complement(<917035..>921792)
                     /locus_tag="CYME_CMS360C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538918.1"
                     /db_xref="GeneID:16997314"
     CDS             complement(917035..921792)
                     /locus_tag="CYME_CMS360C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538975.1"
                     /db_xref="GeneID:16997314"
                     /translation="MVSTRHGNYDLPEGSRIEARWRTSPRRRTPRRRSSRSTSTRTPS
                     HSVETDVPLKTKSSRKTSAARRKSAGERSDTTLSRRDQSAESSPVAVQEPHGGLAGTP
                     SDTPVRPEHETPVRRLSVTVEAGYELAPGQKRATASFSNENGPLTRSQVRRAAALACR
                     ATEQTPRSTVSTSAQRQSSDHIATYVQSSSNQGALESESPGRGSQQRAPRGRSSVPSA
                     TASVHLPSGMESLPRERHHQEEASPQRSVSSSDEHSHLYAVREAHDQTTTGTGVVHGR
                     QTGRRSHPVQRRTGTAHVMNRDSVPGKKGTTRAVQRATKPKQHDGGVRKQSSRAVAVE
                     TRAIARALSSMEAQELCANSREDLTLGAMLRIRGAHGWLGRLQMSLSRWWRLWRGSSR
                     SPAASTSLEHGSPNGLQSSRTDSREHRGRYSSASSDGDASNGTVQRTRMVGETATVSA
                     SADSARECEDASKHTPHKQETQLEYANDSKALPLKDGVVQRQDSLLMDTGDPTRSESD
                     QYASEAQHSRDSVLSGTTQQVPDASSRATSTALARDVADSLAPAIACSSGPVPTARLP
                     EQRTAVSQPHESLAPTQLLTNLDSTSRHERAAATTATHTESPTTRVYGAQPANDSRAP
                     ERSTRQASLVTSYDVIRTFRQRTETRSMGVAIQASKGGSPAQEQSLIRNLADLPPAPK
                     IRPSALGIVPHRRIMDAPAATPTSTMYSVRPSGSDFRRLSPWTPTESDFVAGASRLEA
                     RFTQHSTERLSSSMLDTYRARSSSLHASLERQHYSTLCAHPESYQQEHLDPRLSTSLL
                     GRELERSGMSAIDDRSDGWLRNRADVRHVKLPAVPLTTLPLRDVPHGRTRTSNATSAK
                     RTSPIGVFEQSAGALPSGSLGSGSVPSQAHSVQNRSLDAVWTFDGSPALRMSAAKRRR
                     SDANLIVTGTRSDRHQNGRDGQRARADIRKDGDGAGAPTSRLYQLIESLKRIRDQPER
                     ERDTCITPGKRTPAAATAASDVTSNRGFTIDHSTELDVALDRAAQTVAARNKRRTLSM
                     DVSADDANISSSLTAEQDMHLRTPPLKADQHASAAAVDLAATGTHDTTAPTTRDAGAV
                     SLPPTGDAEQQARSKSATVFGAAAGGARDMQLEAMRRIVPSKLGDDELQVQRTVSLPE
                     HGEHAQQASPEAQLHADAAETTLSKGSSPDAPTLPTLPPRMRPLEIALPRIPEPWRPP
                     SLSTAGSTQRTGYVPVDTTVQPSTVPVSSESASRQESTDSSVHIAPPNAAAPAPTASG
                     SLDVAPSSSEIAKTSLAGFVQTELPHEHDEIAQCSGAPADPKPNTLASASPDDVPRMH
                     APPGSTGQEQQESASEMAMPQKAAYETKSAAETSAAPVSDGTASRKPNSTETQSIQTV
                     DTAGAALGESPQKTPLQSQDTSGASQQVPATAAPAPKASISQGAFAIPAPARTFHFGP
                     PAAGATDTTVAASASNAPPKPPAWLFSAPTASTNSEPFWFGSASQGTNGTSMWTTSSL
                     SAPMQTPTVSAPAVSSLQSPWPASGAAAPLPASLPWPSLAPSDPAANGVPPPATPLLG
                     APGFAPTQALGDAHAPGTMAPRRMLKARRTRLP"
     gene            <924457..>925680
                     /locus_tag="CYME_CMS361C"
                     /db_xref="GeneID:16997315"
     mRNA            <924457..>925680
                     /locus_tag="CYME_CMS361C"
                     /product="mitochondrial division protein FtsZ1-1"
                     /transcript_id="XM_005538919.1"
                     /db_xref="GeneID:16997315"
     CDS             924457..925680
                     /locus_tag="CYME_CMS361C"
                     /codon_start=1
                     /product="mitochondrial division protein FtsZ1-1"
                     /protein_id="XP_005538976.1"
                     /db_xref="GeneID:16997315"
                     /translation="MTGALRYRALARVIERCLGSRALGESGSAAAVSNYVWQREASRG
                     FVLGTRLLPWCPLGSRLLHSPSQTASVIRMNTGSFAPKPDLGEQQPNTLTGQPRIMVV
                     GVGGAGGNAVNNMIASSLPGVEFLVANTDAQALKMSLCPNRIQLGASLTEGLGAGARP
                     DIGRAAAEEAYETLKREFRGVHLLFVTAGMGGGTGTGAAPIIARAAAELGCLTVAVVT
                     KPFHFEGMIRMKTAEQGIVELTEHVDTMLVIPNQNLFKVASPRTSFLDAFRLADHVLY
                     SGVRSITDLMTVPGLINLDFADVRSVVREMGRAMMGSGEVEMEAGNEERAIRASEAAI
                     CNPLLDETSLRGARGVLVNITGGTDMTLFEIDAAANRIREQVDPDANIIFGSAFDASM
                     QGRLRVSVLATGIPS"
     gene            complement(<926585..>928417)
                     /locus_tag="CYME_CMS362C"
                     /db_xref="GeneID:16997316"
     mRNA            complement(<926585..>928417)
                     /locus_tag="CYME_CMS362C"
                     /product="9-cis-epoxycarotenoid dioxygenase, neoxanthin
                     cleavage enzyme-like protein"
                     /transcript_id="XM_005538920.1"
                     /db_xref="GeneID:16997316"
     CDS             complement(926585..928417)
                     /locus_tag="CYME_CMS362C"
                     /codon_start=1
                     /product="9-cis-epoxycarotenoid dioxygenase, neoxanthin
                     cleavage enzyme-like protein"
                     /protein_id="XP_005538977.1"
                     /db_xref="GeneID:16997316"
                     /translation="MNLHPGDKTAFVVGNGALRHWKGASVNATATFQCGRLKRRSLRP
                     ARSGGATHLSSQESGATNTVREQGQLTSAPGKTQSLSAFDRRSWELAHGDMNEEDSYV
                     LDLPDLPHDLVGTLYRNGPSKFTIGSRRMLHPWEGDGAVAAFTLRGDGTVWFRNRFVR
                     TEGYLKERRAGYQLYRGTFATPLPGGIVTNAFRLEQKNLANTNVIYHANQLLALYEGG
                     LPYELRPDTLETKGVFRLGGTLTGPMPMFTAHPHVDPLRRGRLVGFSSRMHLNGLRIR
                     FLEFASENWKLCSERTVDIDGFGFFHDFMITQRYYILLQAPLRFHPLPFVLGLKCPGE
                     CITWEGDRMPTRLLLIPRDDPGAPVREVLSETCTAFHFVNAYDDDDDDAVVLDACRMD
                     RLFLGETRRHRNGLSRTQRVVEAVDFGTQVPKCSLWRCRIPTRSGSGTQRATWREVNT
                     THVDFPVVNPSRLTQPYRYVYMGASALGTEPGPLKNIIKVDADTGQTLATWQPPSVYE
                     FAGEPVFAPRLIEPDKESAEDDGYILSVVSDGLHRSTYLVILDASDLKLVCKVPLRTF
                     LPMGLHGTWTAQVFQPQPKRRTVQDLFESKNWNEVDSSLPLFRF"
     gene            927750..929689
                     /locus_tag="CYME_CMS363T"
                     /db_xref="GeneID:16997317"
     misc_RNA        927750..929689
                     /locus_tag="CYME_CMS363T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461671.1"
                     /db_xref="GeneID:16997317"
     gene            <929850..>931607
                     /locus_tag="CYME_CMS364C"
                     /db_xref="GeneID:16997318"
     mRNA            <929850..>931607
                     /locus_tag="CYME_CMS364C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538921.1"
                     /db_xref="GeneID:16997318"
     CDS             929850..931607
                     /locus_tag="CYME_CMS364C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538978.1"
                     /db_xref="GeneID:16997318"
                     /translation="MWVVPGSFRARRCDGFGVEWTWSVDRACATVPCSSLRRPRPRQG
                     ATVRRERNWSQKPCGVPGNTVVRVSCHIGQSSSNDEGGTGEPLVHSSGEQAWQRRALS
                     STGTKDAELDANELDDGLWGIVSQLPVKRILIWAAFCWLVYLCRPFMGVLFGTFVVSY
                     VGVSFCQWGTRFLQRFGIQAARRVIVGVYYSGIALFITTMSLLTIPRIIKEGQYFVGI
                     IRSSNPYVWIADTMRRALGDELSAKVEALVLSEGYAELADQDTGSSAGQSPSTNGAET
                     SESTNEASPGPVQVRIPHRGSAADAKAERAPGIAAGPLATMNAPAEWTEERSRRLGLI
                     IQKSLSRYVNRFASIVSRILSNSTKIIVKVLLSLVFSFLIVWDLPSVAAGLRSLRRSR
                     LRAAYLELAPAIGEFCALLGRSFEAQSIIALVNTTLTTIGMGILGLPGIGFLSLLCLI
                     CSFIPLFGILLSTLPMCVVALTEYGPMRAFAVVVMVAIVHLIEAYFLNPQIYSAHLKL
                     PPLVVLMVLYIGEHAGGVMGLILAVPLTVYLLRWIYDIPETKERSAYVSSMRATSSNG
                     REEPSEDVTITRQQQQQQQ"
     misc_feature    complement(932177..934512)
                     /note="possible transcribed region"
     gene            <933224..>935194
                     /locus_tag="CYME_CMS366C"
                     /db_xref="GeneID:16997338"
     mRNA            <933224..>935194
                     /locus_tag="CYME_CMS366C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538922.1"
                     /db_xref="GeneID:16997338"
     CDS             933224..935194
                     /locus_tag="CYME_CMS366C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538979.1"
                     /db_xref="GeneID:16997338"
                     /translation="MESRPYHRSFLEQLNAELLLWIAAYLEPSEVEALWSASQSTAST
                     LQWNDLEHFCFETLRRRYGSLFARHLQQAYRQERERRGPGGVRGPWSWRRAFHCVYHA
                     HRWLFGVSFRASAPHTETSSMTWSAVFRERRSAPSESSPSPPWGRLLVQRFDQRAVEG
                     IGNGALLAAVLRMRPDSASRDPVYAECALIVTPYRIVWFEATPLSGSDLCLDTERSHL
                     LTTPLVLTAALSDDERLLVLGRRGCTLEVRDVMTCNVVAEARLPVRISKRDEYSCLDA
                     AGDMIAAGTMAGRLLIFDCTQALQKGVQRTGTVRLKPVRMEISTSGEPLSQVRLCRSA
                     ESSHRPDLVVVCTQKQLRIYYIQLGLFIFQRDFERPIRSVHSARSRTCIYIASGSTVD
                     IIELPALEYAATLGRPSIMSEDDQLTCIAVDEHGNVAGGWSSGHVTFWPARGRLVGIA
                     LTYHDRHLDLHEWKQSGRVCRTDLSQDVDELERNAQSAWCGSRSPIRSIYVDRDRVIS
                     ASSGGVIEVFAHQQVIEAPAVHSLRHESYAHAWQHCRTARISIPNLHGDITHLSAGEG
                     TLLGGLCGDAASAQRLPLVLLQFSALRDQSNGGAAEADESADTLGCAGVAGGAPVRYR
                     ENGWLPPADIIQAFWVLESSGPDKLAPVITRD"
     misc_feature    935995..937951
                     /note="possible transcribed region"
     gene            complement(<937549..>938505)
                     /locus_tag="CYME_CMS368C"
                     /db_xref="GeneID:16997340"
     mRNA            complement(<937549..>938505)
                     /locus_tag="CYME_CMS368C"
                     /product="DNA repair protein RAD52"
                     /transcript_id="XM_005538923.1"
                     /db_xref="GeneID:16997340"
     CDS             complement(937549..938505)
                     /locus_tag="CYME_CMS368C"
                     /codon_start=1
                     /product="DNA repair protein RAD52"
                     /protein_id="XP_005538980.1"
                     /db_xref="GeneID:16997340"
                     /translation="MKSSPWRTPPLKRSRETSALFGGTRSPPVTPSFANRSSATTTSR
                     LNEAIPAREVSKRVGPGGKALYYLQGWQAIQVANEIFGYGGWSNALQSFDVDYCEQGP
                     DGRWNAMATAVMRVTLMETGAFHEDIGCGVCDGMRTRGDALQKVKKEACTDAMKRALK
                     NFGRRLGLMLYDKEFLAMLTSGALGHAALAGARSGDYALGSIQVPAIPAYARGENQKA
                     KQADAVQNGSIQGNSSSDKAIANKANKTSRLESNAGERDARNGGVVSAEIIGRSPGCL
                     TRASAALKASTPTKGNSGMIWNSVTRAELDSLLQQFELDDES"
     gene            <940014..>940871
                     /locus_tag="CYME_CMS369C"
                     /db_xref="GeneID:16997341"
     mRNA            <940014..>940871
                     /locus_tag="CYME_CMS369C"
                     /product="similar to translin-associated factor X"
                     /transcript_id="XM_005538924.1"
                     /db_xref="GeneID:16997341"
     CDS             940014..940871
                     /locus_tag="CYME_CMS369C"
                     /codon_start=1
                     /product="similar to translin-associated factor X"
                     /protein_id="XP_005538981.1"
                     /db_xref="GeneID:16997341"
                     /translation="MSLKRPLPDPTDSELVSVNSADVREPEASHTITKLFTALGAALD
                     ERLERRERFVRASRDLTMAAKKAIFELQRLKSSLRRLRDTQTQEAWAKTEQTFDRLQG
                     LLRGGILKELEATPAFSDTYWQYHQVFSPGVQEYVEALAFRHWFKDARILQFQATCEK
                     LAPFPLEVSDYLLGLCDASGEVMRLAVQSSALGEQGVAFEASSFLDTLRRECTRISAR
                     TRRAWPPSMQQDLDRKLVTMGESLQKVQDVCYRLCLRRAERAVLGLDDRDEADDGADA
                     GIQAEEIIG"
     gene            complement(<941643..>942563)
                     /locus_tag="CYME_CMS370C"
                     /db_xref="GeneID:16997323"
     mRNA            complement(<941643..>942563)
                     /locus_tag="CYME_CMS370C"
                     /product="similar to rRNA methylase"
                     /transcript_id="XM_005538925.1"
                     /db_xref="GeneID:16997323"
     CDS             complement(941643..942563)
                     /locus_tag="CYME_CMS370C"
                     /codon_start=1
                     /product="similar to rRNA methylase"
                     /protein_id="XP_005538982.1"
                     /db_xref="GeneID:16997323"
                     /translation="MNFSRALTGERKPSLVYWERTCCFAFCNWLSTRRYSRPGCSRVP
                     RVVQRRPRCTEPPPLCSAHHLEKNTQLAHTYWRSVLEPGDMVLDATCGNGHDTLALAE
                     YIGAPVTGTLIALDIQDKAVMRTRNRLVDMFQSRFRSTELHIHSEYTQGRLRCRLWTE
                     NGFICELRQFPHEQFQRDMLDSWLADVKARPTWFKVAAYNLGYLPGLDSDRSIRTRAD
                     TTIKSLKLLEGLIAPREGLISVSCYTGHDGGAAEGAAVMDWAQALDASQWTAVAHRWL
                     NRRQAPSLVVALHQVASRPSTPYETTSDKH"
     gene            <944444..>946195
                     /locus_tag="CYME_CMS371C"
                     /db_xref="GeneID:16997324"
     mRNA            <944444..>946195
                     /locus_tag="CYME_CMS371C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005538926.1"
                     /db_xref="GeneID:16997324"
     CDS             944444..946195
                     /locus_tag="CYME_CMS371C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005538983.1"
                     /db_xref="GeneID:16997324"
                     /translation="MGSEKHERLPSETPVGVARPSTGLSGAHLGLTLGTLKTGTPTTS
                     TSAKGAAAQASETREGSSDQEQAGALPGNGETLNVDAAAEGVYERPTDRLQVRTGTEL
                     PAKSPPKGQKQRRPYFLRKQRESWSPEEHQRFLQALAQYGRLWTQVQRVVKTKTAEQI
                     RSHAQKYFIQLEKKRMKEKSSTNSSDSKPSEALREPAASGGAPRHAENAALQPGAVGT
                     RMPHEASQQQTVFQSTEMRHLGRLQPLPLAVPENTCTEHEHNVARVPRVENRLPHGIV
                     GSPSASTHHYRWGRTVSGTSQVVAACGYHPKDMTARIREGAAVAPHTDIPLNLPAMRA
                     ADRLEANQHAVHERCIGNSLLVGTSAGGSHVRRDAYATLGFCDPSIAQAQRAQFTSMP
                     VLSSTAQTHLSDSHSGVTWCQRASTDTDYRTGASLPRPIEPWGGTRPLSPLSLSVTQS
                     SSDWCPSSCASSVPSIASPMQDSPAVSHDRLRQALDSLVNGRKSIERLGTGPILKHFD
                     QHLLQYGVFQTIPQTTPSPSLPVSATEAAIPHSPPSARNPVTAGAKVQLPSVSSLISN
                     RFAVSHSTSQKESMPYS"
     gene            complement(<946685..>947074)
                     /locus_tag="CYME_CMS372C"
                     /db_xref="GeneID:16997325"
     mRNA            complement(<946685..>947074)
                     /locus_tag="CYME_CMS372C"
                     /product="mitochondrial acyl carrier protein precursor,
                     NADH-ubiquinone oxidoreductase 9.6 kD subunit"
                     /transcript_id="XM_005538927.1"
                     /db_xref="GeneID:16997325"
     CDS             complement(946685..947074)
                     /locus_tag="CYME_CMS372C"
                     /codon_start=1
                     /product="mitochondrial acyl carrier protein precursor,
                     NADH-ubiquinone oxidoreductase 9.6 kD subunit"
                     /protein_id="XP_005538984.1"
                     /db_xref="GeneID:16997325"
                     /translation="MTLVTVARSLARALGFARQGSIGGWYRGALTSTRSWSSEAGSGG
                     SVFLDRKDVLERVLNVVRNFEKVDASKVTPDAHFVKDLALDSLDTVELVMAFEDEFAI
                     EIPDAAAEKILSVADAVEYVTNNAHAK"
     misc_feature    947512..949549
                     /note="possible transcribed region"
     gene            complement(947863..950446)
                     /locus_tag="CYME_CMS374T"
                     /db_xref="GeneID:16997355"
     misc_RNA        complement(947863..950446)
                     /locus_tag="CYME_CMS374T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461672.1"
                     /db_xref="GeneID:16997355"
     gene            <953184..>956657
                     /locus_tag="CYME_CMS375C"
                     /db_xref="GeneID:16997356"
     mRNA            <953184..>956657
                     /locus_tag="CYME_CMS375C"
                     /product="phospholipid-transporting ATPase IIA"
                     /transcript_id="XM_005538928.1"
                     /db_xref="GeneID:16997356"
     CDS             953184..956657
                     /locus_tag="CYME_CMS375C"
                     /codon_start=1
                     /product="phospholipid-transporting ATPase IIA"
                     /protein_id="XP_005538985.1"
                     /db_xref="GeneID:16997356"
                     /translation="MDPQRRTKGLSRRSAAERILRLGTQSLGENGSSERIHETGAMTE
                     TTGALSGARSRRAPGTATSWQGPRAGRYLPPGVDVDGLGALPHESLSPLTVEKTALET
                     PTPADLKQNGALAFANDEQVSINLPEKNEPSGDPGPEAYSKASTLQTLRQRWFVKAPP
                     RPRTIYLESGTTNPSKRRFPDNAVRNSKYNALTFFPRALYEEFRMFYNIFFLLIAISQ
                     LIPALRVGYLVTYIGPLAFVLAVSMSKSAVDDILRRRRDHEVNRQVYEKLVAGGNGAV
                     ERRTTRACDLRVGDLIVLSKDQRVPADCILMRASPDPNGTVFLRTDHLDGETDWKLRR
                     AAHSTQLLPSDESLVGLQASVWAEAPRKEIYEFHGNLYLQNGTIEPLGLENTLWASTV
                     LASGNAIALVIYTGAETRSMMNMTEPPSKVGLLDEEINFLSKLLFLLLFSMAFILLCF
                     KGFGRHWFLYLLRYLLLLASIIPISMRINLDLAKYVYKFVIERDHAMPGAVVRNSDIP
                     EELGRLDFILTDKTGTLTKNEMVFKKIHFGSMLFGREAMDDLKTYVERAFDGGKESLD
                     REIRESMLAIALAHNVTPVDNDFQAASPDEVALVQFANATGVQLIEHTPTRIRLRVPG
                     GGIATFEILVEFPFTSVAKRMGIVVHGPQEPNVPIPRRIMFFVKGADSIIGRMVRAND
                     WLDEECGNMAREGLRTLVYAMRYLTEPEYREFAELYGAARARTQGRTEAMAAAQARLE
                     RDLKLLCITGVEDTLQDGVKATLEQLRQAEFHIWMLTGDKVETAKCIGTSSRLVGRNQ
                     RTFTISGVESRTVASRQLAQFKRRQNEVLVIDGTTLDVMLHHFPEDFIQVAGKAPAVI
                     ACRCSPTQKGELARLIRRHLGKRVLAIGDGGNDVAMIRRANVGVGIPGKEGRQASMAA
                     DFSVAQFSHLPRLLVWHGRNCYKRSACLAQFVIHRGLMIAVIQMCFSAFFYFAAVSVF
                     NGLLMVGYATIFTMLPIFSLILDRDVRDTIAMAYPELYSELRRGRSLNVRTFLTWVLK
                     GFYSGTAIMTFAVLVLWNDDFFTTANIQAVAFTALIILELLMVASEIHTWHYLMLLSE
                     ALSLLFYALAIFILTQEFNRRLVFSVGFIWKTAVIVIVAWLPIELAKRIDRCLRPPRY
                     LKVGEAPASTA"
     misc_feature    complement(954510..956153)
                     /note="possible transcribed region"
     gene            complement(<956738..>957919)
                     /locus_tag="CYME_CMS377C"
                     /db_xref="GeneID:16997358"
     mRNA            complement(<956738..>957919)
                     /locus_tag="CYME_CMS377C"
                     /product="casein kinase I"
                     /transcript_id="XM_005538929.1"
                     /db_xref="GeneID:16997358"
     CDS             complement(956738..957919)
                     /locus_tag="CYME_CMS377C"
                     /codon_start=1
                     /product="casein kinase I"
                     /protein_id="XP_005538986.1"
                     /db_xref="GeneID:16997358"
                     /translation="MSVELRVGGKWRLGRKIGSGSFGDIYLGTNVYTGEEVAIKLEST
                     KTRHPQLSYESKIYRYLGTNPATGQPAVGIPQVHWYGTEGDFNILAMQLLGPSLEDLF
                     NFCHRRFSLKTVLMLADQMIQRIEYVHSRSFIHRDIKPDNFLMGLRRDSSVVFLIDFG
                     LAKKYRDPRTLVHIPYRENKNLTGTARYASINTHLGIEQCRRDDLESLGYVLMYFNRG
                     SLPWQGLKAATKKQKYEKISERKICTPVDILCRGFPSEFATYLNYCRSLRFEDKPDYN
                     YLRRLFRDLYRRKGYQDDNAFDWTLMRKAALEAPTGATMESGVAAMPADDTGSCGANR
                     ADVGENYAGKQELELDTPEDIAVPVRYLTRPDTAYGRPAPPTTAAPLPYSEPPPAPSP
                     R"
     misc_feature    958235..959516
                     /note="possible transcribed region"
     misc_feature    complement(958824..960272)
                     /note="possible transcribed region"
     gene            <959869..>960228
                     /locus_tag="CYME_CMS380C"
                     /db_xref="GeneID:16997344"
     mRNA            <959869..>960228
                     /locus_tag="CYME_CMS380C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538930.1"
                     /db_xref="GeneID:16997344"
     CDS             959869..960228
                     /locus_tag="CYME_CMS380C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005538987.1"
                     /db_xref="GeneID:16997344"
                     /translation="MKAGVSQVIVDTFVVACLGLAGAIIGLEYALDGDEAACSELTNG
                     KDEVADDAVRAHVSATWRSAALSRGSASAWRDLKLFLDEHVAPELPKMFRLIGQHWLT
                     PKTAWLWSVVSSWRAIA"
     gene            complement(<962332..>963456)
                     /locus_tag="CYME_CMS381C"
                     /db_xref="GeneID:16997345"
     mRNA            complement(<962332..>963456)
                     /locus_tag="CYME_CMS381C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538931.1"
                     /db_xref="GeneID:16997345"
     CDS             complement(962332..963456)
                     /locus_tag="CYME_CMS381C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538988.1"
                     /db_xref="GeneID:16997345"
                     /translation="MTWRKPCIASGALTFLIYALIVIYRATSVLNGRSSGVQRADLPA
                     VDDSCVRSVSRALRRGSSLRNAKTLTEIWDRTLPVTSKDTRALKESLGFWCESDALWA
                     QRRIRLRRQRKRQTVTLEPNPSVFFYNNWEPDIGCALEERIGNNGDGGKWVCDPPAIL
                     NRGRLFREQLRLPYRCIVYSFGSNNDFSFETKLHERLPDCDFFVFDPTSSPPSAMHSE
                     SFLERVRFFRRPLGPAESNNSLAEIMSGLGHLELPNVVEVLKIDIEGGEFTSFLGAFR
                     AADKLLRQGRSQRELSSEEQYALRTWHALRHVNQVLIEVHAGIASIPEVDEFFQGFMH
                     AGFAIFHKEPNLYGCCGSCEEYSFIRMHDSFFEFKDTIHP"
     misc_feature    complement(963460..966576)
                     /note="repetitive element"
     gene            <966795..>967931
                     /locus_tag="CYME_CMS383C"
                     /db_xref="GeneID:16997346"
     mRNA            <966795..>967931
                     /locus_tag="CYME_CMS383C"
                     /product="similar to methyl transferase"
                     /transcript_id="XM_005538932.1"
                     /db_xref="GeneID:16997346"
     CDS             966795..967931
                     /locus_tag="CYME_CMS383C"
                     /codon_start=1
                     /product="similar to methyl transferase"
                     /protein_id="XP_005538989.1"
                     /db_xref="GeneID:16997346"
                     /translation="MVPEGACSAKELTENDQLRQIYAIYYGNRKAAVLAVAQRYRVFD
                     FLEAREPAGATLDDIVQAYGFSVRGTKALLLALEYLNLVKIANDRYFLAPSSRQFLVS
                     TAPESVAGLIDLEFSEFITPSALDQALRSGRPQVYDAVPDVWQQHQQDTERCVRFTAA
                     MHAISSGPARAMVQRLALEPHWGLHASLATRPHRLLDVGGGSGCYAIEWMRHAPVPNS
                     EADVLETPACSRVTQHYIDEAASSIQPNRIRVLPGDMFTEEAYGDANRYTHVLLSQIL
                     HDWPVRSEASSAPRRDGERLVELAWRALSPGGVLVVHEKLVHDEDSAMVTIDMLHWTQ
                     GQQYTEAMMRELLRDAHFIEVRFRKTPHTYWWLALAQRPFTPST"
     gene            complement(<968375..>972994)
                     /locus_tag="CYME_CMS384C"
                     /db_xref="GeneID:16997381"
     mRNA            complement(<968375..>972994)
                     /locus_tag="CYME_CMS384C"
                     /product="MAP kinase kinase kinase, cdc15-like
                     epsilon-type"
                     /transcript_id="XM_005538933.1"
                     /db_xref="GeneID:16997381"
     CDS             complement(968375..972994)
                     /locus_tag="CYME_CMS384C"
                     /codon_start=1
                     /product="MAP kinase kinase kinase, cdc15-like
                     epsilon-type"
                     /protein_id="XP_005538990.1"
                     /db_xref="GeneID:16997381"
                     /translation="MEYGNSFSKKLSDRKYRAGNQEKETSGSPGSGERNAGRAKSPSR
                     AKQTSNIAQTLSTARRPSSVPRSLLRTRANTEVKTLCSSTGEVLYYLGEQLGRGAYGV
                     VYKAIEISTGYFVAVKQIPIEHMGPADREAVRNEIELLSKLNHFNIVKYSTVLHDERH
                     ISIVTEFMESGSLAGIVRRFGPLPETLIAWYVSQALKGLTYLHEQGVIHRDIKGANIL
                     LNKRAFVKLADFGVATKLMRSDTETLWSSGSASAGGPAAAPSIAGSPYWMAPEIIEMS
                     GYGTASDIWSIGCTVIELFTGYPPYYELAPMSALFRIVSDEHPPLPPNVSEGMADFLL
                     QCFQKDAERRPSAEMLLRHPWLVKRTSELKRAESRLMEASSDSDESDSVDTYPGNQPR
                     RQQKHRRGSSKHSAIASHHENEPVPHLPVPPPKSVNVQVPSEDSLMDEELDDAPAAED
                     LDEEEPDIAEDFDSMTLRSAEDLAAFGNKAPTTERLSRPAEEHQDGVSGGTADPNGVP
                     SQRRAALLASMAPHAAPASMKQSSVGTDHPQTSAHHDKQRGSIAGSTPPVRISVETLE
                     MFAEKEETYDDLGIENEDLLLEELQRWRQSLHTTRFSVSVDMPSSDETDSETDTPDLT
                     PDSEVAGDRSRNRTSSPVSRSRLRQSRERSLSLRHSFPHVGYQSQSLSLFSSPSISSA
                     ESEGDSLNPPTASTLVQVGDVSQAARLQPTEPADADTDANAIPRQRRRSERKLRHSDS
                     LPRDRYERLVWEEISRKISALVRADLTLGDSKQRAVEAANSILELFREVQPQRFYLVT
                     HHLLIPLMEVLDASGIEEQVLVERILAFLNEAAATMPGVPDSTAEGRAFREHLCIAGI
                     VPILVEFSARTYNDRVRMQSAHLLAKMLHIDVEDVGVHEGKVACAPSAQDAGSETASD
                     RRTFAFAYNQKRLDTAAVLDESDVRFIETFIASRGLRVFVHLLEPDFSRYWEMTLIAL
                     RGVALVMQTESQRRRHDICRLLARDGFLDRLSEALEWCIEWLAHKPAPSVEQQKLDHE
                     SPTKARQTHALHEEHVEHLVSRLVELWLLFPPADSVIEKHMARRSVLQPIVHILPALR
                     DQRDQLSVLNSLRDLSGHQESHRALQTSGAITVLVGMLEHSMLLDGRIIITLFNLCRL
                     RGPLETRERQEEAVCAHNGKLVRYLLQLARAGGGAIAGTGPVSQTPSGTGAGSNRNHP
                     GTACSEDAPGQSGEHPLRGFAIEILCALDCSSERIRQVLWQNGVTGFLIGELLGTVVR
                     QQRLRASKEAEAVSLAPAAAATRPPSAANTLSERGASITAPEASPRDDDMRVSHLLTS
                     HQKAILESLVTWMHASKTSLRQIEDVLLLLPHEPLSADAGSVSTFLQVLAELPFCNAE
                     TRSPRAPVTAAAKIADSNCEASGSQWLPLQHQSSSACHAEYILGPYREMIEASARFRD
                     ALSAYQGGIFCRRLARLALGAQKADVRRQALLTLSALMQSADPEVLAVLQQLAVAERS
                     VLLQPEVKSILERFGYTIDTALRETSPRALQVGSASDVTASAPEA"
     gene            complement(<974542..>975573)
                     /locus_tag="CYME_CMS385C"
                     /db_xref="GeneID:16997382"
     mRNA            complement(<974542..>975573)
                     /locus_tag="CYME_CMS385C"
                     /product="proline iminopeptidase"
                     /transcript_id="XM_005538934.1"
                     /db_xref="GeneID:16997382"
     CDS             complement(974542..975573)
                     /locus_tag="CYME_CMS385C"
                     /codon_start=1
                     /product="proline iminopeptidase"
                     /protein_id="XP_005538991.1"
                     /db_xref="GeneID:16997382"
                     /translation="MKTFLYPPIEPFDSGFLQVSSLHTIYYEQAGNPTGTPALFLHGG
                     PGGGIEPVNRQFFDPQHYRIILFDQRGSGKSSPHAELRENTTWHLVEDILRLRLHLDI
                     REKMLVFGGSWGSTLALTFAVTHPEMVLALVLRGVFTLRHRELAWFYEGEGADRIFPE
                     AWQEFVEVIPPEERAFQAPPGEQTLGVDQKARLALTEAYYRRLTSANMEERLRAARAW
                     SIWEGRTSHLRAAADVARKFETPEFAEAFARIECHYFMHGGFFERDGWLLEPSQCARL
                     QNIPCTIIQGRYDIVCPFETAWLLKKQLPNAAFVVVEDAGHSAMEPGTQKHLVEATNR
                     YRTLARQTL"
     gene            <977353..>977610
                     /locus_tag="CYME_CMS386C"
                     /db_xref="GeneID:16997383"
     mRNA            <977353..>977610
                     /locus_tag="CYME_CMS386C"
                     /product="anaphase promoting complex subunit 11"
                     /transcript_id="XM_005538935.1"
                     /db_xref="GeneID:16997383"
     CDS             977353..977610
                     /locus_tag="CYME_CMS386C"
                     /codon_start=1
                     /product="anaphase promoting complex subunit 11"
                     /protein_id="XP_005538992.1"
                     /db_xref="GeneID:16997383"
                     /translation="MRCRITRARLVAAWTWNANDDLCGICRLPFDGTCNACKTPGDDC
                     PLALGECRHAFHLHCILKWLSSETSRNHCPLCRQEWQFQQR"
     gene            <977502..>978353
                     /locus_tag="CYME_CMS387C"
                     /db_xref="GeneID:16997384"
     mRNA            <977502..>978353
                     /locus_tag="CYME_CMS387C"
                     /product="similar to PRIP-interacting protein with
                     methyltransferase domain"
                     /transcript_id="XM_005538936.1"
                     /db_xref="GeneID:16997384"
     CDS             977502..978353
                     /locus_tag="CYME_CMS387C"
                     /codon_start=1
                     /product="similar to PRIP-interacting protein with
                     methyltransferase domain"
                     /protein_id="XP_005538993.1"
                     /db_xref="GeneID:16997384"
                     /translation="MQARFPPALYSQVAFLGDVAEPLPSMSTGVAVSATVTASEQEQS
                     TARDARVRRRGTERHVTRRVKRRTIDRYVARKHILWSRFDEGIQMTWNSFYEVTPEPI
                     ALHIATRFQTRIADSLLVADLFAGVGSNAIAMARLLTKDAPQRLPYVVAVDHNAVKCE
                     MLQQNARIYGVAQRIDVVIGDAFAFVRRWRRMFDGGFASPPWGGPAYRRRPVYNLDAM
                     RPYCASEIFRLGWQVSPNFAVLLPRNSDVSQLAEIARRRPLEVEENWLEGRLITLTVY
                     SGALVQP"
     gene            complement(<979727..>980596)
                     /locus_tag="CYME_CMS388C"
                     /db_xref="GeneID:16997367"
     mRNA            complement(<979727..>980596)
                     /locus_tag="CYME_CMS388C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538937.1"
                     /db_xref="GeneID:16997367"
     CDS             complement(979727..980596)
                     /locus_tag="CYME_CMS388C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538994.1"
                     /db_xref="GeneID:16997367"
                     /translation="MSSRVGLSSWSVSAGCARTLRRIYESAPLLVQLQTSKFSGTRTA
                     ERCVRGFKSRCGAADALRVQQRWTSGSVNKSNAATTSDQGEDLTLSTKPGRTQSWWTS
                     WFQRIGLAAQRHEPNFLLRVLGYYSEESQALRLGKTLYRDTLREVEAWQRRLYGEISG
                     DKPVDVPLAAWVQLTSLHLWVTIYRLRAEGEFGRQVSQALYENFWPHLRQRLAKDLGL
                     GLVEASKQMRECEHMFFGAAIRYDEAWLNKDQEAFIAALQRNIPRIGAEQARVLYDHV
                     AQQLRIGRLHLER"
     gene            complement(<982874..>983545)
                     /locus_tag="CYME_CMS389C"
                     /db_xref="GeneID:16997368"
     mRNA            complement(<982874..>983545)
                     /locus_tag="CYME_CMS389C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538938.1"
                     /db_xref="GeneID:16997368"
     CDS             complement(982874..983545)
                     /locus_tag="CYME_CMS389C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538995.1"
                     /db_xref="GeneID:16997368"
                     /translation="MSRDSIVNEERSTKLRVLCACAFMTVCASYQNIMQGERMLCGFL
                     VAPVPVSRSQATAQALEGTRRSVNGYRSAPVTWRQRARFAVRPATFQSYRMNVDEKEK
                     VKQQKKVREKRTSKEIAKELLTLYGPVYLGTSISFAAVSFTFFYVLVSTGVDVRQFVE
                     SIGDLLAKTPLGRPAVLDQLSPQVGTVALAYIAHKATSPLRFPLTVAAVPFVAKLFKK
                     RSEVS"
     gene            <983887..>984792
                     /locus_tag="CYME_CMS390C"
                     /db_xref="GeneID:16997369"
     mRNA            <983887..>984792
                     /locus_tag="CYME_CMS390C"
                     /product="probable essential nucleolar protein required
                     for biogenesis of the 60S ribosomal subunit; Brx1p"
                     /transcript_id="XM_005538939.1"
                     /db_xref="GeneID:16997369"
     CDS             983887..984792
                     /locus_tag="CYME_CMS390C"
                     /codon_start=1
                     /product="probable essential nucleolar protein required
                     for biogenesis of the 60S ribosomal subunit; Brx1p"
                     /protein_id="XP_005538996.1"
                     /db_xref="GeneID:16997369"
                     /translation="MKRVLVMSTRGIGNRGRHLMLDLRTIMPHSKKEQKLDTKDRLDT
                     ANEVAELHSCEGCLLFEARKRKDLYLWAARTPRGPTVRFEVQNVHTMGELSLVGNALR
                     GSRPILVFDQSFNENAAIHVQLIKALLSQIFSVPCGHKKSQPFVDRVLAFMHTPDGRL
                     WVRHYQIQLEALRQQSKRMPAVRALSQLVSGEQAFDTNTTHLSAEDMQALAETLVEIG
                     PRFVLLPIRIFAGSFGGRTLWENPDYISPNMLRRAARIRGTVAVRAKRHTKRARREAQ
                     LEKALANLPVDELADVFESGEIEPS"
     gene            complement(<985660..>986538)
                     /locus_tag="CYME_CMS391C"
                     /db_xref="GeneID:16997390"
     mRNA            complement(<985660..>986538)
                     /locus_tag="CYME_CMS391C"
                     /product="similar to leucine-rich repeat-containing G
                     protein-coupled receptor"
                     /transcript_id="XM_005538940.1"
                     /db_xref="GeneID:16997390"
     CDS             complement(985660..986538)
                     /locus_tag="CYME_CMS391C"
                     /codon_start=1
                     /product="similar to leucine-rich repeat-containing G
                     protein-coupled receptor"
                     /protein_id="XP_005538997.1"
                     /db_xref="GeneID:16997390"
                     /translation="MGNVLADCFGARSREASHPLHSRNEDESAQRWLQTGVASVQSIH
                     WDRAVPQLLKHGERVRVLYARYGGVKTFPSSLLEHLRSLERLDLSENELVTVPAALLY
                     ALPRLWSLNLARNAIGDLHTTEHRANLSVQAQHEPDPVSGVKPTSPLQWLSLSDNRLP
                     CVPDACRNIVFPCLRYLNLAGNHISSLPKWLSKSFPALEVLILSRNELQTLNIESLRG
                     LQNLRQLCLDHNRLESLPVDLFIELGALQRLELEGNRGHLAEAPTAALSEMVGFTDFD
                     QRRRQVQNKRLSATAS"
     misc_feature    complement(986685..989652)
                     /note="repetitive element"
     gene            <989894..>990859
                     /locus_tag="CYME_CMS393C"
                     /db_xref="GeneID:16997391"
     mRNA            <989894..>990859
                     /locus_tag="CYME_CMS393C"
                     /product="chloroplast 3-oxoacyl-[acyl-carrier protein]
                     reductase orecursor"
                     /transcript_id="XM_005538941.1"
                     /db_xref="GeneID:16997391"
     CDS             989894..990859
                     /locus_tag="CYME_CMS393C"
                     /codon_start=1
                     /product="chloroplast 3-oxoacyl-[acyl-carrier protein]
                     reductase orecursor"
                     /protein_id="XP_005538998.1"
                     /db_xref="GeneID:16997391"
                     /translation="MLLFANPAGIATFNVSKPLSNVFDLPRIARSYIRARPGAGGSLP
                     GSASAIPTLRARLRRSATGKAACGLVASVADVPKVALVTGGSRGIGRAVALELARSGC
                     DVVVNYASAEAAASEVVAQIQAMGREAIAVKADVSNQEQVEAMFAQTVERFKRLDVLV
                     NNAGITRDGLLLRMKKEQWSQVIDLNLTGVFLCLQASCKLMLKQRSGRIVNISSVVGQ
                     IGNPGQANYAAAKGGVLSLTKAAAKECASRSVTVNAVAPGFIATEMTHGLPLDEIAKG
                     IPLGRLGQPEEVAGLVRFLATDPAAAYITGHIFTIDGGLAIGASG"
     gene            complement(<992529..>993683)
                     /locus_tag="CYME_CMS394C"
                     /db_xref="GeneID:16997392"
     mRNA            complement(<992529..>993683)
                     /locus_tag="CYME_CMS394C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538942.1"
                     /db_xref="GeneID:16997392"
     CDS             complement(992529..993683)
                     /locus_tag="CYME_CMS394C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005538999.1"
                     /db_xref="GeneID:16997392"
                     /translation="MVHSRLCGCSEQRLYLAFASLGVRSHSSLRTVAAGTRPQYQPIP
                     SSRPAWRLSKLACRRYSVTHSGCASRLGTRCCAVVRQEAASQRAVLVGLEAADFRHPL
                     DALATRQMDFLTRITGLGALIRRVIGPVAEQVLEIENISSGVLVGPEQLPSLYALLTE
                     ACEILHIDVPDLYIRQNPIPNAYTLAINGQRPFIVLHSALLDMGLTASELQTVIAHEL
                     GHLKCEHGIWITTANLLLLALGQLGELGRSLATMLGRRIFSWLQAAELSCDRAALLVM
                     QDPRLVISVLMKLSGGSATWASEMNPDAFLQQATRLDSVSRTRLGRQVRQRMQRSATH
                     PLPVVRARELDRWAHSVEYQRLLAGGQRRASRDQMRKAEVGKRDPPPKSS"
     gene            <994552..>996243
                     /locus_tag="CYME_CMS395C"
                     /db_xref="GeneID:16997393"
     mRNA            <994552..>996243
                     /locus_tag="CYME_CMS395C"
                     /product="probable electron transport flavoprotein"
                     /transcript_id="XM_005538943.1"
                     /db_xref="GeneID:16997393"
     CDS             994552..996243
                     /locus_tag="CYME_CMS395C"
                     /codon_start=1
                     /product="probable electron transport flavoprotein"
                     /protein_id="XP_005539000.1"
                     /db_xref="GeneID:16997393"
                     /translation="MTLVWSSLTRAIKQDLSRGRVLCTRCVSVAADERSCGESLACSP
                     RRGTLWTMDRCLRRCRERNLLASFRGTSAAALKHSLSQLWKACAHQRYSGTRVVKRSC
                     SCGVDYPDERPTTDVQHASTTETLQLAETTRHGTGACAALVHQRIPPYEASYSALAAR
                     YAERAPTLGSDLTPATRVLQFRSARKHDRRLETRRYLEHFTRGFADARVSPSVLVLAE
                     HARGNVAPATWAALRAAQQVCGGTLSSNGNDAKQTGHIEVLVFDRVDSDMGAVLKQLA
                     QVDGVSRLVLVCDGHCRYPVAEMLAPVIARWSAEQGYSHVFTGGSTFGKNILPRAAGI
                     LGIQPLSDIMQVCSPWEFVRPLYAGSILARVRLVPPSEPSSKTGWRCWATIRGTAFEA
                     AQLRHDDACPTELDITDKARQYLQDAAPPAVEWLQQTGANAERPRLESAHIVVTGGRG
                     LRDAEHFQAFVMELADRLGAAVGATRAAVDAGMCANELQVGQTGKVVAPELYIAVGVS
                     GAVQHLAGMKDSKVIIAINNDPEAPIFQAADYGLVGDLFEIMPALLEKLSNSHKK"
     gene            complement(995170..997246)
                     /locus_tag="CYME_CMS396T"
                     /db_xref="GeneID:16997433"
     misc_RNA        complement(995170..997246)
                     /locus_tag="CYME_CMS396T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461673.1"
                     /db_xref="GeneID:16997433"
     gene            996683..999527
                     /locus_tag="CYME_CMS397T"
                     /db_xref="GeneID:16997434"
     misc_RNA        996683..999527
                     /locus_tag="CYME_CMS397T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461674.1"
                     /db_xref="GeneID:16997434"
     gene            complement(<998982..>1000463)
                     /locus_tag="CYME_CMS398C"
                     /db_xref="GeneID:16997435"
     mRNA            complement(<998982..>1000463)
                     /locus_tag="CYME_CMS398C"
                     /product="1-aminocyclopropane-1-carboxylate synthase"
                     /transcript_id="XM_005538944.1"
                     /db_xref="GeneID:16997435"
     CDS             complement(998982..1000463)
                     /locus_tag="CYME_CMS398C"
                     /codon_start=1
                     /product="1-aminocyclopropane-1-carboxylate synthase"
                     /protein_id="XP_005539001.1"
                     /db_xref="GeneID:16997435"
                     /translation="MFLQSGVYREALFVRAQCRDRLLCSATSQQQQRSIRVCMQQPET
                     SSVLKSAAETLSDRGRALASRAPPRQIEWSFTAKQDAYDPQLKPNGYISLLVAENALS
                     AGPVLAQFQRERSDVLPRNECLQYDYMFGELRFRKALSQLFREHIFAASKGGPASAAN
                     PDNYLCAVGASAVLDLVFSALCDDGDAVLIPAPYYPGFDFDLSCRAKCIPVPVQTALH
                     NHHRLTRDALETADRTCRASGQRPRVLLLHSPGNPTGNILSTEELELSIQWCRSHGMH
                     LVSDEAYALSVFQSHAGRFRSVADVLAVQGLGNDVHVVWTFSKDLCMSGMRCGVLFTE
                     NQALLQAIRAPCLFSSPSRDTQAVLCRMLSDEQWLHKFFVANQRRLEEAYQVAVQAIQ
                     TSLGAEQVRIYPSQAGFFVWIGLQRFLREATWEAELELAERLFREARVLIYPGRVCHA
                     PEPGWYRCCFSAVEDTQTLQVAFERIACVLCPSKSSAPSSRVC"
     misc_feature    999610..1000224
                     /note="possible transcribed region"
     gene            complement(<1001603..>1002430)
                     /locus_tag="CYME_CMS400C"
                     /db_xref="GeneID:16997437"
     mRNA            complement(<1001603..>1002430)
                     /locus_tag="CYME_CMS400C"
                     /product="unknown ABC transporter permease subunit"
                     /transcript_id="XM_005538945.1"
                     /db_xref="GeneID:16997437"
     CDS             complement(1001603..1002430)
                     /locus_tag="CYME_CMS400C"
                     /codon_start=1
                     /product="unknown ABC transporter permease subunit"
                     /protein_id="XP_005539002.1"
                     /db_xref="GeneID:16997437"
                     /translation="MESTSSADTAGALPVSLGQLAVAYGFMLLSVMAIWLFEIGIELD
                     MVWASLRAAVQLLLVGLVLRWIFAANLPLLVFLAVSIMTLVAAWTASQRMHRPIPGMF
                     VAVLVSLLSGAGFVIVQTTWTVIGVKPFWMPRYFIPLSGMILGNAMNTVALLGERLQS
                     EVSSHEKEIEELLSIGASPKQAIAPALRASLRSALIPVVNSMLTVGLVSLPGMMTGQI
                     VGNGSTDTAARYQIVVYYMITAGSTLSASLLALLTYGKFFDHNSWRLVRETYTSGAS"
     gene            complement(<1002707..>1003996)
                     /locus_tag="CYME_CMS401C"
                     /db_xref="GeneID:16997438"
     mRNA            complement(<1002707..>1003996)
                     /locus_tag="CYME_CMS401C"
                     /product="unknown ABC transporter ATP-binding subunit"
                     /transcript_id="XM_005538946.1"
                     /db_xref="GeneID:16997438"
     CDS             complement(1002707..1003996)
                     /locus_tag="CYME_CMS401C"
                     /codon_start=1
                     /product="unknown ABC transporter ATP-binding subunit"
                     /protein_id="XP_005539003.1"
                     /db_xref="GeneID:16997438"
                     /translation="MVISTQGNVSGSVPNTLRAKPEQTLQASRPATRAVSAALDFCAG
                     VAAAVSGISVPGGYFPPFMSFSNRLSPKAGTDTLSVSNQESTREDADAVLSTAAASLA
                     TDLEYGSATERHHENIDPIRPVTRDSGAFVENYPSGTREVAIAFEGVTLSASTQAAGT
                     TRPILRNICFEVRDGETVFIIGPSGAGKSRLLRLVNRLEEPSGGQVRLWGTPVPAYPP
                     GELRGKLVGFLSQQPALPCLAHRRPGLLEALRRLVTRETLWELVLGKRRQRSSANTEE
                     PAKSALETLVRLGVVSRTELEQRLPEALHIAGLSRTILDRPLAALSGGERARLGLTRV
                     LLQQPRILLLDEVTSSLDAATAAQVLQRLSDWKERIRATILIVTHRLSEVTDGQLILV
                     RDGELFLRGDARALLGTADTAASIHRLLTGESLGATK"
     gene            <1004504..>1011133
                     /locus_tag="CYME_CMS402C"
                     /db_xref="GeneID:16997439"
     mRNA            <1004504..>1011133
                     /locus_tag="CYME_CMS402C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538947.1"
                     /db_xref="GeneID:16997439"
     CDS             1004504..1011133
                     /locus_tag="CYME_CMS402C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539004.1"
                     /db_xref="GeneID:16997439"
                     /translation="MPSRGARSKKPAKKTASAEEAAQRLPEHLAAGKFTSLADITSIV
                     LGARSWQSEAEAETRPLTTTASTAELQNWDEHAALVAQRLLKRDESTKLRALQELSTL
                     LQALEQASSERIADQAAYGAQYGAFLGNFATAFVKLTLDPSVRVRAEAVALAGLVVRL
                     YGKRSIALLPGMLPAWVGLLGDPSAQVAEAAARSFQDAFPTEVKRRRALLLVPHALIH
                     HATAQVQSSLAGNVPETLRQSADKAEMPLLHALVCVASTAEALATTLATKTTLSPADD
                     SELVAFLVHWLQHWVSEEGVQTLAVPLFRRYRQSLRVHEAFWRLAIISVDLFGELRQT
                     RDEHQGHSLIAALANACPDWESKASDGFSYLVSRLAWDELHASCQEQVWILLHRYVVR
                     IEPSSSSLARSISAKTLTSWLLGESIAGGRRQASAAERIQSGRVFRGLLPFLQALRIK
                     WLTSDAVRSDPVESASRHHWLESFEGMLLDELTTALLWRAPKTKFPPALVGSAYLDWW
                     QAALVAFLESALWVQQLSSRRERSDDRTALRARCRAALQRYLLAAEAFQRAPEASQSV
                     VQFGGRPADASLLHERFFDVLFYASVDACRSDLDATRSNWQIVGEELAAGLVVIVVIE
                     RAPAWYAKAVVAACERAVQGTSFATLESDQQPRWSLLGLDPGVIRTWSVEIMGGAFCW
                     ALNRFRRRKIGNGNAQHDDNHQQVHGTPAEAEVATTLLLLAWSQRAPASMLERALQYP
                     DPIQGRHRLNDFFHDAVSLLEHPSAENEHDDDDDDNEEEAVAVAALPAAYSHQLVAVL
                     GALAACSHSSEALSGPSSVLNARLEECPGAGRWLIELAQAARIRAASIEQGVPAGLWT
                     ATVFPRHLADQVEHLQCYCDQLDPARYSYYRRSETDAWPSVGLLLEYAAWPEAWLWST
                     STDWSTLRSSMDASVCRALRLGLWDWPQLASFQQGVHSAAAPWTAETRAWLYVRALLA
                     LEQHQSQEASDGHVFADVRPSAALERETLERVVLDALAWLLEDMERVLLAESCETQAP
                     DMLEAVQRFQRVLLELAATSKRPWQALLYDILYKCWVSDAEDSKAIAAQPGERVIEPA
                     WRPLQRLEEQQRQQRWRCSLLESLTPSLDDAASPLDATLWHLYLQFPWTRSWATARFI
                     GWLQRTDAATAASALDVAAAVLARLLDPEASTAACCDTIVTELAKAPLYAPATPTAFQ
                     VPLEQSAERQPTMLMRLLIWSSLVRERFWIRLQTDAAYFGRSVTAASFTRCTMAALET
                     GPVTGLQASGAVGEFALELLRYAAASLAQTLPVWVQSVLNDTSAERMRSATGLQHEPS
                     VQVAPQDVPKTLCASMEILGHAAAIPASYEHRADLLTYLRSALELLIEVPFTNLITSL
                     ERAPQQTSEEFHRGSSFVGKHATPDANTTRPAASATSVRRVSDAPSTPSSSSSAAEDS
                     NRQVLAVLFERLVRPSLDVFATDLGEEHWTWIGETATQALVTSLGWPVYAAALRCLYA
                     WHVRLVERASSTLLSEQMVSSIGQALWMTCYRLAEAYRDSLVTEAPCSPVAELNLPVQ
                     DALGYLICVFRPELERLALRSEDSAPQMMTALPCWREARDRWVTTRFGVKCESLLSSM
                     LGRFWCLTWLPYLVASKSTAVRSAVMQLLGTLWDALEAWLATSTLEGAQASLGTGHAG
                     TGASPADTRPGSIRFESDQRGAATALGRRPAEPEPMPCSSTSATYATETTPLEYSADR
                     RGTQLDGSVEHHDPLRTEASELSVAVSDLGIAENTVHLEALKGLATLHDALIQSCSEA
                     LFALTARFPSLDPTPEAASWEPLQTYFCAWLVLLRLQVTGSYPEASLVTPLGSRLPNT
                     LREGALWTLLDGLGRCWIRAAATITTRTPESSHSTSDAEAQCFREQLEMLLAGLTEQL
                     VLATSDPQWLAREIFWEPTDWRPAALGARLLFLTLLVQPLLAQRWFTDHVADRSLLQP
                     LELLSRTLLTGPLIARELEAIRQYAAHVHQTQHRENGETVPNASPSHTGVLSVQGSLA
                     AREILVRYHFEEVQLPVCLRLADTHPWRAPELVLAPAERSVVSLAGIERETRARSELE
                     ARYRRLFLHMTRILQHGVDRHSADAGTLLLQLGASATSSSTSTTSTLGTASCVPRQYF
                     APSALASAVVYWHQRLVSLLRDAPECPICYQVLHSRTGQVSRVRCPTCRYRFHAACLY
                     RWFSSAAHGATCPLCRSPF"
     gene            complement(<1011239..>1013491)
                     /locus_tag="CYME_CMS403C"
                     /db_xref="GeneID:16997440"
     mRNA            complement(<1011239..>1013491)
                     /locus_tag="CYME_CMS403C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538948.1"
                     /db_xref="GeneID:16997440"
     CDS             complement(1011239..1013491)
                     /locus_tag="CYME_CMS403C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539005.1"
                     /db_xref="GeneID:16997440"
                     /translation="MAPRRGERQTKRSAAASSRAQTEHVDDEGNLAVSDAYWGLGGDD
                     SAVNSDNFPDHVAETFGTRDGSPGDSSLGEGIGRRTRQRLAESEPRPPPSPLGRSTDT
                     SHYLFAVVDFARYDPDTPTSTTATAASTALGVRRDAGRTFSAGSATRADGNPVTAANA
                     MLSDLPNKQSPERQIFEGWLEGTGSAECGVVSAASVSPMEPPTLPPISASRAFAQDLA
                     VKIGVLPALRPARDVLIPAERLPNPIESGTEDIPENVHLQTDDELAQAKLFAPLRDPE
                     SERGTGIGTGTGTGTETGTGTGTGATGGGMLLLSERDRTSFRGYLSGARPTGQDGEHS
                     TLALQSQALNWDQDDIPPYVAHDGAGQLGPSTGTTPLERHIRCPKCSDPGLNKPVCPA
                     CRQRHHRMMKHAPDGRCQWGDACRLCTRRQRQRARQRSSLPSPWETPALGGDAASRQA
                     NLDAGARNAAFQAAAGVLTEQGLSDHGLLLTTARRTRRSQPHADRSTSEADPEAVVVD
                     SPSSGALDRRSASQSLRSRASADALELHRTCQACCATQVCGNCRKRHSRMMQRQGTCD
                     WGNHCRLCARKRRRQHQLQQQQQLQQQSTMNHRSQASTLAMQFNDQLADAVSGDARRA
                     PSEHAMTTHRRHMASEMSSTNSNNSTNNHHHIRSSLSPSLSGRVAGIAESTSPSDHAT
                     MEAVADAASSVLLTDTELLDAHELRRSSSSSSSSPSPSPLPPPPPPSSSSFSADLARQ
                     LFSTSASRMR"
     gene            1013857..1015712
                     /locus_tag="CYME_CMS404T"
                     /db_xref="GeneID:16997421"
     misc_RNA        1013857..1015712
                     /locus_tag="CYME_CMS404T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461675.1"
                     /db_xref="GeneID:16997421"
     misc_feature    complement(1015212..1017288)
                     /note="possible transcribed region"
     gene            <1016563..>1017372
                     /locus_tag="CYME_CMS406C"
                     /db_xref="GeneID:16997423"
     mRNA            <1016563..>1017372
                     /locus_tag="CYME_CMS406C"
                     /product="probable proline synthetase associated protein"
                     /transcript_id="XM_005538949.1"
                     /db_xref="GeneID:16997423"
     CDS             1016563..1017372
                     /locus_tag="CYME_CMS406C"
                     /codon_start=1
                     /product="probable proline synthetase associated protein"
                     /protein_id="XP_005539006.1"
                     /db_xref="GeneID:16997423"
                     /translation="MSVRWKRLQAQLGFLSSGLRMQHTISESKAQGERAQTIAERLCK
                     VRERIQVAALAAKRDPARVRLVAVSKTHAAGTVREAYDAGQRHFGENYVQELVEKAEQ
                     LPTDINWHFIGHLQSNKVRTLLSVPNLWCVETVDRPKLANTLNRLMDELRPDGGPIPV
                     MVQVNVSGEASKAGIEPAAAPELVEHILQACPRLKLLGLMTIGSPDPSPEPVAFQRLS
                     HLRDQIQDRFRFQEPLELSMGMSDDFEAAVRMGSTNVRIGSTIFGPRVYPQ"
     gene            complement(<1017994..>1018464)
                     /locus_tag="CYME_CMS407C"
                     /db_xref="GeneID:16997424"
     mRNA            complement(<1017994..>1018464)
                     /locus_tag="CYME_CMS407C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538950.1"
                     /db_xref="GeneID:16997424"
     CDS             complement(1017994..1018464)
                     /locus_tag="CYME_CMS407C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539007.1"
                     /db_xref="GeneID:16997424"
                     /translation="MISLSGGVRAAILRDDFSHARSSGLVDTMMKTPGFWESSSAVQR
                     VAGFSGALAVALGAFGSHALPRRVSDPKLLRIWETGATYHLVHSLALALAARGGAFEN
                     RPAKVASLCFATGIALFSGSLYALTLTGKRRLGAVAPLGGTAFILGWVALALRR"
     gene            <1018740..>1019783
                     /locus_tag="CYME_CMS408C"
                     /db_xref="GeneID:16997425"
     mRNA            <1018740..>1019783
                     /locus_tag="CYME_CMS408C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538951.1"
                     /db_xref="GeneID:16997425"
     CDS             1018740..1019783
                     /locus_tag="CYME_CMS408C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539008.1"
                     /db_xref="GeneID:16997425"
                     /translation="MNAEAAQESQDLYAKDLRHVAQDYFVVRTLCKRLVVVELELYRA
                     RRLCRAWAQALTAQRQHTPPCMHEQQTSSELISAAAHGTCPYREAMLYLFRQVAETGS
                     VSEYLRDVEHRGARASSLKALLESRSPPTQWTRHESASADSSAASGLAHGNRVQSQRA
                     QARSANVSDGAERASAQRVPAPSSSEPAIMQGQQLPANVGTDLSQAGHSKRPLQFQTR
                     GTTGPEMGPSRTTTLAGFRAAQMPTNASASQQNRWPPWNEQFMEALMESERDTVAGLI
                     EQERLQTQLNLLRGVMMDLEVLLERCPCEDADGAIDCIDSADDDENSLPPLAENGHIR
                     SNKAEMSTNTFAC"
     gene            complement(<1020925..>1022250)
                     /locus_tag="CYME_CMS409C"
                     /db_xref="GeneID:16997447"
     mRNA            complement(<1020925..>1022250)
                     /locus_tag="CYME_CMS409C"
                     /product="similar to survival protein SurE"
                     /transcript_id="XM_005538952.1"
                     /db_xref="GeneID:16997447"
     CDS             complement(1020925..1022250)
                     /locus_tag="CYME_CMS409C"
                     /codon_start=1
                     /product="similar to survival protein SurE"
                     /protein_id="XP_005539009.1"
                     /db_xref="GeneID:16997447"
                     /translation="MYVALQATWKNRSTPWRFRTRAQRLRHWCTQRDQGTSRVLLKCL
                     PGGPCTKRGALWKMQHPTTTTELKPCVLLTNDDGVESVLLLRLAAALEEQYALDVVVI
                     APKTNQSACSHRLTLATPMELVHRADLKTGVYSLAGSPADCVITAIEPNGLLARLGKC
                     ARVVVSGPNLGANLAQDILHSGTFSGARQAGFYGLPAVAFSLAGEPLQRDSQEACVQG
                     AAFLVSLLVERLPLTPPNAGRLDPCRSLHLHGRSEHGPRPGLQTSTASGTASSVRCTP
                     RRHCDVCGKALAPATEVNRSVAADEDAASEDALDLVWSAFCYGDLVLNVNFPARWHWG
                     RWRTTHLGAIFYRDVFRSGAGQKPDSAEMVIIGAEGRPEPLYGFVNSDLVAIREGYAS
                     VTTLQTWPESHPLQANERIVEAMAVSDPQWGLPAWITLRVSPQELGRGR"
     misc_feature    1021615..1025542
                     /note="possible transcribed region"
     gene            complement(<1025063..>1025584)
                     /locus_tag="CYME_CMS411C"
                     /db_xref="GeneID:16997449"
     mRNA            complement(<1025063..>1025584)
                     /locus_tag="CYME_CMS411C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538953.1"
                     /db_xref="GeneID:16997449"
     CDS             complement(1025063..1025584)
                     /locus_tag="CYME_CMS411C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539010.1"
                     /db_xref="GeneID:16997449"
                     /translation="MHRHIGRFAIITVYLVFFLSFLCTHIEGARPVLPFFDSLTEQDL
                     TLLRLSDANVTTFALPDSHLNFDTWDLHCTKTELACAAESSSSAEFRNCSYTASGGCN
                     LLVLGLEEAIDLPDTRQYNLTVSVLRSGSEYFFCFDGRVSCAYATGRQAIRYYYSGCD
                     GSLDHCIRLQPAT"
     gene            <1027907..>1029181
                     /locus_tag="CYME_CMS412C"
                     /db_xref="GeneID:16997450"
     mRNA            <1027907..>1029181
                     /locus_tag="CYME_CMS412C"
                     /product="actin-like protein"
                     /transcript_id="XM_005538954.1"
                     /db_xref="GeneID:16997450"
     CDS             1027907..1029181
                     /locus_tag="CYME_CMS412C"
                     /codon_start=1
                     /product="actin-like protein"
                     /protein_id="XP_005539011.1"
                     /db_xref="GeneID:16997450"
                     /translation="MRTIAPKPKRRCAYSRFSFETGWDLHVRSQSLERHHPQHMISDK
                     PAAVVDFGTGYVKAGFAGDTKPRVVLPNCVGRPFAKAAAEPFVARSGGSALVVGDQAL
                     NKRATGLALTYPLQNGIVQDWEAAEAVWSHLFSVELGIDPQQHPVLCTEAPLNPRRNR
                     EQLATLVFEAFGVPAFFMVVQAVLALYATGRTTGAVLDLGDGVTHVVPVYDGYCLPHA
                     VRRLNLAGRDLTDLAAKLLNSECGLSTHSRPSVVREIARQVKEQHCYVAPDWEAENHR
                     FQQDPDAFLRRYLLPDGQELAFKELRFTVPECLFQPALMGMDAPGIHELLLDAIQKCD
                     VDLRRSLYGGIVLSGGSSLFPGLPERLHAELAKQIPGAGVQTKIVAGPDRRFAVFQGG
                     AVLAGLDTFEQMWITRAEYDEFGPQIVHRKCL"
     gene            complement(<1029800..>1031104)
                     /locus_tag="CYME_CMS413C"
                     /db_xref="GeneID:16997483"
     mRNA            complement(<1029800..>1031104)
                     /locus_tag="CYME_CMS413C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538955.1"
                     /db_xref="GeneID:16997483"
     CDS             complement(1029800..1031104)
                     /locus_tag="CYME_CMS413C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539012.1"
                     /db_xref="GeneID:16997483"
                     /translation="MFLAVSGRCLQVERAGLKHVGLKLHRRAGFCGDQVRFACRTTPK
                     RSGDVLRRLYASAPASESGNASAGTGASAGLSVAREGHIDQVGDKNGSAQLWLSFERR
                     FAALYAFTRPHTVRGTFLAALTGCIRAIIDSREQLLARSKSSAGSLVPAGRLGSEFLG
                     TLTGILVSLDWTLVPKALWGIFALVLGNAFIVGINQIYDRDVDRVNKPFLPLAAGMMT
                     TKQAWMLCIASIALGVWIVYRHFSRTILGLYLVGTTIGALYSVPPFRWRNVPLLAALT
                     IACVRGLLLNIGVYVATKEALRLNLSWTPALRLFIMIMSVFAGVIAVTKDLPDVHGDR
                     LHQVPTFASRLGVAKVARMASATLSSMLVGVAAISLMPEARFHFRVWVFGFGHLALSW
                     YFLTQVHGRLMRLGPENLEALRTYYKGIWNVFYLEFLLYIFI"
     gene            1031214..1033204
                     /locus_tag="CYME_CMS414T"
                     /db_xref="GeneID:16997484"
     misc_RNA        1031214..1033204
                     /locus_tag="CYME_CMS414T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461676.1"
                     /db_xref="GeneID:16997484"
     misc_feature    1034698..1035640
                     /note="repetitive element"
     gene            complement(<1036729..>1038876)
                     /locus_tag="CYME_CMS416C"
                     /db_xref="GeneID:16997485"
     mRNA            complement(<1036729..>1038876)
                     /locus_tag="CYME_CMS416C"
                     /product="ATP-dependent RNA helicase"
                     /transcript_id="XM_005538956.1"
                     /db_xref="GeneID:16997485"
     CDS             complement(1036729..1038876)
                     /locus_tag="CYME_CMS416C"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_005539013.1"
                     /db_xref="GeneID:16997485"
                     /translation="MKSRIRHASENSKRKQQADVVASRKRSARERPRACHSDLLARDA
                     DVSSVSATERLTSTASRPASGAAQVVARNAGAYGSSRTRTQAATFTDQLHAKRERCSE
                     SVKSASASTNAAAGNPNEDAGVSICELQRAELRTPAPVMETELQNAAARTPADEEVAS
                     SRATVHEMEPLARPCPEVTQKSSPALQSLSSEHASEQEQPKPSSGLLTPHRFDSLPLS
                     EPTLRGIEEMGFARMTEIQARAIPLALSGRDILASARTGSGKTLAFLIPIVELLYKAK
                     WMPRNGTGAIIIAPTRELAMQIFGVLHDLASHHHQTRAIVMGGANRRTEAEKLINGTN
                     ILVATPGRLLDHLQSTRGFVFEHLRFLVIDEADRCLEIGFEEEMHEILRILPKTRQTM
                     LFSATQTTKVEDLAKVSFQQKPLHLGIDAEQPVATVEGLQQGFTIVPSEQRFRLLFTF
                     LKRNQRKKIIVFMSSCNGVKFYAELLNYIDVPVLDLHGKQKQSKRTSTFFEFARREHA
                     TLLCTDVAARGLDIPAVDWIVQYDPPDEPKEYIHRVGRTARGVHGRGRAILFLLPSEV
                     GFLQHLRDAKVPLNEYEFPKEKLADIQTQLEKLVEGNYYLQKSARDGFRSYLQAYASH
                     SMKDVFNVHELDIAAVAKSFGFSAPPRICLDVLERAKKIRRRGGGGGFGDEWKNRDRL
                     KDLIRKRLASGQRFRASNPHGKRDEQDRRQFVS"
     gene            <1039396..>1040142
                     /locus_tag="CYME_CMS417C"
                     /db_xref="GeneID:16997486"
     mRNA            <1039396..>1040142
                     /locus_tag="CYME_CMS417C"
                     /product="mitochondrial ribosomal protein L22 precursor"
                     /transcript_id="XM_005538957.1"
                     /db_xref="GeneID:16997486"
     CDS             1039396..1040142
                     /locus_tag="CYME_CMS417C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L22 precursor"
                     /protein_id="XP_005539014.1"
                     /db_xref="GeneID:16997486"
                     /translation="MLACFRCLVWFRVCSASGVLRRTLRQRFCATTSGTIGSSSSAGQ
                     VTTEPAASTNVQRSGSSQIEGTQQTAPRTASAVARQVKISHRKLNVVCSLVRRLSVSE
                     AERQLAVCRKKGARILLKLLHQAMANARNNHQMDLARTFVRESFVGKGQCFKILRPWH
                     GKGRFAFHEKKYSHATIILEEANAAQDSSRSRDTRDTGRGFSWSAHRKAVKGERPLPP
                     LPAVWNLTVDPSGIYRNTHREPDDTNQSRG"
     gene            complement(<1042253..>1043362)
                     /locus_tag="CYME_CMS418C"
                     /db_xref="GeneID:16997474"
     mRNA            complement(<1042253..>1043362)
                     /locus_tag="CYME_CMS418C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538958.1"
                     /db_xref="GeneID:16997474"
     CDS             complement(1042253..1043362)
                     /locus_tag="CYME_CMS418C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539015.1"
                     /db_xref="GeneID:16997474"
                     /translation="MNPLDYRGLNFCAYPAWWGLERGAATGKTSLSPSVRWVRRDVTC
                     AGVSDWLGHSVNDQGSRQRPTNRPRFSVNGKRQPKGTRSLVCSKWFPFPGLSEDRDTQ
                     RDQRNKRSPDYAANAGTVIETLRSDYPHLFERDPNFEVYSPTITLVDRTSGNVLQGLG
                     AYKAVFWVLRLHGKLLFSERSIEITSLFHDEREGTVYIRWIMRGRLRRWVPLLGLGAF
                     RLRPEQDAPGWQESTSWEEETRIRQLEGYSMYYLNLDGWVEQHALDNIQHTRLRLRPL
                     VESILGLGTLQPLRGRQPALHLERLRSGVEWFMAYLRAQMALQTVPALEGSVYLWQEE
                     EANEPGTNEDNTQEAIRPWSDGGTQGPGPNGEPTA"
     misc_feature    complement(1044671..1046684)
                     /note="possible transcribed region"
     gene            <1046915..>1049851
                     /locus_tag="CYME_CMS420C"
                     /db_xref="GeneID:16997476"
     mRNA            <1046915..>1049851
                     /locus_tag="CYME_CMS420C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538959.1"
                     /db_xref="GeneID:16997476"
     CDS             1046915..1049851
                     /locus_tag="CYME_CMS420C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539016.1"
                     /db_xref="GeneID:16997476"
                     /translation="MDDQDNVPRKARRTAAASADDRAQPSGSVAITDTDNTGNTTPSA
                     QSVDLSENLMDSIPRREKQHMEKQSAPGTAGAETLDYEVPLDSPSLRWPEKTLSSTRA
                     QELERTLAAEPWNADAWIALVEEAQRHPLTEAKAVYERALHRFPTGARLWKLYLEHLI
                     REQAFPEAEKRFAYALPRCYSVELCQLYLHYLRTVKKAPISVLIDAFEYVTALLPYEP
                     ASASLWNDYIALLMAVPIRNAHDGAQRNRLLRSVLQRAVTLPLHNLDAFWRQFEQFES
                     SQGKSGSSHASVATQPFHGAFLRARAEARGRRARREHLQLQALAVPPRRGAGIMEQAK
                     RWAKYIRGEEANPHELSAAELEARLRFAHEQRLVYMYRMPDAWLEYALYLAHRDDGNL
                     VRSYPEAIAVLERAERALPDCLLVYFTLARLYEELDVEIARIAGQQKRKREYLQEEIE
                     RLGGSRLSNDDEAVGAPDERPSDADPDQSNGDDTGSGSRESHIASARQSGSPKHGSGA
                     SLAPSTDTKTAATEAQSERDAPAASKSSGAPASTEAAATGTKADTHSEGIGSRATAVY
                     ERLLARENLDAVQRTHAYIEYMWFSRRVLGVSAARSIFRRARHDPRCADIDALPNLYL
                     AAATLETYCNHESGVAKRIFELGLRHLPDSTEMALCYFDYLWQRNDGNELRMLIGRLL
                     QTTLPDDAKLLLCDRWLSFEARYGSGGLQGLRLAEAERKRLFSERQPSRLNDLLFYTS
                     FLQNVPLNDDERALIEQNTSDSKSGSLAEAPQRDAGFVPGGIIPSSALLYALGSNRPQ
                     ASSARRPDDAVIEAGQPVRKGAARAERKAPSPAVENIPEKLTLEEGLARLVGALPPAL
                     LQSAPPNPDFVIRHLLRLPASFQDLAVFNGGRELDSNAAGRRPGRDKERPSRSSGDTY
                     PSRTADASPVPFAESRLFQRLQRARQQTSRAPRPDAYGSGTDAAPASMQAPPPTRDIY
                     RSRHRG"
     gene            <1051008..>1051880
                     /locus_tag="CYME_CMS421C"
                     /db_xref="GeneID:16997477"
     mRNA            <1051008..>1051880
                     /locus_tag="CYME_CMS421C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538960.1"
                     /db_xref="GeneID:16997477"
     CDS             1051008..1051880
                     /locus_tag="CYME_CMS421C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539017.1"
                     /db_xref="GeneID:16997477"
                     /translation="MELASPTYLPEEDTRNEDDDLDGDEGTTLERGVDLPAPPLPRAT
                     YWLRGSWRSVLGDAPFGDAWLAEWSAWAAAPTAATPAPPGTSAALPAQPPSTEEKPPA
                     AGASASALAAAAAAAVDATSPERLVQEARSLLRAWFQEYRHGLELLEETRTPSPDARQ
                     ALHQTWTLCDGMLRALVQRLNALRAWQAALQLVYLSMDQVEAMRHQVEKIRYERAQRA
                     ASTCAGDQQVSIAAAADEAQTTCANVCQQQAVLHEQAPVAKNAATEALLATAELRMIE
                     KLQEIARQFPDVTE"
     gene            complement(<1051856..>1054849)
                     /locus_tag="CYME_CMS422C"
                     /db_xref="GeneID:16997455"
     mRNA            complement(<1051856..>1054849)
                     /locus_tag="CYME_CMS422C"
                     /product="chromosome assembly complex Condensin I, subunit
                     G"
                     /transcript_id="XM_005538961.1"
                     /db_xref="GeneID:16997455"
     CDS             complement(1051856..1054849)
                     /locus_tag="CYME_CMS422C"
                     /codon_start=1
                     /product="chromosome assembly complex Condensin I, subunit
                     G"
                     /protein_id="XP_005539018.1"
                     /db_xref="GeneID:16997455"
                     /translation="MARLSSRVAATAARSTSAPTERAANEALRERIIQVLETVTLSDS
                     STRDSSQALKAVWDVDATGSLCVLFELLKRCLVVYNKDTRVERIFDLIGTLALQTSKE
                     RPTDEPRDKENIPGGVDFVKEMLTFFTRLLAAQDKAVRYRSCQAIISIVQHVGEWLSH
                     DRASMTKVSRALLERTRDRVPVVRAQALIALHTLHLRQVQTLDEELLGVFERLVSRDP
                     SASVRKAALLQLATALHPSLVDAVVSRARDVDASIRLLVYQKIFAQRVNPKMLSIAQR
                     VELLRCGLSDRSMEVKKACLEEMLRKSWLECVCKGRLTDLLQLLDVEVHETPVLPALV
                     QMLVSCPDADCFRLVRRFAAEVQSSCQSTEEQIEQSVSQIDLNELNAERAAVAYVCAQ
                     ITAWKARNLERSLWPQLAASLLPCITDLCAALDYYHQHARTEVVDTSPLGMHAAHSPC
                     STSVCRASETARDAAEPRSYAFVVRMLLKVLRTLDMSDEAGRRLLLRTMEALIRSPRL
                     GPEELQLALEVLFRAQANVQETTRLVTELVAGLHSTAEADEDPDVTGKHSCLALSEAL
                     LQALLRYQSGLEQRHLLRHSQAANARSVLSRDLNAIVQTFMPLLVTLLSVCTLHHVTS
                     EDSSQRLTAMRVLGLAGLIDRSGQLSMQHSLLLLHVAEHDVEAVRLAALRALFDWLCT
                     HASEEGTAPDCSEISGESSTAVLETTTTTSPRQVLLDRLCSLLTAADTDALQGTVVEG
                     FAKLIFLRRLAPDAELIKRLLLLFFTPSTADNVALRQCLAVFFPAICLTGDPEHRYAF
                     EHAFLPTLRVLVKSPKDNPLATVSPVQAGQYLLFLLDPYRALSTESEQRIHAGAQGQT
                     ATVAGDGNVHLRLAIAMLNEILVEPRSEFAIACARLLQHLVLPQVLSDTDSLQTVATV
                     ERLVQSAMTEPVSALLRRLLDRFENRIRELLATAGCSESLDDTPHDCSASSVCAGNVA
                     SNETASIPRAGSCSPYSGHSVTSGN"
     gene            1055339..1057366
                     /locus_tag="CYME_CMS423T"
                     /db_xref="GeneID:16997456"
     misc_RNA        1055339..1057366
                     /locus_tag="CYME_CMS423T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461677.1"
                     /db_xref="GeneID:16997456"
     gene            complement(<1055825..>1057375)
                     /locus_tag="CYME_CMS424C"
                     /db_xref="GeneID:16997457"
     mRNA            complement(<1055825..>1057375)
                     /locus_tag="CYME_CMS424C"
                     /product="glutamate N-acetyltransferase / amino-acid
                     N-acetyltransferase"
                     /transcript_id="XM_005538962.1"
                     /db_xref="GeneID:16997457"
     CDS             complement(1055825..1057375)
                     /locus_tag="CYME_CMS424C"
                     /codon_start=1
                     /product="glutamate N-acetyltransferase / amino-acid
                     N-acetyltransferase"
                     /protein_id="XP_005539019.1"
                     /db_xref="GeneID:16997457"
                     /translation="MCDLVFRPYRSTSAETAGFDRERYYGVSGSMAFVVSPVPAFQRR
                     FVQAEPRFIQYHRKLAPARNLSYIRRGLLPPQRLCLQQRVEPALHESFRFLRDGSVTT
                     PEGFRAAAMAAGLKPSGAPDLALLYSPLPCIAAGVFTQSVLAAAPVRFCRAQLAQADQ
                     RVQAILINSGQANAATGTAGDIDAQQTAEAVARSLKISPAAVLLASTGVIGKRIPMDL
                     LLDAVPRIVELVSRADASSIGGTLAARAIMTTDLVPKHIAGEAFMPDGRRIRVGAMAK
                     GSGMIHPNMATMLAFATTDAEMKSTTWQKLLRNAADQSFNQITVDGDTSTNDTLLGLA
                     NGAAGVSIPDDERSIEYRVIRDLLTAVLQHCAKAIARDGEGANVLLEVRVSGARSDAE
                     ARQLARCVASSALCKAAVFGKDPNWGRVAAALGRAGVPFDPMHLEIALGPHQLMTAGQ
                     PVPYDAEAARRYLADAAAAGKNAETYNTAADTVTFEIRVGQGPGMGLAWGCDLSYDYV
                     RINAEYTT"
     gene            <1059938..>1061107
                     /locus_tag="CYME_CMS425C"
                     /db_xref="GeneID:16997458"
     mRNA            <1059938..>1061107
                     /locus_tag="CYME_CMS425C"
                     /product="NADH-dependent hydroxypyruvate reductase"
                     /transcript_id="XM_005538963.1"
                     /db_xref="GeneID:16997458"
     CDS             1059938..1061107
                     /locus_tag="CYME_CMS425C"
                     /codon_start=1
                     /product="NADH-dependent hydroxypyruvate reductase"
                     /protein_id="XP_005539020.1"
                     /db_xref="GeneID:16997458"
                     /translation="MARLQWRTFNSNGRHRVVVTKPLVGENWLETLLAADCRVDQCLS
                     ERILSRAELRDAIGSRCDGVVGQLTEPWDEELFRALKSAGGKVYSNVAVGFDNVDVSA
                     ATRHGIAVGNTPGVLTETTAEMAVALTFAAGRRLVEADAFMRAGKYKGWLPTMFLGKL
                     FYGKTLGIIGAGRIGSVYALTMARGCHMDVVYYDQFQNEQLERKVRETGSLYQQLGER
                     CISIRRAETVEELLEAADVVSLHTVLDASTRHMINNERLRLMKKDAVLVNCGRGPLID
                     ERALVQHCREHPDFRVGLDVFENEPKMAPGLASLPNVVVVPHIASATVWTRTGMSTLA
                     AANVAGIIRGDPVWNQPDVLAFVDAPSVAAMPRAAPSIVNAKELGLPQYKQMSRL"
     gene            complement(<1061414..>1062154)
                     /locus_tag="CYME_CMS426C"
                     /db_xref="GeneID:16997466"
     mRNA            complement(<1061414..>1062154)
                     /locus_tag="CYME_CMS426C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538964.1"
                     /db_xref="GeneID:16997466"
     CDS             complement(1061414..1062154)
                     /locus_tag="CYME_CMS426C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539021.1"
                     /db_xref="GeneID:16997466"
                     /translation="MGKGTGRGGICFADTKLVNCFLFVANILFILAGVVVLAVGALDQ
                     RGNAFSAYSQYKQTNPLVGSVARNAWLYIVAGAVLIGIGALGVLAHCAAKCCLGKLFY
                     FLYNLVLLLAFLFLGALCVIAWYAYGTTGPNGSNNISSNSWLMTVQSNPRFVCSQELH
                     YGCAGYNANQCSTSNPDVQYCPGISTGGSCRTSEELNAGRGCAEPINEAFRHDWFVLA
                     VTCTVALAVIVLCYLASCWRTFCTCCGI"
     misc_feature    1062813..1063420
                     /note="possible transcribed region"
     gene            complement(<1063396..>1065936)
                     /locus_tag="CYME_CMS428C"
                     /db_xref="GeneID:16997468"
     mRNA            complement(<1063396..>1065936)
                     /locus_tag="CYME_CMS428C"
                     /product="eukaryotic translation elongation factor 2"
                     /transcript_id="XM_005538965.1"
                     /db_xref="GeneID:16997468"
     CDS             complement(1063396..1065936)
                     /locus_tag="CYME_CMS428C"
                     /codon_start=1
                     /product="eukaryotic translation elongation factor 2"
                     /protein_id="XP_005539022.1"
                     /db_xref="GeneID:16997468"
                     /translation="MVNFTIDELRSLMDIPEQIRNMSVIAHVDHGKSTLTDSLVAAAG
                     IIAIEAAGDTRLTDTRPDEQERCITIKSTGISLFFHYPPDLELPKDSGDSRDFLVNLI
                     DSPGHVDFSSEVTAALRVTDGALVVVDCVEGVCVQTETVLRQALAERIKPVLTINKLD
                     RAFLELQLEAEEMYQTFSRVIENANVILATYQDAALGDVQVSPAKGTVAFSAGLHGWA
                     FTLTRFARMYAKKFGVDVEKMTQRLWGENYFNRKTKKWTTKSTDAEGEQLERAFCEFV
                     IKPVKKIIELCMSDQVEALEKLLSGLDVSLTNDDKQLRQKPLMKRVLQKWLPADQALL
                     EMIVTHLPSPVKAQKYRTELLYEGPMDDVAATAMRNCDPKGPLMLYVSKMVPASDKGR
                     FVAFGRVFSGTIRTGMKVRIYGPNYEPGEKKDLAVKNIQRTLLMMGRRTEAVDSVPAG
                     NTVGLVGVDQFLVKSGTITDEESAFPIKNMKYSVSPVVRVAVEPKNPSDLPKLVEGLK
                     RLAKSDPLVEVTMEESGEHIIAGAGELHLEICLKDLQEDFMNGAEIRVGNPVVSYRET
                     VEGVPDPLNTAVCLSKSPNKHNRLYIYADPLPEGVAQAIDEGKITPRDEPKARAKILK
                     DEYNMDEDAARRIWCFAPDTTGPNLFMDRTKAVQFLNEIKDSCVAAMQWACKEGVLCE
                     EPMRNIGFNLVDVTLHADAIHRGGGQIIPTCRRCLYGAQLLAKPRLFEPMFLVDITCP
                     EQAVGSIYGLFSRKRGMVTEEQQRAGTPLWILKAYLPVVESFGFTAELRSATSGQAFP
                     QMMFSHWELVPGSPLETGNLAYDFCKATRLRKGLKESVPDISNFYDKL"
     gene            complement(<1067272..>1068513)
                     /locus_tag="CYME_CMS429C"
                     /db_xref="GeneID:16997469"
     mRNA            complement(<1067272..>1068513)
                     /locus_tag="CYME_CMS429C"
                     /product="serine-glyoxylate aminotransferase"
                     /transcript_id="XM_005538966.1"
                     /db_xref="GeneID:16997469"
     CDS             complement(1067272..1068513)
                     /locus_tag="CYME_CMS429C"
                     /codon_start=1
                     /product="serine-glyoxylate aminotransferase"
                     /protein_id="XP_005539023.1"
                     /db_xref="GeneID:16997469"
                     /translation="MAPLTTKDVPVPYGRNFLMVPGPTNVPQRVQNAMHRNSEDHRSL
                     DFPKLGLAALEAIKKVFQCRQGHAFIFPGTGTLGWEAALTNCLDPQDQVISVRFGQFS
                     HLWIDMMKRLGLRPIELDVEWGEGLPMDRMEGLIQNDRAHDIKAVCVVHNETTTGVCT
                     DIPAVRRLLDKYQHPALLMVDGVSSIGAVPFKFDEWRVDLAVTGSQKALMLPAGLGFV
                     CASPRALERSKTAKLPHVYMSFQDHLRSNVDGFFPYTPSVPLLYGLVEAVKMLEEEGF
                     EQVWARHHKLAEGVRRAVRAWNLEICCRDPRLQSDTVTTVMLPQGVDGVQVVKVAFQK
                     YNLSLGAGLMRLRGKAFRISSLGDLNELTILGALAGVEMTLRECGYNGFKLGAGVAAA
                     AEYYQQHAVQARGFTEAMAKI"
     gene            <1071042..>1073294
                     /locus_tag="CYME_CMS430C"
                     /db_xref="GeneID:16997463"
     mRNA            <1071042..>1073294
                     /locus_tag="CYME_CMS430C"
                     /product="protein phosphatase 2A B55 regulatory subunit"
                     /transcript_id="XM_005538967.1"
                     /db_xref="GeneID:16997463"
     CDS             1071042..1073294
                     /locus_tag="CYME_CMS430C"
                     /codon_start=1
                     /product="protein phosphatase 2A B55 regulatory subunit"
                     /protein_id="XP_005539024.1"
                     /db_xref="GeneID:16997463"
                     /translation="MNGAGEIFDDLTHYRFAQAFGERATAEVPQEVDLISAVQFSRTG
                     DLIATGDKGGRVVILQRIDAGRGEALRREQVARATRRSRLVQRETSRIRGNSSSCSSQ
                     GRLSTGLSPVPIPRSPRIAVVGPRWSGSHSNGSYRRGSLDRSHLSNCHKLSRLQGTRA
                     RESYLDDSGGEHESDSSESSASESSTSSSDERSSAASTMEMVSPPAGVSHGANGDVDL
                     ELNECDVLMTSCADVDDRAFQERSRTHLLDALPGIRSTPHVPLDDEVWDDRERASDGR
                     NADGDDGLRPDRSRIPAFVPEYRFWTQFQSHEPEFDYLKSLEIEEKINQIRWCRDVSG
                     AYRLLTTNDKTIKLWRVFERQVRQLVSFDNQTGEADTRPESHQALRHHDASADPSSAI
                     RGLVERPAEDSSGLASAGIIAGRNVCLPRLRRAGSMVIAVPKRIFSNAHAYHINSISL
                     NSDEETFLSADDLRINIWNLENCSTGFNVVDIKPENMEDLTEVITAAEFHPHHCNLFL
                     YSSSRGVLKLCDLRVRALCDQSCREYEEPEDPANRSFFSEIIASTSDVTFSHSGRYVL
                     ARDYMTLKLWDINMEKRPLLTIPVHESLRSRLCELYENDCIFDKFQCAFSADDASVLT
                     GSYGNQFQVYSSKSGRGLCYEASVDFVSSGRPPRLLFPNGMSCSIETMTDASGSMGGV
                     SSSPPLLSASGLGPTISSGVPPEPLLPTQSPNARRVLHVAAHPLENIAAVAAGPALYL
                     YNAVLSPCFL"
     gene            complement(<1073372..>1073608)
                     /locus_tag="CYME_CMS431C"
                     /db_xref="GeneID:16997464"
     mRNA            complement(<1073372..>1073608)
                     /locus_tag="CYME_CMS431C"
                     /product="cytochrome c oxidase assembly protein"
                     /transcript_id="XM_005538968.1"
                     /db_xref="GeneID:16997464"
     CDS             complement(1073372..1073608)
                     /locus_tag="CYME_CMS431C"
                     /codon_start=1
                     /product="cytochrome c oxidase assembly protein"
                     /protein_id="XP_005539025.1"
                     /db_xref="GeneID:16997464"
                     /translation="MNDDHADLKTSSAPYRAEASEAGNHDGNPKPKKKICCACPETKQ
                     ARDSCIAERGEEACRDLIEAHKACLRAEGFNVPL"
     gene            complement(1074007..1076070)
                     /locus_tag="CYME_CMS433T"
                     /db_xref="GeneID:16997465"
     misc_RNA        complement(1074007..1076070)
                     /locus_tag="CYME_CMS433T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461678.1"
                     /db_xref="GeneID:16997465"
     gene            <1074437..>1074940
                     /locus_tag="CYME_CMS432C"
                     /db_xref="GeneID:16997509"
     mRNA            <1074437..>1074940
                     /locus_tag="CYME_CMS432C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538969.1"
                     /db_xref="GeneID:16997509"
     CDS             1074437..1074940
                     /locus_tag="CYME_CMS432C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539026.1"
                     /db_xref="GeneID:16997509"
                     /translation="MDGVLIPPLNFSMAAPGIYRSGYPNSMNHAFMKKLQLKTILYLC
                     PEDYSEANTAWCRAHNVQIVQCGILPNKEPFQFIPEDVVADALRVLLDCRNHPILMHC
                     NSGKHRSGVVIGTLRKMQGWSLTSIFDEYRRFAGSKVRILDQQFIELFRIESVTYDKE
                     YAPRWLR"
     gene            <1076280..>1077227
                     /locus_tag="CYME_CMS434C"
                     /db_xref="GeneID:16997508"
     mRNA            <1076280..>1077227
                     /locus_tag="CYME_CMS434C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538970.1"
                     /db_xref="GeneID:16997508"
     CDS             1076280..1077227
                     /locus_tag="CYME_CMS434C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539027.1"
                     /db_xref="GeneID:16997508"
                     /translation="MSAVYCARTETGRRKRFTIFHRKKTQMLTSLHWVTSSIWWTVLV
                     LLLAATLTNAASSVDQAAYPPLVPSRGRTLAVTFDKLGNASAGENSVADSAERSRDAA
                     VLLFRRQVHPPCKEAIVVLGGSVSGVPLVDQKTSQIEYEVVNLGRNTATDIRIYEYDA
                     NFPVVAFERKNWPKEKTGPASSERPGEYVLFELPTLLPGERFTRNLSIVPHTYRAGAA
                     EAALFEAPSFIEPVHVYKLHPARLTYRIGKQGAQRTGFSSTESYLVVESARGFDRRAL
                     WHPKAWVVYLGGVGLLGVVPWMSAYFGTKQAGARPPRTT"
     gene            <1080429..>1081514
                     /locus_tag="CYME_CMS435C"
                     /db_xref="GeneID:16997510"
     mRNA            <1080429..>1081514
                     /locus_tag="CYME_CMS435C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538971.1"
                     /db_xref="GeneID:16997510"
     CDS             1080429..1081514
                     /locus_tag="CYME_CMS435C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539028.1"
                     /db_xref="GeneID:16997510"
                     /translation="MGSLSSWFAAPRALRWTRLWLTLLIVLLGVHLRTDAALPVAEVA
                     SGDGTSESGSSGTQPNVPVRVQLPLEAKRQSLERERAELLRDAQLGRLSLRDPAVQEK
                     LRKLNEGLLRLQPLIRRNPANAESEQRPNSGPPPDHGTQSGEHRHRPHELGEELAIEC
                     LTPDLSSWEPMQCRNQQDPVVIRFGLDTDFQCSWPLESDAAYTLLRDALAMQRAIHCR
                     VPLDNELSAGHLRFFAPVTITLWGIAEGSHLHVNTHVNFVFHAHRGYILGAAAYSVRD
                     HFQIVQPGGVLQLHGKVHWFDGHAFVPYVHEPFRLPPAAARRLTSAVLALWLSTLVLS
                     GVVFTLFYKKVLKVRLIRRLDPTFKAE"
     gene            <1081519..>1082736
                     /locus_tag="CYME_CMS436C"
                     /db_xref="GeneID:16997511"
     mRNA            <1081519..>1082736
                     /locus_tag="CYME_CMS436C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538972.1"
                     /db_xref="GeneID:16997511"
     CDS             1081519..1082736
                     /locus_tag="CYME_CMS436C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539029.1"
                     /db_xref="GeneID:16997511"
                     /translation="MQSEGTVYRHRARCTLFVGVAAPFGLCTTKRHLGLLSAQRPSQR
                     YLRSGLGPVDSSMGSRSSARVSAALVHDTRWGVGTSAAQPRVSETILSRGLATIFSLL
                     LWQDLQDTAAYAAEHTRTQARAQWVNHHTEEATRWGSLPLLADSTQPQGQDGNLSTKL
                     LPDVVDTDGQPRVILDLARALSSFEYEQLRTRIHHIEATTGYRVRILTQRFETVGRAI
                     SSYFGLQDQRSILIVLDERSGNVLNFRVGDQVTARFPSSFWLELQGRYGNQFYVREHG
                     EYGVLDACIRAMETCLQDGRICRFVPGFGRDQWALSFLMSLLGGAVIGFTARTPQDGK
                     EASTPNWRWVLVFSPLWAIFLVSFGTLPIVAREGWWNRDLIANWAGAVLVATAFWYAI
                     PRVFPNGPGDRAR"
     gene            complement(<1083905..>1084660)
                     /locus_tag="CYME_CMS437C"
                     /db_xref="GeneID:16997504"
     mRNA            complement(<1083905..>1084660)
                     /locus_tag="CYME_CMS437C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538973.1"
                     /db_xref="GeneID:16997504"
     CDS             complement(1083905..1084660)
                     /locus_tag="CYME_CMS437C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539030.1"
                     /db_xref="GeneID:16997504"
                     /translation="MALNPLLPLATGQVTPAHNADGRGASRELGNPDLLVYRETTVSF
                     RLRAQPAANSSTQELCCSLELFGVGECFLTLQRLVFVWTPQPSVTLRAFEVPLSALGE
                     LRVLADWFWSSHNHLECQVLPFVESAFYPHAARLDIEAQMCAGLDEFYKALSRTLALS
                     RGVPNCQVPRSPGDLLPAPWCDVEPTARGISLASLAGSFREEWDALSTRFSFGDENPT
                     TVTMHPRPIAYADMRYRPPRIYLPMTVPKRLFF"
     gene            <1084801..>1088751
                     /locus_tag="CYME_CMS438C"
                     /db_xref="GeneID:16997505"
     mRNA            <1084801..>1088751
                     /locus_tag="CYME_CMS438C"
                     /product="similar to pre-mRNA splicing factor U2AF large
                     chain"
                     /transcript_id="XM_005538974.1"
                     /db_xref="GeneID:16997505"
     CDS             1084801..1088751
                     /locus_tag="CYME_CMS438C"
                     /codon_start=1
                     /product="similar to pre-mRNA splicing factor U2AF large
                     chain"
                     /protein_id="XP_005539031.1"
                     /db_xref="GeneID:16997505"
                     /translation="MPRTGSDRTKLSDTLSGTPQAERTVRRSCRLAQKTGLEPVVPPT
                     TSDRVRSARTESSSDPSSEPDKEPSSLKVCQRQRAGNRGTVSQKDGASETEQAPVAPV
                     ETPVRLPVVRRRSRRVQAAKDVPVSEPETATSKEHQTARDSAAPGMHHSANNANIPSA
                     QAGSASVAFAQTTRKVFPTEEPASDSRHPASASAESASASAESASAEERTPAISANAS
                     VLGTGAPTSPSNGVLAPDYRRSASTRDRRLSEQVDSARPRAEWLREAPPLSDACPSLQ
                     QPTAQWNRSQRKRDPCSDSLGTSGSPSRRRRVINTARASERVTSSTSVPPTPTLSPAS
                     TQALAASAASTADTGYTAAGKLDERCALSASTDDGGDVPAHRPCSSTAPAYRDASERP
                     AEKRCSTDVREYRSGHAASTWNAAHGRAAGLVPHSSQNSATQSAAAAAAAQVSHPVAP
                     KMRNQGSRCLSEHAQSESSPDLREMVLKQRIRRALASVREPLPTTAGDTGAEPALSDA
                     SCARFPVQQSTTVYADARSQMSCASGLDRPHGRSSNQQHQHEHHQQQLRIRQSSPQSQ
                     VARDAHRCAGAGPLEHQFRSRNCTPDDRHSSHRESPQRKRMPNERSAMIAQAPVRAVF
                     PAQGTALVDPHASKPLLMASKHEWALMASAKKASPSPMPLRAHVPAATEPREHYRPPD
                     IGRVADEAAKLVKAAAAAGAGVAGGGGASTEAEPPARMATRAALGVAAHSSDAEAELL
                     CMLWLHGPDVSSQPARRLILRNLPPSTNEHDLYSYLVHVMAATCCFAYDYIGWHQRFA
                     HWHAKQRRAAGMLAAAGRYRQQSERLPERNDARGPGVNESSRGQAQSSLLRELRLTPV
                     WELQVLWKSRTAFVECLTVQETTGLVQLSGLLFQGYQIVISRPREFDAELWLSSNPLP
                     AEAAEALRLPPARFHRAAVAESQMSPNVWPASDSRTPAGAFYGHIRGIPLHLTEYTMI
                     QWLRTALVGWPWQLSAFHLAREGRSGLSRGFAHFRLDRCRAADCTSLDQGVTNATQAA
                     SEMRTVASERLATVDPEVERLVEHLRSHLLPGLSRPLIIRQANPMHPRESKSTPEAPD
                     AQGEACSPRVPHHAASAADVSENASASMVTAHVDGRSTEASVLALVRLLRPELFADTQ
                     ERTEAIDDVTEELRQYGSIEEVALDERPNEPEAGTVYVRFTKAADAAAAADAMQHRRF
                     EQRPVNAELLSVFDMRARLGDTRSMQQTVVVLPEVVDPQAFLDEEERADIAMDIREEM
                     LQFAEKVEVEIPLPPHPEAGAAFIRFPDRVSAEKALSSLQGRFFDGRPVRPYLR"
     gene            complement(1091307..1093619)
                     /locus_tag="CYME_CMS439T"
                     /db_xref="GeneID:16997506"
     misc_RNA        complement(1091307..1093619)
                     /locus_tag="CYME_CMS439T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461679.1"
                     /db_xref="GeneID:16997506"
     gene            <1093928..>1094794
                     /locus_tag="CYME_CMS440C"
                     /db_xref="GeneID:16997507"
     mRNA            <1093928..>1094794
                     /locus_tag="CYME_CMS440C"
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /transcript_id="XM_005538975.1"
                     /db_xref="GeneID:16997507"
     CDS             1093928..1094794
                     /locus_tag="CYME_CMS440C"
                     /codon_start=1
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="XP_005539032.1"
                     /db_xref="GeneID:16997507"
                     /translation="MNVSRKPRFGAPGTLFFLNSAHSALWTPVASGNWSQVQSTTSFH
                     SAVPGCGRSTRSLVHRAGARWGLRALRCSSANAPMTIEGARIGPPPDLPSLLLHNRIV
                     YIGMPLTAPVCELIIAELLYLNYNDPDKPVYVYINSTGTMGLDGSTAGFETDAFAIID
                     TMNYIKPPVYTICVGSAFGLAAVILACGDKGNRAALPNASIMLHQPRGTARGQAADIA
                     IKAREIMYNRKVAMEILAEHTGRTAEECLKASERTKYMTPQEAKEFGIIDKILRSEKD
                     LPKDMPAFLKQL"
     gene            <1096411..>1097172
                     /locus_tag="CYME_CMS441C"
                     /db_xref="GeneID:16997512"
     mRNA            <1096411..>1097172
                     /locus_tag="CYME_CMS441C"
                     /product="similar to golgi SNARE protein, membrin"
                     /transcript_id="XM_005538976.1"
                     /db_xref="GeneID:16997512"
     CDS             1096411..1097172
                     /locus_tag="CYME_CMS441C"
                     /codon_start=1
                     /product="similar to golgi SNARE protein, membrin"
                     /protein_id="XP_005539033.1"
                     /db_xref="GeneID:16997512"
                     /translation="MLTSHGVYQGPSSVPVAVRSLDEVHREARKVLVELQSALQQAEQ
                     QQHHAQLATKGALKDLGVATLTAEALEAPRLKLQQLELVTAELSQLAERAPAAQRALW
                     QRRALQLETQHRELSSLWRQVYAAERQRQWHLRERESLLEGAEQHRSKSKADATIVDL
                     EQLATQSLEHASHSADGILGSGRDVLNALRQQHQTLKAVRRKTLDMAHRLGLSQSLIR
                     RVQQRARNDMRIVCGGLAAILALVCLLFYVKHYLM"
     gene            <1101865..>1102698
                     /locus_tag="CYME_CMS442C"
                     /db_xref="GeneID:16997513"
     mRNA            <1101865..>1102698
                     /locus_tag="CYME_CMS442C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538977.1"
                     /db_xref="GeneID:16997513"
     CDS             1101865..1102698
                     /locus_tag="CYME_CMS442C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539034.1"
                     /db_xref="GeneID:16997513"
                     /translation="MPSCYLFLVAILVFTVKLCEAIALEDDFCTTWPSVSGLRYWLRT
                     RDARCLRQQLARVLGYGVVAGAALVKLPQLLRILQNRSAAGISVATYLVESFGYAYNL
                     AYHYRAGYPFSTYGDFVLLGVQNCLIMALIFYFNNQWFPLGLLTLSSYITATVVASWS
                     QRAVPLAVLERLCSLNLAIVIGSRLPQILANARRKHTGSLSLATCLGLFGGATARVFT
                     TMQQVQNHTILVGYLASAFLNGILVAQILMYRKQTRTTPEVSGATMQETRARPRKSKT
                     S"
     misc_feature    complement(1102406..1103858)
                     /note="possible transcribed region"
     gene            <1104194..>1105516
                     /locus_tag="CYME_CMS444C"
                     /db_xref="GeneID:16997515"
     mRNA            <1104194..>1105516
                     /locus_tag="CYME_CMS444C"
                     /product="4-(cytidine
                     5'-diphospho)-2-C-methyl-D-erythritol kinase"
                     /transcript_id="XM_005538978.1"
                     /db_xref="GeneID:16997515"
     CDS             1104194..1105516
                     /locus_tag="CYME_CMS444C"
                     /codon_start=1
                     /product="4-(cytidine
                     5'-diphospho)-2-C-methyl-D-erythritol kinase"
                     /protein_id="XP_005539035.1"
                     /db_xref="GeneID:16997515"
                     /translation="MAFCFLNALSRSRPRSLRRQDPGRAPWTPRREDVVAYALRRRRS
                     AYLEDCSEHRSVSSEKSVQAHPEAGGHHREAFNGPVWSGEPHPATNLADFDVVLYSPS
                     KINVFLRVIRRRPDGFHELATVMQAISLVDRIGFQELPAGASADVLECNNAKVPLDKT
                     NLIIRALDTFRTHSGSRKHYRVHLDKQIPTEAGLGGGSGNAATALFAANRLCGEPASN
                     ADLIRWASEIGSDTAFFFSSGSAFCTGRGEQLHPIRPLAPTTVYIVKPRGVGLSTASV
                     YRALSLHQLNREDHLDPHVLCEQMERIGPLCAPLVNDLEGPAFALMPPLRHLKTFLES
                     FGFQRVLMSGSGTSFFALGCPDSVHSESFRNLVSNMGLQHAGPLQHLFPEGVDVFKCG
                     FIHRDAEHFWYMENPASTKDDSRFTGQPPPSPPHTASRPDCLGDSPST"
     gene            complement(<1106606..>1107415)
                     /locus_tag="CYME_CMS445C"
                     /db_xref="GeneID:16997516"
     mRNA            complement(<1106606..>1107415)
                     /locus_tag="CYME_CMS445C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538979.1"
                     /db_xref="GeneID:16997516"
     CDS             complement(1106606..1107415)
                     /locus_tag="CYME_CMS445C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539036.1"
                     /db_xref="GeneID:16997516"
                     /translation="MQVSCFVLRLTFLSVPLHSVHRRFVPVPASLRLERLDSGRLRSR
                     RTRVCVLATTHSSRAASRMDDSASAPARTDNARPQRFCTRCGAQLTIQTPIGDYRERA
                     VCERCALVHYENPKVISACVATSRDRRKVLLCRRALRPASGRWTLPAGYLEIGETSRD
                     AARREALEETNAAVLVGPLLAVYELLQAAQIQLVYRATLERDWTPADYRQNAETLEAR
                     LYGWDEIPWDMLAFPTVAWALRYARSTLHVPDSTLVPEIRVKSASGEQFIV"
     gene            complement(<1109431..>1112505)
                     /locus_tag="CYME_CMS446C"
                     /db_xref="GeneID:16997517"
     mRNA            complement(<1109431..>1112505)
                     /locus_tag="CYME_CMS446C"
                     /product="thimet oligopeptidase"
                     /transcript_id="XM_005538980.1"
                     /db_xref="GeneID:16997517"
     CDS             complement(1109431..1112505)
                     /locus_tag="CYME_CMS446C"
                     /codon_start=1
                     /product="thimet oligopeptidase"
                     /protein_id="XP_005539037.1"
                     /db_xref="GeneID:16997517"
                     /translation="MTIEASDAGGNGASAVVSAAASDGVPDSRDAVNARKSRWSAVLD
                     WARSPWLALRTEYLQMNGSTPWFVPALSGSAIVVALLGTVVVVRAYRRRQDVQKGRVG
                     INASAGTDPAAAQRTRRAAYRTRAPDAERLSEFGQDSEVERSISQHARTERSEKRLSV
                     GHTCPKHIAFRVDMSVADIKAETQRIIAEERALADHISSLYELVRGGAPLLKPPLDFD
                     HTFQLWADMEAKHAARRSSVTFPSFVSPHSDIRAASVEAQRELAKLDVELSSRADVYR
                     VLRPIADEYEIQLRDALRRQRSSLHAPVASRESRREQLRHKRESILEQAAHDQDYDDF
                     GRQTPLGAQAAAALGLTLEHVRYMRFTVRDLERHGAHLDDQLRERLVDLRTRIADLCI
                     EYQRNLNEENTRLWFSAEELAGMSPTFLEGLRSRPNPAKPEELEFEVTLKYPHYFPIM
                     KHCSVEETRRILEKLFHSRCVPENVFLLEETVRLRDEAAKLLGYPSHAAFVLEMRMAN
                     SPENVEAFLHRLSKRLDKAAHAELSELRRLKRKDNLERYGVLLGLEPDNEIRMWDLRY
                     YMTKYEEQQLQIDHTKIAEYFPLERVLSNMLDIYQELLGLRFVHLTQGQRWHEDVRLF
                     EVRDAQNAALLGYFYLDLHPREGKYGHAAVWPLQPSCVRPSKVQETTAPRGKVGTPST
                     GTSHVHRASETATNALQLNAMHSADGERQVPVAAMVANLSKSSGGRPSLLRHEEVVTL
                     FHEFGHVMHHLCSKPRFARFSGTRVERDFVEAPSQMLENWCWDRQALERLSGHYERLA
                     PRTPRDDGQSESAGAGAGTGGALVPEPLPSTLIERLQQTRRCLIALQTRRQIVLALFD
                     QALHHAPTREKLEREYGADRRNSRNRSRSRASGHRNSQQQQQQQQQQQQQLSSSSEML
                     VDGIDTAELLALLQRRIGLVPMTPGTHMGASFGHLMSGYDAQYYGYLWSEVYACDMYA
                     QAFADQPLDPKAGYRYRQLVLAPGGSRGANEILHDFLGREPHEDAFFRLRGL"
     gene            <1114958..>1117027
                     /locus_tag="CYME_CMS447C"
                     /db_xref="GeneID:16997518"
     mRNA            <1114958..>1117027
                     /locus_tag="CYME_CMS447C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538981.1"
                     /db_xref="GeneID:16997518"
     CDS             1114958..1117027
                     /locus_tag="CYME_CMS447C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539038.1"
                     /db_xref="GeneID:16997518"
                     /translation="MRLIALLSGGKDSLYAAIYAQYVLGHEIVAAVNLYPTGPERPPE
                     AVAGTDLVAWTDEVDSAMFQSVGAHVVGAAYADCLPSSIRWYRAAFEALEFHTDHGLR
                     YRLAPHASALETPADEVATLHRVVGALLDNFEVQGLARPEGLLSGAILSDYQRLRIEH
                     VASQHQLVSVAPLWRRDARELFDSICALGIEAIIVKVASLGLDMAHLGKSLYQVREHL
                     MQLETRYGVHCLGEGGEYETLVLDSPWFRQRLVIDASSPVDHGSGSAYLRIERFHCEE
                     KPAAMRADQQAQFSDWMQRERARPLWVFPLPLNGISFRKSIPTVLAPAGDANASAAER
                     TPRSPMFQVRYRERLWHLSDDHRFYVAVCWVESSADVATHPTDPRCAVLAPPGEAARQ
                     TELLLLHLRQRWPDAACRPFQCLLFLANMQDFAAVNAVYAHYFAAEDAPPVRCCVQVA
                     SLPHPTSLVQLEVFAESVDLHGKGIHVQSLSLWAPACIGPYSQARIQHQGTTLYLSGM
                     LALFPGTGEIPEGLSLPAQIEACLWNANRVVEALDDRGMKRPWQCRLCIAWYKAGSRD
                     SAETHGRLIHEMLHKRLPRAQRFVLGVPQLPRNALVELQFVYERREAEFHGTHCPVIP
                     QIAHDFLSWDTEDFEGAPQKLDASPGSSFHVCIPVLIPHSVYGSACTRLRCYLPPGKA
                     PDKPSAL"
     gene            complement(<1117728..>1118957)
                     /locus_tag="CYME_CMS448C"
                     /db_xref="GeneID:16997519"
     mRNA            complement(<1117728..>1118957)
                     /locus_tag="CYME_CMS448C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005538982.1"
                     /db_xref="GeneID:16997519"
     CDS             complement(1117728..1118957)
                     /locus_tag="CYME_CMS448C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539039.1"
                     /db_xref="GeneID:16997519"
                     /translation="MFQALLLARLGGGVLSLLALTLSLQNIWLHLRHYVRPEYQLYIC
                     RILGMVPVYSLSSWLSLLIPEMALYFDLGRDSYEAYTLYSFVALLINVAGGERSLAYL
                     LELKPPLPHPWPMNWCFQPEVLGARFLQKVRLAVLQFVLLKPLTAAVAVLLNRHGWYV
                     QPKTPTASPFWCYGYPYIWIVVNLSVSWALYWMVMLYLATEDLLQAFRPLPKFLCVKA
                     VIFFSWWQGVVLGLLVQWHWLTDVGDFTSDSVATGIQDLLICLEMFVAAIVHHFVFSW
                     RDFEDYAPDPSRAVLRNFGELVDIRDMLSDAKNALYGPRHEKELRDREPMIPKSHLTS
                     FGEVYRHSSSLETAATNQFMSAGKREDVEGARTARALREAAKQLRRTDGSLRWERAPD
                     AASTSGSTALPESLALP"
     gene            <1119212..>1119823
                     /locus_tag="CYME_CMS449C"
                     /db_xref="GeneID:16997500"
     mRNA            <1119212..>1119823
                     /locus_tag="CYME_CMS449C"
                     /product="similar to molybdopterin biosynthesis CNX1
                     protein"
                     /transcript_id="XM_005538983.1"
                     /db_xref="GeneID:16997500"
     CDS             1119212..1119823
                     /locus_tag="CYME_CMS449C"
                     /codon_start=1
                     /product="similar to molybdopterin biosynthesis CNX1
                     protein"
                     /protein_id="XP_005539040.1"
                     /db_xref="GeneID:16997500"
                     /translation="MFTLHAAVITVSDSCAAGQACDKSGPLVRQLLEESSAAALGATV
                     PRFQVTWSEVIPDERQVIVKRIRVLAGQDSREDDGASSVSGPPQPVDLIVTTGGTGIS
                     ARDVTPESTLEACEGRSVWGLSYLMLQVSLQYTPMAALSRYGAGVCGSALVINLPGKP
                     SAVQEVLPAIKPVIVHGCMLLHGHTRHGGESDVPAQEATPNVQ"
     gene            complement(1119956..1122130)
                     /locus_tag="CYME_CMS450T"
                     /db_xref="GeneID:16997501"
     misc_RNA        complement(1119956..1122130)
                     /locus_tag="CYME_CMS450T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461680.1"
                     /db_xref="GeneID:16997501"
     misc_feature    1121528..1123118
                     /note="possible transcribed region"
     gene            complement(<1123360..>1124559)
                     /locus_tag="CYME_CMS452C"
                     /db_xref="GeneID:16997503"
     mRNA            complement(<1123360..>1124559)
                     /locus_tag="CYME_CMS452C"
                     /product="similar to TFIIH subunit TFB4"
                     /transcript_id="XM_005538984.1"
                     /db_xref="GeneID:16997503"
     CDS             complement(1123360..1124559)
                     /locus_tag="CYME_CMS452C"
                     /codon_start=1
                     /product="similar to TFIIH subunit TFB4"
                     /protein_id="XP_005539041.1"
                     /db_xref="GeneID:16997503"
                     /translation="MTQRTGDDVFLDAAGEPELLVVLLDCNLAAWARAGSAAFPGAVK
                     ACFALVRLLAVARPLLQVAWLGFRERAHTRWLKPVQPLATDDFAYLHSLQEVTDEETS
                     LQGLYALPQLGKALREFACMKLSEAVSVEGAAAEDAAPGEPLLQTKQSSAANTEQPAQ
                     VVAVEADQLDSQQVAASSADVLVYPSNVSVALLETICSLHARGWFPERKPSFGYAVGD
                     PLRSESSQDPEQLSPRARLVVISAPGPFDVAESVPLWNAAFCAQQHQLLVDVVRIEAT
                     SEPGTKPQARAALQQLAYATQGIYLECRCACAKLFTHLATYIVPNRLERRYLTRRIPE
                     LGSYASGTERCGVVESVDLRATCFQSGKLVHMGYVCSRCLSVYSTPQAACIVCDARLD
                     AAEHPEK"
     gene            <1125083..>1126396
                     /locus_tag="CYME_CMS453C"
                     /db_xref="GeneID:16997553"
     mRNA            <1125083..>1126396
                     /locus_tag="CYME_CMS453C"
                     /product="similar to mitochondrial carrier protein"
                     /transcript_id="XM_005538985.1"
                     /db_xref="GeneID:16997553"
     CDS             1125083..1126396
                     /locus_tag="CYME_CMS453C"
                     /codon_start=1
                     /product="similar to mitochondrial carrier protein"
                     /protein_id="XP_005539042.1"
                     /db_xref="GeneID:16997553"
                     /translation="MGPLTRTPLLPTLRRPEHCETTARSYPCRTRMKLYSERGRNPDS
                     TFGFTSDRCSFRKIMARTSEYDDFMNEDDVIAVCAALITATSPGTGGVYHGAPEAKLS
                     GLVAFERLGSTLWTNRVSLAASAVARAASTVVMFPLDTLKTRLQSADTAALGPREALR
                     KVLTQGHFYRGLGSTLFGQVPYGALTFGTYECYKQALEEWGLASRRLRWMLAAVLGDL
                     TGSLWLTPSELIKQQLQNMHNTGTRAAQAATVWQVIGQNWRQYGIAGFYRGYSGQVAR
                     DVPFRAIQLLLFEDARERLERYRRRALTPLENLAVGAYAGCLTAAVTTPLDVIKTRLM
                     TDRTYRHAGDALWQLLRTQPRALFRGIVPRVLYIAPSSAIFFIVYTFLQRRWDAKAAA
                     WEKRGRDASCTPTKRNRGGSRFCAIDSKFSGRKPFSLARSMGLCA"
     misc_feature    complement(1127134..1129407)
                     /note="possible transcribed region"
     gene            <1129806..>1130798
                     /locus_tag="CYME_CMS455C"
                     /db_xref="GeneID:16997555"
     mRNA            <1129806..>1130798
                     /locus_tag="CYME_CMS455C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538986.1"
                     /db_xref="GeneID:16997555"
     CDS             1129806..1130798
                     /locus_tag="CYME_CMS455C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539043.1"
                     /db_xref="GeneID:16997555"
                     /translation="MQTPCRSTELLSMSGVSAVGSLRSASRTSSAASLAATRRSRSPS
                     PISQYGLRQSAPPAVRSVTPGVVPSPTNNAPCFGGASASAISSPAGPELQCPRPRWPV
                     AFSAAAWCNSGSWQTSSTGGNAFGVSGLYINGVEEANALESEAVTAQAAVRPGGRWSA
                     GVTRGSVVSGRPSGFGGGSGGGGGGSSSSSSAALILQRSSSSQSVHSLTPPPPPLGST
                     CSSPLSSSPTIGAGMQTEWRAWHPTFRIDETVECAAEPLCVRPVAIRRANSYTAPSPG
                     HHGVAIPSPLAGAHGMAPFLSSGYATPNKVGECGVSPPVRATNPQCRDARFCVP"
     gene            <1133237..>1133917
                     /locus_tag="CYME_CMS456C"
                     /db_xref="GeneID:16997556"
     mRNA            <1133237..>1133917
                     /locus_tag="CYME_CMS456C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538987.1"
                     /db_xref="GeneID:16997556"
     CDS             1133237..1133917
                     /locus_tag="CYME_CMS456C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539044.1"
                     /db_xref="GeneID:16997556"
                     /translation="MASAPKRLRGRQGPLPARSPQALDDHARKLLVSKLKEVIRTDDS
                     EHAVASPSPRPPAHAAKDALSLDAQTEALQARWKRTRRLARQQLGYRRLPDPSEDVEL
                     ELSLLRTATRGTVQLFNLIQERRAAQAKASDVRARAERSRLLEARSRSFQASLSIPSL
                     SLSSSSNLGQPDTSYGWQAFSEHFLLPETTDDRRDSEASSLSTTAAAQETPFDAASAS
                     EGDMSASE"
     gene            complement(<1137242..>1141642)
                     /locus_tag="CYME_CMS457C"
                     /db_xref="GeneID:16997527"
     mRNA            complement(<1137242..>1141642)
                     /locus_tag="CYME_CMS457C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538988.1"
                     /db_xref="GeneID:16997527"
     CDS             complement(1137242..1141642)
                     /locus_tag="CYME_CMS457C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539045.1"
                     /db_xref="GeneID:16997527"
                     /translation="MPPDTLGWHWTERSKRWLGVVRGNLVRVSNIAAEPGLAEAAASS
                     TSVPVAIAYRARELAVFRVADGELLQRLHVKKALGFERCECIRGAFRARGRTHDALVL
                     VCAGDHGPCAAHALKAVELYWTQTAPTSPLTLHARTLTLTSTETGSADHNPVDLSKQL
                     GAAFMPLLSDESVVSTVTYSDTTTTRPELSDCNRAADPRPGPCGVVYVHQVLVAVSGQ
                     PPAVLSLRSRAASAPFAFEDATLEQNEELVQAWPWASQLNWPLPRACLVLQCPCSGCR
                     HEERKSCRLKTGLVIYDRVVGILCWRLRKPEAAAGAASDLRRALDVRVQFLRSLPTWV
                     ALQSTFADLRLPEDLPWLVLSRYERRPYQGHCPDLSMDDVLHCAGRLYWSLGDCRLEM
                     PTRLENDAESSALVTLRWFQRKAGAPQELSLVPLDGCVDSLRYRDPQQKQQQENTRLC
                     VLYADGRLLRLAAQSDGHPASWASFPAATSTEASWYLLATSWLKQLRPLEEPLGFINE
                     QLVWTTFGRLLRAATESDGRVSALTPRTYPLTHDPAVVAAETQWDEASETITAAVVTS
                     VAAERHPASSPSPLTAASAAYVRARWSVERGAFLERLQYGFVMHHALSTEALEQQGRP
                     TRLFALENEALLVALLSSEWPNRWTRVLVLHHRWEAGSSGSEPDWSAAFCSTDSTVAL
                     HQWLSWGEAIQVCTKQFVLLQWQKNRWTRLCIHQSDLTNDAFATDDARLFVLGQGHRL
                     CLWMRSGSCAPLWYPYLSVELDAPVATITLDFRFLKVSRWLHDGWLVFALKWAGFSEL
                     SVAPPVTADLFSGQASSQEAGAGEALLRAAPVRSALRRTLNPTLSLELLGLGNGALVV
                     NGECCFPFGFTEIQLRPCPATPATAACTTPGGDGDASVSPTISMVDPRSVEPPNEAMT
                     PLLLLLVDGQLWLGVTSEHCSLGGQASALTLWPVLFPNSHPVRLVDCQAVMRTPTGIR
                     CCDCIRRNDIDIRISTDDGTEQRGECAWRFCTHTQDDRIDDLDYESNSEHHHVHWSEC
                     ACSTAPDVGSSGSRQHQEGNEATSSALLQSGRHLARLSLLWLDTDGIVHWGLVECALN
                     GLRTHCKAGERPITALEYDACTDSIWTLLDGRPVALVPDSLRPRVIHDARGVLSNAFV
                     DLCIPPVTPSEAFPASVRGEVLRALGDRLIALQDTNESVYLATARLEAGDVWLQAYPL
                     ETVGGDTTSSIGRLPRVGQRLRLGTSLVPGTVLLVIERPRSFVLEAWTSRRDASSTWA
                     SEWRPERVAQCTLSGVDTFRLDPWSRPLVLTEIAGDGTLLLSGMYPDTPMSIPFRPGQ
                     HVELWRPNASNHVQLIGCCSRVRVYFGASGLVTVDHRTTSPAPREQVEGGARSPQAAI
                     PARFSTGADARDSSNCSCTSCCSCSCCYPWPQGYVPCFYQPQVLTAGVVLSRYPNGHL
                     VFSGAESHWATFSDGACLVWYPRRFSAGPC"
     misc_feature    complement(1146756..1147567)
                     /note="possible transcribed region"
     gene            <1147448..>1149796
                     /locus_tag="CYME_CMS459C"
                     /db_xref="GeneID:16997529"
     mRNA            <1147448..>1149796
                     /locus_tag="CYME_CMS459C"
                     /product="similar to RNA export mediator"
                     /transcript_id="XM_005538989.1"
                     /db_xref="GeneID:16997529"
     CDS             1147448..1149796
                     /locus_tag="CYME_CMS459C"
                     /codon_start=1
                     /product="similar to RNA export mediator"
                     /protein_id="XP_005539046.1"
                     /db_xref="GeneID:16997529"
                     /translation="MVVRSRTEQLRRMAAAQWEASWGAAASLQDHRTEGLVEYLESTR
                     NAGTGKTPPRSGASAAPDAPQFASNEKRAPQQEPLRPLNEALVRLTPTTDFFENVQST
                     GVVSVSTALESGGDRWTTGQRLAPKTFASGSAPGSADQAAKPEIVLIQAQQKSLTPSI
                     SKRTRENGSGRSRVHAKPVPESSFGDVEARTCAFIEQWLWVALTANKTSIGTSQSQVD
                     GLIMDGWWRWNTPSNACPWTKECVSLARVLEKLECERLAASEQALDRLQQRLCEVRAV
                     STTAGAAAAAATLGSAGHVTKSPSGVRGASVPGETFPSLDAIHSPCGDPQAPAITKTT
                     TATTMKLTGSASAHSGATESASSRYAQGAKLPSSLPVSGSVSSPDASALTLEREPHTN
                     AHTRAYSKPETKPIQTSRAGVTSKDASPSPSPSPRPHTSLLTPTPASTLAPDTRRDAS
                     VDASTRATSAIDGTAASDAPTTQVSRASPETALPADVQQVLDHYTQICNLADKFQQDP
                     ASQSLRFQLRKRINLAVNQIGLSLPSVLHKSSVLAALLHESLTTETAVESSESVSLLD
                     AWLQLQVVRRIVREGAEQVVVSLPSSFALGAVLVLLTQQHPRLKPVVLGTFYQLCPYT
                     IPHWYRRRPGESLEAYLVRLGYSKPNESFESYYERMGGYLSLFAAMLQTALPNMHPNP
                     YGTGMLWTWSARVVNAKPRRMTCLLLGNVFEVAGYALSQQYGNQFRKLLRLVEAEVLP
                     RLPKDAPPGPTARLKHWIEEALRSGPQPCPGHILPMRDSQNT"
     gene            complement(<1151527..>1153377)
                     /locus_tag="CYME_CMS460C"
                     /db_xref="GeneID:16997530"
     mRNA            complement(<1151527..>1153377)
                     /locus_tag="CYME_CMS460C"
                     /product="similar to endo-beta-N-acetylglucosaminidase"
                     /transcript_id="XM_005538990.1"
                     /db_xref="GeneID:16997530"
     CDS             complement(1151527..1153377)
                     /locus_tag="CYME_CMS460C"
                     /codon_start=1
                     /product="similar to endo-beta-N-acetylglucosaminidase"
                     /protein_id="XP_005539047.1"
                     /db_xref="GeneID:16997530"
                     /translation="MGETPSTTSGAGSWYFSSLKELLHWDESSSALHLDQKSRVPFQE
                     PSTTRHQRVLLCHDAPQPYSVAECYGTRSRTEAELAYHFREWSFIDDFVYFTHHGVSM
                     PPPAWVEAAHRHHVRCFGSCVLEHAAGGALLEQLLHLRTIFFLAYRLARLAELFSFDG
                     WLVNFEVEIRDDAKVSPSSRNQSTPLSPAIQRVLIFVSTLREQLQKRVGTHAAVIWYD
                     ALTVDGELAHQSRLNARNEAFFQVASAMYLDYRWETGQRLLESVARASQLNRPAKDIY
                     VGIDVYGRGKMPGGGGFRTFEAFDVAWSTGASVALFAPAWTMQVAAPRLYHPETRDER
                     SAQLFWLYQRHLDQQWTHWNAAIWAWKRFQHLCPPRVLVTDASLAVETSFWPGWSRRH
                     GSFDLRRAQLQPSFLREWIASCTRPCDAERVLLYWMESATDSDCGWFRVEFPGVLGPG
                     RLEALVVLRFLCVALSMPLRVRYLVRSETGRDLQRCALGLVTDKGRLWTLGCRDCAPT
                     TTGKRIPLLMNERDTTSATFYEAVCCEPSAIKGIATEQGISEEREYQVKSADAAELVQ
                     EVLIILGDLAALTEKLPTGDQTTGVALALANHQSKADILWLALDRNDSTP"
     misc_feature    1154735..1156297
                     /note="possible transcribed region"
     gene            complement(<1155304..>1156911)
                     /locus_tag="CYME_CMS462C"
                     /db_xref="GeneID:16997532"
     mRNA            complement(<1155304..>1156911)
                     /locus_tag="CYME_CMS462C"
                     /product="fusion protein of dihydrofolate reductase and
                     thymidylate synthase"
                     /transcript_id="XM_005538991.1"
                     /db_xref="GeneID:16997532"
     CDS             complement(1155304..1156911)
                     /locus_tag="CYME_CMS462C"
                     /codon_start=1
                     /product="fusion protein of dihydrofolate reductase and
                     thymidylate synthase"
                     /protein_id="XP_005539048.1"
                     /db_xref="GeneID:16997532"
                     /translation="MVSDEIPNVQLPLRIVVAVQAADWGIGYNGQLPWPHIAEDLAHF
                     KRVTTRNCRSSEDESAVVGGKPAVIMGRHTWLSIPPERRPLSGRLNIVLTRQKPIVNE
                     ASDAFAGAYLANSLNEACSLAALHGARVAYVIGGASVFRETLAHPACDRIYLTRIRRL
                     DPQRAPYPCDVFMPAIPSDEYVEDGPSNKHCVSVCVDERAEQLEVEFLVYRRQERIPM
                     SHSPERERVASDAKPSSNTKTIERPVLECNHEEQQYLDLVRSVIGHGYRKADRTGVGT
                     LSLFGAMMRFSLRNQCIPLLTTKRVFWRGVVEELLWFLRGSTDATELSARGVHIWDGN
                     ASRAFLDARGLSHRAEGDLGPVYGFQWRHFGAKYVDCKTDYRNQGVDQIRQIVETLKT
                     NPDDRRMLLCAWNPLALPEMALPPCHVLAQFYVANGELSCLLYQRSCDLGLGVPFNIA
                     SYSLLTMMLAHVTDLRPGELVHTMGDVHVYLNHVDALKVQLGRQPRPFPHIRFRRPVR
                     DIDDFCTDDIELIGYYPHQTLRMDMAV"
     gene            <1158996..>1160165
                     /locus_tag="CYME_CMS463C"
                     /db_xref="GeneID:16997533"
     mRNA            <1158996..>1160165
                     /locus_tag="CYME_CMS463C"
                     /product="similar to serine/threonine protein kinase"
                     /transcript_id="XM_005538992.1"
                     /db_xref="GeneID:16997533"
     CDS             1158996..1160165
                     /locus_tag="CYME_CMS463C"
                     /codon_start=1
                     /product="similar to serine/threonine protein kinase"
                     /protein_id="XP_005539049.1"
                     /db_xref="GeneID:16997533"
                     /translation="MAFASTSWGTSWCPGWRIRRVSAVVPQPLRDLRLLQRDYSLVPP
                     PRYKVSPLDFVIDRTRVLGSGSFGTVYEAKKVVAPEEGLEVAAKTVAKERLQGVQLDD
                     ALYYTAIERYANDQVRATIESNTDAALADHVARYLGFGEHAGTEWLFFERIPGSTLET
                     YFNSETDDIAFALALSQALNINATDSSEDGVHILRHLVLRVASEVLETLVSFTRLGMV
                     HRDMKPLNWMIDEQRRCLRVLDLGSAAFISTPRYGAAIGYNARWGPADPDFVPPERFL
                     DPRFPYQFDVYSCALSLLRIAVPGLRKIASFRAFVEEFRIRHQSDLALYASRVFNGTA
                     SFIPDKFVTGLVVLKADDGRLFEFVRQMLRESPSDRLSPEAALVTLAKIHGAITA"
     gene            complement(<1161801..>1167443)
                     /locus_tag="CYME_CMS464C"
                     /db_xref="GeneID:16997534"
     mRNA            complement(<1161801..>1167443)
                     /locus_tag="CYME_CMS464C"
                     /product="TBP-associated factor 172, similar to SWI2/SNF2
                     family"
                     /transcript_id="XM_005538993.1"
                     /db_xref="GeneID:16997534"
     CDS             complement(1161801..1167443)
                     /locus_tag="CYME_CMS464C"
                     /codon_start=1
                     /product="TBP-associated factor 172, similar to SWI2/SNF2
                     family"
                     /protein_id="XP_005539050.1"
                     /db_xref="GeneID:16997534"
                     /translation="MLLQKQQSRLDGLLALLEAKDTSTSVRRLAAQQLAELVDAQPSD
                     AAFIIDPGSVHVLNQLLRVVLHSKVWDARICAGSALKLVVQRLQTCLQAPANLDNDEA
                     LNNLLTLRQLDPKFLMDTGSVFSSSSGVEYMVAAGDVREQWVELRRELLGGVAATAID
                     LDIGVSLADIAERKQNTEQATPKNALRVPQRRKTAPLQSNVCKRPRAPTSLKADVLDS
                     VHTDSHEHMNDGDDDNGDKDVDRPSRKTSVQAGSIELETENDLGTVTLDAALHRLVCI
                     LADSLLSPDWETRHGAAVATRDMLSVRAFREWLPMEEREDIASRMYVLLAMDRFRDYA
                     SDQVVAPVPETVSMALGSVAVGLDAETAAQLESHLLELIRYKEEWQARHGGLLGMRYL
                     LAVRADLRAKRLPETLPVLLDVLKSDDDDVIAAACEVIILIAEEIHRLDIERSTNHLT
                     EILGACWDNLGSFDELSACVTALVRCIEALLRARPSSCSILGEGPARVFRLLRHRNGE
                     TRRAALSCLMQGLRALPEASPVRRTLDEAGLYSAIWAAWLLETGTDAGIGGKLREFWY
                     LLCDTRCTFVENDRETPQEQVPDASQHAGVIIQPAPGTPAAVPQKSLLDNVDGTKPVE
                     ALLGCSRHPLEVLLLRAAAEARSPVEAQKLLERLFQRMHWSLPGTAVAPVSSGHDAGY
                     EMQLQSAEALACYIRMHPHCLEGERHGLASWLATLAAASSLTQRRFLALTGRALETCP
                     AWLLTAVEAQLALLERSTDTLHEEAHAELDPLFWQTIRSLRQVQPAQVPALAPEQTPR
                     TADLGALFGACTRDDLWEQVTDPEAAARLTAMRLNVRSAILRCCKTENTGRLLVAAAA
                     VGALVRHLPELPSRVTPWIRILLGVLLEQLPDGFGVPLFDAHDACSLVECAQEVAAMD
                     LARLTQRMKRGSKARDQVVKNLITARCSRALAALARVYGPGLFTELPQMEQEVFGSVE
                     SVLPNAPASADTDETKAEQHQRCDLVLCAVADDLDSTLVSRLLMLFPALIRRRARALV
                     PLCCRFTRPAMEAVIQHLLPLLEPGEEAPLPAVPVNRHANTTCDTYEARFQAIALLAE
                     IVHSLGERIIPYAAFLVVPLLGRLVDQDERVRSLAAMVFGELVRLLPLEGALPADELL
                     SPALQQQLSSARDFIAQLLGQKPLEVFRLSIPIGDNVQLRTYQQEGLNWLAFLHRYGL
                     HGALCDDMGLGKTLMTLCILAADRCGLVGGPAGARLSSRSSTSGHRDGVDAPAQNDGQ
                     VALEASAGTTPLPSLVVCPASVMHHWHDEVLRFFPRHLTPVLVYAGAPGQRQELAQQL
                     RGAERPPLVITSYEVVRSDLEKLASLRYAYVVLDEGHMIKNARSKLSQAVRRLHARHR
                     LILTGTPIQNNVTELWALFDFLMPGYLGTEQSFVAQYAKPIQAARHPKCSDAAREAGE
                     RALAALHRQVLPFILRRMKENVMKELPPKVIQDRICALSDIQRFIYDSFVQTAPLEWL
                     AETRAPTLAATAAEVEAAPRDTDEDAGQVPALTPKRLSGSSHVFYALMFLRRLCTHPR
                     LILSELAPELRRQVEEQLNRAQLDWNSLDIAPKMLALGELLYECGIASDDTSSAGASI
                     IDATVQTWDTTSQRAEKKHRALIFAQLKETLDIIETDVLQRWYPQVSYLRLDGSIVDP
                     RIRQDLVHRFNRDPTIDCLLLTTHVGGLGLNLTGADTVIFVECDYNPTVDLQAMDRAH
                     RIGQTRVVTVHRLITRGTIEEKIMSIQRFKMHLATSVVNQENASLRLMNTEQILELFR
                     PVAATGTAGALDAKAEIPLPSAETGSARRRAPGKDAHGEAGGRSTGAWRMLARIPEQA
                     AAEAYGEEFQRARAFVQELLTSDQEGSALVQMEHDSKR"
     gene            1167024..1169144
                     /locus_tag="CYME_CMS465T"
                     /db_xref="GeneID:16997540"
     misc_RNA        1167024..1169144
                     /locus_tag="CYME_CMS465T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461681.1"
                     /db_xref="GeneID:16997540"
     misc_feature    complement(1169328..1171904)
                     /note="repetitive element"
     gene            <1172402..>1174453
                     /locus_tag="CYME_CMS467C"
                     /db_xref="GeneID:16997541"
     mRNA            <1172402..>1174453
                     /locus_tag="CYME_CMS467C"
                     /product="ATP-binding cassette, sub-family G, member 2"
                     /transcript_id="XM_005538994.1"
                     /db_xref="GeneID:16997541"
     CDS             1172402..1174453
                     /locus_tag="CYME_CMS467C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family G, member 2"
                     /protein_id="XP_005539051.1"
                     /db_xref="GeneID:16997541"
                     /translation="MNSSHGDAIVDEEAGMTAEHLSEHVNGDTYVPFDPLKSHVDDEF
                     SEFSMDAGHGSFFEGQPSESKTAEDSLVQQQTVSMNWHDLCLSVRLKTGGPFKRSKET
                     VVKPILKGITGYVRPGQMLAIMGGSGAGKSTLLAMLGGRVPVGEYEISGELRVNGHER
                     DVNMFRRYTGFVEQDDRMFADLTVREQIEFSAQCRLPASMPTEKKMRRVEQVITELGL
                     AKAADTPIGNAVQRGVSGGERKRVNIGIELVTNPPLLLLDEPTTGLDSFQAQAVMLTM
                     LRLAKRGRTIIATIHQPRSQIFQMFDYLLLLSEGHQIYFGPAKDMVPYFAALKYPCPA
                     YFNPADFALDLISLNARSKTLEKQTRARISYLANRFLEHKSEASLPLDDPLGATGDLH
                     TKVTRKGVSLFSSEGEPNYAEPWPVQFGLLVKRSFKLMVREKGTNFARFFQTIIFSVV
                     LGLIWLNTGRNSSDFNAVPGVLFFLLINQSFGASFGVVFLFPLERGIVLRERTSRFYR
                     VSAYFLAKSVAELPRLVVLAVLFSCITYWMVGLQPHPSSFFIFVALVLLTTHTAESLT
                     LMASASASSPQTAAAIAPVLIVLSLLFGGFFIGPNVIPVWLRWLRFVSFIYYGFAAVM
                     DNEFGYIPRSNTNNPLVTYNINSFGIGGNIGFLIMLDVAYRAIAFVFLLYNKPRFQKS
                     I"
     gene            <1175415..>1178270
                     /locus_tag="CYME_CMS468C"
                     /db_xref="GeneID:16997542"
     mRNA            <1175415..>1178270
                     /locus_tag="CYME_CMS468C"
                     /product="similar to DRAP deaminase involved in riboflavin
                     biosynthesis"
                     /transcript_id="XM_005538995.1"
                     /db_xref="GeneID:16997542"
     CDS             1175415..1178270
                     /locus_tag="CYME_CMS468C"
                     /codon_start=1
                     /product="similar to DRAP deaminase involved in riboflavin
                     biosynthesis"
                     /protein_id="XP_005539052.1"
                     /db_xref="GeneID:16997542"
                     /translation="MQQCPSHMATGRDGGAEQTSPASSPPCTALRRRRFQCLRSEHQS
                     TNESVLRTLLPLQSLGELEASVPQPADYVVYKGFRYARPYVHAYQAYCKARWIGLRPC
                     DALAAEFPYLPASYWREAQRTGRLLLNDRPVPTDCVLSGHGVERLTHIVHRHELPVVY
                     TERIPVLYEDAHLLVVDKPASIPVHPGGHYHRNALQQLLRMQRHLERFASPALPCETA
                     ECTTFASTAPGDLSAALGAAGACSPVAMSTTVYDASTAAIETPSANALQHAPTTTTTT
                     AAAAAAAAAAAAKRTTQPLWILNAEEHRKHEPQVVSPDTSKPETLHVIHRLDKETSGV
                     VLFAKNKDTARRFSIELQKQSTDVGVGKSESSAPLNLRKLYLAQVEGIWSSSDVIEEA
                     PVPEVTSKAATLSMTDTKHLVQALFHSFEEQRRTREQADQVQGAPRPYHTSARLVPDA
                     DSDLISAPNALTPLKPATTGDQTRTRAHSEAAPLDILGVSRKRARNSDEVQALVQAAV
                     RSPDAWRCLEAVAETRGVHVIRNDKDNASDLVHRATRVPATTTTTTTIPPDANAPNAE
                     SGAVTCPALRTLFRVRPGPVACDIDGEAHAVQETSALDVAASDTPIAAGGEAGATPPL
                     QYSAKRDISAGSMEMVASLQQRIIPLKYPWIVCRQRLLYDRRANCTKVDADRGKHAET
                     WFRPLAYDAEQRRTLVACIPVTGRTHQIRVHLESMGYPICGDGLYGGAWSSSPLPFAS
                     AHEPAIPENDPRTMLDALPFQIHGAASNPAVDTAQSLARVESEFSLRDDAQGAANGNT
                     EALDFESTPVDADIAGLAPKAPAPSLVARCREASCTAVTGTSTRACMRQPSSETHHST
                     ASCRVFRIGSLAAEQSPRCAPEDDAASMGCVICPALAAIPNALPECIHLHAFCYGTFI
                     APLPQWAMVYGPALRRHQDGEGTSELAGSSALSDASP"
     gene            complement(<1178663..>1181254)
                     /locus_tag="CYME_CMS469C"
                     /db_xref="GeneID:16997543"
     mRNA            complement(<1178663..>1181254)
                     /locus_tag="CYME_CMS469C"
                     /product="similar to Raf/ATN-like protein kinase, with ACT
                     domain"
                     /transcript_id="XM_005538996.1"
                     /db_xref="GeneID:16997543"
     CDS             complement(1178663..1181254)
                     /locus_tag="CYME_CMS469C"
                     /codon_start=1
                     /product="similar to Raf/ATN-like protein kinase, with ACT
                     domain"
                     /protein_id="XP_005539053.1"
                     /db_xref="GeneID:16997543"
                     /translation="MPDVQRSGAGTERGSGQGDPPVPSPPPDSRSAYHVERASGHVRS
                     ARPGEYVMSLPAEVTLRHYQLWRQFILSKKPFVEFAVEQKGGMKTVELTVVGRERKGL
                     LAELSDKLRDYGFNIVAAKLFSLPSDSIMDIFRLDDADGVLEDDARASQLYDELMRVL
                     TGESRAAEPVSSARGAAPRGSSRETVPVPPALSSTAPAGNEDIPKAPPARMAAAAAIA
                     NAEGRLAAASGVERSLSNIALSDLEQRAREVADRRYLEARRDADREFLRHGSVLYRYS
                     FSSGKRRREHVYVDIESRELRWSSTIAGHSSAGDTQFRTEAQESAMNRPEKPIRIHSV
                     SLDTCERILHGPQSTVFATLGPDRIPDPDWLCFSLVLNERTVDMAAITEDELMAWIFG
                     LQNLCERIRPADRLTRHAVLVNRARMKIRWIAHEHNMTRRAFLLRNLRCHGLRLRAEE
                     NSVESGLVFAPQRPLATADGSVRGAAGAGPAPDTQVTLQVATQARTIGPVTESNPMLS
                     ERDAGPNASVTELAELVRRLRNELEVSKDRIKVLKTKLRDTQKTWEIDFAEIKLQEKI
                     GSGAFSELYKAEWRASIVAAKVISVEKGAESVIQSFCEEVNVMSKLRHSNILLFLGAV
                     PRIPRLAIITEFCFGGSVYQAIRLPAWRRLQHADLVALARDTARGMAYLHACGLIHRD
                     LKSQNLLLDKPLSLGRPTVKVADFGLARSLATAASESSASTSSSAAGVMTAETGTYRW
                     MAPEMIRHERYTEKVDVYSFGITIWEFFTAEIPYATMTPIQAAFAVADKGARPPLRSG
                     PDSKSAWRIPSQWAQLMEQCWKEHYSERPSFQQIVEWLNKMENEDPRYPSRWLSTSTS
                     TDRTPQV"
     misc_feature    1181675..1184686
                     /note="repetitive element"
     gene            <1184724..>1185428
                     /locus_tag="CYME_CMS471C"
                     /db_xref="GeneID:16997569"
     mRNA            <1184724..>1185428
                     /locus_tag="CYME_CMS471C"
                     /product="mitochondrial presequence translocase subunit
                     Tim17"
                     /transcript_id="XM_005538997.1"
                     /db_xref="GeneID:16997569"
     CDS             1184724..1185428
                     /locus_tag="CYME_CMS471C"
                     /codon_start=1
                     /product="mitochondrial presequence translocase subunit
                     Tim17"
                     /protein_id="XP_005539054.1"
                     /db_xref="GeneID:16997569"
                     /translation="MASTGSAPIEHAREPCPDRILDDVGGAFCMGAIGGSIWHFVKGM
                     RNSPRGQRLLGSIDAVKLRAPTLGGSFAVWGGLFSTFDCAIGGLRGVEDPYNAIASGA
                     ITGGVLSARSGLRASARSALIGGVLLAIIEGLGIMLTRMTAEMGPTPEEVERMRREFA
                     EQQHRQRLEGGAGTRTADGFAAPADERLGMGANDVVLTENSGVRVGGSADPSSHSGQN
                     EPERRGGGFLRSLFGS"
     gene            complement(<1186783..>1193910)
                     /locus_tag="CYME_CMS472C"
                     /db_xref="GeneID:16997570"
     mRNA            complement(<1186783..>1193910)
                     /locus_tag="CYME_CMS472C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005538998.1"
                     /db_xref="GeneID:16997570"
     CDS             complement(1186783..1193910)
                     /locus_tag="CYME_CMS472C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539055.1"
                     /db_xref="GeneID:16997570"
                     /translation="MYGIDNKLGYFANCCSRSSQIIVMMRTVHVPAAASRNSQTENTP
                     ENPSPIYESANLPMLLIEYQVFTGTKIPGKKDGMNESSALFRVPFSSEPSPRKNEKKR
                     NVDSSCAPLKKPTPCCSRALFTGLDKAQGVKMLGFAPASAIESTEKATSKVTRDQPAS
                     KLPLEPELRGLYSQAAEAFADGRFSEAASGFERVLRLLAEQQKLESASSRPQRGDAPW
                     IKRLGYLSAWSLGQVYERIGEPAAAFEAYAKATHYQPKTVLLWLKAAATAEAAGYRGA
                     CCFALRQTRALLRQSEKALPAWNILFRQLHRRLVTCLAHASSAAWRRKRRHETLESEA
                     AGTRRRQSQGEKATESSQSSVLSIIPMDDDGALVFDVVDQVDQLVHKRLAMDTAEPLL
                     TANVFIRDERETAASFSAKGAHGHVTDARRSPLSSVGAAALPSSGVGDDAASFEQVAG
                     RVATVMRTTTESSSFVQEGVSERVDSGMLRAGACVPAEAQESAPGLTSKKAIVTKLPN
                     KLRASGASESPREGSEAAERQPVEHKHSKRTACESTRGTTSDPVTSLTASTRGRAASA
                     TAAVTVNEAMQQQQQQQRGICSTCQGGGVESDPQVVAVATVPPARSSRSGETCSEPNR
                     AGVSTAESESPARRTRRSLRYETEASLRSSSVPRSMIIAGISAGEIPGGAGANGAAPA
                     SRLLPSNDQDAASATATPEAAAVLEQLRCQLHDALRDYDATEQQNPASSSQAAQVIES
                     VQETPTARVANATIIDAVRSVGAPFQFHESLLPLTTLVNRILGEALDRMMTIPVRMRT
                     TLARKLCRLYHLWISWHPNGTGSFVLGTPASSAIPQEERAHWWLVWMWRSLALLEVAF
                     WAGDWSLVDDVLTRTRACFDGYMREGLLPSSTIRMLLLIRYMYLHALNLLRQKHWNAA
                     MDALKRALALWEDVQRLQRDHTTVSEAHFVDSAGKRCTSGRLQRVSVSPQEPPTSQQS
                     ACAEREALQASSGYNECTIAASMEAEYQTEPSKANESTAAGVSVSQISVPRHAAGQFV
                     ADEVHPKDTADDTAHALQNDAATERFGRASGKYPARTETAIQGSVSLGCRNTVAPVTG
                     TTATHALVFEDTSPLCEDMSVTESDAPVERLLRAWRLRRRASASTALLELPEASGNAS
                     QLASAEACRAQERCRSVSASTAAENGPEATSACQVLCSWMAGLHPDQLLEHAALPEET
                     SLHLGKIDLLRCLQYAAFEQLWKSLGASEDTFQTEMLDSEAMLMRLLSFLDLPIETVQ
                     VRLRQLLSRYAGGAAVVAAQELQRVTLRVTAATASASAAPTARSPDSSPRLEAQAQRS
                     REPSLSRWRKLAALAQSLRRELDALGKATLVVPAQLRHKLYQMLGVSLPRILDLLWDV
                     APSESIIEQNLHDQLLVEWAAVFGLFVVGRERFIRTHAFSDSDEAVRCSAGAFLHQLL
                     HGLALRLQRGTALSMERRASERMRQACSLLYQLYAGMLWERLSAEQGARWFLGCSLCS
                     PEWDPSWFSRLDWERIQCLHVLYGLDCSAIGLKSGPPVAASCSAWTLARALRPEQMVL
                     PPEALCPALTLGQSELDDVLASRSRPRIRTLWQWTGKLIQAASGIEQRYLLPCYRDLL
                     LYHFRLQMEYLDLEYKRVAEPERRARLLPTELLDALQTLIELLLPFFIGSAALKQDAP
                     QQERCVGRKRLQGLLSPEADNPAPRISPYFRATRHESPGAAKSSTETASETAAAPTPA
                     TEMGTAASAPAAATQRKATGSGNASEAGVAAVEAVDPEAVSRDTSASAIDAPSSEAAT
                     AAVGIVADHPGKGTIERTEQQLACNSEVSNLEDRRALCPRLDDSELTLALATCMRHAA
                     QFSLETAELIGNANRFRLHRYVEWLLTAHRFAVGVQTIASGGNKHAPDAVIIMTSHSG
                     TAGHASAPEAAASVSCRHATGAKRTPNAHAVHTAAHWEALYCAYLLLPIHIPAAAWDT
                     LAPDTKRAVESARASMPNLLCTLREQAHGKDDTPDAEDAPAAESEVALLLDYWQWLRE
                     VGEAAPPVSYASSVERIAERLARYEHALPRLSQQLHGQAQLQYSPWLEYRLAVLANAL
                     YQALGWIPSSKSAHPGTTTTRSTRSNGSNDELGSVLTQLAELPSYRSAYLYALGVFCG
                     YQDAARAITALEPLFRVDASSASRHGYFWLMWNHRYLVAPEQLPHAPLLYDNHCFAYW
                     QFRCFALYVRLLECTLRYDTMLALERTLSRRMQRHNALDAECLTLIVERNLFAFANGF
                     AGVACPAAAAQELIQPVTATQLVRPVDLQLVWELYTDAVLVNDLLQDAGSMLDSPDVA
                     WTGSAALVDACPWPLTGHNLPQVGESCGEAVLDLAERLLIIAAEAEGATNEHALQVLQ
                     RRCRHWFGRSV"
     gene            1193733..1195519
                     /locus_tag="CYME_CMS473T"
                     /db_xref="GeneID:16997571"
     misc_RNA        1193733..1195519
                     /locus_tag="CYME_CMS473T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461682.1"
                     /db_xref="GeneID:16997571"
     misc_feature    1195453..1197105
                     /note="possible transcribed region"
     gene            <1197909..>1199411
                     /locus_tag="CYME_CMS475C"
                     /db_xref="GeneID:16997561"
     mRNA            <1197909..>1199411
                     /locus_tag="CYME_CMS475C"
                     /product="tRNA isopentenyltransferase"
                     /transcript_id="XM_005538999.1"
                     /db_xref="GeneID:16997561"
     CDS             1197909..1199411
                     /locus_tag="CYME_CMS475C"
                     /codon_start=1
                     /product="tRNA isopentenyltransferase"
                     /protein_id="XP_005539056.1"
                     /db_xref="GeneID:16997561"
                     /translation="MGTRHAYVSLSALSQGLANRRPFHPTVFGTLGSKQKRLQKCCFC
                     NCGGRFRVTMRTVRGEGPAQRRPMVVVIAGPTAVGKSQLAHELAARLNGEIISADSVQ
                     VYRGLDIGANKPSALERSLIPYHLVDILEPSRDAFSAGSFYELARAATTAILGRQRVP
                     IVVGGTMMYLRWYVLGKPATTAPTPEITRAVLAELALDEWDWDRCLARLAAHDPERAA
                     MLHRNDWYRLRRALEVVKSTGGIGIGGLPLRGGAPCSRRATAAPLSATHMAAGPSSSS
                     AWTDTAPPATITTKAPDLDVDFRCYFLSLPRVELNRRIDARCEDMVWRGLLLETAGLL
                     RGPWAAIETGTGPEAGLDAETSKALSAFRAIGYRQAIEYLQHGERTPAGLRAFLAKFM
                     QASRQYARRQIQWFRSETLFRWRAADQPDLVDRIENELQRVSPVDAHDDAEDARLRME
                     SHREAKQMKRYQSCLQIFHDDSRAWQVLRALDPSRPSDPGVHAPPSLPTS"
     gene            <1201867..>1202649
                     /locus_tag="CYME_CMS476C"
                     /db_xref="GeneID:16997562"
     mRNA            <1201867..>1202649
                     /locus_tag="CYME_CMS476C"
                     /product="similar to regulator for ribosome biogenesis
                     regulatory protein RRS1 of yeast"
                     /transcript_id="XM_005539000.1"
                     /db_xref="GeneID:16997562"
     CDS             1201867..1202649
                     /locus_tag="CYME_CMS476C"
                     /codon_start=1
                     /product="similar to regulator for ribosome biogenesis
                     regulatory protein RRS1 of yeast"
                     /protein_id="XP_005539057.1"
                     /db_xref="GeneID:16997562"
                     /translation="MEASSIQVDLGHLKVIDNRAVEEQSDIDARASTAVQRLVDELFQ
                     LPPDTAATEQVGFGRVVRLPAPIERLPREKPLPKREQLQTRWERFAQAKGIQRHKRER
                     FVWDETSQSWRPRHGGGKARPSIHSKATEWIIEDKEEGPPGRNPFRRRKGSPESRKAA
                     AGPTASVKSTKATAKRDRVREAQQKLSERMKSAKDALDHQLSIAQRSTASMGAYDRRI
                     DGERDHRQRGKSRAGELNTPSQYASERKRALQVADAVLQGIS"
     misc_feature    complement(1202986..1204559)
                     /note="possible transcribed region"
     gene            1204000..1205506
                     /locus_tag="CYME_CMS478T"
                     /db_xref="GeneID:16997564"
     misc_RNA        1204000..1205506
                     /locus_tag="CYME_CMS478T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461683.1"
                     /db_xref="GeneID:16997564"
     gene            1204657..1206486
                     /locus_tag="CYME_CMS479T"
                     /db_xref="GeneID:16997565"
     misc_RNA        1204657..1206486
                     /locus_tag="CYME_CMS479T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461684.1"
                     /db_xref="GeneID:16997565"
     gene            complement(<1206014..>1207510)
                     /locus_tag="CYME_CMS480C"
                     /db_xref="GeneID:16997548"
     mRNA            complement(<1206014..>1207510)
                     /locus_tag="CYME_CMS480C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539001.1"
                     /db_xref="GeneID:16997548"
     CDS             complement(1206014..1207510)
                     /locus_tag="CYME_CMS480C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539058.1"
                     /db_xref="GeneID:16997548"
                     /translation="MGRLVRQGSGMLCSGVAPATTGVEVGTAPPVRVGSVSAQSPRAR
                     VLSTLFIPLTGLGLLKVSSFTWVQLRKACDAVEHRTLGCASRASLCGRLVPEPARPPA
                     SQAAQPPKRQRPRRTTTGLQCTTSRKPRRGFATNLVRFVQHRILERDWVETLWKVAQR
                     NWWSSAFNSNTSMPGRSLAQNSTDSRSLPVTMTPSQVPSKPMLASSTTSLGRTRTQIR
                     MVPFLQRALPWARHVHVRSRRTSDLLNRIEQRLRTMPLRTVRVDHDPSVAAPNAAVLV
                     LLCRGPEAAETDSCVQVAFVLTERSKLVRIHRGEISCPGGKVRAGDCSLLETALRETQ
                     EEIGLDPSFIRILGKFHEYRPLLRSSNFRVLSFIGYLDDRVNPSQLALNRAEVQSLLV
                     VPRGVLEACRSESGNCTWEDTTLGTDLVNEASHAGANTTSEIVGTTARDSPEETGQRQ
                     APLEQFSTEAAPAPMFCLPRELSSGKIVWGMTARIIYDVLALIRECEH"
     misc_feature    complement(1207878..1209710)
                     /note="possible transcribed region"
     gene            <1209569..>1210183
                     /locus_tag="CYME_CMS482C"
                     /db_xref="GeneID:16997550"
     mRNA            <1209569..>1210183
                     /locus_tag="CYME_CMS482C"
                     /product="probable N-acetyltransferase MAK3"
                     /transcript_id="XM_005539002.1"
                     /db_xref="GeneID:16997550"
     CDS             1209569..1210183
                     /locus_tag="CYME_CMS482C"
                     /codon_start=1
                     /product="probable N-acetyltransferase MAK3"
                     /protein_id="XP_005539059.1"
                     /db_xref="GeneID:16997550"
                     /translation="MAADSTESSDFAVIPFGSEYLHFFAVKTLIDGLLSEPYSTFTYR
                     YFLRQWSELCFLAVRKLPHAASCTPLRSEDLFGCIIGKAEVHRDSLRGYIAMIAVDMT
                     HRRRGLGTLLVQRTLQAMQERGCDEVVLETEVTNHSALRMYEKLGFLRDKRLERYYLN
                     GSDAFRLRRRLVPLPMPNIDSPAPQLPLNQKTSEPERITESYSD"
     gene            <1211016..>1212992
                     /locus_tag="CYME_CMS483C"
                     /db_xref="GeneID:16997551"
     mRNA            <1211016..>1212992
                     /locus_tag="CYME_CMS483C"
                     /product="similar to DNA mismatch repair protein"
                     /transcript_id="XM_005539003.1"
                     /db_xref="GeneID:16997551"
     CDS             1211016..1212992
                     /locus_tag="CYME_CMS483C"
                     /codon_start=1
                     /product="similar to DNA mismatch repair protein"
                     /protein_id="XP_005539060.1"
                     /db_xref="GeneID:16997551"
                     /translation="MKEAKLMAGEVLERWPEPTSLHALVERLFVELFRYGSLSAIAFH
                     FDFSLGVLELHWRTIPDTNAAPSLDVKDWLTNCCTRTVLAASSLRIEGVFAHRPIIRR
                     QLEAQAGRLASELLSTVLRPWAALYVNVSWEVALMGSGTLAFARHFRWDNPNDEAASE
                     QPWLHRMRQLLNETAAVVRFSTHVIAGNLPASPMPSRSASGEWHLALVHGFRQCCWIF
                     GWNGRPLKIDIECLQRTLGVPHREQLACGIAQWRDGNATWGAFQADGFDHARTADCWL
                     CSGPAESCEVFQALQLKLRELLGVSTSTLQTDSVWGSVREQALASITASRRSCQRHDV
                     VPSTASLRDPVLADGITSTTRALAFSETLGRPRTPPSRCRTRPCTRDTSNFPPSLSVF
                     TTRALERLQPGWESDLYGAQGHCPVPILPDLDNARVDPTAARTAVQLHARELEDAVVV
                     GQFDAKFIVFRVRSEIFLLDQHAADERARFEQLTQMYQESLDPRKYPTALNRSVSLRV
                     PLLVDLGSRCLSATTCAFLRHFGWSWDEASSEKPIDTHIASTAIAGTEHRSTLRVRSV
                     PSVLGQQPLLQASDLLECIDLMLETDHAVSMVPAAQRVLETLACRHAIMFGDRLDLAA
                     CQQLLKRLSKCRLPFQCAHGRPSVAALSCPRRPR"
     gene            complement(<1213457..>1215277)
                     /locus_tag="CYME_CMS484C"
                     /db_xref="GeneID:16997552"
     mRNA            complement(<1213457..>1215277)
                     /locus_tag="CYME_CMS484C"
                     /product="similar to guanylate kinase"
                     /transcript_id="XM_005539004.1"
                     /db_xref="GeneID:16997552"
     CDS             complement(1213457..1215277)
                     /locus_tag="CYME_CMS484C"
                     /codon_start=1
                     /product="similar to guanylate kinase"
                     /protein_id="XP_005539061.1"
                     /db_xref="GeneID:16997552"
                     /translation="MSPNVRRLYESPPWGLGRRVERRRYPAHRGPPRSTFSFVPLLRS
                     TACRVTDHSLRRRASEKRRSESTSRRPALGCRSRRAQLRAPQVRLLQRGAQEAAPHST
                     SRMLTAQQDNAANAIRNDPQVGDIVLYPGRWREERLIGVVEGVTPRANSVQVITDIKP
                     LERVGDTNKFIESSNRKTVWRTSTEIVVCDRVAYDPQNRVWTLEALPPPARSAPLSPE
                     MIAERDQGLQEYQKLKRWLLQGTLVTSGIGVCVCFLRAGIADALAFAAGSSAGVLYLR
                     LLQRSVDRLQPIAGSTDLAGAAAAPASTTEQPRAVSVFSAARYAAPMVAILSLVLSQR
                     GTLTSSQVFSCILGFLSYKIPLWYVSIRDYAEAARIAPASAARNAASQHAEYASNHDV
                     ASRRAARSARNLPDLARNPPAVTAIVVTGPSGVGKSTLIGRLLAEFPNHLGYSVSTTT
                     RAPRPGEVDGVSYHFVSKENFLADVAAGKFIEYACVYGNYYGTTFGAVRAVTQSPSPR
                     VCILSLDLQGAQTMMDRQELDAFYIWIAPPSLMELEQRLRRRETESPSELDRRLEAAR
                     QEMDIAEKITGFDLRIVNDDIEVAYEKMRRVVLALLHGRR"
     gene            complement(<1218981..>1220075)
                     /locus_tag="CYME_CMS485C"
                     /db_xref="GeneID:16997573"
     mRNA            complement(<1218981..>1220075)
                     /locus_tag="CYME_CMS485C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539005.1"
                     /db_xref="GeneID:16997573"
     CDS             complement(1218981..1220075)
                     /locus_tag="CYME_CMS485C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539062.1"
                     /db_xref="GeneID:16997573"
                     /translation="MSTGVSARTLLTSQDSQKVVKDVKFSAETLSETKRTFERNAAAV
                     RETHSRLCEICRQVLAAYEQRLPGLGTLTSDPVFGLEIVEALGNRSPPIDIAVLGERS
                     WPPEVSMGLALLLRRLGPPLTDWEQVARLIQRSKRFLMEEKELMMRLLDQVEFVAPNL
                     CALTGKNFAVRVLAECGGLEALAKLPSDQLRLIGARDTYVFYGPRCLRGAIFQCSLLR
                     EILAGLENAGAVGSETNVRRIRCIARKIANSIALMARVDLFESTTTDRRGEMGARAHA
                     ELLDLWRKEARCAAWHTTEASNTTPLLYDYLRPVAVPRPWEKRRGRGGRKRTRRKQRA
                     RSAAKAPRPVHQSLADEELELESGVDEDEA"
     gene            <1220307..>1221809
                     /locus_tag="CYME_CMS486C"
                     /db_xref="GeneID:16997574"
     mRNA            <1220307..>1221809
                     /locus_tag="CYME_CMS486C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539006.1"
                     /db_xref="GeneID:16997574"
     CDS             1220307..1221809
                     /locus_tag="CYME_CMS486C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539063.1"
                     /db_xref="GeneID:16997574"
                     /translation="MVSAGPPQRASTGGGGGSGGGSSSSSEDSMKPAELPDLAVWQPI
                     SLVPARLRSSRHSVWDANALEDTVSTLDDPWSLLSAASKLLVEKSQGKRPESEQGALY
                     SQRDADISALAPVKGLPLEWLPQQSLRSFGLRNLGNTCYANAVIQALLHTPPLVLKAL
                     SDGCASATPHTGFFDAMAAFVRLCRQLLVVRPSGTNAVAPTEIIRNLPAICRRYRVGR
                     QEDAHEFLRFLLESIARSCSRRGERRLPSQQVSSDELVASDCNHGTGWITRIFGGLLR
                     SRVICRTCQHKSYRTERFLDLSLDFRQSASISKCLEHFAATELLAGRNRYDCAACHGY
                     SDAEKQIRIRQAPVVLTLHLKRFHALRKLSGVVRFSEWLDLRPYMAEEFVAGPVMYRL
                     FAVIVHEGHSLSSGHYYAFVRSASGAWLRCDDEHLSRVGIGSVFAQQAYLLFYLRVDA
                     VPGESAIETSEVSTATSEPDTKISGGVSTAPDFQARQSKKPRSEVKRFES"
     gene            <1224679..>1225065
                     /locus_tag="CYME_CMS487C"
                     /db_xref="GeneID:16997575"
     mRNA            <1224679..>1225065
                     /locus_tag="CYME_CMS487C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539007.1"
                     /db_xref="GeneID:16997575"
     CDS             1224679..1225065
                     /locus_tag="CYME_CMS487C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539064.1"
                     /db_xref="GeneID:16997575"
                     /translation="MANEDKPGATQETGRTSRLQDMAERFMAAGVGTSRAGFDFAPEA
                     NETSPEGGVPIPGAGSPPRSSSPMARSPSQDIWKRTFHPGGRSPPDRSLFDSAREHVE
                     GAASGQSVSEIYAQKRNQYYVAPRKD"
     gene            <1227854..>1228948
                     /locus_tag="CYME_CMS488C"
                     /db_xref="GeneID:16997590"
     mRNA            <1227854..>1228948
                     /locus_tag="CYME_CMS488C"
                     /product="similar to glucose-6-phosphate/phosphate
                     translocator"
                     /transcript_id="XM_005539008.1"
                     /db_xref="GeneID:16997590"
     CDS             1227854..1228948
                     /locus_tag="CYME_CMS488C"
                     /codon_start=1
                     /product="similar to glucose-6-phosphate/phosphate
                     translocator"
                     /protein_id="XP_005539065.1"
                     /db_xref="GeneID:16997590"
                     /translation="MSSTHASLQVSEDSVKKPLVVERGKDCAPSRPSLWRRLVQHGSA
                     EYVTVGSMCLNFFSSTCIVVANKYAMDSLGFRYGSTLTLFHFICTSALLYVSSRCFGL
                     FERKPCELYKVAKLAAGAAGFVVLTNLSLQYNSVGFYQVMKVMTTPTIVVIEALFYQK
                     QLENRLKLALTPVCLGVVLTTATDFRLNLHGTLIASAGVIVTSLYQIWSGTMQKTLQL
                     DALQLQYYTSPMSALFLLPFVPLMDNWRPGSPDSIFAYAFTPYRLGVILMTGVLAFLV
                     NISIFMVIGRTSPVTYNVLGHAKTAVIISSDFLFFGRPRDLRNFAGVLLTMIGVVWYT
                     HLKLEDQRSDAKSKVNDSSGSICKASTASP"
     gene            complement(<1230290..>1231363)
                     /locus_tag="CYME_CMS489C"
                     /db_xref="GeneID:16997591"
     mRNA            complement(<1230290..>1231363)
                     /locus_tag="CYME_CMS489C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539009.1"
                     /db_xref="GeneID:16997591"
     CDS             complement(1230290..1231363)
                     /locus_tag="CYME_CMS489C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539066.1"
                     /db_xref="GeneID:16997591"
                     /translation="MREDKNMEYLVCRPLSRRVLRVLVLVALVLIAATLVLHRRLFVQ
                     RRRLPSVSAALEKPAFRLWKTGDELTEQVLEKLSLDRKDHCLVVVGLEKTPRSPGLAQ
                     VVQWFAHQPNVLHLQGVSEVDLKDAYRRDIAETGSLAERQERVFAFTGPVKLESIDAQ
                     VACSVSHLLALLWVRSAGCRTALLLEDDASLEILPLWESNVADLAAAACTKDRPVLQM
                     ELKLVSLLRAGYSEELKLETLGINCTARFVLPHIRHLTYGTAAYAISALGAEQILQRF
                     RLDASLSTIDVNKVIQSGGVADVDVIYNKATTRVLWPPYFFEYGDAKSYLTGQSKKEW
                     YYLSASKAIEANLERAALCRLFS"
     gene            <1233196..>1234377
                     /locus_tag="CYME_CMS490C"
                     /db_xref="GeneID:16997592"
     mRNA            <1233196..>1234377
                     /locus_tag="CYME_CMS490C"
                     /product="probable malic acid transport protein, malate
                     permease"
                     /transcript_id="XM_005539010.1"
                     /db_xref="GeneID:16997592"
     CDS             1233196..1234377
                     /locus_tag="CYME_CMS490C"
                     /codon_start=1
                     /product="probable malic acid transport protein, malate
                     permease"
                     /protein_id="XP_005539067.1"
                     /db_xref="GeneID:16997592"
                     /translation="MVLNIPRPLSKVAGPREIVRQFVPSWFAVTMGTGILAVVIKDFP
                     FQFPHQDDLGWAYWFFNVGLFGIFSILFLSRWIFFFNDAIPMFHHPVQSMFLGAIPMG
                     LATIVNGLVLFGTPHWGNSATIAAIVLWFVDVGLAVLCGLLVPIFMLTTHSHALESMS
                     AVWLLPVVPGEVAAASGGLLLAVVQNQRLAQNIAFISMLLWGFSVPLSMSILVIFFLR
                     LVLHKLPPSDLIISCLLPLGPIGTGALAATELGLYAKRTFENSGYGVSATTFQSLASA
                     TPAIAMFVATALWGYGVWWLVIAIFAIGHTLRNRLPFNLGWWGLIFPLGVFTASTADL
                     YKLTDFYLFRIPAAVLICILFVLWWVVMFHTVVRAYSGELFYAPCLGPRQACTQNELE
                     I"
     misc_feature    complement(1234699..1235384)
                     /note="possible transcribed region"
     gene            <1235022..>1236308
                     /locus_tag="CYME_CMS492C"
                     /db_xref="GeneID:16997624"
     mRNA            <1235022..>1236308
                     /locus_tag="CYME_CMS492C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539011.1"
                     /db_xref="GeneID:16997624"
     CDS             1235022..1236308
                     /locus_tag="CYME_CMS492C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539068.1"
                     /db_xref="GeneID:16997624"
                     /translation="MRIARGVLFWLLCVNFCWCHLSIGALRAVRAISVSEEVSLPGFR
                     LFPRVPQSEASTIFFRDLLLPKKTYSIDWSAEASSRSLTSGLRNDRGTFTTSEGNVTY
                     VQTLRDADGHLYVCRVPADEPATPNNVETVSMDVESEPTIDLDAALQKQLKDKCFYRQ
                     GGWRVFEFCFHRHVRHFHWERRRSMPAERERIRAEIEQLLKEHVFPEGPNGEPGRKRF
                     LRLLIQAQQIPPDGSLNLIIKDEVCMGMYDEALDRERIRNGTNLITSGAFFSGRRWQA
                     PPQATNGAASRVDRGSDAEYRLESDGRVLPVAGEGIGSAVAYLVQPYTRDGDHCDITG
                     RPRRTMVRYRCIEDVPRIAIFDPSPVVSSFIASVHERSTCEYDLVFVTDAVCSHPAFV
                     SPARHSVPVVCERMSSEMEAINISPGSAQHPALHRS"
     gene            complement(<1237049..>1239367)
                     /locus_tag="CYME_CMS493C"
                     /db_xref="GeneID:16997625"
     mRNA            complement(<1237049..>1239367)
                     /locus_tag="CYME_CMS493C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539012.1"
                     /db_xref="GeneID:16997625"
     CDS             complement(1237049..1239367)
                     /locus_tag="CYME_CMS493C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539069.1"
                     /db_xref="GeneID:16997625"
                     /translation="MRLLMLWMSPCTQLKAVAFAQPVAFWTSSPSKTFCFAFRRGLKV
                     AACRRRSQRSVLRHLSANVPDLAYVTGSTREPEREFQGAQWVFRVYLAPQLRAALRVA
                     ASDRKGRIFVPGTEPSLELLRKGIWERFSALQRLEGTPLHVVLVAHRPDSLELVDSDA
                     LLKEAWQAKAPLYLRFDPQISDSMIEEFRQRPRNTDGVRERQRARMLPPFYPAKELDA
                     VDEDIQMLSFYRFVPIAEPEELASRLRFYLKPLAIRGRIYIAPEGINAQVAVPLRSLD
                     ALKRLLEAESPYLVELAGVYLNLDPQLLSAAQFAAQPPFRNLHIRCRQKIVADGLKEP
                     LDLTQAGRELSPAEWHQALEDPHAILIDVRNDYETQLGTFFGSAEARPLNTRTYRETW
                     KALEARLANEPRDRRILTFCTGGIRCVKAAAYLENRLGFQRVERLAGGVVSYAAEAHR
                     QGWDPKFKGSIYVFDERLKTPVTNDILSRCETCSAPALDVLHCAHVPCHRRMIQCARC
                     RHRLSGCCSPECQRGLELALASASNELHWYAQTMSRTAPWGTEAPILRELAAETHRKF
                     PQAAHMMSGPVQGAVLHAVARLLRAQRVLELGTFTGYATLCFAGAMGPNHVQTVVTVE
                     QDPNAADTAEQFFKCVAGQLAPIELHRGAVLDVLERFRDQAVAPFDLIYLDADKRRYI
                     TYFDFILDHRLLSPNGALLVDNVLFRPVYGKQKHAQMEDVEFGEHAERIALRSRKLMD
                     AVHAFNQHVLEDARVTQVILPIRDGLSIIQWR"
     gene            <1243413..>1244723
                     /locus_tag="CYME_CMS494C"
                     /db_xref="GeneID:16997626"
     mRNA            <1243413..>1244723
                     /locus_tag="CYME_CMS494C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539013.1"
                     /db_xref="GeneID:16997626"
     CDS             1243413..1244723
                     /locus_tag="CYME_CMS494C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539070.1"
                     /db_xref="GeneID:16997626"
                     /translation="MGFLWWLGMGSSREPRESRRLARLEKRISVLSGRLEAWRRRKER
                     TLAAFRLYAFFFVCIWTAYAFTFNDLLFLGAFANSRLRAVLVLSTSGGAYLFLYKIAS
                     LWYRWRIESAEERLAKYREEKAELLEQLKESTRFYETIKLLEKYGGVPDALRPISSAE
                     ESRAASPTATSGTPGAVRAPGEQETASSSGVASPSAGTSGSPRSSTIARLTNRVVDVL
                     TKDEEDWDEPQTAREAFLIGRLREMREALTREHSQRLQLQRALESLERQLCDLRSPSH
                     PEPAACPSDPSNLENRRIPENNPETSGRGVKAAAVTLSTSKAGSLHMEDAGVSPITGH
                     GQRRGVLNNSPTEPVSRAQLNDEPMDSVLSSSVDRSALSLHKSNEDESEICAQRSGHP
                     RQPSTEQSGTPIGHGPSSGSRNESPLQTMQKLRRQRLNPSRTER"
     gene            complement(<1246084..>1247580)
                     /locus_tag="CYME_CMS495C"
                     /db_xref="GeneID:16997627"
     mRNA            complement(<1246084..>1247580)
                     /locus_tag="CYME_CMS495C"
                     /product="probable transcriptional adaptor ADA2"
                     /transcript_id="XM_005539014.1"
                     /db_xref="GeneID:16997627"
     CDS             complement(1246084..1247580)
                     /locus_tag="CYME_CMS495C"
                     /codon_start=1
                     /product="probable transcriptional adaptor ADA2"
                     /protein_id="XP_005539071.1"
                     /db_xref="GeneID:16997627"
                     /translation="MDSTAGHSASSDVADIDVKRSRKRRGGARKSSKQPVTSTSGRYH
                     CNNCARDISDTVRIRCAVCVEYDLCIDCFSIGAETDDHRSNHDYRVLEVVDVDVFEES
                     WTGAEEERLLEALEYYGIGNWSDVSTMIGGGKNARYAELHYTRVYLEATPTGIADIFR
                     PTLLPRPATQEIQELPEPDPKSLKVMHEYTIDEMSGYMPKRGDFIYEWDNEREEIVAD
                     MEIERTENARDVELKTRVMEIYNHCLDERVERKRFALGSGFCDLKAKSRVEKAMSPDL
                     RDLWEHSKPFFRHSLNPQIHEDLLLGMLRERHLRERIEALYQARVQLQATQLAAAAAF
                     VDVSKLTPGVGRRLLPSEELLQRVHGALTGPDAEQIRERVLKVNGIDLYAYWNGQVSS
                     LRRQSGPELFCTDGIELLTRSETELCAGLRLSPHQYLVCKEILLRENARTGAVRRKDV
                     RLLLGIDDKKAYRIYDHLFAQKLIGEGAFHQYDRQESNPPDPTGAVPH"
     gene            <1248830..>1256839
                     /locus_tag="CYME_CMS496C"
                     /db_xref="GeneID:16997584"
     mRNA            <1248830..>1256839
                     /locus_tag="CYME_CMS496C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539015.1"
                     /db_xref="GeneID:16997584"
     CDS             1248830..1256839
                     /locus_tag="CYME_CMS496C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539072.1"
                     /db_xref="GeneID:16997584"
                     /translation="MCPETATPPQDATAAAASETSGPRTGCCSTSLQHMPPGQQHDTY
                     LCRSQIIPLLEWIESVSDCMLGNASGNRVDGCCPKATDVNTSPAPRIPDAKGGYQRIK
                     SNSLTSEALCTALHALTEARTPAAFHACTRQAFGKLIETTRAYVVSDTREAPANMLEL
                     LLDVLLLTEVVLFGSNLISSSLQCTWVTWLDRWLTVWLERWAAVPRNTDASAAVRQVY
                     QQARLRDVLYACETVASGACQTGKNLAFAFERLSLHRAAGVTSHVSGTVHQAGLVTHA
                     LLHPDSKTSPSGTTLPGSAAMLGIESCRSLLTTQEPLTSSSSGVRHCSTGRASDSCSN
                     AHEAPATRADAHMLLHDEFRQAEVDLVRESAGNHAVIPAPNALTSTLSTQQSTTDDAR
                     SGFVSTCAVGALPPSSPTSSSSSSTPTPQQEAISAACAAAPAESACALDHSTRASAWM
                     WLLVVLGHLRGPQSTPFPIEDDRNEAGVLLWMACLEPVQLRGLYALSKSSIFRDALHQ
                     HKNWNEYVPLLVHASLREYEALLAARCRLEPFTVETAMAEASTQWRLPPELCDDVARC
                     ACRLASEVTGPSSVPVLMSLLCNETVPRSVSWNAAKSLALLDIRDGIAPWHRLECQRL
                     TAFSQLAYLRSRLEHDTEATRELQTGTEEASAVSADSTEDPSVPGRALATVARAADPA
                     DAGASSEAFSRKEPQHSCSWLASAAQTLERLHHEHPTDRTLRTVAAETLALLVERIPG
                     QRYAEALLLRLLMESTDLPDRFFQQSIQKMHRETLVSACTLPMLQQIWSKCCSLMPCH
                     FRFLRIMVQENGVDAMHETADELLQRALLALNDHSMMLVKSALGFLEAWYLAEKRLRA
                     RGASIPTSRLLVRIGCFLQEFLARSPAERYVSASRLGVTLLPMLLRHGATVRELWECL
                     CGARDPREGSLETTTGAPQVSGKHCDSSADRTHEHQHQHEQVRERFHRVLEGSTLPYL
                     LLLVTVALVRARVVTRVELVVVDDVESNIGATEYQVCGEHRQHYLTAPKHAAQCLFVP
                     QWLAQWALAHAEDTIALDALYLLTQPNVLTTAPIPLGHLQLLLEALPALTVGTLAPKS
                     TQMLRQFFIKYMGPACQALVQGSGFWASVGFLPGTDSAAQVPDAESWSAKRSGTLSRT
                     RPEEALTKADAEAAAAEATFLSQTRDVNVSAKATAAAGPGTAPGMQNASAVDIESNEV
                     ISSNRDLYAIQLVRFLKSWVRLLTLQIGPGVGLTRRLAAISLLESLPVQVWRFVEHQC
                     PQHIRIMEDCIAVALGCLLDPYDSIRVRAWALLRNLAAYADLNTVMRVLVPTGSVLVR
                     SWTRRKADSGALLLRTAVMFMDKAASPRALGKLDVSRISLCNGVGTPAQEAPSRVTLL
                     EALATILANVDIKRHGVVLTLRYLLDDCMDSATGRWIQPPKPSLASLTRLSQACITLE
                     ERCSALFATQHDGYEAALQTDPLSEDEAFASTASAEDTQDRAHWENQTSNTSLVASAE
                     LAYDADAEERVSDDSQATCAEFARRSTQHGVFLIIREICYITSIIIRLLLDEFHPEES
                     LDEAFVVPSTADWVVGAAVSVSPATVAALVEFLTDFLAGMLLRYRHSGICGHASICWR
                     SVCKQLVKHTDPALRALPNRCLDLIVQRLHHGGFAVLRRSAGLAYLVQGVVAASANSP
                     LDALVDVLLRMARSWCDGQALGSVHAMHILRALLQDASLTQRTAHLVPLAFQVALDGF
                     QGTAPWMIRNAALLLLAACIQRILGGQIVQGATAFRVTNKTNRSHEQGSSERTLHDLP
                     GLQTRSGARTRITDTNTQAFRLEAYWEEPLVLVQSRALTMDVFLSRYAGILESLCRLL
                     QQAAASTTSASVHPGALTAVYPVLVLLSRLAPLSTSTDELGDGAASSAVAFPDRPEAL
                     CFSGRRSVLRILLEAVERLTVSAEGAVRRKAALCWARIWQTCCSADAAPCLWPDDSTD
                     AAAVQGIILRLRYLQAVGACPSSVREAFQKRFNPESFARRFGLDATIEALRLYGEFGL
                     QTEPSQWLSFCSWAVRLASTDASVPAMIMAALALRRFCGACSAACAILDDNEYAEEAL
                     RSAGPTFAARFEMNAAHEERVPASCTDALVLSYLYSVAATCPLPELVATALQLAQERS
                     LGGIPSAWIPLLLRQLRYSSNLCVLAAALRWIIQTSPDHPAFFPAVWRHYLAAAHTST
                     TLGDLALEALGSLVHDAPRARQWVQALEALRHSAYAGTPQAPRVSVERRLAMTRSLQR
                     AFCCNYWRMPERTLAAFFWSERLRIHGVCWRLLGDDEEIVRCEARRAVALFWGQPLYA
                     TLRRGYLEQQLARDLVYAILQEQTEMIPAPYNTDDAALSTYLIGTCIGAVHQHNSFSS
                     QVSVQAALEGQSTMERQRCQSRSGPGYWHLLYSSDDLHVSDVEPLSAEQLALYVQVML
                     KQARNGRLCVGGSGEAMSIQGAFSAHANLFRIPDAVSARFSDKRALPQTPSSVPWAAS
                     QAPLHGQGFVDFGQHVRGYALETVRASFRELFVETLKAAASEASAPPAELRESVPRCP
                     TDERAFSYASLTGADSRLEQLVKGQFQAMQVPDVFSKRYRLWMQRVMGLEHTESASLD
                     EFSELDLAPALWRWSRCTTQQMLCPQRANALRDVEEERHSAARASCETVISNTDDQPV
                     WYLLPVSRIGVKENL"
     gene            complement(<1258001..>1259059)
                     /locus_tag="CYME_CMS497C"
                     /db_xref="GeneID:16997585"
     mRNA            complement(<1258001..>1259059)
                     /locus_tag="CYME_CMS497C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539016.1"
                     /db_xref="GeneID:16997585"
     CDS             complement(1258001..1259059)
                     /locus_tag="CYME_CMS497C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539073.1"
                     /db_xref="GeneID:16997585"
                     /translation="MVPSLIVSDGFHNRRRTIVLLFALLGLLGIGLLKWLSVRSIQTP
                     DLEQLSSGDTARKQVARLLSIGTPGHCTAIIGLNSKPRYPGLAKVVEWFGAGQKWKVR
                     YVRGLTADSLRTLGFARRSNLLYFSNPDHVTSVSNVAAASVSHLLALQWMVRSGCTSI
                     AVFEDDTSLDLLPFWNKPLAALAKDLRAPDRLVLQLELKLDAFHLQNGASGDLRLEEL
                     PLNCTDRYWIRHRDLITWGAGAYLMSRAGAEGLLRKFGDGDRIDVSKVMTMSSAPDAH
                     LLFSRDTTMFLWPPYAMEWSSSSSVAWSSGEQNWHKNVHHASALVAMAVNVRQASACA
                     FLGYDAYKQALGHAYSRS"
     gene            <1259754..>1260470
                     /locus_tag="CYME_CMS498C"
                     /db_xref="GeneID:16997586"
     mRNA            <1259754..>1260470
                     /locus_tag="CYME_CMS498C"
                     /product="similar to thiamine phosphate pyrophosphorylase"
                     /transcript_id="XM_005539017.1"
                     /db_xref="GeneID:16997586"
     CDS             1259754..1260470
                     /locus_tag="CYME_CMS498C"
                     /codon_start=1
                     /product="similar to thiamine phosphate pyrophosphorylase"
                     /protein_id="XP_005539074.1"
                     /db_xref="GeneID:16997586"
                     /translation="MRKRPCSGFSVTAGRPVVVWVTPDCFCRKPYLPSVARRRIDCPA
                     QQKESSSANESVVTPDWVIVRDRTTCVAERAEVVEQLGAHGAILHAGHQLCFEEYSTG
                     VRRLHMPWRLFRKSIHEPEMRAALAQFEVLGTSVHSVSEALFAAETGLVSYLLVGTMF
                     ATASHPEKSSPEFIEGIPLMRAVSQALSTSSLHLYGIGGITPGNINQVLEAGAHGVAT
                     IRSIVPVLEYVACKYENHSV"
     gene            complement(<1260987..>1261604)
                     /locus_tag="CYME_CMS499C"
                     /db_xref="GeneID:16997632"
     mRNA            complement(<1260987..>1261604)
                     /locus_tag="CYME_CMS499C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539018.1"
                     /db_xref="GeneID:16997632"
     CDS             complement(1260987..1261604)
                     /locus_tag="CYME_CMS499C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539075.1"
                     /db_xref="GeneID:16997632"
                     /translation="MSLSSGAAAADAVTSAGAKLSPAAQHLRIEQVRILFCTFGGSSG
                     GIRSFLSSELFSYARQHPDVKFSVERRARRHPLAIGRYRNGYERTLELSNQSPREIRE
                     RLDYLINSLGNKQRPPTQLSYGVVSQSPSIQGMTRVAQLTPDWYVQVARKALDGARSR
                     AGIPSFAEIVDHVGMTRATRIFQRVQLLARTQNGRIANDASSDTA"
     gene            <1262334..>1263248
                     /locus_tag="CYME_CMS500C"
                     /db_xref="GeneID:16997633"
     mRNA            <1262334..>1263248
                     /locus_tag="CYME_CMS500C"
                     /product="similar to cyclin H"
                     /transcript_id="XM_005539019.1"
                     /db_xref="GeneID:16997633"
     CDS             1262334..1263248
                     /locus_tag="CYME_CMS500C"
                     /codon_start=1
                     /product="similar to cyclin H"
                     /protein_id="XP_005539076.1"
                     /db_xref="GeneID:16997633"
                     /translation="MANYLHSTQRRYWTFASVEELERLRAAARSRYAHKYPQRERIDP
                     ETEAKFRLACAYRLYQLARAEPVSLPRYVAATAVTLWKRFCLYNCFLEWDLNVLLPTL
                     VYIAAKVDENYRSAAQVSQEHERQILAMELPLLSSIHFQAVCHHAYLIIRAEFPKFSD
                     WSRVDEAVIRTDSALLMSPASFALVILGRELGGRHVLWENNEKERERCFHIFENAMQG
                     TADLFESSGAGLDAPRSPALEEAFQKLYEWYLRNRDPLLDKDSAESLHRQEQENRHLE
                     RQRRRHMRAMEEEERKRRTLLSSGVVDP"
     gene            complement(<1265055..>1266398)
                     /locus_tag="CYME_CMS501C"
                     /db_xref="GeneID:16997634"
     mRNA            complement(<1265055..>1266398)
                     /locus_tag="CYME_CMS501C"
                     /product="similar to mitochondrial carrier precursor"
                     /transcript_id="XM_005539020.1"
                     /db_xref="GeneID:16997634"
     CDS             complement(1265055..1266398)
                     /locus_tag="CYME_CMS501C"
                     /codon_start=1
                     /product="similar to mitochondrial carrier precursor"
                     /protein_id="XP_005539077.1"
                     /db_xref="GeneID:16997634"
                     /translation="MEKRETQLPLWQSVVAASTGALVTAVVLNPIDVVKVAMQNQNVE
                     AYKNRLSFREPSGSVCPRCGKYSSSWAAMANEPGPVGEAATISPLQAAVRSLGPGGSQ
                     VGDLLRKNDVGVQHSDLCASERLVSARSALEATVRRLQPTVWGTIASIVRVAGVTGLW
                     RGLSASILTIVPATGLYFGLYEQGTQLILRYSPADSRLADPLFVAPFTGAAVRCLVAT
                     AVSPLELVRTSMQANGGTIWETLRCTLREGGGVRALWTGLAATLWRDAPFSAIYWGVY
                     ESLKVARSRMMHEATTSPVDANSAAKRSILENWEQSAATRSSYHFFSGVTAGMVAAVV
                     TNPADVVKTRNQSWPGVRISAKALTGQTPSHLDTREKPSLVMRFWPAIRQLLREEGVP
                     GLFRGALPRVAKVIPASGIMMVTFEEMKRWLARHEITVHRAVEAQAGSDGMPQAR"
     gene            <1266911..>1268302
                     /locus_tag="CYME_CMS502C"
                     /db_xref="GeneID:16997635"
     mRNA            <1266911..>1268302
                     /locus_tag="CYME_CMS502C"
                     /product="mitochondrial translation elongation factor Tu"
                     /transcript_id="XM_005539021.1"
                     /db_xref="GeneID:16997635"
     CDS             1266911..1268302
                     /locus_tag="CYME_CMS502C"
                     /codon_start=1
                     /product="mitochondrial translation elongation factor Tu"
                     /protein_id="XP_005539078.1"
                     /db_xref="GeneID:16997635"
                     /translation="MSVSCGRRIFSDIVRQVRTFATVGVDARSLAGTRNATVWRSYRT
                     TTLQYPRLWELRASRFLSGEAVEASASKRKPHLNVGGMGHVDHGKTTLAAAITKVLAE
                     TGGARYTAYEEIDKAPEERARGITINASHLKYETPSRSYAHVDCPGHRDFVKNFITGA
                     AQVDTAILVVSGPDGPQPQTQEHVLLSKQVGVPNFVVYLNKCDMVDDPELLDLVELEV
                     RELLSKYEYDGDNVPIVRGSALKALQGDQSELGCGSIHKLLEILDKVPIPKRDLEKPF
                     LMPIEDSFSITGRGTVVTGRVETGILRPGDEIEIVGLRPPEVAPMRTIVTGIETFKQS
                     LPYAEAGENVGCLLRGVKREDVLRGQVLAKPGTSRAHRKFEADVYILTQEEGGRHTPF
                     FSNYRPQFFVRTADVTGRFLLPPEVEMCMPGDRVRCAVELIYPVALQEGLRFAVREGG
                     RTVGAGLVTKVIE"
     gene            complement(<1269207..>1269719)
                     /locus_tag="CYME_CMS503C"
                     /db_xref="GeneID:16997628"
     mRNA            complement(<1269207..>1269719)
                     /locus_tag="CYME_CMS503C"
                     /product="probable ubiquitin-conjugating enzyme E2"
                     /transcript_id="XM_005539022.1"
                     /db_xref="GeneID:16997628"
     CDS             complement(1269207..1269719)
                     /locus_tag="CYME_CMS503C"
                     /codon_start=1
                     /product="probable ubiquitin-conjugating enzyme E2"
                     /protein_id="XP_005539079.1"
                     /db_xref="GeneID:16997628"
                     /translation="MSANSSRAALLLTRQLRDLNKSSVDGFSAGLVSEDDPFRWAVTV
                     LGPPDTPFEGGLFRAELTFPPEYPMLPPRMRFLPPIPWHPNVYRNGEVCISILHPPGD
                     DPHGYEMAGERWSPVHTVESILLSVISMLASPNDESPANIDAAKEWREQPDAYRRRVR
                     SLVRQTLEES"
     misc_feature    complement(1269733..1273108)
                     /note="repetitive element"
     misc_feature    1273777..1274997
                     /note="pseudo-gene of NADPH:protochlorophyllide
                     oxidoreductase"
     misc_feature    complement(1275252..1276724)
                     /note="possible transcribed region"
     misc_feature    1275298..1276449
                     /note="pseudo-gene of trefoil factor"
     gene            <1277427..>1279616
                     /locus_tag="CYME_CMS508C"
                     /db_xref="GeneID:16997631"
     mRNA            <1277427..>1279616
                     /locus_tag="CYME_CMS508C"
                     /product="similar to hedgehog protein"
                     /transcript_id="XM_005539023.1"
                     /db_xref="GeneID:16997631"
     CDS             1277427..1279616
                     /locus_tag="CYME_CMS508C"
                     /codon_start=1
                     /product="similar to hedgehog protein"
                     /protein_id="XP_005539080.1"
                     /db_xref="GeneID:16997631"
                     /translation="MRKRYFSIVRLLVIVLVVSGTHTVRGVLSAENTVLWTWIGGSSS
                     NGSSGSYGVQGVPNTSNVPPARYGAAFWTGADGVLWLFGGGSDLRDVFGDLWNYNLST
                     FSWTWVGGSASLNSGGVYGSLGVPNKSNYPPSRTESAAWSDSNGNLWLYGGWNLNLGY
                     SDMWMYNVSSGEWTWEQGSNKTNVSPTYGPLGNSSASNTPGARFQPATWVGLDDQFYL
                     FGGFSPSGTYYGDLWQYNTVTNEWSWIGGTQQLSPSGSYGAFRQASPNSYPAGRFGAT
                     SWRDLDGNFWLYGGLGEIDAVGSFLNDLWLYNISSKEWTWMSGDDSVGSNGAVYGEKG
                     VPSSSNTPGYRSGSSGFVDSSNTLYLFGGVSRGVCNDLWTFNITSLEWTWVDGDDTTN
                     GAYSYGEVNKTSNTTLPPPRYDAVLWNTDQNDPVLFGGLGSSGSYNDLFTLYIAAPTP
                     TPTATPTPTASPTPSVTAARSATTNVTQTAVGEGSAVCFPADASVLIDGLGNHLQISE
                     LRSGMAVMGVNGRGQLVEDSVLGWLHNEPGATAEILAIKTLSGKQLRLTRQHLVYRVI
                     EHFRDFDSMMTTFSCISQKQQQQHQKHIRRSLELGTTAVEAVFAEDIRVGDALLDVAA
                     HLPDPVVAIETVVTHNGLYAPLTRSGRLVVDGVLVSCYGTYASHAVAHAVLWPARVDA
                     LRKVWTSGLGTEGIVGIMPYAERLYHIWTSAARVLTEARVSVVVAAC"
CONTIG      join(AP006501.2:1..1282939)
//
DBGET integrated database retrieval system