GenomeNet

Database: RefSeq
Entry: NC_010146
LinkDB: NC_010146
Original site: NC_010146 
LOCUS       NC_010146            1621617 bp    DNA     linear   CON 16-JUN-2017
DEFINITION  Cyanidioschyzon merolae strain 10D DNA, chromosome 20, complete
            genome.
ACCESSION   NC_010146
VERSION     NC_010146.1
DBLINK      BioProject: PRJNA28057
            Assembly: GCF_000091205.1
KEYWORDS    RefSeq.
SOURCE      Cyanidioschyzon merolae strain 10D
  ORGANISM  Cyanidioschyzon merolae strain 10D
            Eukaryota; Rhodophyta; Bangiophyceae; Cyanidiales; Cyanidiaceae;
            Cyanidioschyzon.
REFERENCE   1
  AUTHORS   Nozaki,H., Takano,H., Misumi,O., Terasawa,K., Matsuzaki,M.,
            Maruyama,S., Nishida,K., Yagisawa,F., Yoshida,Y., Fujiwara,T.,
            Takio,S., Tamura,K., Chung,S.J., Nakamura,S., Kuroiwa,H.,
            Tanaka,K., Sato,N. and Kuroiwa,T.
  TITLE     A 100%-complete sequence reveals unusually simple genomic features
            in the hot-spring red alga Cyanidioschyzon merolae
  JOURNAL   BMC Biol. 5, 28 (2007)
   PUBMED   17623057
  REMARK    Publication Status: Online-Only
REFERENCE   2
  AUTHORS   Matsuzaki,M., Misumi,O., Shin-I,T., Maruyama,S., Takahara,M.,
            Miyagishima,S.Y., Mori,T., Nishida,K., Yagisawa,F., Nishida,K.,
            Yoshida,Y., Nishimura,Y., Nakao,S., Kobayashi,T., Momoyama,Y.,
            Higashiyama,T., Minoda,A., Sano,M., Nomoto,H., Oishi,K.,
            Hayashi,H., Ohta,F., Nishizaka,S., Haga,S., Miura,S., Morishita,T.,
            Kabeya,Y., Terasawa,K., Suzuki,Y., Ishii,Y., Asakawa,S., Takano,H.,
            Ohta,N., Kuroiwa,H., Tanaka,K., Shimizu,N., Sugano,S., Sato,N.,
            Nozaki,H., Ogasawara,N., Kohara,Y. and Kuroiwa,T.
  TITLE     Genome sequence of the ultrasmall unicellular red alga
            Cyanidioschyzon merolae 10D
  JOURNAL   Nature 428 (6983), 653-657 (2004)
   PUBMED   15071595
REFERENCE   3  (bases 1 to 1621617)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 1621617)
  AUTHORS   Kohara,Y., Shin-i,T., Matsuzaki,M., Misumi,O., Ogasawara,N. and
            Kuroiwa,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2003) Contact:Motomichi Matsuzaki Department of
            Parasitology, National Institute of Infectious Diseases; 1-23-1
            Toyama, Shinjuku-ku, Tokyo 162-8640, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP006502.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1621617
                     /organism="Cyanidioschyzon merolae strain 10D"
                     /mol_type="genomic DNA"
                     /strain="10D"
                     /db_xref="taxon:280699"
                     /chromosome="20"
     misc_feature    883..2833
                     /note="repetitive element"
     misc_feature    2491..3399
                     /note="repetitive element"
     gene            complement(<3521..>5401)
                     /locus_tag="CYME_CMT003C"
                     /db_xref="GeneID:16997827"
     mRNA            complement(<3521..>5401)
                     /locus_tag="CYME_CMT003C"
                     /product="copper-containing amine oxidase"
                     /transcript_id="XM_005539024.1"
                     /db_xref="GeneID:16997827"
     CDS             complement(3521..5401)
                     /locus_tag="CYME_CMT003C"
                     /codon_start=1
                     /product="copper-containing amine oxidase"
                     /protein_id="XP_005539081.1"
                     /db_xref="GeneID:16997827"
                     /translation="MHPLTPLTPAEILRAASIGRQGAPFPEEPLFERIQLHEPPKELW
                     VAGKPTEREAEVFIFRRSSIGVWKLIVSLSQEIVIAKKYYPNARPMLQLEQFTAIEEA
                     VRACPEFQAACRKHGIEDMSLVCIDPWSAGAFGSVEEKDHHLALAFCWVRNHADDNLY
                     AHPVEGLYAMVDVLGNKVLKVYDLQNIPVPRTECNYEPNLRTDIRKPLKPLRIVQDEG
                     PSFVLNDHSIAWDQWSLVIGFNAREGITLHDIRFAGRPVARRLSLVEMVVPYGTPVEP
                     HFRKNVFDIGEYGIGKLANSLRMNCDCTGCVVYLDAHIATMHGEPLTIPNAICIHEED
                     AGLLWKHWDFRTDRAETRRGRRLVISSISTVCNYEYASYWYFRQDGAIEYEMRATGVI
                     NTVACEPGRPSRYGTEVMPGVEGHIHQHYFCVRMDLSVDGDRNSVVECNTRAEDAAAN
                     PYGNAYYVTETPLRTELEACRCANPASHRYWKVLNPNKKNRVNMPVAYKLEPAHPLTP
                     FLDPDSPSGQRSGFIRRHLWVTAYDPEERFPAGEFVNLSDGQDGILRFVSQNRCIEDT
                     DLVLWHVFGIHHLPRPEDFPVQPAMSTGFMLQPYGFFDENPAITLPRSSDASQSGCRA
                     CG"
     misc_feature    5119..5657
                     /note="possible transcribed region"
     misc_feature    5595..8334
                     /note="repetitive element"
     gene            <8341..>10854
                     /locus_tag="CYME_CMT006C"
                     /db_xref="GeneID:16997796"
     mRNA            <8341..>10854
                     /locus_tag="CYME_CMT006C"
                     /product="probable anion transporter"
                     /transcript_id="XM_005539025.1"
                     /db_xref="GeneID:16997796"
     CDS             8341..10854
                     /locus_tag="CYME_CMT006C"
                     /codon_start=1
                     /product="probable anion transporter"
                     /protein_id="XP_005539082.1"
                     /db_xref="GeneID:16997796"
                     /translation="MSSADQPPTQSQEQNWSQVSSTVVEVAHTVDVHVQPVCFVDLSE
                     EIHAFAQLEKFAKCESSEVIIDLNVRNTHQAVGALVRCLEERGKLPAHSGDLLRRQLL
                     GAEPPSLFQLAQQGLHMSSGGDVLGHASGYWTHSIQGPSFIIGYTETPLLLSDEEAVA
                     VARLAHPLNAGALNNSLTRFLVLVLTLAHDTPQVRRASEMARVFASLFADEVFYDEAV
                     EASDRASFLEAIHRFLERQRDAAREREALHRSVRLATAATVTFFDDDNHVDGDGVAEY
                     LGGTDGGTLSGCRTKDVTINDNFGIMNARLDRYFKAQGYSNLDTVPRWKYWLALFFRF
                     PGALMAADLRRRLPHYRSDWTAEWNKIHALGKYFFASIFLIFTVTLPAIVFGVIASRT
                     THGEIGVIECLFAQGVLGIGFAFFSAQPLMVNMVTGPTIVYIQVLYRWSQRLGFAFLP
                     FFGWTGIWMGIFVMSYAIMNTSTLIPYLGRFTDEIFQTFIGIIFIQYWFTEFVRVTHT
                     GYEQVLLFLVLSLGTLLLALLLVSVRGSFLLRPILRSILGDIGPALSVFIWTGLSYAF
                     DPIDVPRLQIPGSVGYSTTTGRPWIVPLGSLSVGYVFLAIVPGWLLSLIVYIDQQVCT
                     YIVERPENRLRKGTGYSWNLFVTGALAVLASILGIPWMYAGLPHSLLHVYALAEIEDI
                     ELMGRRWIRVLRAREVRIAALSAYLFALLIILAKPALDQLPIYVLYGFILYMGAASFL
                     NNPLWDRFVLLFTQPTKYPPTHYVRRVPMSHLHLYTSVQVILTVVLFFVAVNFYRGAT
                     LFNTGLIFPLVLFLFVPFKWMVLYRWFPRRELRVLENQL"
     misc_feature    15049..17631
                     /note="repetitive element"
     gene            17539..19406
                     /locus_tag="CYME_CMT008T"
                     /db_xref="GeneID:16997797"
     misc_RNA        17539..19406
                     /locus_tag="CYME_CMT008T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461685.1"
                     /db_xref="GeneID:16997797"
     gene            complement(<19567..>20691)
                     /locus_tag="CYME_CMT009C"
                     /db_xref="GeneID:16997911"
     mRNA            complement(<19567..>20691)
                     /locus_tag="CYME_CMT009C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539026.1"
                     /db_xref="GeneID:16997911"
     CDS             complement(19567..20691)
                     /locus_tag="CYME_CMT009C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539083.1"
                     /db_xref="GeneID:16997911"
                     /translation="MTTSTSTSTSTVSSTSVPPCPGGVVYTCLLGDICGCVTTTGSCS
                     GNLAKVCVGDLCVCTQAGTSTSNGTASSGVSEAFFAEPERNSTHSAESAPRATATVTP
                     AVVHPTPTPYIATMNAMSVTPTSSQASSLSVSTLPVATTATLPPPFSPVITTSTSGGS
                     FLDNVEPGGERNSHSSTLGAFATAMRTTISPPTFSSLGSTPRPGTGIDAPTTSSSGPD
                     RIIEQTSAIPVSSSSSRAGNLGSGTSDTSSGSNSGTPGSGTSDTSSGSNSGTPGSGTS
                     DTGSGSSSKTPGSGTSDTSSGSNSGTFGSGTSDTSSGSNSGTFGSGTSDTGSGSSSGT
                     SGSGTSGSGGLSSTNNGMNMTAFGRWFYVVPRIQHVQNII"
     gene            <28954..>30675
                     /locus_tag="CYME_CMT010C"
                     /db_xref="GeneID:16997912"
     mRNA            <28954..>30675
                     /locus_tag="CYME_CMT010C"
                     /product="retroelement, alive"
                     /transcript_id="XM_005539027.1"
                     /db_xref="GeneID:16997912"
     CDS             28954..30675
                     /locus_tag="CYME_CMT010C"
                     /codon_start=1
                     /product="retroelement, alive"
                     /protein_id="XP_005539084.1"
                     /db_xref="GeneID:16997912"
                     /translation="MLESTNEDETWRYIRSRLDPPKKCLGLTPIVYEEALRTESASVN
                     EAWTDHGTELHEDATGHCRNRIYWHQYAAKLQRLDPVPEWNDPIFWPESVRTLLCSSN
                     RKTPGFNGIPAEWMKLVTPKDETTGTPSIPDEPDTILGKRLLELIQRMFEEAYIPDVR
                     RTAEVVPILKKDSPTDMNDYQTMRLIPSIMKLLCAIPTNRIQRGLQERKFFAPEQAGF
                     RSREECMSHALTHIEVAQRRSIGGQQPTYVCFIDFQKAFETAPHEAPFLKMERAGVSE
                     KCLAFFSALYADSWMRIRLGDGSKTPSIRIRRGLRQGEPASTLLFSIFINDLLNNRRQ
                     FVVEVPWIDCGEPGKEPSHRNRLAGLLFADDVVLLAPAPETLAASMEQVSAWADRWEM
                     SIGASKCGVMVIHGDSQSIRNRSWRLQNQEIPIVEKYRYLGVCLTPTLDEKAHVDEMI
                     AKMHRGTAIARPFLSDPSIPLAIRTRALRMCIIQPATWGAGWCGMKHTNASRLQTAAN
                     RAMRLVVVVGCSMQSRATNPLALGLELQIPSTEAIAAGCRACMRAKGPTMRTSLSRIF
                     MQTPTHR"
     misc_feature    31190..34444
                     /note="repetitive element"
     gene            <34442..>35773
                     /locus_tag="CYME_CMT012C"
                     /db_xref="GeneID:16997913"
     mRNA            <34442..>35773
                     /locus_tag="CYME_CMT012C"
                     /product="similar to C3HC4 zinc-binding integral
                     peroxisomal membrane protein PEX10"
                     /transcript_id="XM_005539028.1"
                     /db_xref="GeneID:16997913"
     CDS             34442..35773
                     /locus_tag="CYME_CMT012C"
                     /codon_start=1
                     /product="similar to C3HC4 zinc-binding integral
                     peroxisomal membrane protein PEX10"
                     /protein_id="XP_005539085.1"
                     /db_xref="GeneID:16997913"
                     /translation="MATLTRASVRVPVAQQAEVLRASEKDKQVRNELARALQNIWQGG
                     SIVLGRFLHIQRLNQRWSRAQRAPSRVPLSTGQAQGTSRSSTLGSLQQPWEPLGAPPT
                     AFRFLSDLVFYWSTVGIGRQTPGEEFCDLFECTIATGDRIQVATLSWKQRLLETLLYA
                     TIDSFQLLLYWLRVALRRVARFLERDWYSQCLLSRERRCRVASTLRFVDTCCARLQLL
                     QSSDRHALALTIQWLMRVHLALFYLYGRYYDPAKRLAGVRLVHIGRSRAYSPRYDALG
                     LLLIVQLVLEPIDVLMQRPAWKRKLRVLFKWALELFRKMYASVSTSKRIAGDGVSQAR
                     PQMVTAVHTTDRFSGEETGLPGSRTTDQQRSWSVVSPKFEPVPTARRARNESRHRCVL
                     CLDQCQDPTCTACGHVFCWICILDWVRQQNSCPVCRREAQLNDLRCLYSLG"
     gene            complement(37493..38983)
                     /locus_tag="CYME_CMT013T"
                     /db_xref="GeneID:16997914"
     misc_RNA        complement(37493..38983)
                     /locus_tag="CYME_CMT013T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461686.1"
                     /db_xref="GeneID:16997914"
     gene            <39189..>39854
                     /locus_tag="CYME_CMT014C"
                     /db_xref="GeneID:16997963"
     mRNA            <39189..>39854
                     /locus_tag="CYME_CMT014C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539029.1"
                     /db_xref="GeneID:16997963"
     CDS             39189..39854
                     /locus_tag="CYME_CMT014C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539086.1"
                     /db_xref="GeneID:16997963"
                     /translation="MGTRKELSLSERKVVVNVYDIVDLASTNDRLYRLGLGVYHTGVV
                     LGRREYAYGFKWGPGTGVFYTTPRCAPNARYRQSLEFGPIIVTATEARERFRRVCEEF
                     TGSSYHLLDKNCNTFTARVVYDLTGQKLPSWINRTARWASVFRCLLPPELAQPQSVPS
                     AEMLPSSHALEYRSMLSGPPGTEECSDGDAHSGSTLSRASTPPKEDSQPLPPRVELNE
                     ILQ"
     gene            complement(43547..45052)
                     /locus_tag="CYME_CMT015T"
                     /db_xref="GeneID:16997826"
     misc_RNA        complement(join(43547..45020,45036..45052))
                     /locus_tag="CYME_CMT015T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461687.1"
                     /db_xref="GeneID:16997826"
     gene            complement(44985..45071)
                     /locus_tag="CYME_CMT016R"
                     /db_xref="GeneID:16997964"
     tRNA            complement(join(44985..45020,45036..45071))
                     /locus_tag="CYME_CMT016R"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:16997964"
     misc_feature    45090..47322
                     /note="possible transcribed region"
     gene            complement(<45808..>48348)
                     /locus_tag="CYME_CMT018C"
                     /db_xref="GeneID:16997967"
     mRNA            complement(<45808..>48348)
                     /locus_tag="CYME_CMT018C"
                     /product="probable N-terminal acetyltransferase"
                     /transcript_id="XM_005539030.1"
                     /db_xref="GeneID:16997967"
     CDS             complement(45808..48348)
                     /locus_tag="CYME_CMT018C"
                     /codon_start=1
                     /product="probable N-terminal acetyltransferase"
                     /protein_id="XP_005539087.1"
                     /db_xref="GeneID:16997967"
                     /translation="MAPVSAAGAGSAQGRKPSLPTKEQSLFKQMFRLYEIKQYKKANK
                     IADQILRAVPDHGETLAMKGLILRALDQRDEAYELARRGLRQDIRSQVAWHILGLLHR
                     HDREYKEAAKAYQQALRLDPNNAQLLRELSPLQAHIRDFEGLLRTREQMLQQRPTLRL
                     NWLGLAVANHLLGRHEEALRVLDAWERIAAKYQLGTEGSNISEASLAYEYRLRLLEEA
                     DMREEALKYAETCIQEGKILDRTFALHTAARIAERIGDHERAHRCYWQLLRRNPSNAE
                     YLEGIVRNDTTGRDVVALYDAVPRELCDSAGEECFTPDEAPVLGCALGALRHLEGSCD
                     EFRKRVKELMHHFLEIAQVPSFARILENFYKDDAKKRVIDEVFLELIGNVPAAVHNEA
                     TAIFAAEHCMRVSRDPERAIAFLEQFTDSPECRAAIARIWRSVGAYRRAYEAAERARS
                     LDVRDRALNSLAAEYALLAGIPDRAMELILMFTHDGEAPPVQALYNLQVMWFELAYAD
                     AALAQGRIDRALKYYTAVLRHFTDFREDEYDFHAYCLRKSTIAAYVDLIRWEDRLHQH
                     EYYQRAVRGAARCYLALHRNRADITARLERLRVHAGAITTSASTNETSTAKRASRRPR
                     TPGWMETDPDGTMLISRAAPLEEAEKLTLPLILKATQPSELSEELLDIIFQVAVESAR
                     YALAARAVVAALRGSTTVETLSPMAIRLLVRLSRSIRGSSSAAKLAQAELDAVVKTLH
                     GNNVEKVCHEFFERRGATDLASVTALATATGDKAYLERGVLRLCEAGVHPFLSDFEEA
                     WAVAVTENVSEETRAAMRNWYPFADALSSNPPVDPCLFASRSEDISRP"
     misc_feature    complement(49986..52419)
                     /note="possible transcribed region"
     gene            <50088..>51500
                     /locus_tag="CYME_CMT019C"
                     /db_xref="GeneID:16998055"
     mRNA            <50088..>51500
                     /locus_tag="CYME_CMT019C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539031.1"
                     /db_xref="GeneID:16998055"
     CDS             50088..51500
                     /locus_tag="CYME_CMT019C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539088.1"
                     /db_xref="GeneID:16998055"
                     /translation="MAPALSVVAVWRAVEFLLRLNYQRFEGALSERYACLEAAASVIE
                     IRTVALRSLDGSYAKTSSEVSPRAPERTRLLQVRIFEHAARSMQQRLRTGDRARDTLG
                     VVLLVHGLSPSGNRDARMEAVARALASLGFTAVIPDFVEFRECRMGQQTLDEIAWAVV
                     AVAKAFHQESISLFAACVAAGYTLCAVLGSGEHIRQRVRTIMCIGPYAEVEAMVWCAM
                     SSDSADDYGRNAIFYNFLQYSSLISEIEHAGNAANGHGWMSQLLHALRLALEDSHFLR
                     GSTEAAMLPKYFKELRDRVPHSFDTANDASEDASSTRTSHVQRVFERFQLDKEFRELH
                     TKAMLSHPAVQKLIASCQPIRVVSREPIDFPILLLHGECDNIVPCRESRRLFCAMMHN
                     KLCTVKPLIEITSLLNHGDRQRLNWFTDTPQIIRLIRLFAQFFTWAAQPRISVPQSHS
                     SSAKNRTESRLLQPRIIRSR"
     gene            complement(<54147..>55769)
                     /locus_tag="CYME_CMT021C"
                     /db_xref="GeneID:16998054"
     mRNA            complement(<54147..>55769)
                     /locus_tag="CYME_CMT021C"
                     /product="similar to AKIN beta2"
                     /transcript_id="XM_005539032.1"
                     /db_xref="GeneID:16998054"
     CDS             complement(54147..55769)
                     /locus_tag="CYME_CMT021C"
                     /codon_start=1
                     /product="similar to AKIN beta2"
                     /protein_id="XP_005539089.1"
                     /db_xref="GeneID:16998054"
                     /translation="MIMYSDPVSDEPSIESKPSVVWKSGSVSVLHLLQRYDCYCECSQ
                     ADNWHTIERTKRPVYPRGYLVHGTCRLLPHDEPFFSITNTHSANWDPWFMETFCHRKG
                     NHLPASDSFERSYQDANRARLTTLFLGGTGASRSNNGFGNVGVAVAGVMGHSFSREGG
                     PGAPAAASRVLTRGSAALSERSAAALAAAASVGAAPAAISPRLSPHSPASLGMESYFS
                     GGVPRAAPGWAVPETSGMSENALQAKASASGPPPLPSAMQLPPALGSDSREHGGAEVP
                     PRRSVDHGVVHTPQLEDTETKLAEMELLEVPQRNLVPVAFNWHHGAVAGVEVAGSFDG
                     WKRRHPLHRSGNAFYILLNLEPGDYQYKYVVDGEWRYAPEQMVARDAHGNVNNFIRVE
                     PFFGEFLVQDDFLPGTKRASEVFRREQSPVGSYDNAIPGIESGFHREPPPLPVLLGEE
                     TAPRLPIEMTPNEFIEEQLRRERGEVDLFPPRPVTVTLNHLYIVPSGVSANVRHVHKY
                     VLTRRYHERYVTSVFYLRSDRIPSQSWERSPS"
     misc_feature    55635..58432
                     /note="repetitive element"
     gene            complement(<59384..>60214)
                     /locus_tag="CYME_CMT023C"
                     /db_xref="GeneID:16998056"
     mRNA            complement(<59384..>60214)
                     /locus_tag="CYME_CMT023C"
                     /product="similar to nucleolar-matrix protein with
                     nucleic-acid binding properties, subunit 6"
                     /transcript_id="XM_005539033.1"
                     /db_xref="GeneID:16998056"
     CDS             complement(59384..60214)
                     /locus_tag="CYME_CMT023C"
                     /codon_start=1
                     /product="similar to nucleolar-matrix protein with
                     nucleic-acid binding properties, subunit 6"
                     /protein_id="XP_005539090.1"
                     /db_xref="GeneID:16998056"
                     /translation="MAASASPLDGADVLKLDEWIWKEVASTIPARTRYGHDVDGRDAL
                     AVGTSSRKDPAAQRRNAQLRGSHGETRVSGEERRRSIKLSPSELAMSVNRAERNSANA
                     GIEQPSADCMPPNSRTMPRGAQTALSDAEPRAQTSANTSDAQEKRISFSRTMDEEGPR
                     GHSRKVTLAQVKQAVSEQKQLATETQEARVAHQLEKAIKRAAGCKVKDDPRLLKRALK
                     RQQKERVKRARAWQARLQAQSAAKEARQRERAASLKARRAARQQKRMLSRAKRLAKAS
                     "
     gene            <63190..>64392
                     /locus_tag="CYME_CMT024C"
                     /db_xref="GeneID:16998057"
     mRNA            <63190..>64392
                     /locus_tag="CYME_CMT024C"
                     /product="arsenic methyltransferase Cyt19"
                     /transcript_id="XM_005539034.1"
                     /db_xref="GeneID:16998057"
     CDS             63190..64392
                     /locus_tag="CYME_CMT024C"
                     /codon_start=1
                     /product="arsenic methyltransferase Cyt19"
                     /protein_id="XP_005539091.1"
                     /db_xref="GeneID:16998057"
                     /translation="MPCSCASGCQKSKNGGSTPSIRDHVADYYGKTLQSSADLKTSAC
                     KLAAAVPESHRKILADIADEVLEKFYGCGSTLPADGSLEGATVLDLGCGTGRDVYLAS
                     KLVGEHGKVIGVDMLDNQLEVARKYVEYHAEKFFGSPSRSNVRFLKGFIENLATAEPE
                     GVPDSSVDIVISNCVCNLSTNKLALFKEIHRVLRDGGELYFSDVYADRRLSEAAQQDP
                     ILYGECLGGALYLEDFRRLVAEAGFRDVRLVSVGPVDVSDPQLRKLVPDVQFYSCTFR
                     CFKVATLEATREDYGQSATYLGGIGEEFKLDRFFTFPKEKPVRVDRNTAEIIRHSRLH
                     QWFSVSAEQQHMGLFKANDSYALLHAPLSMQVEQLVCEVKKGSTDTCSEQASANGASC
                     CATGRRCC"
     gene            <64944..>68309
                     /locus_tag="CYME_CMT025C"
                     /db_xref="GeneID:16998079"
     mRNA            <64944..>68309
                     /locus_tag="CYME_CMT025C"
                     /product="probable exodeoxyribonuclease V, alpha subunit"
                     /transcript_id="XM_005539035.1"
                     /db_xref="GeneID:16998079"
     CDS             64944..68309
                     /locus_tag="CYME_CMT025C"
                     /codon_start=1
                     /product="probable exodeoxyribonuclease V, alpha subunit"
                     /protein_id="XP_005539092.1"
                     /db_xref="GeneID:16998079"
                     /translation="MRLYTHGMKGQLYRCESVEREHAGKWKAGWQQLPGLLGFIQSTS
                     RPHCSSRWRRGLKDPRRSIRYVGTVSTVRRRLLLSTGGGSGSDEQDPGPEPEQHKKNP
                     LRQVLGYADTRVFKDPSGKKIVHGVRVPETGEFLRVRYPAHVEIPAVGERMLLLGRFS
                     SDENGTEIFEVLDVRFVSDMEGPSRPVSNNRHVWDFRQNGHGLLSPYALVGMERNTSG
                     PASNADQQKTSKTPNPETASNPEGPASNPPERPRDESERKSSEPSASQPSDIAERVSA
                     QAVEAERPSQSSLVLHGDTAGSSSDTKASNVASSELPPAQESREVERSTIEGTIKSIL
                     YRNAQNEFVVCVLSTGEKIIGSCAEDVDFLLKPGARVRLRGAWVTHPVYGKQFQAGKI
                     RESAFIAESEQDQGRVSLVALKSYLASGVVKGVGVKMAERIINRFGESTLHVLDTDPA
                     NMLTQVEGIGRVRAEQIATAWRAQAPLRALMLFLRPYGIGPAICNRIARAYEGDPDPI
                     GRIRLNPYRLVEDVRGVGFRTADQIAAGLGIDPESPERYAAGLLNVLQTAENLEGHSF
                     LLKSDAFDRVLRLLFGTNAAASDDTNLAERQARFSQAVEDLKRRQALVVNNIGGDEEP
                     HLLTPRMDRAERGIIEHLRRLFFHSRKPIDSSESARRAVEGHVNREHILRWINVNYPT
                     LSAAQREAVCVAAEQPIMILSGGPGVGKTHTATAIVHMWRTLLGIENVQLTAPTGRAA
                     NRLGTAANVWGNARCATIHRCLECDRQGRFLRNEHNQLNTKAVIVDECSMMDALLAHA
                     LLQAIPNGARLVLIGDADQLPSVGPGRVFADLCESNAFPTIYLQEIFRQALKSMIVRV
                     AHEARNGRYLSMPRAKTPAEALELGRKTDLVFLEAADPVIGLQFLLELCCGRDNEPEG
                     ERKPVLPFDPLKEIQVLSPGHRGVIGVRNLNLELQKRLNPTRLPLSKQARTSEVFLRI
                     GDRVVQNMNNYDKGVFNGEVGTVMHVPDLDAIDSDNDQSSQLLVEFQNHDDWVAYDYP
                     MEAADQLQLAWAMSVHKAQGGGYPCVVIPIFMTHSALLTRNLFYTAITRAQELCVVIG
                     NLTAIRMAIRNEITTKRNTSLLQRLDELELDAK"
     gene            complement(<68752..>69261)
                     /locus_tag="CYME_CMT026C"
                     /db_xref="GeneID:16998080"
     mRNA            complement(<68752..>69261)
                     /locus_tag="CYME_CMT026C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539036.1"
                     /db_xref="GeneID:16998080"
     CDS             complement(68752..69261)
                     /locus_tag="CYME_CMT026C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539093.1"
                     /db_xref="GeneID:16998080"
                     /translation="MLCFQLTPSTGLTFVRPRVNATTCALSQLTRRGTSSRFTLASAA
                     LRMSVDDQERLTVRKQAQICLESGCSIEDLDALLERTRLIRDELMKDVKELNDVITNL
                     QALSEASKNLPGNEVAEKVTIPVTGKEARLDDVVRAVLRIFSRAEDHYPKIGLQPWSM
                     DKPKKKKRF"
     gene            69530..71119
                     /locus_tag="CYME_CMT027T"
                     /db_xref="GeneID:16998081"
     misc_RNA        69530..71119
                     /locus_tag="CYME_CMT027T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461688.1"
                     /db_xref="GeneID:16998081"
     gene            <70562..>71509
                     /locus_tag="CYME_CMT028C"
                     /db_xref="GeneID:16998082"
     mRNA            <70562..>71509
                     /locus_tag="CYME_CMT028C"
                     /product="Mn superoxide dismutase:"
                     /transcript_id="XM_005539037.1"
                     /db_xref="GeneID:16998082"
     CDS             70562..71509
                     /locus_tag="CYME_CMT028C"
                     /codon_start=1
                     /product="Mn superoxide dismutase:"
                     /protein_id="XP_005539094.1"
                     /db_xref="GeneID:16998082"
                     /translation="MRATFKSTAFLQVYGGGTTPCSNRHRLRRQTWTLGRRRSGYKCA
                     SVAALSLTQRTEYSRRELLRAFSLLPATAVFAYTAAMTVQQAAAAVAPSTTGAPATAP
                     KTGAEIPVAPLPYPYNALEPVIDAKTMRLHHDKHFAGYVSKTNAALNEEQRRTFPAIL
                     SRLSTISDRALRETVRNQGGGAINHRIFFQTMRAPVADAQKNVPDGALGDAIARQFGS
                     FEAFQKEFSRAAKSLFGSGWIWLFELGNSTRRELRIGTFANQDSPLMQGNLPLLGLDV
                     WEHAYYLRYGPDRGAYVDAWWRVVNWPAVARIFESRQLP"
     gene            <74798..>76168
                     /locus_tag="CYME_CMT029C"
                     /db_xref="GeneID:16998083"
     mRNA            <74798..>76168
                     /locus_tag="CYME_CMT029C"
                     /product="N-formylglutamate deformylase"
                     /transcript_id="XM_005539038.1"
                     /db_xref="GeneID:16998083"
     CDS             74798..76168
                     /locus_tag="CYME_CMT029C"
                     /codon_start=1
                     /product="N-formylglutamate deformylase"
                     /protein_id="XP_005539095.1"
                     /db_xref="GeneID:16998083"
                     /translation="MRQFIPVIHGSLDWIALEACSLASLKPVTLPHQRHREPAAAVEL
                     HPSAAKLYNYCRFNGIPGKQLDSVPEGASVAEEAHVAVYLQPITPVTGERHRARAPLL
                     VDSPHSGRIYPVDFEFYPEFTKLRRGEDAYVDRLVAPALHSGATVIAALFPRTYIDVN
                     RHENDIDVELLASPWPYPVRPSEKTARGLGLLRRYVIPGEPVYAPGKRLTVEQVHHRI
                     VSYFEPYLTLVANAIDALHSEFGVVYHLDVHSMKSRGNAMTPDGAGASRPDVVVGDLR
                     GLACEPEFTQFVVQALEAEGLSVSVNKPYAGAGILRRFGAPQDGVHCLQIELNRALYL
                     DEEQVECLSDGRFERLQSALARVFARVADWTLKRAAEEMGKPISEQDTEADFVRRVLP
                     SVARRLRSSGMRVSASLLEPLLLGDADGGHESDPDSNDSLDSDYEQEPEISEKQSPKG
                     LYCIPS"
     gene            complement(<76727..>76915)
                     /locus_tag="CYME_CMT030C"
                     /db_xref="GeneID:16998097"
     mRNA            complement(<76727..>76915)
                     /locus_tag="CYME_CMT030C"
                     /product="40S ribosomal protein S30"
                     /transcript_id="XM_005539039.1"
                     /db_xref="GeneID:16998097"
     CDS             complement(76727..76915)
                     /locus_tag="CYME_CMT030C"
                     /codon_start=1
                     /product="40S ribosomal protein S30"
                     /protein_id="XP_005539096.1"
                     /db_xref="GeneID:16998097"
                     /translation="MGKVHGSLARAGKVKAQTPKVAKQEKPKKPRGRANLRAKYNRRF
                     VNVATGPGRKRGPNAQTL"
     gene            <80177..>80842
                     /locus_tag="CYME_CMT031C"
                     /db_xref="GeneID:16998098"
     mRNA            <80177..>80842
                     /locus_tag="CYME_CMT031C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539040.1"
                     /db_xref="GeneID:16998098"
     CDS             80177..80842
                     /locus_tag="CYME_CMT031C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539097.1"
                     /db_xref="GeneID:16998098"
                     /translation="MFPALIRGAARFSERLRGDLRKKMQHQAPKPLILIDMDNTIVSF
                     DDAFVKRWKELDPHADEALIRKRQHFELEENLPPEARAIAEKIMGEPGFYASFRPLEG
                     AIVALRAMIDRSWEVRLCSAPHPLQWEDCVRDKYSWVREHLGSDWLHRIMIVRDKTCV
                     RGSVLIDDKPSISGFYPDPEWLHVVFDQPYNRDVEARARLSHWSQWEEVLTPILKAQG
                     FSV"
     gene            complement(<83391..>84260)
                     /locus_tag="CYME_CMT032C"
                     /db_xref="GeneID:16998099"
     mRNA            complement(<83391..>84260)
                     /locus_tag="CYME_CMT032C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539041.1"
                     /db_xref="GeneID:16998099"
     CDS             complement(83391..84260)
                     /locus_tag="CYME_CMT032C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539098.1"
                     /db_xref="GeneID:16998099"
                     /translation="MEVALEIETPRSAENQGRRPAAENTSCASLTSDTSLGTGNAAKR
                     AGRCGSGGMESEPSSDKDQDAAEQAQVTATVPARLSSEQVLQPGTFALETTKVRFLCV
                     NGDAFSVSFPVYATIGQVKEALLALQPKELLEQLRVLHQPPCSTASDLRILYLGNVLE
                     DTDTLLECGFQVGLCQTVHVVTRPATESGSRSQPPSSPQHPLGSNFVSYLWSSHNTSR
                     NRVPGSEAAGAEAERRHRRSHRQVASRQAGRASTSGTRSTRSQRSAHVAETNAPNTAA
                     VNGRVGCSTCTIT"
     misc_feature    complement(84995..87025)
                     /note="possible transcribed region"
     gene            <87205..>88686
                     /locus_tag="CYME_CMT034C"
                     /db_xref="GeneID:16998153"
     mRNA            <87205..>88686
                     /locus_tag="CYME_CMT034C"
                     /product="NADP-dependent glyceraldehyde-3-phosphate
                     dehydrogenase"
                     /transcript_id="XM_005539042.1"
                     /db_xref="GeneID:16998153"
     CDS             87205..88686
                     /locus_tag="CYME_CMT034C"
                     /codon_start=1
                     /product="NADP-dependent glyceraldehyde-3-phosphate
                     dehydrogenase"
                     /protein_id="XP_005539099.1"
                     /db_xref="GeneID:16998153"
                     /translation="MSSVFSPIHEGNTYFLLIHGKFLRSESGKTITGQTPFDGTPTYT
                     IQAATKEEIDRAYESAAQAQREWRRVPLWKRAEVVHKAATILREHVDEIATVILREVG
                     KNRKSAVSEVLRTADLCDYTAEEGLRMEGQLLVGDSYPGQPRNKLCLVQRVPLGVVLA
                     QGPFNYPCNLTGSKVAPALMAGNSCVVKGPTQGAVSALYLTAAFHFAGAPPGVVNFVS
                     GRGSEIGDYLVQHPLCNCISFTGGNIGLEVAKKAHMIPMQMELGGKDAAIVCDDADLD
                     LAAKCIVSGAFSYSGQRCTAVKLVLAVESIAEELISKVVERTRALTVGHPEDNCEVTA
                     VINKAAADYAESLAMDAKEKGAKFLLEYRREANLIYPLVVDHVNESMKLAWEEPFAPV
                     LPIMRVKDEKAAVAFANRLRYGLQGCVFTRDVNRAISLSSSITAGTIQVNGAPARGPD
                     HFLFLGHKDSGINAQGAKWSIEAMTKLKSIVINLPEEAYMVAN"
     gene            complement(<89493..>90866)
                     /locus_tag="CYME_CMT035C"
                     /db_xref="GeneID:16998154"
     mRNA            complement(<89493..>90866)
                     /locus_tag="CYME_CMT035C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539043.1"
                     /db_xref="GeneID:16998154"
     CDS             complement(89493..90866)
                     /locus_tag="CYME_CMT035C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539100.1"
                     /db_xref="GeneID:16998154"
                     /translation="MFAGEVHVLLLGIDKAQRCHNSNLALTSRRTPLPRSGRAVNTQR
                     RAPPRDAASKLQLQMETSNTSSKHVCFLVHGLQGAPGDLTYLAHALQQRGLLVHTVQC
                     NWRRTTDGISSGGKRVAAEIEHVVADYRSRLQWISLVGFSLGGLYVRSALETLFDDTE
                     GTTKVAGLEPHTLICIATPHLGVSSYGLLRYCPRWSHFLAGVFAGQTGRELFLLDEEQ
                     EPLLLRMAQHRAALRAMAAFSVRLLVANLSYDLMVNAGTSLVLPDERRYRVPVTTYEA
                     TCIHQAPHVRIWQLRPEAISASSRPETLQLKPDVAGASVLVSPFSSGARVLYLLRSFV
                     YFCGAWLVILCTWDQKTKKKKKNVQHSGGSDREDIERRMASALNQVSWDRYAVEFDAP
                     WIPAHNRIVAWSRNDFGAWLWRHGRPVVDHIATHVENCPSAQLVDADVDRSGTSNSPI
                     DAEPQVS"
     gene            90222..91916
                     /locus_tag="CYME_CMT036T"
                     /db_xref="GeneID:16998155"
     misc_RNA        90222..91916
                     /locus_tag="CYME_CMT036T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461689.1"
                     /db_xref="GeneID:16998155"
     gene            complement(<91721..>92326)
                     /locus_tag="CYME_CMT037C"
                     /db_xref="GeneID:16998156"
     mRNA            complement(<91721..>92326)
                     /locus_tag="CYME_CMT037C"
                     /product="similar to thioredoxin-like protein"
                     /transcript_id="XM_005539044.1"
                     /db_xref="GeneID:16998156"
     CDS             complement(91721..92326)
                     /locus_tag="CYME_CMT037C"
                     /codon_start=1
                     /product="similar to thioredoxin-like protein"
                     /protein_id="XP_005539101.1"
                     /db_xref="GeneID:16998156"
                     /translation="MSCAAFITTGWNLNYRRCGRSADRLCVLSHPVESRRWSLHWRAC
                     IDPSAASASEPVRLVPDHAHFVEWVTADTEAGRASIVMFKASWCHACANVYPRFLELA
                     SQQQASKYIRCYAVQFDENKKLCRSLGVTSLPYFQVYGGPEAGMCLEERSIGPKRLAE
                     LDELFTRYNRGWHATDQSARECTASSADHDATSPSAEARND"
     gene            <92830..>95580
                     /locus_tag="CYME_CMT038C"
                     /db_xref="GeneID:16998157"
     mRNA            <92830..>95580
                     /locus_tag="CYME_CMT038C"
                     /product="similar to retinoblastoma-family protein"
                     /transcript_id="XM_005539045.1"
                     /db_xref="GeneID:16998157"
     CDS             92830..95580
                     /locus_tag="CYME_CMT038C"
                     /codon_start=1
                     /product="similar to retinoblastoma-family protein"
                     /protein_id="XP_005539102.1"
                     /db_xref="GeneID:16998157"
                     /translation="MLDAKPGVEQWVRRLAAQAALDERTVDEALQLVEQVRFPEDEAS
                     WAACALLVAVQSPETAGHVLGAFLRCADVTPQPSPKGRGNCISDFFERAKMISPTAQR
                     MEQLLVVIANVHRKFVELYQGDIFDEERAWICFLTALALLASRGGPLGELPDLVSAYH
                     LMVAVIRRLQLKMLKQPDILEEDVERYLARLETTMIPWDDTSGMQDLYNSVFVGRLGF
                     DGRILLQAHHLGQMLCEMHKFPAKDAAPTLVQRVRPERCVPRFSRVISETLSSLRAKR
                     QRMESTPLSSSSSSSSSMAVKPSLHAEQVPPARGASAEDEQHSSTAPGPKSTALIYND
                     AETPMPSTQCVYPDQKDSADAVFDELAAAAALQNLARPREADSAGGKVAAALRTPQRA
                     ALSTQNPNRVPPPSPRRTPIRGGIASVRWVRAITALASRVCDNLRETYGGLGVDPLGF
                     ANSATGYLLQSFTERFHPETAEQRIGEVMAVYWYALESILNAETQRMNGSTDFVPKLL
                     ALQPFHKALLLCAVETVCASYGIRDEIHFEHLLESLKLSPFDFIKIIGAYVLNVENLP
                     PQAKRRLAACQECVLCVLAWQSDSLLVRALRTGDMSSIPTAALDLFFDKLLMQADYRI
                     LNVCARLGICEEAFENRVWSIFKLALTEQWELFIGRHLDTVLLCCFYGAAKTQRSLQF
                     KFVDIIRAYRAVVADSECIRLSDSLQTVYRDLALDDGGRGDIIAFYNLIFVPHMKRYL
                     LGQTTPEGPAAALSMSSTPERRRESESELDAHHVNAPHASPVSSPGLGPRIVDKIISS
                     PLRLPRIRSQSGVVSLRASPATSPRNTFPVWTLPTYSPQSTLTPLASSRRAALLAARL
                     PPNASPQFQAPRPEGSPSTRTQAAAAEAETQAEAAPASPHQPLAEQRITSPPGRRKLV
                     FF"
     misc_feature    complement(96175..99029)
                     /note="repetitive element"
     misc_feature    99623..101655
                     /note="repetitive element"
     gene            <101948..>104041
                     /locus_tag="CYME_CMT041C"
                     /db_xref="GeneID:16998175"
     mRNA            <101948..>104041
                     /locus_tag="CYME_CMT041C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539046.1"
                     /db_xref="GeneID:16998175"
     CDS             101948..104041
                     /locus_tag="CYME_CMT041C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539103.1"
                     /db_xref="GeneID:16998175"
                     /translation="MTGVVAESENLPPSGAEAKSLVDDAGFAPTAPPPAAVAPAPVDE
                     TADALGSSRSRGNGSGTEVVADADEEEQVAAAAAKAASAAASRIAFRFRTVRPGDFEP
                     ERHFYPRCLNAQIHPSVRFFMGLSRERIVSRYTHLNTRVDPVELRRLLAYSPRYLRWA
                     GCDLMHVVDSRSQRKCMVVIETNSCPSGQKSTPLFDDQDEYGGYRTLLQRALLSRLES
                     PAEQPIAGGKLAVLFDKNPMEASGYAACLAELTNEEVYLVPMLEENAADCAEPELRTL
                     ADGARGQATTGIRATDGSPTSAPATSSGTNVANGRSYAFFKNGILYVRRPKEHLLESM
                     IPNGANNCAARDRVSVVLPPDSRKQTCEAQPALRSEAASTTAGKNGILRDDDTADVVP
                     IRAALRYVTQRPWNRIPVHTQTIITNSVVSCLAGGRNKLVAAKAYDNANVELMACGLE
                     IRTPLTIRDVPLNMLRRWVDRLGGFAAIKVPYSNAGQGVFTITSQEEFDRFYEAESKR
                     PNRYDKYIVQALISNHEWSSAGSGTSAAGSVESYSRLYHVGTMPDKRGHIYVNDLRLM
                     ICGGPDGFVPVGLYARRARAPLAKEPGNNSWEQLGTNLSVKVGEGLFTSESERLMLMD
                     KKDFNLLGLSLDDLIDAFVETCLAVRAIDVMAQWLCSDAGGRFSLPLFRSVCGDDSLI
                     REIIRGSPELQNASG"
     gene            complement(<104529..>107105)
                     /locus_tag="CYME_CMT042C"
                     /db_xref="GeneID:16998176"
     mRNA            complement(<104529..>107105)
                     /locus_tag="CYME_CMT042C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539047.1"
                     /db_xref="GeneID:16998176"
     CDS             complement(104529..107105)
                     /locus_tag="CYME_CMT042C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539104.1"
                     /db_xref="GeneID:16998176"
                     /translation="MPCDAQAGQRLVRALSRAETWDTRRALLRTLVSELRDPESVTFF
                     LQETKLRSVLGQLIERALRAAQPHIVDLLDLSMQVIKCLVKSMQREDVVDFLEESKSL
                     VHGRKALRKLGRSKGVSAENFVANASEKAWGERLATLREQAANIIAEMEQVAGREKPS
                     TPSAPEETPEAGESRSLPVAVHAPVQTTDSGHPGTTEASIHANTDASNASAKAAASQD
                     DTSEPAQSTVGEHETPLAVGALSSFASADASMKTGRKRPRPRPERDTALPAFTSSSDE
                     ASQSVSARATESVGTQPTVDVSDADASLLPQQASAHATAARAERMHHSDALETTSPPG
                     ATIPERCANEATHHVPTPTVRDAGHTGDIAEKEASSAESTSFVAPEEAAATCAITSRS
                     AKRAKMEAPRPALRIRTSADASSTKLARKPASKRVHFAPEPVLVQVYAFEYIPDERTH
                     APVNLAGIVADTDELALDGESGATSATKERSTHAPGNGFSEVVEEGRLMQKKRQHRQK
                     VLAEMREDATFYPPPHVESSCPLGAAGECEQLSDVLANGSTVGCVPRNADSHQSGTIG
                     VVSPGSLSSGVPDEPMPPSPPRERSLDRQTPPPSLRVIPEYRVEHPAPTSFSYTPAGA
                     LAPAGTPEATVSAPAAATTANLLTSFHGTRGPSTLDPTRLQTKPWDRIQPPHLETSLW
                     SAIPPNTSGTPVSATSQGQHTDLLQRNQIDEAILQHLLLVKDEETRLQLLCDENVLRV
                     VQKYAEEKQREAALQYAHGYRHANAAPGNQWSGYPAPAPAPAPAPACTIISSTGESSS
                     RSGTRQYTAHRRCSGGLAAHRVSMDAEMRTRASAAAVYARAERVFPRITRTLCPGTAY
                     VA"
     gene            <107839..>109485
                     /locus_tag="CYME_CMT043C"
                     /db_xref="GeneID:16998177"
     mRNA            <107839..>109485
                     /locus_tag="CYME_CMT043C"
                     /product="GTP-binding protein of Nug1 family"
                     /transcript_id="XM_005539048.1"
                     /db_xref="GeneID:16998177"
     CDS             107839..109485
                     /locus_tag="CYME_CMT043C"
                     /codon_start=1
                     /product="GTP-binding protein of Nug1 family"
                     /protein_id="XP_005539105.1"
                     /db_xref="GeneID:16998177"
                     /translation="MAPHRHSKRETLKHKYKVQRKVAEHNRRMRRLARKQRQEGIIKG
                     QRKAQRELGVPNLYPYKKQLLEQAARRLALRSTVTAEAGSLGESPVSAPALSGANALG
                     KTPVFREVARSRRSFAAALRRVVELSDVVVEVLDARNPLESRSSALELLVRHEGARAA
                     GGKRLILVLSKADLVPREALQAWLCRLRAEYPTLAMHEGLDQTGQHRGPRQPGSAVQP
                     KQLSQLVQLLKLYAKRRADKQSSSSTITVGIVGKPNVGKSSLLNALCREQGAVATGAR
                     PGITKTLQEVRLDSNIRLLDSPGVVLDDVQEIDPAPVVEVEQTKAAGSPEPVANATSG
                     SRDESRMALAGFLAVEELSDPVAAARLVLERCQYNADGALSLLYEMPAFSMCDMVAAN
                     EATREESFATQFLALFAKRRGLLRKAGVLDLEAAARVLVQDWATGRIPYYTLPKHVGL
                     PSSQQLGAQIVSNWDNAFDLDVCEPSPSAEEVVMDENPATDAAPLSVADVDDEVVFHV
                     WKHKTRRERQTFALPLSPGAAVENVAADADLEDFEFSTTS"
     misc_feature    111963..114974
                     /note="repetitive element"
     gene            complement(<115217..>117364)
                     /locus_tag="CYME_CMT045C"
                     /db_xref="GeneID:16998178"
     mRNA            complement(<115217..>117364)
                     /locus_tag="CYME_CMT045C"
                     /product="probable ATP-dependent Clp protease regulatory
                     subunit CLPX"
                     /transcript_id="XM_005539049.1"
                     /db_xref="GeneID:16998178"
     CDS             complement(115217..117364)
                     /locus_tag="CYME_CMT045C"
                     /codon_start=1
                     /product="probable ATP-dependent Clp protease regulatory
                     subunit CLPX"
                     /protein_id="XP_005539106.1"
                     /db_xref="GeneID:16998178"
                     /translation="MSLVRVDAVLSQRSYLVDWKAWCSLGQKSVEPRLAAVGTIHRCR
                     RQGGVQCLSTSGTRSGSWEDADEFRYGSAVRDGHLMATYTRLLRQRVAALPTPRALFD
                     HLNEYCIGQEKAKRVLAVATHNHYKKVLASELMERVRAASAASTVGMGGTSENENTTS
                     TRFGWPGFEESLSNNSTSGSNSSTSSSTSTSGNTSQTISGKPSLQSSAGRILLMMMSD
                     MHGSRRTSGAGTRVPPAIHSIDSSNANPSSSWSSGNVRPRRMPLDSDAEASPAESNMS
                     RRPIVLDDLTEAAFRSSDLDLTASTKTRAPYIHESTGADDAHATSRESVKSRPGPILE
                     LRSSTPGAASYGTGNAGCMPGSLPYRMGDASSAASLTLNSLLDHCVEFEKSNILLLGP
                     TGSGKTLLAKSLARKCRVPFVMVDATTLTQAGYVGEDVESILHRLLQAADFDLNLAQR
                     GIVYIDEIDKISRKSESPSITRDVSGEGVQQALLKMLEGSIVNVPEKGGRKNPRAEYI
                     PMDTRNILFICGGAFSGLERIVGHRLAATSIGFGAHVAASDAVDDALLDHVESTDLIR
                     YGLVPEFVGRLPIVVNLRALTEPQLVQVLTEPRNALVRQFREMFRMSGVDMHITDQAL
                     RAVAREAVHKGVGARGLRGILERVLLDCQFDLPGKEGQTVLIDYEAEREAFETRFVDP
                     ASAATWNAGQTGHSSGPSTSTTAAAAAAAACIV"
     gene            complement(<118898..>121942)
                     /locus_tag="CYME_CMT046C"
                     /db_xref="GeneID:16998222"
     mRNA            complement(<118898..>121942)
                     /locus_tag="CYME_CMT046C"
                     /product="cullin 1"
                     /transcript_id="XM_005539050.1"
                     /db_xref="GeneID:16998222"
     CDS             complement(118898..121942)
                     /locus_tag="CYME_CMT046C"
                     /codon_start=1
                     /product="cullin 1"
                     /protein_id="XP_005539107.1"
                     /db_xref="GeneID:16998222"
                     /translation="MAALTTPPASRHAVSTAPFHETREAELVGEESAPPGSPVSSGGG
                     DLADDFEPSRSLAETRQSALTRPTIHTVHVPAPRGILSASVWMELYRTVLLLCTKPGP
                     CAVKRALYEQVEREMGAFCTSKILPDMERRIPTREGANRAMSAMLSYAPSGCSPMREL
                     EEARSGRSALRAGRARTSMDTQSSHFSHSKSTVGDSDRDQFPVSHQSMEEGSLQGIEL
                     MDMASDDVSDTSEENNGAGASITSIEELLHAFCAWWMAYQHLVQFVCKIFSYLDRCYT
                     DKENGPPPLEHLGRILFRTKVLDKMRDVLRTAILTLIARDRSGEVVDRALIHSAVVVF
                     TATDWVSYYTDEIETPYLAAFQTHYAEASERWLRDCSFPEYMREAEAALRQEIAIAQA
                     VLHPSSMDRVKDAIENVILLAHEEKLLAAETSGFVALLSQRQFDDLKRVYWLYSGKWI
                     HELCGQPMDGNGGLARSNASGRLVPESQAHQERALRPIAQQFARCAEAEGAALFAHYD
                     AITTEMNPNGDSVGYEDSDRSVARKRHADGSEKQETGPMSSALSCVLSPKFDAPYASC
                     GPEAEISPTEQAGMWLVRELVNLHETYQLVLRTCFENHEVFSQHFRMAFESILNNPRD
                     MSMIPKLLASYVDRVLQRIYMIEPPGADLSGHLRVIVQLLEYVYDKDVFADLYQFLLC
                     RRLIFDLSIARDLEITFVEELKAVIGPLFTARVEGMLRDMRTSLRFQERFNQWNAILD
                     NRERQRSTGAVTLEHATPSHTPVFQAILTTTSIWPSFPSDDDLRLPPALASCLTEYEC
                     FYAHQTQYRQLRWIHVLSKGLVECTRAAFPYMTRYDQVELELNTYQLCMLLLFEDRNE
                     MTFEQICDALNIQAPEILDLFKRCVLSLCNKKHCLFIKSPAGAELRPTDTLQLNRYFD
                     PQQRRLSFAYLADGFKREECQATRQNGHDDQVPLLEATIVRIMKMHRQFAHQKLVAGV
                     QNALSTRFTPDVHSIKERIESLIAREYLERDPQDPSLYHYLA"
     gene            complement(<125541..>126818)
                     /locus_tag="CYME_CMT047C"
                     /db_xref="GeneID:16998223"
     mRNA            complement(<125541..>126818)
                     /locus_tag="CYME_CMT047C"
                     /product="eukaryotic translation initiation factor eIF-2B
                     delta subunit"
                     /transcript_id="XM_005539051.1"
                     /db_xref="GeneID:16998223"
     CDS             complement(125541..126818)
                     /locus_tag="CYME_CMT047C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-2B
                     delta subunit"
                     /protein_id="XP_005539108.1"
                     /db_xref="GeneID:16998223"
                     /translation="MTSRGARTKQRLQYDDPDAVAKAEKRAVLKRAPAQRLVPLFAHL
                     PQLEPLRPDATQVSFVETSGLHPRVVRLGQQLAHGVVQGGSARVVALLLALREMIADF
                     EPTNSSSTLPPATDAAASMPVKVSDSGTESITETRRELERALNRHIQFLVDSRPLSIA
                     MGNAVRFVKSRLGIQALAQSFLELQQQIINDIDAFIEERVVLALETIFDAGADRIRDG
                     DVVMTYDASFLVESILLRAVQKHKRRFRVIVLDARPRHRGCALVHRLLQGGVAQCTYG
                     LLQGAPMLVQEANLLLLGAEACFSNGAVLAAAGTASVASLAKQERIPVAVACESLKFS
                     ERVLIDSICLNELGNPDELTWGTWMRPNASQVGQNGGIQPPLGEDWRERYPNLKLLHL
                     YYDVTPAEAVDALITEFGLIPPHGVAAVTLDMG"
     gene            complement(<127912..>129291)
                     /locus_tag="CYME_CMT048C"
                     /db_xref="GeneID:16998224"
     mRNA            complement(<127912..>129291)
                     /locus_tag="CYME_CMT048C"
                     /product="probable de-N-glycosylation enzyme Png1p"
                     /transcript_id="XM_005539052.1"
                     /db_xref="GeneID:16998224"
     CDS             complement(127912..129291)
                     /locus_tag="CYME_CMT048C"
                     /codon_start=1
                     /product="probable de-N-glycosylation enzyme Png1p"
                     /protein_id="XP_005539109.1"
                     /db_xref="GeneID:16998224"
                     /translation="MAHDDDGTLGVWCKTMCYTFSRAEIGETTSLACWRTELQRLSGI
                     EPSAQHLCWIFWCDALDMPLKVGTEVRADGGHSVEELLPVLGALAESHAELARRTRGP
                     FRSCLLLLKRGESATKCLTFLFRILQHWVQASRLDAQKVEAARASGVVPVQRFEQSAE
                     SHFSQLARSQTEPGIGVDNQPAAGDALPLADICFTAAVVREALHWFKREHFQWVDSPP
                     CEHCGIRTLRLKGVDLPAASEALHAAERVEVYECPTDERGCGALVRFPRYNDALFLLT
                     ESRRGRCGEWAQAFALALCACSVPRVRLVFDFEDHIWTEFWSESRETWIHADPCEEAL
                     DQPHLYSCGWGKALSWVIAIEVGLRTCHLEDRSRVYVPRAHWPAMEERQARTAGDIDA
                     ASGLLRMLATLSGGKQYYSETALAAEEHASESEGSTLEPGQHLQPRQSGAPAWIASRG
                     ENGPAIAKR"
     gene            <130147..>131433
                     /locus_tag="CYME_CMT049C"
                     /db_xref="GeneID:16998225"
     mRNA            <130147..>131433
                     /locus_tag="CYME_CMT049C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539053.1"
                     /db_xref="GeneID:16998225"
     CDS             130147..131433
                     /locus_tag="CYME_CMT049C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539110.1"
                     /db_xref="GeneID:16998225"
                     /translation="MSVQLRTAETYATRSNSQQSLLRNSEGVQFPRRCSDQQLLFRQC
                     GYPPSLGASTAGVGQKRERSNEATLTDLLERELLQRPVARPFARIRRQRGHPNDATPA
                     QTRRLHMDGVSRLGSPAPQRVETPTELESWLHSALRPKEVTASIGDQAASEPVGEAQV
                     PSIRRLLRLASQPQLSKHASPNGQPRADSSALTPNAAAQQQSPGSTSSHESPSSFDSI
                     DEQACMGALLRASLDPQRAQRLLECGAVQYLVQKLRDSTNSQVVTQIAAALVNLDPAT
                     TPVPGLAQALSKKLSLLTSECSERLMLYTLGDGSKPVLSRVEIDTLARHALASLPRHL
                     VLLRRLAELSAGGANGHATFWNHAAVQLIEKLKPATAAQAEHLLAILQTIPLACIQNK
                     RAAFANHIVIHIASRFPDQNSVQRAAVELLGKIAAA"
     gene            complement(<133264..>134748)
                     /locus_tag="CYME_CMT050C"
                     /db_xref="GeneID:16998240"
     mRNA            complement(<133264..>134748)
                     /locus_tag="CYME_CMT050C"
                     /product="unknown transporter"
                     /transcript_id="XM_005539054.1"
                     /db_xref="GeneID:16998240"
     CDS             complement(133264..134748)
                     /locus_tag="CYME_CMT050C"
                     /codon_start=1
                     /product="unknown transporter"
                     /protein_id="XP_005539111.1"
                     /db_xref="GeneID:16998240"
                     /translation="MFLEAELTWALGDLPLCAAAGAPRSTLALRRCAVPLTVLEAGRR
                     FRRPTRTGFWVRKIRSQNQSDPQQEQDRILVSRKQQPSRQPHVNKPAAADTTGSTGAV
                     TVLPGLQVPGRALYYFIAFLWGSFSPAVRELYTLKHPPPPALFNTARLLLSSATFWPV
                     WRTQWLVLQQRLRRARTNSTPVDDDYGNADGADMTAANGYGGEGGRLGAQLSPRELAS
                     TLTALFWSDTYRWFRGGLELGLYVFLGNVAQVIGLEYTPAARAAFLVQLQTVFIPLLS
                     DFFARIGFLEPGSSQLNSQTLITSGMAFLGVFLLSQDKTSTVPSNWLGDSLEVLAAFT
                     FSVYVLRLDRYARAITDTTPLAATKILVQTVCSLGWAVFSSQSNGHVHAGAELPPLSW
                     YDALVTVGVVAWTGLLVSAFSAYVQPQCQKRVSASETGVILATQPLFAAALSVLFLGE
                     RLGWKGALGGLVILLSTVVSSFLNAPQQPRSKLQKHDADSKTNS"
     misc_feature    134946..136937
                     /note="possible transcribed region"
     gene            complement(<135866..>136327)
                     /locus_tag="CYME_CMT052C"
                     /db_xref="GeneID:16998242"
     mRNA            complement(<135866..>136327)
                     /locus_tag="CYME_CMT052C"
                     /product="similar to 26S proteasome non-ATPase regulatory
                     subunit 9"
                     /transcript_id="XM_005539055.1"
                     /db_xref="GeneID:16998242"
     CDS             complement(135866..136327)
                     /locus_tag="CYME_CMT052C"
                     /codon_start=1
                     /product="similar to 26S proteasome non-ATPase regulatory
                     subunit 9"
                     /protein_id="XP_005539112.1"
                     /db_xref="GeneID:16998242"
                     /translation="MKETGRLLPEMLPSGPAHTQTAPSTASASRVVESAPAVRTASSR
                     EHRPGDNQPAQSSDWTETSLGQSNLRPFAKVVQVEAGSPAAQGGLLQGDLVVRVASCT
                     VCETLAMTVVFSVVKGLRASAPECSVTTHDIVVVPTPWAGAALLGARFEQY"
     misc_feature    136906..139866
                     /note="repetitive element"
     gene            <139985..>140917
                     /locus_tag="CYME_CMT054C"
                     /db_xref="GeneID:16998243"
     mRNA            <139985..>140917
                     /locus_tag="CYME_CMT054C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539056.1"
                     /db_xref="GeneID:16998243"
     CDS             139985..140917
                     /locus_tag="CYME_CMT054C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539113.1"
                     /db_xref="GeneID:16998243"
                     /translation="MTALWEEAFGSGVWAALIAMLVCALIERFGGAVGGVLATVPGTI
                     TPASIGMWLARKDVVSFRSSMASAPVGLLVNAGFLTFWRYLPYWVERLHLRRSVQLLL
                     LVGGSLTLWALLAIPVMVLVSWLRHREQMLILYALGTGSALLVLVVGVAGTWHTPKST
                     SRASGIPWWMHPVRALLAFFVVTAAVWLSHQWPALAGILAVWPAVFLTTMVALWWSHG
                     GDFQTSAAFPMILGLWAPMLFCGLVCFLYPRFDVSIGCILSWLLAVALGTIPLAGYIR
                     WRQAAVTLEHFPVNLRTAEDLFVENAPESSQSLA"
     gene            <144086..>144589
                     /locus_tag="CYME_CMT055C"
                     /db_xref="GeneID:16997775"
     mRNA            <144086..>144589
                     /locus_tag="CYME_CMT055C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539057.1"
                     /db_xref="GeneID:16997775"
     CDS             144086..144589
                     /locus_tag="CYME_CMT055C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539114.1"
                     /db_xref="GeneID:16997775"
                     /translation="MFWYSCGERLRTSLARPSARRLYAPLDQFTGFRWSKMTIRNHRF
                     PFEGRSASHYYTGDSRVSRTGASALHTAQPLRGFDAGTLRPAAGQRYPTASMRAPCAG
                     YQLPPDYVIVAIAGALLAGAGFMLRSLGDVIGEESRLPSASSAKTRRELYGSRRYLQK
                     KPPRDTK"
     gene            <146499..>148322
                     /locus_tag="CYME_CMT056C"
                     /db_xref="GeneID:16997776"
     mRNA            <146499..>148322
                     /locus_tag="CYME_CMT056C"
                     /product="probable sodium-dependent transporter"
                     /transcript_id="XM_005539058.1"
                     /db_xref="GeneID:16997776"
     CDS             146499..148322
                     /locus_tag="CYME_CMT056C"
                     /codon_start=1
                     /product="probable sodium-dependent transporter"
                     /protein_id="XP_005539115.1"
                     /db_xref="GeneID:16997776"
                     /translation="MLKGMGKGCAVRFRDGSAANTLGETEQSCAGRSCYGQMFVLSRV
                     PPVFSRNGFSLSKINRGCTLSLGSGIRRFGCGGLDARSSAWCGQPRCFVHTPSFPRVL
                     RGEKKQRSIGAQGSRRTVMVALTSKPVPWKRLAGWFVDGFPVWCMLASYLALRYPQVF
                     ISAPFVTSPQGVTFGLSLIMLSMGMTLTWQDVGRCLGLQPPAMEAGTPSGTLATSSMV
                     RRAVLVNTIMCFVVMPLVAYLLAKTVMTSTAVVSSLLGASLDTVKAVPGGMDAASKAL
                     KSAILTGMVLLGSVSGGQASNLCTYIAKGDVGMSVTMTTATTLLVTVALPLITSLLLG
                     AAVPVDGARLATSTARVVLLPLALGIALNTYVLRTNEARSRLAPWLPVLGVAATLFTI
                     VGALSPVSATVLAALSETPLVLAVAGFHIFGGFLGYYISKRMPGFYGDEATARTISIE
                     TMFKSPALSFILAAKHFDGAWVLVPSSISLVVLAPIAAAYAVLLRRSASLSFPAFMAG
                     ASSLTPFRNLKQVPLGSAAPSPQPVVRSNVLTVGETRVKSQPPTALPIVTAPGRLLHP
                     RVRVYFRNAPNPVIVPKSELRNFLLKMRKMKGMQVVKIVEV"
     gene            complement(<149071..>149685)
                     /locus_tag="CYME_CMT057C"
                     /db_xref="GeneID:16997777"
     mRNA            complement(<149071..>149685)
                     /locus_tag="CYME_CMT057C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539059.1"
                     /db_xref="GeneID:16997777"
     CDS             complement(149071..149685)
                     /locus_tag="CYME_CMT057C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539116.1"
                     /db_xref="GeneID:16997777"
                     /translation="MFLLYTGCVLRRDIRFGVCSKLNGAGARTQHYGSVRSGSTWWRK
                     SLLPRGRYPVFTGYAAEQQRAPSKRCLCESLVMVTDVASTWMAFAWGAVTGSALTTPT
                     VANSVQVPAFVAPLRGLLSLVFTTYTVLFLLRFVIPWFPQINAGRPPWSIVVLATEGL
                     LRPTRRIIPPQGGVDITPLVWLALTSLSQELLVGSQGIITLLTR"
     gene            <149831..>150667
                     /locus_tag="CYME_CMT058C"
                     /db_xref="GeneID:16997778"
     mRNA            <149831..>150667
                     /locus_tag="CYME_CMT058C"
                     /product="phosphoribosylglycinamide formyltransferase"
                     /transcript_id="XM_005539060.1"
                     /db_xref="GeneID:16997778"
     CDS             149831..150667
                     /locus_tag="CYME_CMT058C"
                     /codon_start=1
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="XP_005539117.1"
                     /db_xref="GeneID:16997778"
                     /translation="MFSTATYLGPYQVTQRHLWSQSSRLQSCRPRRFVRSIAFLKLQG
                     ELALFCGRRLYASAVRPGDAAAAGRVKRVGVLVSGTGRSLENLLQRIHTGTLLGAQIV
                     VVVASRADCFALERAAQRHVPAEVVAARAFSDTDRFSEAITEVLVAYRVDLVVMAGFM
                     HFYRIPPRYANRVLNIHPALLPAFCGRGFYGNRVHQAVLDFGAKVTGVTVHFADNEYD
                     HGPIVLQSAVPVLDEDTVETLAARVFAEECRLLPEAVELFCQDALILDGRRVRIRQRQ
                     NV"
     gene            complement(<153799..>154620)
                     /locus_tag="CYME_CMT059C"
                     /db_xref="GeneID:16998075"
     mRNA            complement(<153799..>154620)
                     /locus_tag="CYME_CMT059C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539061.1"
                     /db_xref="GeneID:16998075"
     CDS             complement(153799..154620)
                     /locus_tag="CYME_CMT059C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539118.1"
                     /db_xref="GeneID:16998075"
                     /translation="MANQWERFVWLALDAPDTIVERAPLVIQVAWLEDTQLRLWEPAA
                     REPLKRGDDAALRTYLRDAAECPWDPATDPSLVREFLLSRAVDCAFRDELAEHAGCVV
                     DEELDTDFIAETMALSEELVRADDKKLPLETQDLDPASFDLLRAELALPAASAREVLR
                     AGAHWAITRWPPREQWLPPCSRADAPATTALAATGGVPSEAQATPEPMCTETTVSDAT
                     CALPSGVYAQLQRIGRQLHNEELLYTQHLLNAALERAQTMTANPRTEARLGRVGH"
     gene            <153998..>154843
                     /locus_tag="CYME_CMT060C"
                     /db_xref="GeneID:16998076"
     mRNA            <153998..>154843
                     /locus_tag="CYME_CMT060C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539062.1"
                     /db_xref="GeneID:16998076"
     CDS             153998..154843
                     /locus_tag="CYME_CMT060C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539119.1"
                     /db_xref="GeneID:16998076"
                     /translation="MGSGVACASEGTPPVAARAVVAGASARLHGGSHCSRGGQRVIAQ
                     CAPARSTSRADAAGSASSARSKSKLAGSKSCVSNGSFLSSALTSSSLRAIVSAMKSVS
                     SSSSTTQPACSASSSRKAQSTALERRNSRTRLGSVAGSHGHSAASRRYVRSAASSPLL
                     RGSRAAGSQRRSCVSSSQATWITSGARSTMVSGASSASHTNRSHWFAMSAPVTTKRQP
                     VTALSNLRLYPVSLPRVAVQQRQTSMSYEATSPNAAGQAVRVTAKSESSCEAHLLRAS
                     TGSFL"
     gene            <155817..>157715
                     /locus_tag="CYME_CMT061C"
                     /db_xref="GeneID:16998077"
     mRNA            <155817..>157715
                     /locus_tag="CYME_CMT061C"
                     /product="zeta-carotene desaturase"
                     /transcript_id="XM_005539063.1"
                     /db_xref="GeneID:16998077"
     CDS             155817..157715
                     /locus_tag="CYME_CMT061C"
                     /codon_start=1
                     /product="zeta-carotene desaturase"
                     /protein_id="XP_005539120.1"
                     /db_xref="GeneID:16998077"
                     /translation="MCLQNGDTWTAFVAAPLGRTLAPAPVLVRCRTGLSTGATSPRYA
                     TTGQAHDNNARVYVRGGVRLRTGWRQSHCSMHQDGTDAFRVIRSARELLEARGYEPSE
                     FGLRPSGEPRRAVVIGAGLAGLATAMELADVGFAVDIFETRNFYGGKVGSWQDRDGNH
                     IEMGLHVFFGCYYNLFAIMRQLGVLDQHFLPKEHRHIFVNRDGRLAELDFRFGPVGAP
                     WNGLKAFFTTEQLNLIDKLRNAIALGTSPIIRALVDFDGAMEQVRELDEMSFTQWFMR
                     HGGSRGSIERLWNPIAYALGFIDCDQISARCMLTIFQLFAVRTEASQLRLLIGAPVQY
                     MLKPMLEYIKARGGRLYLRQGVRSFITESDAETGQERVVGVRVRSAASTSATKNRAVS
                     STYVPADVVVAALDVPGMKRLIPDSWCEQYEYFANIKRLETVPVITVQLRFNGWVTEL
                     ADGSLHRDGDARGLDNLLYSADADFSCFADLAVTSPADYYRAGQGSLLQCVITPADPY
                     LHMADAAIVAKVCSQVQELFPSARNLQCIWSNVVKLGQSLYREAPGAERYRPTQRSPI
                     ANLYLAGSYTQQDYIDSQEGAVRSGRLAAQAIVEDLLTAMKQGNGATLTYAAAPPMQR
                     STLSTEAS"
     gene            158351..160321
                     /locus_tag="CYME_CMT062T"
                     /db_xref="GeneID:16998078"
     misc_RNA        158351..160321
                     /locus_tag="CYME_CMT062T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461690.1"
                     /db_xref="GeneID:16998078"
     gene            complement(<161684..>163150)
                     /locus_tag="CYME_CMT063C"
                     /db_xref="GeneID:16998196"
     mRNA            complement(<161684..>163150)
                     /locus_tag="CYME_CMT063C"
                     /product="chloroplast membrane protein ALBINO3 or ARTEMIS"
                     /transcript_id="XM_005539064.1"
                     /db_xref="GeneID:16998196"
     CDS             complement(161684..163150)
                     /locus_tag="CYME_CMT063C"
                     /codon_start=1
                     /product="chloroplast membrane protein ALBINO3 or ARTEMIS"
                     /protein_id="XP_005539121.1"
                     /db_xref="GeneID:16998196"
                     /translation="MGALQILSTQRICGRLLEVSGRKLDTEAEANDTNSIARSEQRLL
                     FRFVPVLATGPTAGSCGCKIGFVAGLYASGTGSVRSLATASRQCGYTAAGCGLGGAWR
                     RCRLRPGGEPNRRRVGLMSPRRRSVGVQSLRLQFVDPSQSLAALQDSWHTVTFALASA
                     SLLLVDAADGSTSAAAAATAAAGAQKAGLWNGFVHLIETIITGTGDTLAALGVPGSYG
                     FAIIFLTIIVKAITFPLNYKQMKSTMAMQALAPKVRELQARYRDNPQLLNLETARLYQ
                     EAKVNPLTGCLPVFVQLPVWIALYRALMNLAADNRLDQGFFWLPSLEGPVRQGQGLSS
                     WLFPFQNGAPPIGWHDAIAYLVLPCLLVVSQSISQKILQPPVQDPQQQQANAILRFLP
                     FMVGWFSLNVPSGLGLYWVTNNIVSTIQTIGIKRYLASKQPERVGAPRTLDGAVDERL
                     NPEAMGFTPRTSETNGDAVDTEDPSTKSKRKPSKKKRR"
     misc_feature    complement(164054..165168)
                     /note="possible transcribed region"
     misc_feature    165345..168266
                     /note="repetitive element"
     gene            <168404..>170536
                     /locus_tag="CYME_CMT066C"
                     /db_xref="GeneID:16998198"
     mRNA            <168404..>170536
                     /locus_tag="CYME_CMT066C"
                     /product="ATP-binding cassette, sub-family B, member 6"
                     /transcript_id="XM_005539065.1"
                     /db_xref="GeneID:16998198"
     CDS             168404..170536
                     /locus_tag="CYME_CMT066C"
                     /codon_start=1
                     /product="ATP-binding cassette, sub-family B, member 6"
                     /protein_id="XP_005539122.1"
                     /db_xref="GeneID:16998198"
                     /translation="MARRWKLKLPELRFLNWRRWEAYTDSWETSSSTDVEKLVEPAHR
                     ETLSLPDTSEVRRLLASLAPFELERLQSVQAVFWLLKPFLWPREWRIRFYVALTFVLT
                     VAGKVLTVLAPVALKRVIDALASAPVGSSTAAVRKAVTYTVLYAASRFGMQLLNDGQR
                     YAWLTVSQTATRAIALTTFAHLHSLSIDFHWQRRTGEVIRVMDRGVASLGEVLSVFVF
                     TVFPTAIELLLVLWVFFAMGSFWIAITVLVSVLVYGVYSKQLTEWRTSYRKLYNERDN
                     AAEARMVDSLLNSETVKLFTAEAREVNRYTEAYVALQESERTLIATLGLLNSGQSVII
                     SLGVGISMVMATRRVARGEASAGDLVMVNAYILQLYQPLRWLGSAYRQIMRALTDLDK
                     LSRLLALEPTVRDLPGAPALRRRHGQVEFHQVTFHYDVLWSGTEPGAATRAQMPSTAT
                     DTATATSSSSGGGGGAGGAGGVHNLSFTIPPQRVVAVVGPSGAGKSTIVRLLLRLIDP
                     QQGAVYIDGQNIAHVSQQSVRHAIGVVAQDPVLFNETIAYNIAYGVDAAATPACIEAA
                     ARAAHIHDFITKLPDGYQTVVGERGVRLSGGEKQRVAIARAILKNPSILVLDEATSAL
                     DTATERAIQANLMEMRTGRTTLVVAHRLSTVIDADEILVLNGNGEIVERGAHAELVSR
                     PQGAYRAMWEAQARAQVTTSDSVPSTTA"
     gene            complement(<170829..>173486)
                     /locus_tag="CYME_CMT067C"
                     /db_xref="GeneID:16998199"
     mRNA            complement(<170829..>173486)
                     /locus_tag="CYME_CMT067C"
                     /product="transcription factor E2F"
                     /transcript_id="XM_005539066.1"
                     /db_xref="GeneID:16998199"
     CDS             complement(170829..173486)
                     /locus_tag="CYME_CMT067C"
                     /codon_start=1
                     /product="transcription factor E2F"
                     /protein_id="XP_005539123.1"
                     /db_xref="GeneID:16998199"
                     /translation="MSESAAATPEARSRRSTLYPRGSVEFSPVLDDALPSASTARPRG
                     RQSRSTSKTDGGSGRHGTLELSESATTPVKRWLGRPLLDSETCLTSPVTSALLGGADA
                     PLQARSPNDGLSSSPDDRFQEDELDLGRTPRTSSGGASGAKVAKRRSGCRQDCSLFKL
                     TRRFLDLVFKTDDGLLDLNAVAERLGVKKRRIYDITNVLEGVGIIEKQGKNHIRWKGM
                     GESAAGNPGTRKTALAAVNRDASGEAPAKTETATVQRAGLTTDGNAVVCGVDLAADQE
                     ILRLREEILELEKSDRLLDEQIRILRDDLRRLSTSEKVMRYAYLTDEDILSLSIFQKH
                     MVIAVQAPPGTELLWGDDPKARNRASKAVVYQLHVRSSGGAIECYLLSAGIGGEHRRH
                     AGAALTSNLSLQSNGPDRARICNERAPVAERNGMDVADGSWVPALRRRAHKKDPRVPP
                     DANAAPWRAAAPQKLGAEAAIYNSLQAALPDRGHNPIAALTFDTQLANNRDCNADVEA
                     SAFDEAALRADIEEFEAPAQSYASWGSGAPLSIPASPTGSSRTLEAVDGIVELASPLR
                     CMAPSGSSPTRLSFAATAGGGLATMPSAGHDGIRPFPMRSVCREPGIRTSLDASSATS
                     IATTVTIEQSSAAFMYTAAANARQGGPGKRSNGSASAVASAAVAGAASSAAPCQHGVR
                     IARLNTERRDASPVALRTRFVGDDVDDRTRPEHVAYGAPDPEGHTTPPRYKHLHAVGE
                     DAVDDFHGEVLNLRRQQERGETLHPGTVSPGGTLKLRRASSPYASPLIDGVQRFSPFR
                     RGAVGAGLHLDYELDGSFSGMLACVSGGALTRSPSPPLLQDLAVESLLLDHTRDRAIC
                     GNSSSGGVGGSNLMDLFISTEPDFERSLS"
     gene            complement(<174188..>175972)
                     /locus_tag="CYME_CMT068C"
                     /db_xref="GeneID:16998200"
     mRNA            complement(<174188..>175972)
                     /locus_tag="CYME_CMT068C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539067.1"
                     /db_xref="GeneID:16998200"
     CDS             complement(174188..175972)
                     /locus_tag="CYME_CMT068C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539124.1"
                     /db_xref="GeneID:16998200"
                     /translation="MDDIDWKALLCDEVAAFPERVASAGNAQRVAKEHPDTPSQALAD
                     GAAGRTRAASPEPTSRGAPPWLPLSEWSPHDLIPWSRNSRFRAVEATDSGSAVAPARP
                     VTQATAVPQSPCSFGGIESFLWYVSPDIPKTPVSYRRMSQGVSSSPLGVSAFSPTLRA
                     CLGQAPDKEWPGWCTEQIDRLAADRGDTVLNAPSAGSPGRRPQPRRPIRGTEHQPLQP
                     RSLMDALYEASGAREKQTLGRRNVASEQLTVRQCIAASVAEQASPSAAAADTPSSPYA
                     AHPDIDIGILMTNPSFLLKHFHPYHPRPHDQHLHGSGPATGEDCHPDSPRTSGRYARS
                     IGFLTAHLLGLFAPQAEGKASYAEHQTCSSLATALKVAPRRIYDVISVLEAIGILERE
                     ARGGNYKTPSMRIRLRSLTPSRLLSAATGARAQRAHLERQLEDLANISSELDDDLHNL
                     RCRLRDLLRQLLYRPGSTVTCALETATVVASELDERGHQHATSKKRWFLLRPCDNSGL
                     TGFWASSHPPLSAERHIGTGDSAALQCRLRVPAAAQLIPVPAIEATTPVSVASVRKAS
                     YRRDGPLQSLDPNRCLADMRPVKRQRYR"
     gene            <178456..>180282
                     /locus_tag="CYME_CMT069C"
                     /db_xref="GeneID:16997746"
     mRNA            <178456..>180282
                     /locus_tag="CYME_CMT069C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539068.1"
                     /db_xref="GeneID:16997746"
     CDS             178456..180282
                     /locus_tag="CYME_CMT069C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539125.1"
                     /db_xref="GeneID:16997746"
                     /translation="MRSSPMFILQRSSFVTSDGSLFGKVQGQRQARKWRGGAVRQLQA
                     SMEAGNVARRRWAFQQAKRQAEETIRKVQEARRKQEELMQALDMPVRAPPPPPTSVVR
                     DTSHLEAVRREIEANRQAAQRAAELAREESKATGRAAGAATSTATSSGVTAGSGRDST
                     AGRSAAAAAGSVSAPSTAASKDAKGAAGSGDAGTAAPKAAGSASTPTSPSASAGATAT
                     NRASGSMPATGSAASTKSSPAPPASETSGGRTSQPPKTSASASEPGSGGADGPTKTDR
                     QGKQPSMLASTTTTTTTTSPSSSPNELGRHRLSERELRPSFTTPGESDRELESLRRAR
                     DEALPQTKRGVSFGDDSTRDDSGSAQPFVPEWTSPGNASAPSSGPNRAPLGSRVQPSD
                     GAVTYSAPRDATYIASETESITAPRSTTASVTPSSAGSERNAQDRDTGLRNGTRSEMD
                     MPSNDRDASRSAAPKGFGMYIRRAGRENKQTQHGDSPADGLPMPQGSLGDESSTRDAS
                     RNPGGESPVPNARIHGSRAPVTTTNGVAGSPATSSRNTPNVAADLEHKVIDHLRSGTL
                     TTLTVPQLRSFLQQQKLPTTGKKKDLVEQVERWWQAAHHQIR"
     gene            complement(179383..181059)
                     /locus_tag="CYME_CMT070T"
                     /db_xref="GeneID:16997747"
     misc_RNA        complement(179383..181059)
                     /locus_tag="CYME_CMT070T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461691.1"
                     /db_xref="GeneID:16997747"
     gene            <181259..>183031
                     /locus_tag="CYME_CMT071C"
                     /db_xref="GeneID:16997748"
     mRNA            <181259..>183031
                     /locus_tag="CYME_CMT071C"
                     /product="methylcrotonyl-CoA carboxylase"
                     /transcript_id="XM_005539069.1"
                     /db_xref="GeneID:16997748"
     CDS             181259..183031
                     /locus_tag="CYME_CMT071C"
                     /codon_start=1
                     /product="methylcrotonyl-CoA carboxylase"
                     /protein_id="XP_005539126.1"
                     /db_xref="GeneID:16997748"
                     /translation="MRPFGSVRLWRGAAAFPLAAWLPAFATRRLASSQSRNLAEPPKQ
                     PVNANQVLQNEYERLMVLAEQGGGPSARKRHQARGKLLVRERLAALLDPGSPFLELSA
                     LAGAGDYVYAGAPDDDSETKMPPGAGLLTGIGLVAERWCMIIANDATVKGGTYFPLTV
                     KKHLRAQEIAAENRLPCIYLADSGGAYLPLQHRVFPDRDHFGRIFYNQARMSRDGILQ
                     IAAVLGSCTAGGAYVPAMSDEAIMVHGTGTIFLGGPPLVKAAIGEDVSAEELGGALVH
                     TQQSGVADHLVENDAEALLRVRAAVKRRALPARQASTSPLMESFPAPRASIGDLERTL
                     VGENPRADESSARLIGGAGAGGLDMYQLIACLVDGSVFDEFKAQYGTTLVTGFASIYG
                     QQVGLVGNQGVLVSDAAKKGTHFIQLCEQQGIPLVFLQNISGFMVGKQAEWGGIAKDG
                     AKMVNAVACVRVPKITVIVGSSYGAGNYGMCGRAYGPRFLFTWPSARIGVMGSEQAAN
                     VLRQVQGGRSDPAAEAGINALTKRYAFENSAWFATANLWDDGVVLPRDTRQVLGIALR
                     VVESASETETSVTAQRGRYGVFRM"
     gene            complement(<183861..>185759)
                     /locus_tag="CYME_CMT072C"
                     /db_xref="GeneID:16997749"
     mRNA            complement(<183861..>185759)
                     /locus_tag="CYME_CMT072C"
                     /product="Isovaleryl-CoA dehydrogenase"
                     /transcript_id="XM_005539070.1"
                     /db_xref="GeneID:16997749"
     CDS             complement(183861..185759)
                     /locus_tag="CYME_CMT072C"
                     /codon_start=1
                     /product="Isovaleryl-CoA dehydrogenase"
                     /protein_id="XP_005539127.1"
                     /db_xref="GeneID:16997749"
                     /translation="MLWLGRAFGFREAPKHSDVLSRLWWRCCYHHARKWYPGDCVCGC
                     IADHRTGSEWRFESRERYTEVCPDARTPLRVFSRQHGYCTVEHALKREQVGAVASVTR
                     LEVPLPSGLQRNRERTGVLSPGKRFRREVSSSSSSSSSSSSLPPQSTVASAGPASAHS
                     ASAPSTSAWWTAPGPTYYDGRHTHADEVLLGTVLDSDRSGLRNTVRAFAHEYIAPYAA
                     AIDEANRFPREQLWTELGNLGVLGVATANAYGGLGLGLVEHCLVMEELSRASPSIGLS
                     YGAHSNLCMMQIERHGSAAQKERLLPPLCSGVWVGALAMSETGAGSDVLGSMRTSAYQ
                     RKRTTAAGELRSGWSIRGTKMWITNGPDADVVVVYARTPELESHSASTSTLAAVESAS
                     SSSLPKQSKPKLTAFVLETAQLGPRYRVAQKLDKLGMRGSNTCELVFDDVWVPDDAVL
                     GEPGLGTTVLMAGLDAERLVLSAGPLGIMQACLDVVLPYVRERQQFGSPIGTFPLMQA
                     KLADMYGALAASRAHTFGVAASVDKLTRQIGEPTPPASSKHGGLNPQLRRFRKDCASV
                     ILQNAERATQCALQAIQALGGNGYISDYPTGRLLRDAKLYEIGAGTSEIRRILIGREL
                     YEASHATK"
     gene            <186167..>188920
                     /locus_tag="CYME_CMT073C"
                     /db_xref="GeneID:16997750"
     mRNA            <186167..>188920
                     /locus_tag="CYME_CMT073C"
                     /product="methylcrotonoyl-Coenzyme A carboxylase 1"
                     /transcript_id="XM_005539071.1"
                     /db_xref="GeneID:16997750"
     CDS             186167..188920
                     /locus_tag="CYME_CMT073C"
                     /codon_start=1
                     /product="methylcrotonoyl-Coenzyme A carboxylase 1"
                     /protein_id="XP_005539128.1"
                     /db_xref="GeneID:16997750"
                     /translation="MNSAAIALDAVFIANRGDAALRVIRTAKRLGLVTAVACTRAELV
                     RPTAAVDAADYAVELDGALPAAGPATAPYVDVERVVLAAERFRERLLERKPDARKSVS
                     ALQVAVHPGWGFLSERSDFANAVLERGFRWCGPSAHAMQAMGEKVSARETMSKAAVPV
                     VPGLRLAQVASQSTEVQRLGEMLVSQVGFPLILKPVYGGGGKGMRVVRHPSELPRALQ
                     AARREARIACGDDTLLAERYLESVRHIEFQIFGGYRDGAYEAVHLYERDCSVQRRHQK
                     IVEESPAPGLPVATREKMAQCAVRAARAVAYEGAGTVEFLYDPVREDFFFMEMNTRLQ
                     VEHPVTEMIVRTRPLNVGTLQNSRRTLDGSPGDRSEAAPVDLVEWQFRVAAGEPLPVA
                     SQDALSIREPAHAMELRVYAETPDEQGNWLPQQGRLERFAIDGLDIEQHMPTDTLRVD
                     AGIRTGDEVSIEFDPMIAKIIVCEPERPQSISALQRLLESSQIWGVSTNVPFLQALLA
                     DEEFLHGVGGRGHGVPVTWLEHRLPLLLSRTVSAGAVRSETAPPGTRSVLETSSTLQG
                     ASLETYASARETQKRPDEQGCPLDLESRGDGSDVARLASSAVPVWRALAATAWAATEP
                     YWLLSRPFGGFRNDGRGNRFEWYLEYPVLQQMQQRAPLQRPTNESMLPSFYRALLRLG
                     RAPATVCFFPSAADAAPRTGLENHPERDDLLDWVVEIQQVWPAASESAVVPLTLYPDE
                     RLAIDGVVAPVDAYCVEAPLEATDHEELAPQWCFRLADGTIVRVHTPLSFALWRLGRR
                     ELTSTSTSTSASTRVAQAETGLHRRPAGKAAVESLPGQVLSPMPGRLLELLVQKGQMV
                     HHGEPLAILEAMKMEHTVRAPMDGVVTRVTELPCGAYMPAGTFLCMLRDLRKEPSEQA
                     DKV"
     gene            <190486..>191529
                     /locus_tag="CYME_CMT074C"
                     /db_xref="GeneID:16997870"
     mRNA            <190486..>191529
                     /locus_tag="CYME_CMT074C"
                     /product="AU-specific RNA-binding enoyl-CoA hydratase"
                     /transcript_id="XM_005539072.1"
                     /db_xref="GeneID:16997870"
     CDS             190486..191529
                     /locus_tag="CYME_CMT074C"
                     /codon_start=1
                     /product="AU-specific RNA-binding enoyl-CoA hydratase"
                     /protein_id="XP_005539129.1"
                     /db_xref="GeneID:16997870"
                     /translation="MSSLSFCKQKFRRKISGFDQNAYLVIPWQSATSRRCLVSLDSAG
                     SGCFQPRPSNGMRPLTRLARFWHRGFCEKRTSLVLWNEPIERTVVLTLNRPERANALS
                     AELVEELRTHLHRVLELASARPVRCVMLILASAHERIFSAGADLKQRAAQSPDQQRDF
                     TRRLRETLQSLAKLPCFTAAALRGGAYGGGLELALACDFRIVQEGAILALPETGLGIL
                     PGAGGTQRLPRLIGVSRAKEVILLGRRLDARQAHHYGLVNVVVPDADAGTAATDNTLE
                     EALQLAASLRERSPMALQLAKRAIDEGIDASSLARGLAIEDSCYAETFGTKDRAEGLQ
                     AFVEKRSPRFTGE"
     gene            complement(<192320..>193744)
                     /locus_tag="CYME_CMT075C"
                     /db_xref="GeneID:16997871"
     mRNA            complement(<192320..>193744)
                     /locus_tag="CYME_CMT075C"
                     /product="DegP protease precursor"
                     /transcript_id="XM_005539073.1"
                     /db_xref="GeneID:16997871"
     CDS             complement(192320..193744)
                     /locus_tag="CYME_CMT075C"
                     /codon_start=1
                     /product="DegP protease precursor"
                     /protein_id="XP_005539130.1"
                     /db_xref="GeneID:16997871"
                     /translation="MERETLPSGNPSNAFNVGFLLPVVREQWQLRALPRRFLMSRLRC
                     GSVAGRTGTSAAAAGATATATADTVPGIRKLRASQKHLRALSSTCLSRGLGRTFASLL
                     GAALWCVAPGDHSAVSALSLPSAPNYVLPVTEAVAATQSATYTESDLSPEEKATVALF
                     ERNRDSVVLVTTLIERRDFSSLNIMEVPSGNGSGFIWDKDGHVVTNFHVVRQAEAARV
                     TMADGKTYPARLVGYDADKDVAVLKIDAPTETLRPVTLGSSAGLHVGQRAYAIGNPFG
                     LNETMTQGIISGLGREIRSPTGRPITNVLQTDSAINPGNSGGPLLDSQGRVIGMTTAI
                     YSPSGASAGVGFAIPIDTLKTVVDTLIKYGKVTRPMIGISYLESSQAQILGINEGVLV
                     LDVPQGSEAAKAGLQGTRRSTFGQLELGDIIVGLDGERIRNEADLFRVLEEKKPGQVV
                     TLEVIRGNDPRNLVKLQVKLSSSQ"
     gene            <194643..>195329
                     /locus_tag="CYME_CMT076C"
                     /db_xref="GeneID:16997872"
     mRNA            <194643..>195329
                     /locus_tag="CYME_CMT076C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539074.1"
                     /db_xref="GeneID:16997872"
     CDS             194643..195329
                     /locus_tag="CYME_CMT076C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539131.1"
                     /db_xref="GeneID:16997872"
                     /translation="MQRLQAREMMAIERSGCSREHTAFVPTFLKPNFSTCVRSRTWSL
                     TAERVTRQARCPAGVLPVKKLGLRCTLTKFEPFTVRPSLKLPVTVLGIAGVLAGAGGG
                     AGKVFAVPVGLLGVFLVVNAGFLLRFRFGPDAIEVWKRGAADSVQPTAGDDAALRGYR
                     YVRGWHYDRIEYWKLWWPRFPVLFYFRESESYDGRGSIHFLPVVFDAQQWLRGFSERT
                     QRKDSGRFRY"
     gene            <196696..>197985
                     /locus_tag="CYME_CMT077C"
                     /db_xref="GeneID:16997873"
     mRNA            <196696..>197985
                     /locus_tag="CYME_CMT077C"
                     /product="similar to auxin-regulated protein"
                     /transcript_id="XM_005539075.1"
                     /db_xref="GeneID:16997873"
     CDS             196696..197985
                     /locus_tag="CYME_CMT077C"
                     /codon_start=1
                     /product="similar to auxin-regulated protein"
                     /protein_id="XP_005539132.1"
                     /db_xref="GeneID:16997873"
                     /translation="MGQCLSCTRARGHRRANFAPTVAADGTSTGTGEQEEPEEEEEAE
                     SLLFPRFSRAKVDTESVARLLDDSKADAKARMEQSLKTESKRERSSTHSSYTDAQEES
                     QGSFRLSRSTSRSFSTSSEVDALKSTLADLEEQVSVVESEDDAIELLCHMADLRREMQ
                     IVAALRHPHRAQKIHSLLIRLESLIHRLQAYVLRSPSPDGFRRVRESSRGVLFQRGAA
                     ARVRPVTERERHALPHRYLSFNSATFYDSGAVLKRESTVRDQSGQLRIDPTRGDGRCL
                     FRSVVRGLAFYAGLYPGSKWSERRERREADILRYLCVREMRKHRDLFLRDQVVEEDFD
                     EHLRRLVHSDEFAGEPELLILGPLLQTPICVYMSTGDQADANAARSSSNERTKSSDLF
                     LVAVYGRSFIAEPVSLRYQSMHYDLLLPRSDHELGKT"
     gene            complement(<198296..>200989)
                     /locus_tag="CYME_CMT078C"
                     /db_xref="GeneID:16998214"
     mRNA            complement(<198296..>200989)
                     /locus_tag="CYME_CMT078C"
                     /product="probable glutamate carboxypeptidase II"
                     /transcript_id="XM_005539076.1"
                     /db_xref="GeneID:16998214"
     CDS             complement(198296..200989)
                     /locus_tag="CYME_CMT078C"
                     /codon_start=1
                     /product="probable glutamate carboxypeptidase II"
                     /protein_id="XP_005539133.1"
                     /db_xref="GeneID:16998214"
                     /translation="MPAEGASTESAGLQTTLGELSDDEQIIDDFVMDVESAEHEEVVQ
                     DRLPFFRRNEEDSTERGAVAVRHPKRRSRLSGNPFRESLKSRVFWCIRDHWRIWAYTA
                     LGALALSLVLLLLSRWSSSGERVPTDAPTDALSQKAQFMGHPYWHALLLRAPDPKRMR
                     NLLHRLTSEPHMSGTHAAKRTAELIRDEWVAAGIPAQIETFQVLLGSQPSHLVIRWSE
                     TDPSAPETSIMDLTEPSIRGDAATEAVSNATTFHGYAASGKVRSAPIVYVNYGRPEDY
                     AELERRGINVSGKVVLVRYGQLFRGLKVFHAQVRQAAAVLIYSDPGDDGAARGSTYPD
                     GPWRPAKAVQRGSVQFNALCVGDPSTPGYGSTEAAPRRTYEAAVRESCLPSIPSVPIS
                     AAGAEILFRRMHESWQRAGSKNDTLVSLMTAPEAFRGGLDSKLYVLSGNDDVRLDLEV
                     VHEYALKPIYNVIGVIPGAHGDLESDKEIVFGNHHDAWIYGAVDPHTGTLVQMESVRA
                     FGALLRRGWRPRRTLVFASWDAEEWGTIGSVEHVETNLESRIRGRTLVYVNADVIVSG
                     STARLGLAGSPLLTQAAEQAMRGLTDPITSKALVEDWKARRQQAIDSERALQRSSPNE
                     APHLGTDFRDEPPGPLHNRAATANWIPLLDLLGGGSDHTAFLHHAGVSSLDIGFDELD
                     HPSYPVYHSIYDDEAYFLGFTDPDFRLHLVATQLVSTLLLDLVDAPLLPMNVTDYAHW
                     LRYHLRLLETSRPDLLSVVQQQLQPAMDAFAGAAQRFSAQRMLTVAQCWALRECRAAL
                     SDRASRRLLDRDVAKYAALNQALMNVERALIHSDGIPGRSWYRHTAVAPHPDKGYSAV
                     AFPFLYGSTATNASQGLAATAAAIQRAARVLEECVSQWLMS"
     gene            <202696..>205599
                     /locus_tag="CYME_CMT079C"
                     /db_xref="GeneID:16998215"
     mRNA            <202696..>205599
                     /locus_tag="CYME_CMT079C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539077.1"
                     /db_xref="GeneID:16998215"
     CDS             202696..205599
                     /locus_tag="CYME_CMT079C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539134.1"
                     /db_xref="GeneID:16998215"
                     /translation="MQGTDVLVLLRVWNAELERNASWLTQPQGAPAVPKSEGESVAAA
                     HAKYGCREPGVHGVQRSSEGCGTRPAEFPRRTWRNECGALGGGGLGSALTTAITEQNE
                     RSESVVFQQINSQRQSEGLARVKADSGTRTRPGKAATVAAATSGRRTPRAETERLTAY
                     QELKTESYTSPSATRVPLSRQILSALRSHVKAIPMSDVHRSHRMRFLRLSRVPPCPLK
                     CKTEDLPWNMGIERALCTTESGLVMPPVEPRDREALGSPEQRWNSSESYPPLTYRTVR
                     DPQVQERSSSVADARRRVVPPRADSAAESPEGLCGHSAPLLADDSKPSRREIAPESSH
                     FQRERIDFIHEYNGAHGVDGACVGGCLGLERARGHVTVTGREHPGIAPRPIPGENNPC
                     KRRRMADDLAQSKCHRLGDMLGNRYLFMDAMDAELPRYILLLPLLARVLAVSCPGLHC
                     VVQFPLKWQLDLAMIQRSWSVGEGNAGDRSGTITSQIEGENRHRACVPKSCTPGIWRA
                     PSQHARARGAAAPTCSARRSAVPQPNDSERSPDTASFQEALMNALLLRGWQLLVLPAS
                     DSESPQADTATLSLAQVHPHSWRVSSLQDGQLLSGWRRNDGAPCEPPSRLPSSVWRRV
                     QKLRTRIGGFGAEVSAPDAGWSYASHSKHTGILSCDNVAQHVRPSCADDLRFYVAYDN
                     GSSVELVTCADPVLYGVRKSRVNGCQPVLVFCFNQHHASIELADLVLPLTESVYAHAP
                     ACVPRATRLPSQPRRLPSKGMRSHENVLVVDIGAQPVDMRMAFDAHRESTASTKSSAN
                     STPSEALITENPDTDTERKMETAADRQSPCFNGDIPSRGGPDLLDPARRAQSADHGPL
                     LAADERLDHAHMERVHFDGNPNEDVSAVASGQESRPVQPRSDHHRSSTQEHDAALQRT
                     SMDSQRAVPQAPDVHRAQRSTETRFEQSTGCVYKPSLGQALNDTFTTCRMRRT"
     gene            complement(<205768..>206802)
                     /locus_tag="CYME_CMT080C"
                     /db_xref="GeneID:16998216"
     mRNA            complement(<205768..>206802)
                     /locus_tag="CYME_CMT080C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539078.1"
                     /db_xref="GeneID:16998216"
     CDS             complement(205768..206802)
                     /locus_tag="CYME_CMT080C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539135.1"
                     /db_xref="GeneID:16998216"
                     /translation="MSELVTQSVSNPSASQGDTKERPPVIESAIKVLLERCRKHRRRT
                     RDLLDADSGSESEPDGATDWVFLVLTLQCIPENMPRRPRLIPLPNPLYRSTEPGDAVS
                     ASLSVCVVCPDPVRPYRRFLVESPPAQWRERIRSLRVTEVLSVRQLRRDYLQFEQRRR
                     LAAKHDLFLADTRVWPLLPDLLGKEFFRRKKYPLPVNFSGLDQCTSVVAERVIRACER
                     VRDSTVWYPGLAAGTCCAIRVGRLSMSPEALKTNVEQVLHQLPTFIPGGIRRGVLSIY
                     LKTRARVPIPLYVADRTTQVLAASAPVRSNFTMWSPERRRRRSRQTKQKLVRVPDTRP
                     TPLAQKRQRQ"
     gene            <207005..>207994
                     /locus_tag="CYME_CMT081C"
                     /db_xref="GeneID:16998217"
     mRNA            <207005..>207994
                     /locus_tag="CYME_CMT081C"
                     /product="plastid-lipid-associated protein PAP"
                     /transcript_id="XM_005539079.1"
                     /db_xref="GeneID:16998217"
     CDS             207005..207994
                     /locus_tag="CYME_CMT081C"
                     /codon_start=1
                     /product="plastid-lipid-associated protein PAP"
                     /protein_id="XP_005539136.1"
                     /db_xref="GeneID:16998217"
                     /translation="MAPRYTPKVTGFVESASWSLNGGSNTHHLLVSGRGEAAVLEAPA
                     RKSRYQTAAGVRTPTVRHVAAVRHLRCTQEAGPGSRWNASSGASRPADDRFAVRDSNV
                     VEIPGRTLSVSELKSELLRSVAEQNRGLASTSSSRKETLELVRALEREQAQGSSPSTT
                     IAAPCNLGWAEQASKVSGDWKLLFTTALDVLLLGWSVLPFTPQVGSIYQNIRVALSAD
                     AMEFTLENVVQFAAPASFLLAQFGIEDSDATLRVFARGQCDRSRPQRLYLRFERARLE
                     PNRFLGRRIDETLPPLQLPLRGTAVGWTELTFLDEDLRIIRTAVNDVFVLWRV"
     misc_feature    210618..212034
                     /note="possible transcribed region"
     gene            complement(<211666..>212964)
                     /locus_tag="CYME_CMT083C"
                     /db_xref="GeneID:16998207"
     mRNA            complement(<211666..>212964)
                     /locus_tag="CYME_CMT083C"
                     /product="probable uridylate kinase"
                     /transcript_id="XM_005539080.1"
                     /db_xref="GeneID:16998207"
     CDS             complement(211666..212964)
                     /locus_tag="CYME_CMT083C"
                     /codon_start=1
                     /product="probable uridylate kinase"
                     /protein_id="XP_005539137.1"
                     /db_xref="GeneID:16998207"
                     /translation="MTQRTTWPGFVLLVIQPEAFYRKDPILAYARKTDGWTEVARQTV
                     VWTPERARALLSPEPAETTTPAPDDEVHNEQHVAALCEGRSEIVVLRRATPPVEMVFL
                     SNEEATPLEQTSATDWKRWLELCGPVDPAEARALAPRSLRALFGVDKAHCGVWTSRDV
                     TQITSDLAKCFHDATEVERIYERVRVVGEQVAGGGSAAKSYLSSTVLETLTTALSRLC
                     MAQPAQPLEWLGAYLQEAASLQGHARLPPRLVFVLGGPGAGKGTQCARLVAEFGFWHV
                     SAGDLLRAEIQTQSEQGQLIDEMIRQGAIVPGHITLELLRKKLVDAGSTLAVPGVLID
                     GFPRALDQAIDFECLLRRADFCLFFECSEAEMERRLLQRSRSSGRTDDNPESIRKRFR
                     TFIETTMPVIEFLERRMRVHRIPAERSVDEVYAQVRQLFL"
     gene            <214635..>217010
                     /locus_tag="CYME_CMT084C"
                     /db_xref="GeneID:16998208"
     mRNA            <214635..>217010
                     /locus_tag="CYME_CMT084C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539081.1"
                     /db_xref="GeneID:16998208"
     CDS             214635..217010
                     /locus_tag="CYME_CMT084C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539138.1"
                     /db_xref="GeneID:16998208"
                     /translation="MWVVFVNQVRRTHDGIDVSSRGRWYLNANKLRCKRARSLAYMTV
                     VRSLPRPPGFYVTTQDGDTLASIASRYGIDAKRVWELNNRASRLEFKRGKFPFLPGLK
                     QHEVSRQAPSGGVSLEEALERPLCSGQRIFVPNETVAQTAKGGNLHGASLRQTAPPKT
                     VEAPPVTRTFVPPKAQTTPQQKSSAAMGAPSAPPAKGVPVVEQQALPPSPPLQGTLVG
                     SVGTTDFFLGVFAVLVGFYSAKMMLPRSNTEPGTQPKTSLLKALYKRLVGFLQAMITV
                     AVLIGLAAGALGARLRAALLFIFNACTILLRGVSQMIVLFGQFMCGMLGVVALAVQGV
                     VQLFQRLAQAAFLLIASIFLVTWQSAVRLWSAASTRSSAVLENITQRGLSPSLPSAET
                     GLWSVPDERSSSVDQTASESFFGLIRQFFSRDSGSDLIRCVLRERTQISDAFVRMRFD
                     LPGPDDQLVLQMGQRIEVHVQKSRQSLWSDVQPLDQAESSCGLGAIRPHLLAVASDRH
                     QPGSFEIIVPVSHALQQVLWEASDADNATHSAAAAPMDAEYDGAFSTGSDVQVLERPS
                     TSDHVFSATCSANNDEFDEHFLIALESLVEGVDAIRVRPAPNTELIYRRAMNPSAGTV
                     VVHNVVLLACGLGIVSAVRIADELLQDSESAVSRITLIYYNERARDFILLDDLERMSK
                     DHGERFRLHCVWNENAGAYLASTGFPRAATASAGAGTSATVAAAAARRNGYGRERRAA
                     QPVPATVRVISAIPAWTEGTMAIISGNESFSQEMWYALGDSGYPEDAITFI"
     gene            complement(<217578..>221327)
                     /locus_tag="CYME_CMT085C"
                     /db_xref="GeneID:16998209"
     mRNA            complement(<217578..>221327)
                     /locus_tag="CYME_CMT085C"
                     /product="UDP-N-acetylglucosamine pyrophosphorylase fused
                     with phosphoacetylglucosamine mutase"
                     /transcript_id="XM_005539082.1"
                     /db_xref="GeneID:16998209"
     CDS             complement(217578..221327)
                     /locus_tag="CYME_CMT085C"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine pyrophosphorylase fused
                     with phosphoacetylglucosamine mutase"
                     /protein_id="XP_005539139.1"
                     /db_xref="GeneID:16998209"
                     /translation="MYVFRTIGSIVESTLPRVSSSGSSTRANGQHATLLIPEKALTTN
                     GRPPNLQQTARAYDSSWKCSALVCRGLCIAPLVSVFHNCTQSPSSHGTLSTQRRSQRP
                     AGNLSCGTQQEVIRNGTGPKRTSPVSLCAQAMTLAIDFSHRVHFMFGASGLVPDLALV
                     ASRRTVSPQLRPITRHQTRLRGRAPPRSVRLRPCKLAGGVGRATLCSLGERSEAGQCL
                     NTTDASPYPFHELANWLSNRYPLTEAVRYTGAGVRVRDGPALDAVVARAAAVVALVAS
                     FRKCVLGLMITASHNPSSENGVKVVRSDGGLLQAHLQDTPHPLLGEFFADLLQETLAP
                     PTDSANNDSFDGMNVETLTVPIHAPRAVALGSLFHRLAHRMLHGREPAAAEKTATLPG
                     AAGSSIDDKSGRGGVVILGYDNRPSSARLAQVALEVLLRATQCSGVRNLGLTTTPFTQ
                     YAVWASQNGRLSTFDAYVHERLVKGYHALCRALQRDPEVTGSGAVDSTTRLRVDCAYG
                     SASVVLAEVSSLLSFPLSTTHRHEESQAVNERCGAEYIHQHAGHGDDFRCLVSGDRMA
                     ALDGDADRLVYYASSEQRSAGRTKEASSISSIVVYDGDWIALCLVAFLRRCVQLLVAA
                     PETTTTPIQVLPRLSFGCALTAYCRRVYRERIRALCDGNLVLVPTGAQYGRDIVERCF
                     NLAVYAEPNGHVGCYVAPLVQRQLYELLLRDVSTPLTREARYAAECIVSLARLANPAG
                     SDGVATLLTMEALLRTEPVTHLLERLEVFASAGHSEVVNAQLTEHDMETPLLRQASRY
                     AAANWRYTADETRVLDPEWVQTALIDEQLQRIQLEFPDVSIEDAVSVLVRPSRTQPFW
                     RIRVEVSSTALEGEVAKTLARRLERLLRSRLRQILEQVATSLSENELRHLESGSFGIR
                     LAETSRLGDLEVAGALLAEADAGELGPASAWQAQLQSAAVVGIVLAAGRGTRFRAAYP
                     KVVHSFCGKPMLRHVVETLHTMGIPTVVVGNESVEGAIRTALDALPYLLVRQSQPLGT
                     GHALYAALCSTLSTFSGDILVLYGDNPGVDSAILEPLLDQRSRQREAAAHPNGPSQTF
                     GVILSGCYTSRDAGAYGRVVRDAQSGALRAIVEYREALQRPDGAQILAIREFYSGIMV
                     VDRALSMQLLAASLPHRVDKGNQRVRSSSPVPERFEYYATDLVQMAVDCGYDVDVYCV
                     REESGLLWRLEGVNTVAELEALEQMASSPPRGNNGAAMPPTRTHS"
     gene            <222714..>223370
                     /locus_tag="CYME_CMT086C"
                     /db_xref="GeneID:16997986"
     mRNA            <222714..>223370
                     /locus_tag="CYME_CMT086C"
                     /product="probable isopentenyl diphosphate isomerase"
                     /transcript_id="XM_005539083.1"
                     /db_xref="GeneID:16997986"
     CDS             222714..223370
                     /locus_tag="CYME_CMT086C"
                     /codon_start=1
                     /product="probable isopentenyl diphosphate isomerase"
                     /protein_id="XP_005539140.1"
                     /db_xref="GeneID:16997986"
                     /translation="MTANLAATDDWGELLDVLDPGDPTGSRVIARYDRLRVHREGLLH
                     RSVHVCVVRSVPDWPAQVHGLRNTNYKLLLQRRSESKAIAPGCWDLSCAEHLRAGESF
                     EGAAVRGLQEELGLALAPDQQTTPIHALDDGEPALQLYDYPSVGLTDYEWNRIYVVFV
                     TDQADEALAKLKLDSAEVAQVRWITRESLQMELAENPSHFTPWFRDQARKHLLPSAYN
                     "
     gene            complement(<225045..>228017)
                     /locus_tag="CYME_CMT087C"
                     /db_xref="GeneID:16997987"
     mRNA            complement(<225045..>228017)
                     /locus_tag="CYME_CMT087C"
                     /product="similar to DNA replication licensing factor
                     MCM8"
                     /transcript_id="XM_005539084.1"
                     /db_xref="GeneID:16997987"
     CDS             complement(225045..228017)
                     /locus_tag="CYME_CMT087C"
                     /codon_start=1
                     /product="similar to DNA replication licensing factor
                     MCM8"
                     /protein_id="XP_005539141.1"
                     /db_xref="GeneID:16997987"
                     /translation="MQLRFPLGLPEYECYAWADDTDADSNATNRDFRLAITANVVLFL
                     LSQEGQSVATQARCRYEQTAAAVGIPSLGQALESVRPAPLSSARVNALGPAGNDTGSG
                     SCIVGAAAGLSVFPFESGDESLREKSMDATDRWQRLSAETDGDMQRCRVFMDTIDEIS
                     VPVEHTLLVRSPTMSTFADAVIENPEESLNCLGLAIVQVVKIHAWVRADHLHALGSCP
                     QQYLDLIGEHLAAVRLPRAVVRLQGLRDQTDFSELRAHAVGRLVGIRGTVIRMSSIRP
                     QLSSISVACATCGKSQRVTCPNFQYNPPPHCMASAECKSRVFLPDRCSAVTLDWQRIR
                     LQELSSVGNVADVGGIPRTVECELTYADMLDTVVPGDIVDVVGIVRFLSLDADASRAR
                     RGRDHALYQVYLEVISLTPTNDAKEGEQRELAADATTFEAAAPDPATEQDGGQTSQSL
                     RSKGTMVRPAGIGGSRPHADSFTDEDLRCIRGILEHRGHVFEFLVQSLCPLICGHDII
                     KAALLLGILGGSNRGGTRPVPAIDNVGPAGISMLDSDILSALHASDASEHQQSLEHSV
                     ARSDIHVLVVGDPGVGKSQMLRAAAALLPRSVYVCGNTTTNSGLTVTVSRESGSGEYV
                     LEAGALVLADRGICCIDEFDKMSADYQVLLEAMEQQSISVAKAGIVGTLAARASILAA
                     ANPIGGHYDKRRTVCENLKMCPALLSRFDLVFVIQDQPDRCRDQRISEHVMATFGGRR
                     QRAAPMRWSLSTESSDGSSPPATNNKAGECSVGVSLWQRLQQSRKWAQKPASTRDLRT
                     YVAFARRFIHPVLSVEAKQILRDFYLLMRRNAHALAGVHGHEALPPVTTRQLESLKRL
                     AQARARAELRSVVSAQDARDVIEIMQCSMLDVYSDERGVLDFSRVGGTSRANDVRRFL
                     LVLHQEANRRQNALFHLDELRQIAQQHHIEHGTDFSQFIDMLNLQGFLLQRSYRTYRL
                     QGNDFAGVATDTGSRRRS"
     gene            complement(<230249..>232219)
                     /locus_tag="CYME_CMT088C"
                     /db_xref="GeneID:16997988"
     mRNA            complement(<230249..>232219)
                     /locus_tag="CYME_CMT088C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539085.1"
                     /db_xref="GeneID:16997988"
     CDS             complement(230249..232219)
                     /locus_tag="CYME_CMT088C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539142.1"
                     /db_xref="GeneID:16997988"
                     /translation="MKADLEAEEIETLTALEYKRRREARRATDSGRDSNEPVWSANEL
                     QKPASSLDVEDCWQGTSTGWEERSSLVYTNHSSVLEESLARIDASLLEASPSRQPETP
                     PEFPPDEREEGLPNRGPAPCTHIPGDLVLRRCIRMTLRFVDRKRALECVRSMRRLHAV
                     ASIAESRQARGYNLDPVGPAVRAMSCYCFPAAAAGPEQKRAWSWVRRLSLAHRALHEE
                     EFDFQQLWHPGVRRPQRGTQLPNKSDGARASQAGAAADRRLSAGLSPQPQTLPLLLED
                     LAGWNMHLSTNCELPALQWWQQRISRWRQAFLPLYRVYRRAAQCTPPETLARSTGFHV
                     VGDHYWATFGWISGLETAPRQGNCGGDQKKAPSSMGANANTQSMKEEKQRNLALPFGF
                     MSHTTERVRNLLDSIFAVQYDVLGDQRSVRPAVSPHFMRADATFEKDWMSQPVDAARS
                     RSCPVVVRGAGNVQGLFELLLHFGPWLFSNTDVPLLLASSDVPFMGASLVLTDYTFIG
                     DDDVLLAGDEVSHPCSSTGPRDCTPSYSVTLEFKGPLSPFAMLHWEAFLSQTGAAAAT
                     LHAETDKRTLMPRGALSARLFQARDGRLSEMPAALASRLGSAWQHLEAWPAPKDGVVH
                     QDAYPGDALEKPPSVRPWCFLSKADRLGLADR"
     gene            <235514..>237295
                     /locus_tag="CYME_CMT089C"
                     /db_xref="GeneID:16997989"
     mRNA            <235514..>237295
                     /locus_tag="CYME_CMT089C"
                     /product="electron transfer flavoprotein-ubiquinone
                     oxidoreductase"
                     /transcript_id="XM_005539086.1"
                     /db_xref="GeneID:16997989"
     CDS             235514..237295
                     /locus_tag="CYME_CMT089C"
                     /codon_start=1
                     /product="electron transfer flavoprotein-ubiquinone
                     oxidoreductase"
                     /protein_id="XP_005539143.1"
                     /db_xref="GeneID:16997989"
                     /translation="MLGLFRSTSLGTGPSRPRRNPCTLSPLWQRRCSSEAEALRYDLL
                     VVGAGPAGLSAAIRAKQCLPEARVAILEKGSEVGAHILSGNCFEPRALDELLPNWRQD
                     PKFPAHEPVTHDQFALFLSHRRQLPLPVPHLMRNDANYIVSLCQVTRWLAKQAEALAV
                     DIYPGFAGARLLVDENPTRVYGVATNAFGIGRDGRPKPNYAPPVSIHATYTLLAEGCR
                     GSLTRQAIERFRLADASEPQSYGLGVKELWRVPASVHQPGSVLHTVGWPLDMRTYGGS
                     FMYHFRDRISGSMENLVAVGLVVGLDYENPLLSPYGLLQKWKTHDQIRRVLAQGELLE
                     YGARCLNEGGYQSIPQVAFPGGALIGCSAGFLNVPKLKGTHTAMKSGMLAAECCCEEL
                     RKPEPSPEPSQYAETLRRSWIIEELYAVRNIRPGFRWGLLPGLLHAAVDTYLWRGRAP
                     YTWKLGRADHTATRLADRYRRPSYPAPDQRLVFDILTNLARSGTNHEHDQPCHLKLKD
                     PTIPERVNLPLYGGPEQFYCPAKVYEYTPAPPDPASKTTTTTTTIRLQINAQNCLHCK
                     ACDIKDPTQNIVWTPPEGGGGPRYSRM"
     gene            complement(<238113..>240062)
                     /locus_tag="CYME_CMT090C"
                     /db_xref="GeneID:16997838"
     mRNA            complement(<238113..>240062)
                     /locus_tag="CYME_CMT090C"
                     /product="probable vacuolar protein-sorting protein VPS45"
                     /transcript_id="XM_005539087.1"
                     /db_xref="GeneID:16997838"
     CDS             complement(238113..240062)
                     /locus_tag="CYME_CMT090C"
                     /codon_start=1
                     /product="probable vacuolar protein-sorting protein VPS45"
                     /protein_id="XP_005539144.1"
                     /db_xref="GeneID:16997838"
                     /translation="MNFESASRFYRSRITAPKGLKALVLDADTLPTFATLLTQTEALR
                     EDFVLVEKLENLVQEPARDRQVYVTGIVVGRPSTETLLALRRELAQPHFGAYHIFLVN
                     LIRRTLLEDLADADASLESVVHVEEIYFDFLPWSPWVATGGGLCDAPVQNEPRLPVAG
                     LAPHQLTLDRQLDTLFSILVSLKQKPASLRVLRSFRSCRALAERLAVRIDQESRLWEV
                     PATDPSPGTSPLSAHGAGSKRCLVVILDRREDPVTPLLTQWTYEAMLHQFFGIRAGRV
                     RIPTTLEGKDPPHAAAPQEQEYIVLPESDDFYAANRYATFGDIGEAVHRLVASFQERR
                     HAALAHVTDAARQDAALADPTAVAPGIDIATNGDYDATDTERMTQILEFFPEFRRQSQ
                     LASKHVALISALSQQVKERALLQMSQIEQDVVSRDAEQEHLRRFRDWVRLVADGKAST
                     LGMRSARLADAWRLAALLALRYESTRPELLQQVKRLLHEQLQMPSSELAALDMLLQTC
                     GSKHRSLDLFGNRDLFARAKNTLRRGFSASVDNQYIQHEPLLAQVMEDAARGRLPTDT
                     FEELLPSASADGSPFSVVIVYVIGGITAEETRMTAAFQGDTTARIGSRRDFQSIPKGT
                     TFYVAGDLMHTPGSFRERYALSRAL"
     misc_feature    241933..242797
                     /note="possible transcribed region"
     gene            complement(<242706..>244016)
                     /locus_tag="CYME_CMT092C"
                     /db_xref="GeneID:16997840"
     mRNA            complement(<242706..>244016)
                     /locus_tag="CYME_CMT092C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539088.1"
                     /db_xref="GeneID:16997840"
     CDS             complement(242706..244016)
                     /locus_tag="CYME_CMT092C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539145.1"
                     /db_xref="GeneID:16997840"
                     /translation="MDVGGTTPALRRLPWRQQHTRAAPGSRNAEPAKRVQQLNFFQQL
                     WQTGLVLVVLFFCAVLVQLNVLYWGVPFRTRFSAPLAFVFTPRMPENDTLGIVIAEAE
                     AALPSLLVRRLWTRRRTLVPLESGRSRNPDRCMPSSDGQGRCEASGTLNAVLHWVLPE
                     SVRNQQAGTVTVVLTMWQEPHPRVYRRARVPALPLCEQRRSVRVLAYRSSTERAMQSL
                     LTLPHSFLSALSVWRWTQKPVGLASRDAQLRSIELLRCATLQIVQEARSTPVFRTWNA
                     SRRAAFHFAVVMLRTVAHWIGVLSDNVIRRLFRDQLLGGLISLIPLGIGEWINDRFVR
                     SHPPVQMLVRLELYQFAAMESASAYDRAQFPFMEMEDGSATMHFEWVLVGWRRFLRQH
                     YFLGTLLGSWILFGIFALLYLTYKIGTGIWRASQPAQVQQWNTQ"
     gene            <244969..>245832
                     /locus_tag="CYME_CMT093C"
                     /db_xref="GeneID:16997841"
     mRNA            <244969..>245832
                     /locus_tag="CYME_CMT093C"
                     /product="shikimate kinase"
                     /transcript_id="XM_005539089.1"
                     /db_xref="GeneID:16997841"
     CDS             244969..245832
                     /locus_tag="CYME_CMT093C"
                     /codon_start=1
                     /product="shikimate kinase"
                     /protein_id="XP_005539146.1"
                     /db_xref="GeneID:16997841"
                     /translation="MSRMSREPLCFVVTGAQPRQRAAPSVRCPTPRPLAGTDRCPVVV
                     GVCRRRSGVRKAPLVPLSERLVLSTVEDGVVYQQLREKLHGASVYLVGMMGSGKSTLG
                     AYLAKALEYAFIDTDVIIERTLQKSIPEIFAQDGEETFRDVESLVLESLQSHVRTVVA
                     TGGGVVLRQRNWGTLHTGLVVYLNGTPDMLAKRVQGGAGRPLLSNTMHAPADSTIPEP
                     AAIEALSARLAEILSEREHFYRQADVTVELFPDCSVAETSRAVAAKLIRFIEENPSAS
                     SKHRRQHSSAS"
     gene            <247564..>248982
                     /locus_tag="CYME_CMT094C"
                     /db_xref="GeneID:16997842"
     mRNA            <247564..>248982
                     /locus_tag="CYME_CMT094C"
                     /product="similar to 2-dehydropantoate 2-reductase"
                     /transcript_id="XM_005539090.1"
                     /db_xref="GeneID:16997842"
     CDS             247564..248982
                     /locus_tag="CYME_CMT094C"
                     /codon_start=1
                     /product="similar to 2-dehydropantoate 2-reductase"
                     /protein_id="XP_005539147.1"
                     /db_xref="GeneID:16997842"
                     /translation="MEVQSCSLSPSRLPRVAVVGSGAIGLTLFGKLVSLYRASSQSFF
                     SSLTLVCRTEENARWITSRGGIALYHASKTETPATCASGDLEWCALQPPAVNVVDQQR
                     FAETPVDLALVCVKSHQVESVAPLLRRMFERHREAGVVVPLCNGIGHVARLATALPAD
                     VAVLPAVTYLAAERIERHTVKIHGAGATYVLVRGSSHASMETRPKQAINAFSREACNA
                     ANTADQTERLRTLPASEGVGATRLPAPAPNASSSPALPVVTGQAALAYPVGTMLQPET
                     LRATRRFQDDMHSEPWGPALHLSAAQCRLLDEDRGLCAWLNAARLGPALVTNDERPFV
                     EKLAVNCGVNAVATLLGVRNGELLHLPDAWQVTESAAMEVATLFGLPHASIGPRLRQI
                     VEATSGNVNSMLSDVLAGRVTEVDALNGAVARLSISRTNRPSVVNATLAALVRALSQR
                     QHQAECCIATPQQTHPPDTIHR"
     misc_feature    complement(249887..251350)
                     /note="possible transcribed region"
     gene            <252256..>254280
                     /locus_tag="CYME_CMT096C"
                     /db_xref="GeneID:16998188"
     mRNA            <252256..>254280
                     /locus_tag="CYME_CMT096C"
                     /product="nuclear transport factor importin alpha"
                     /transcript_id="XM_005539091.1"
                     /db_xref="GeneID:16998188"
     CDS             252256..254280
                     /locus_tag="CYME_CMT096C"
                     /codon_start=1
                     /product="nuclear transport factor importin alpha"
                     /protein_id="XP_005539148.1"
                     /db_xref="GeneID:16998188"
                     /translation="MQATRARIEERHRSFKKAVDLDEARRKRDEHKVEIRKTKREETL
                     MKKRREHPAVQATSRAGASVPGDMAAVHDPTAAAAAAAGTARAAPAVGENLLSAPVSG
                     EKAAGSLSESAVPVESMLDAPGESAEASSSLLTTRSRQEILASMPALRDTLYQAGASP
                     EQLLRTVREFRRILSIERAPPIQEVIECQGTVEKLVEFLSYDQFPALQFEAAWALTNI
                     ASGNTEQTTVVVQAGAVPHFVRLLRAPNEDVCEQAAWALGNIAGDSVQYRDLVLAHGA
                     MEPLLQLLQTQHKPGMLRNATWTLSNFCRGKPAPDMPLILAALPVLAQLAQSTDEEVL
                     VDTCWALSYVSDDKTEHNAQIDALIRSGVVKRVIELLGHESTAIQQPALRTIGNIVTG
                     TDEQTQVVLDCGALPYLLRLLSSSKRLIRKETCWTISNITAGTIEQIESVIQSGLIPP
                     LISLLANSDFETRREAAWAISNATAGGTDAQIRMLVLHGCLKPMCDLLFANDSKLLIV
                     VLEGIENILASGERERERLHQPANEYASLVEQVGGLERIEMLQNHVNEDIYFKSQHIL
                     RTYFDVEDEDEIQGLVPMAASEGDGFGFGIERNDALARSGFHFGTSSSSLMMTSSGMM
                     TASTSVPHATHETAFGAETASPRTGQVSWRPSDDTNGDGDDATNGMPMGS"
     gene            complement(<254503..>257985)
                     /locus_tag="CYME_CMT097C"
                     /db_xref="GeneID:16998189"
     mRNA            complement(<254503..>257985)
                     /locus_tag="CYME_CMT097C"
                     /product="kinesin-related protein, C-terminal motor
                     subfamily"
                     /transcript_id="XM_005539092.1"
                     /db_xref="GeneID:16998189"
     CDS             complement(254503..257985)
                     /locus_tag="CYME_CMT097C"
                     /codon_start=1
                     /product="kinesin-related protein, C-terminal motor
                     subfamily"
                     /protein_id="XP_005539149.1"
                     /db_xref="GeneID:16998189"
                     /translation="MTKNQTSSPRKPQGKRSRKAGGSDASQGARSSQVNASALPKMQY
                     RITLTSGDITPDGARFFVYITLVGSLNALPEVALNTSAHLVRGGFEQSSSSSIAEAPE
                     LVPLLRSSSESFTVPAAEDIGSLDKVILRLEDEAGDTDALDALGWFLERVSVESICSS
                     PGEACTEWAFSVNRWVNRDTEHLIELQRAMATEVLLDDRGAKVVKVRLAMHHLPSEPA
                     HEEIYVSGSIPELGCWNVERAVRMEKVLPVALAQKESGRRSVNRNSWHGDWEYCFTLD
                     PDAASDFDYKYFIRNQRTNAMIWEHGPNRKMLIERIAENQSDANVTVRLNDQWNTPTL
                     CRKVLNSYLMNGIMSPLSKILGSSEDGVMAAVRRIRNELEEMRRENSTLRSMLQARSD
                     VRPSGALSEEASLDTECKGSQNANVSALAVQKMNLSQLSFQGTQPDPAHDLNRAGLAH
                     RLRHAREQTQLLQAILEQLRAEARASLDATASMIHTQSATLSQAIERCQRLRDHSMAM
                     WRKEFHWRRKLFNQVQEITGNIRVFCRVRPVLPTENDHTVCNVLDNDKIAVRQKIFDF
                     DRVFGPEHSQEQIYEDTSPLVTCALDGFNVCIFAYGQTGSGKTYTMSGSPESRGVNYR
                     ALAELFRLCEERSAAFSCHIQISMLEIYNESLRDLISGKTETRLEIKLGPDGKPYVPD
                     LIWIPVEQLDHVWSVIEAGTRNRSQGATRMNIHSSRSHLIVSIMIEAVSRSTGDKLEG
                     KLHLVDLAGSERVSRSEAEGDRLREAQHINKSLSALGDVFMALLAKQSHVPYRNSKLT
                     YLLQDSLGGDSKTLMFVNVSPTAADETETLSSLMFAQRVAKVELPRASKHVESAQVAK
                     YMKAVAKAQDDIRARDDEIALLRKQIEQLQRPQVRGTCSSIRSLPGTRNGIQVVSNQR
                     TVLQRAHSSTLATTPPDDTTASDIEDDKENCFAGRRDSRRSARLAPAASPPGTNTRHS
                     AAALHALQGCNANDASTTVDTTVSCVVDGVSEVYTAVDINPADAGIATSNTSVTERQL
                     ARGLCSPLATANQQQQQQQRNNNSSTGIANTPASKATSKRTGNVVAVANARTSSAVTA
                     LPSSSKTGSAGPPTPPSARRVVLRETRADLLRRQANEAKRTGTPARVRYAFGSRVEGA
                     PAATAHASPNVSRR"
     gene            complement(<260797..>263790)
                     /locus_tag="CYME_CMT098C"
                     /db_xref="GeneID:16998190"
     mRNA            complement(<260797..>263790)
                     /locus_tag="CYME_CMT098C"
                     /product="probable ubiquitin isopeptidase T"
                     /transcript_id="XM_005539093.1"
                     /db_xref="GeneID:16998190"
     CDS             complement(260797..263790)
                     /locus_tag="CYME_CMT098C"
                     /codon_start=1
                     /product="probable ubiquitin isopeptidase T"
                     /protein_id="XP_005539150.1"
                     /db_xref="GeneID:16998190"
                     /translation="MNRSGVPSIDCVEKEECSLCFEDVDSPGGVCVCLTCLQCFCAYR
                     RHAELHTRKTKHQVFANLRRAPLAEADRLEQSTLVQAQKDAAEAERGTTATLAPQVLR
                     TSEGYTIQGAESLEAPVPPVRLEGIYDVAAKCWVACLREPEAGSARNWSSDLRSGAYP
                     ASQLEAWITLAESVHEAAAMSRKEQVQAWELQLQPCEHTLTVCRLEGIDVDTSLSRST
                     AKCSSCDLRENLWLCLSCGHLGCGRTNFDGTGGKNHAWEHFQAYGGMNADHAVAVKLG
                     TITADGTADVHCYVCDELRVDPELERHLSEFGIDIRREEKTEKSLIELEIEQNVQLNL
                     KELGSNFSDHNPSLRRITDPSLYAPDVVATGMRNMGNTCYISSVLQCIYALVFAPYRW
                     YQEPRALSFPFKNKSLDRHYTRCEAGSALQCFECQMRKLADGLLSQRYWKREHTPQRI
                     DELGRASAAKIHEHEHATMPKPVKTGAPDHEAPSRMAEAPEPEPAPATSDVQTPAEGA
                     GLLRRYQPPQGIAPRMFQNLIGQGHPEFATKRQQDAHEFLEYFLSRCTAEARRQGTRD
                     PARFFIFPLVQRTECLRCHRIGMNSTEATSLYVPIASSVRGAEYSTRSKAISAEQDQE
                     SSARVSLAACLDLSVASELLSFQCPSCRASIGVADPNQAERRESPSRCPPFLIMHLRR
                     FEAGEDWVPRKVSTAVTFSDPQRGLEQRADGTIVLDMKPWLVVDESEWDRLPPERRME
                     AAEAPASGTPSGRALTRIDPSERLLMDMGFTLQQARVALQASNHDGERAIEWLLDSAN
                     SAAANGASTPEEEPTANTEAETSAALASSSRTRYALAAAMVHLGASLQTGHYVAYVYR
                     NKRWLLYNDEKVFDAGQNPSALEQAFVLIWRRDDEAFDATCVDWMTSDRLRLESDTAV
                     SRVQPLHPVATSMDQPLRFDGTVLNWNTTRGASANEAAAAPTFSFADQLDQLMSMGFS
                     ADASRQALEASRGDVEQALNMLLSA"
     gene            <264956..>265729
                     /locus_tag="CYME_CMT099C"
                     /db_xref="GeneID:16997998"
     mRNA            <264956..>265729
                     /locus_tag="CYME_CMT099C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539094.1"
                     /db_xref="GeneID:16997998"
     CDS             264956..265729
                     /locus_tag="CYME_CMT099C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539151.1"
                     /db_xref="GeneID:16997998"
                     /translation="MFAFLPVAKAVFPIFCRSFPSHARFNEALGQRRHACGFVRITRP
                     RYVALRVRRRHTVRGVARSLVAVVRPGDVALVPSPYPGSEDAVVLVVGLDTTGRTADV
                     VTLHAVGRSEDSAVLYEREAGAATRFERVDKLAPLKRVQRDETKDVWKVTTAELESVK
                     AAFLSPAGQAAVQAEMEQIESSIDRRIFERSPSPAPTRTQLLTGSGICAGASVACVVA
                     LSQHGSDGLASASGVLTAAAFILSIVSGGLALAALRQQQ"
     gene            complement(268120..270584)
                     /locus_tag="CYME_CMT101T"
                     /db_xref="GeneID:16997999"
     misc_RNA        complement(268120..270584)
                     /locus_tag="CYME_CMT101T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461692.1"
                     /db_xref="GeneID:16997999"
     gene            <268412..>269659
                     /locus_tag="CYME_CMT100C"
                     /db_xref="GeneID:16998001"
     mRNA            <268412..>269659
                     /locus_tag="CYME_CMT100C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539095.1"
                     /db_xref="GeneID:16998001"
     CDS             268412..269659
                     /locus_tag="CYME_CMT100C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539152.1"
                     /db_xref="GeneID:16998001"
                     /translation="MVLVSGIVAVFRANGTSPLSASLQVRSNLVDTRELPKGTTFLHE
                     CSSALFFIFVAIQWHRRALFPIYLMVTAPGRTFNKYTSSEPRLNRETRVVANSLQSQN
                     DTQDVAKPSTQFYRLLDKSNFIWNTSTSMRASIVCLVAREVAPESRPLPSPESGTTQT
                     IAHRKRNTLFGNVGSPRQSRVQRDTLACGSPKNARHTLGGTNRRDPCLHRRGISNASE
                     HAGLRLLPRAFSAADDDHHNQGSRLGAPNGCGDSHDGAGNLSEDSSADRCCSKSGRRS
                     WRTIARSVFSRTRSRAAVSRCCSTRSRSSTSDSVLSSSFHSRSLSAPLVCKSAMACLI
                     ESDEGFEARFRQTVSDASSFRWTGVASCCSSSDALVLGLRPVLSRCADTGLGGCNASP
                     GATCESVSAIETRLVIRGVSGGL"
     gene            complement(<273227..>274504)
                     /locus_tag="CYME_CMT102C"
                     /db_xref="GeneID:16998000"
     mRNA            complement(<273227..>274504)
                     /locus_tag="CYME_CMT102C"
                     /product="unknown aldo/keto reductase"
                     /transcript_id="XM_005539096.1"
                     /db_xref="GeneID:16998000"
     CDS             complement(273227..274504)
                     /locus_tag="CYME_CMT102C"
                     /codon_start=1
                     /product="unknown aldo/keto reductase"
                     /protein_id="XP_005539153.1"
                     /db_xref="GeneID:16998000"
                     /translation="MDSKLAFLVKLPVLPGSSLAGAPRSARSLGLCLTTRSGDVAYAA
                     EKPVLLAGRNGGVQLRVPLGLGAWSFGDRFYWGSSSEEDNTDAVRESLRNGVTLIDTA
                     EVYGTPPGRSEQLVGRIGRQVTEEVLANAGPDSPLPEINVATKYAPFPWRTAGLSLNL
                     LGWLSRPQRRETVRRSVLGALRASMRRLGLENIDLYQQHWPAFVGENDEPIWDALAEA
                     YHEGLIRCVGVSNFSPSRLLKCDTYLRQVHEVPLASNQVQWSLLHRDPETVRCLGATD
                     DRTLCEICADRGIQILAYSPLAQGLLTGRYRKGRLPSGVRKRLAASLVERVDVLLSEM
                     ERIAAKRQVSLAAVALNYVITAGEMRAAGEKPTIAIPIPGAKNAWQAQQNAQALGWRL
                     DLDEMTKLRRAADQVDAKLPSIPLARESNRRGL"
     gene            complement(<275186..>276106)
                     /locus_tag="CYME_CMT103C"
                     /db_xref="GeneID:16998002"
     mRNA            complement(<275186..>276106)
                     /locus_tag="CYME_CMT103C"
                     /product="probable glutathione-S-transferase"
                     /transcript_id="XM_005539097.1"
                     /db_xref="GeneID:16998002"
     CDS             complement(275186..276106)
                     /locus_tag="CYME_CMT103C"
                     /codon_start=1
                     /product="probable glutathione-S-transferase"
                     /protein_id="XP_005539154.1"
                     /db_xref="GeneID:16998002"
                     /translation="MPTVRVDRVDKPVGERSPPAGEPGSIVVGYWDIRGLGSPVRCLL
                     YYLNLDFVDRRYVQGDYNDDVPFSRDAWLSVKHRLGLDFPNLPYLIDARGEHATRPIA
                     ITETLAILRHLARTYGHQVSEYALGANDPYVDMIANIVMELNGATARACYGSQSADQA
                     IQVYTEMMVPKLVALESYCRRHKVAACAKGSDPRFLSVQQTGGSEPSYADLFLAELLD
                     HIETCLPGSLKAFPHLSQLRQNVHGLERLQEFLNSPSRAGLACNNKIALIGSGSKMPP
                     PGKLPHLKLPEEAIAAARDAVILSKDRTER"
     gene            <279117..>281372
                     /locus_tag="CYME_CMT104C"
                     /db_xref="GeneID:16997695"
     mRNA            <279117..>281372
                     /locus_tag="CYME_CMT104C"
                     /product="probable tryptophan 2,3-dioxygenase"
                     /transcript_id="XM_005539098.1"
                     /db_xref="GeneID:16997695"
     CDS             279117..281372
                     /locus_tag="CYME_CMT104C"
                     /codon_start=1
                     /product="probable tryptophan 2,3-dioxygenase"
                     /protein_id="XP_005539155.1"
                     /db_xref="GeneID:16997695"
                     /translation="MPCPFGYSIEDVTTPVNGNASRLRNCHGLASAARSCNASAARHD
                     QQIAVVASSGKEPAVEDYEQDYFPGIGSICLEQSRRAPEEERPNCVLPEPPLRPEELN
                     QGYWRDVEDEELCADGDEMEEPLESTSPQETPLGTETRPTEHDAGVLVVTGSKTSEDA
                     SALSGPVAIQHTDEANEALAGMCVAHGSDSSTCNGCTAECETSPASRDPVHALNNRRG
                     LGSSQPWNGSNKADWLDCSSITESENSLFTERACQGGICGDLEPRAALECAPDPLSGD
                     RLAEGRTRTLPRRAARSPAWRREAPVAMWPPRPASSLQSSSKLAATVSESSASASHWT
                     STRAGDSPPALGCMAPAGNAATSPVPQMELPRDQRSTAYIRQRKGRPLYYNSYLKLDR
                     LFSCQDPISWRFGDHAHDEMLFITVHQVYELWFKQLIYELDSLRALFLAESMATDGVR
                     AQLRVSVDANRMMNLALHRLDRMVEIQRILVEQIRVLETMTPQEFLTFRDYLFPASGF
                     QSWQYRLLEVKLGVRAEQRISNHWKLHLSEEHQAVLSDAEKEPSLFDLINHWLERLPF
                     VVTTEADFNFWDAYRKATERMLALDRAFIDREIHAGADRARAYRELSRMRNLYRSVYE
                     EQVHQEMVERGQRRMSFKAMAAALLIMLYEREAPYLQLPHRVLRRLLDLDEGMAQWRF
                     RHVQLVSRMIGSKTGTGGSLGVHYLMLTLEASRVFTDLGNMAALLIPARLLPDLPEKL
                     RQQLEYAWTQV"
     gene            complement(<283644..>285605)
                     /locus_tag="CYME_CMT105C"
                     /db_xref="GeneID:16997696"
     mRNA            complement(<283644..>285605)
                     /locus_tag="CYME_CMT105C"
                     /product="nucleolar protein pescadillo"
                     /transcript_id="XM_005539099.1"
                     /db_xref="GeneID:16997696"
     CDS             complement(283644..285605)
                     /locus_tag="CYME_CMT105C"
                     /codon_start=1
                     /product="nucleolar protein pescadillo"
                     /protein_id="XP_005539156.1"
                     /db_xref="GeneID:16997696"
                     /translation="MVAERNKKGTSGAAATYVTRAKALRMLQLSLSDFRRLCILKGKF
                     PRDPRNKFEGPRRTYYLKKDIQFLAHEPLINKFRELAAFRRRYRRALARGEFSQAALA
                     ARSSPVYSLEHLIRERYPSFTDALAELDDALTMVHTFAEISRPGDGRRGVSRGLFPPA
                     RLENCARLAREWQLFLMLRPGHLRRLFASVRGFYFEAQIEGVRILWSQPHRFVQYVPP
                     SVDLKVMSTFLEFHEALLHFVLLRLYRRVLGVEYPPRVDRNAESRGALLREMMEVRTL
                     AQLGPIPESNCIDVPLSVSRSNRDSTDSNMHDSTGALRLASAGTGTGAAASQQVQNGT
                     DVDEEALETVSNQGTHSPETTAPPPSLVDGLAQTDHSRDTLANLFRGLYFYVHRETPV
                     HILEMVLYACGAEAVGYESPCTSTSPLTIDDDRIHYVIADRPLEMLPSRRLDREYIQP
                     QWVFDSINEAFRLPTWLYRVGRRLPPHLSPWESELEEETRQRLQHTDAASSAEVQRPA
                     YRLYLERVKTGATSVPLPKELAWLEEPQASVASGSDSHTNHLQTNPEIAASQRPLDAV
                     DSDHEATLDAADSDSDDDGDVPEYTKSKHAGTTPIAVEKKLAEQRHRQRMLLSRRKQR
                     LYDELVARQLQEQKTGTSAALVKRPRHGR"
     gene            <287674..>288765
                     /locus_tag="CYME_CMT106C"
                     /db_xref="GeneID:16997697"
     mRNA            <287674..>288765
                     /locus_tag="CYME_CMT106C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539100.1"
                     /db_xref="GeneID:16997697"
     CDS             287674..288765
                     /locus_tag="CYME_CMT106C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539157.1"
                     /db_xref="GeneID:16997697"
                     /translation="MVPQQTPPDDQAQPRTFHFSDKLENHLRRVDDPGLRWCQRRVES
                     RLRYWLALALTAITTVEAGVLFTFVLCGAGFCRQACVWNMHLLVLSLVSQVPKRFIWR
                     SRPHVQQRAVPLRRDRTSSFPSRGVTCAWVYPVALIRAFRCTQPATHMSRTQSFFLSC
                     VFVGSATLLTLATAWARVFLGVHFPTDTIAGFLQGLLILALVPRQYDAFCPQMRSIWV
                     ALRNTPKSLDGLRFVGMTAVGAQLLLIAELPRLQLWGKASFVFGAEWSMIALGVSGLR
                     FRPFRLSWEVRLLGALISAVYGAATLFTAAFFISEQQRHQRSPKRHHQSQRWLAIPHL
                     AIFLSVYGAGVLFFWIAPKVLSKFESFVG"
     gene            complement(<289242..>289766)
                     /locus_tag="CYME_CMT107C"
                     /db_xref="GeneID:16997698"
     mRNA            complement(<289242..>289766)
                     /locus_tag="CYME_CMT107C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539101.1"
                     /db_xref="GeneID:16997698"
     CDS             complement(289242..289766)
                     /locus_tag="CYME_CMT107C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539158.1"
                     /db_xref="GeneID:16997698"
                     /translation="MGRSGSWVGKEQSLAYAETVFYGVPSKQWTTRRKYGVQRFQSRT
                     SVSGRRGVSSGTRHATRLMRYVQACAEEPKCPTCAGKSVIECPVCGGRGVLGRTIPCS
                     YCKGRKQITCPVCVSDQYEATWEAETIETSDPELESYLPPNADERVRALYRSHLDSLR
                     RERRGSETPGTQSP"
     gene            289910..292161
                     /locus_tag="CYME_CMT108T"
                     /db_xref="GeneID:16997817"
     misc_RNA        289910..292161
                     /locus_tag="CYME_CMT108T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461693.1"
                     /db_xref="GeneID:16997817"
     gene            <292590..>294917
                     /locus_tag="CYME_CMT109C"
                     /db_xref="GeneID:16997818"
     mRNA            <292590..>294917
                     /locus_tag="CYME_CMT109C"
                     /product="similar to cyclin M2"
                     /transcript_id="XM_005539102.1"
                     /db_xref="GeneID:16997818"
     CDS             292590..294917
                     /locus_tag="CYME_CMT109C"
                     /codon_start=1
                     /product="similar to cyclin M2"
                     /protein_id="XP_005539159.1"
                     /db_xref="GeneID:16997818"
                     /translation="MVEVWRVLFAIVCVCFSAMFAGLTLGMLTLDLFDLRIIAESGTV
                     REREQARRVMSVRKHGNYLLCTLLTGNTAANALFSILTAELTSGLIGFVISTLAILFF
                     AEIIPQSICHRFGLRIGAAMVWLVKIFMIVLTPISFPTSRILDYFLGTEPITRYNKRA
                     LKALLSIQTRDNAIAAAAETVQAERQRKALKTRRRRRRKKRGSVQNSPVTSTGEHPRS
                     SNETAPGHGKSLKDAMRRAFRSRSSSERASTENPTPESEAESGALRVTGTADAMSSKL
                     DAWSTAPADALVDVERGVSPSPADARIIARPPEASVIGGRDSASIVAGAIGATYAAAA
                     SKASTEQITMEEGLILSGALEFAAKTVEQIMTPLNKVFMLSGKDRLDFKTMASIFQSG
                     HSRIPVYLGKRSNITGVIFTKDLILIDPDDNIPVSAILLLFRRELRRVVADVHLNVLL
                     NEFKTGRGHLAIVQRSSSDEAVGIVTLEDVIEEIIQSEIVDETDVYRDNVRDEVVVRK
                     RRIDADLLRMLDSTPRYETHLTAGEVSIIASFLANNFAREFGESKMSFHQLEHLLANC
                     TIAEYDRPGAPINGLAEDEPSHRDAISDTAGASDDDASIRKAPEVTVWDLDGTRSAGS
                     SPAWMASRGLDFAAATGRSSGRSFGSKEEHHTLAARRSIPLSAASADDLTERSADFYI
                     YKRGVPSHHATLILSGHVEIMWDRRRRISETGPWTLLAREALEDELYVADFTARGVEF
                     PLRLLRIPTRLYRRSIRLSAEEAASPQAGVKSSAS"
     gene            complement(<296227..>297510)
                     /locus_tag="CYME_CMT110C"
                     /db_xref="GeneID:16997819"
     mRNA            complement(<296227..>297510)
                     /locus_tag="CYME_CMT110C"
                     /product="sulfate adenylyltransferase"
                     /transcript_id="XM_005539103.1"
                     /db_xref="GeneID:16997819"
     CDS             complement(296227..297510)
                     /locus_tag="CYME_CMT110C"
                     /codon_start=1
                     /product="sulfate adenylyltransferase"
                     /protein_id="XP_005539160.1"
                     /db_xref="GeneID:16997819"
                     /translation="MVTAPVHGGLAEPVNRYGNRLPVEALLSRPSVAVSSADCTTLHR
                     IADGTLSPLTGPMNVDDYESVLERACIVRHGEAYAWTIPIFLPVDAEDAARIKVGDEV
                     VLRDENSVAIGVLTVETIYERDLQRFLRIVYRTERTDHPGARLWTGDSRRFSLGGSLC
                     MFEPAPDPRPFASYIKGPLQVRELIQHRGFEQTVAFQTRNPLHRAHEYALVHGAEQLL
                     SAHPERYTGVFLNPLVGELKSDDVPATVRMQTYINLVEQRVLGQGDQNEDVWKRAGQS
                     LHEQLHLVGLDMRMFYAGPNEAVMHAIYRQNLGFTHFIVGRKHADAPYDDQTPIWDDF
                     EAQRIFRSLGGKLAIEAIPVGYAAYFEELGRVGLVEEHPGMTPVSISGTKMRETLRAG
                     RIPDSRVMRECVARVLIEYYRKDADDSATPEHVHL"
     gene            297771..299160
                     /locus_tag="CYME_CMT111T"
                     /db_xref="GeneID:16997820"
     misc_RNA        297771..299160
                     /locus_tag="CYME_CMT111T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461694.1"
                     /db_xref="GeneID:16997820"
     misc_feature    complement(298321..300426)
                     /note="possible transcribed region"
     gene            <300605..>301816
                     /locus_tag="CYME_CMT113C"
                     /db_xref="GeneID:16997866"
     mRNA            <300605..>301816
                     /locus_tag="CYME_CMT113C"
                     /product="probable phosphoribosyl diphosphate synthetase;
                     ribose-phosphate pyrophosphokinase"
                     /transcript_id="XM_005539104.1"
                     /db_xref="GeneID:16997866"
     CDS             300605..301816
                     /locus_tag="CYME_CMT113C"
                     /codon_start=1
                     /product="probable phosphoribosyl diphosphate synthetase;
                     ribose-phosphate pyrophosphokinase"
                     /protein_id="XP_005539161.1"
                     /db_xref="GeneID:16997866"
                     /translation="MTDSNLFSPKPNQIVSTTEASERADSLGTSAESGALRSDSSTSP
                     GGVGRRSPLDLLSSGRNGYPSTELEPVQDEEHLGAALDQALNYELRIMAGNSNRELAA
                     AIARNLKIELMEADVRRFSDGEIYVSIKENVRGKDVFVVQGTSPPVNDNIMELLLMID
                     TLKRASAKRITAVMPYFGYGRQDRKCAPRVPISARLMADLLEVSGAHRVLAFELHAGQ
                     IQGFFRIPVDHMYAVPVFVSYLLENNFDGLVDPVIVSPDAGGMERARAFAKRLNASLA
                     IIDKRRSGPNVAHVMHIIGEVHERDCIIIDDMVDTAGTLTEAAKALKDHGAKKVHAYA
                     VHPVLSGPALDRIRESAIDKVVVTNSIIVSDERKRKSGNKIVQLPVDILFSDCIKRIH
                     REQSVSSLFDQ"
     gene            <304608..>305492
                     /locus_tag="CYME_CMT114C"
                     /db_xref="GeneID:16997867"
     mRNA            <304608..>305492
                     /locus_tag="CYME_CMT114C"
                     /product="similar to ribonuclease PH"
                     /transcript_id="XM_005539105.1"
                     /db_xref="GeneID:16997867"
     CDS             304608..305492
                     /locus_tag="CYME_CMT114C"
                     /codon_start=1
                     /product="similar to ribonuclease PH"
                     /protein_id="XP_005539162.1"
                     /db_xref="GeneID:16997867"
                     /translation="MDSVRPDGRSSEAFRPLRVALGVLERADGSSLLSLGETRVLVSV
                     YGPLQSELSTRSGGVAVQTPRDGTCQVTWLEPEPTLSDILTTTREAHRGGVQGAPYPV
                     LPLSAEQAAVRSRATGLRRHPATETLLERLFSSVIILMEYASSCIHVIVQVLHHDGGT
                     LAAAVIAASLALMDAGVSLRGFLVAVPILARSIDHEQADVSWLVDPTLAELRQQSLGS
                     SLWVVDQTGNICYCRLEAPFALETSAPASLSDINASMHLEWHQDAYRIAAGAAEKLCS
                     WLRSVMESQIKDALPEIQ"
     gene            complement(<305991..>309590)
                     /locus_tag="CYME_CMT115C"
                     /db_xref="GeneID:16997868"
     mRNA            complement(<305991..>309590)
                     /locus_tag="CYME_CMT115C"
                     /product="similar to transcriptional coactivator p100"
                     /transcript_id="XM_005539106.1"
                     /db_xref="GeneID:16997868"
     CDS             complement(305991..309590)
                     /locus_tag="CYME_CMT115C"
                     /codon_start=1
                     /product="similar to transcriptional coactivator p100"
                     /protein_id="XP_005539163.1"
                     /db_xref="GeneID:16997868"
                     /translation="MRLDSPKTTDAGQSVTGTMKISAEKDASSSPVWLRAIVGTVLEA
                     DELVLWTPTSADLSRTELPAARRVRLAGIQTPRACPAQRPESSSVPAPATEAGDRHAL
                     LTKDGCEGNGLSPASDDIEQDWAFEAREWSRKSTIGRHVTFSIVGTDGHSEYALVHLD
                     PKESLQSQLLKAGLARLAPNQLGTHASATGPKGLTSLGERSSTVTTTAPATQAPEQRD
                     VGMGSQTAAFCSQRNIVVAQWFAAHVYPALQQDEVAARAHECGIWSKQYPQRHIVVPV
                     TQVKTWLEANIPMGGSFYLKAVVERVLSGSVVLLRVPEPATAPSRESSRQVQRHALIL
                     AWLAGLATPSVSSGQTRADSNNTDLGAKASPEDPNSPAGRIALQARFLTERFLLQRDI
                     LVYGKEQTPLGHWIVTVRGVSGSGVDSLHDEQQQQQQQQQQQQQETYTLHAQLGEALL
                     RNGLGWMSDWGMDLVSAYAKRWQSLQEDARRRELGWWKFSPATTKAASPLEAPNLTEI
                     GSRWQAEVIQVLSGDSLLLLPSHQRSRATSTTASATSMTTDTSQEPVLHTSSLQSALQ
                     VGLAFVRAYPLDTEGGFTAREWLRTRLIGHPGLVRVQVVSQRPSRVSSASSTSTGVPQ
                     VLLWQADCLLNAALLEAGLVQLKTLPNDQSDAACQQAVNTFVEIERKRKQQPPEQQRK
                     QGGGSRAPTGSTLHRSGAGESAVPRGSTTPATILTQPRRIHDVTRREASRRARDLFPI
                     LCGSQQSLSDTSERIGIVEYVRSGSRFKVFLNKDALLVSFALAGVRCAVPRPIETEGQ
                     RLSAEEDCSWRAYNEARRHVLQRDVRVRILDVDRYGTFLGTLYVLGPSLSQTDPSEQN
                     VVFSGDWAEHLVQAGLATLLERASLPAATWQQLQSAQQRAQRTRRGLWAVSAPSVSAD
                     AGKEIGLSRVGAEHSGRAVVWRSLTVTEILPGGLLFLRSPKANPAEAARIQELCDLVA
                     RQLVTETAHKPMPHPFDLVLAQYPGERPWYRARVLDTAPGEHDLIFLRFIDSGGELWV
                     DASHLRTLPPHDANVHILEQLPAQTFAFRFDDIAVPDTDEPCWEQSGTLLRELTWDRP
                     LNVVVTKQDPGPAPSIAPELGLVLGDLLVASRPTTQEPRSFHSIDEAGTSVAGLLVQR
                     GLAWCLHPQDEGTRRPAAHRFAAEEQQARHQRSGIWQYSDALRFAALDEEFGL"
     gene            <310697..>313453
                     /locus_tag="CYME_CMT116C"
                     /db_xref="GeneID:16997869"
     mRNA            <310697..>313453
                     /locus_tag="CYME_CMT116C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539107.1"
                     /db_xref="GeneID:16997869"
     CDS             310697..313453
                     /locus_tag="CYME_CMT116C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539164.1"
                     /db_xref="GeneID:16997869"
                     /translation="MLAEGVTKGLTASAVVTLAEFRHCLLQVFPAAERPQLLGLAVGV
                     APRDSKSLALALLGKAWAQQHGKRFAAIWVPEDANEAEGFQWFTQLGRLGLVVEKAAV
                     AIHGHQWSNARSDSLSVCSSPERHVQVRKMPVLNACKGTKDAERLHAKPETDEPGRAH
                     PAQATAASVRGQTPSAAFAGRLPALDEYSEQGASRKLPRGALWERRQQRLRILCAEAL
                     ERDLGLVALGHCLDDQVSILVHRMRHGGFLDGLSALAPAQDPVDLPLRVPRIVRPFWH
                     LSEFRLVETCRAAGLVEATGRGDTAAVVVYNASGLRAARSKETSGPSRVGSPESTRPI
                     SAETFADPAIEMFRARNAASNEPVSTTTDNCCASQGRPEATSIKPTTSSPSDVQRSPV
                     AALMGTACSAPAPVNIEPIENARTKGAAVALSGSSRQVVAAAPAAAHPASESSVLDEH
                     ATASRHLYLAPVIKALRKHEQLLDEEADQLLLQCVEFSSPLGYLVIRPAKLAEHALTK
                     AVGLRALLRILQYVGAHQRANRTEALERLYEDITAPATKMSGRTLMGCLLKPQNSLNR
                     IGAFLHKVRWRQSTAGIPDQLGALQADQTFYLKQAADAHEGKDPSLQYWHEACGNHSD
                     LAGEAGDAEHPSDALGAATHASTPAALRKHRGRAEKSHMNARVREQHDQSRCRFVTKA
                     ADASDPASNNKLGWYPRFVVCREPASSAGRSYEWMPLGRCILWDRRFIIRIERHEASH
                     SGTTRGKSSPQTPPDVLTGFEGSFSVEKKKQADVCEVYSLATEALRTTISTSATGGWG
                     AADQVGNLAPAALPPASERGKHWFRVRQMTLHDWTQVTAWRPRLKWTFVPYVCRLALP
                     VFDDGRNLIAVPHFGFNRRPDLRFTVLFATANRTLPPELDRTIGQGIGAESLLVDENP
                     GHGF"
     gene            complement(<315468..>316529)
                     /locus_tag="CYME_CMT117C"
                     /db_xref="GeneID:16997848"
     mRNA            complement(<315468..>316529)
                     /locus_tag="CYME_CMT117C"
                     /product="probable hydroxyacylglutathione hydrolase,
                     cytoplasmic"
                     /transcript_id="XM_005539108.1"
                     /db_xref="GeneID:16997848"
     CDS             complement(315468..316529)
                     /locus_tag="CYME_CMT117C"
                     /codon_start=1
                     /product="probable hydroxyacylglutathione hydrolase,
                     cytoplasmic"
                     /protein_id="XP_005539165.1"
                     /db_xref="GeneID:16997848"
                     /translation="MRFLCLSWIPATRHEHRFVTLSSQCNRVLRSRYHHSALVCCEQR
                     PVALARPGRHVFPECGGKPSEAVLRPTRRASSLPISMLNTWKVADTSVRIPGTCLRVE
                     AFPLFQDNYSYVLLDESQHGPSRVIVAVDPADPDTFLEQLHARLAVRQPTHVLTTHKH
                     WDHAGGNSELARRFPGLVIYGSATDEIPACTVPVHDGDEFRIAQSRLQVKVLATPCHT
                     RGHVCYYVRDTEAPRDAPGLVFTGDTLFIGGCGRFFEGTGAHMLQAMQKLKALPPETY
                     VFCGHEYTVANLAFALTVEPNNESIRNKLKEAERLRAENKATIPSTVGGEQQWNVFLR
                     AADAQWMTELRERKNRFRG"
     gene            <318043..>318660
                     /locus_tag="CYME_CMT118C"
                     /db_xref="GeneID:16997849"
     mRNA            <318043..>318660
                     /locus_tag="CYME_CMT118C"
                     /product="similar to bacterial peptide chain release
                     factor"
                     /transcript_id="XM_005539109.1"
                     /db_xref="GeneID:16997849"
     CDS             318043..318660
                     /locus_tag="CYME_CMT118C"
                     /codon_start=1
                     /product="similar to bacterial peptide chain release
                     factor"
                     /protein_id="XP_005539166.1"
                     /db_xref="GeneID:16997849"
                     /translation="MQAVRLIQRTFCGVLQRPAALLCAPATLRPVSKPLLVQGTWTLP
                     TKSDVYQTALAKLYAARVWATIPRAWYATSVDSDEKTLERLRERQAVLEGARVELNEA
                     DLEETFVKGGGPGGQKVNKTSSCVILRHTPTGIVIRCQAFRSQFQNRQEARRLLARKL
                     DLQLRGEASQVSQEIARIRARKRKRQQRVMKKYFKSRSDQARLDS"
     gene            <319817..>321937
                     /locus_tag="CYME_CMT119C"
                     /db_xref="GeneID:16997850"
     mRNA            <319817..>321937
                     /locus_tag="CYME_CMT119C"
                     /product="inorganic pyrophosphatase fused with
                     fructose-1,6-bisphosphatase"
                     /transcript_id="XM_005539110.1"
                     /db_xref="GeneID:16997850"
     CDS             319817..321937
                     /locus_tag="CYME_CMT119C"
                     /codon_start=1
                     /product="inorganic pyrophosphatase fused with
                     fructose-1,6-bisphosphatase"
                     /protein_id="XP_005539167.1"
                     /db_xref="GeneID:16997850"
                     /translation="MERNGSYTHQRAHSERNFSSDDEGPVQNESVPPPSAYSTVEVVS
                     ERNADERRLYFTLHDHGFISALHDIPLYVDREKGILNMVVEIPRWTNAKFELRTRLPL
                     APIMQDEKKGKLRFVQNVYPYKGYIWNYGCFPQTWEDPEQVHMETGALGDGDPLDVCE
                     IGQHIAQIGSIKQVKVLGVLGMIDEGEMDWKVLVMDVRDPNADNLNDVDDLYRTIPGL
                     VHATFSWFRTYKVPDGKEENKFAFRERVQSRQYALEIVEECHRSWQRLVYGKVKHSNH
                     HCSNTTLTDTPLYMPPEEAASVVEQVRTELSATTENTGDAGMKHGALATRSLRPLHRE
                     ASISQLEKFHMPDFAQELTNEFNQHERSLFQAPSETIKHFLTEQQRQYPHGSSELSLL
                     ITEYGTAAKIIASNIRDQPEAPFEYMRQNADRQLHTALATSGFCCMIYSAQTGQMMPL
                     DLDAGIGNYVVVYTALVGEVGGTLGSLFSVYYRKSYSGREGDTADLLQRIGYEQVAAG
                     YALYSSSVHLVISTGLGAHIFFLDDISGHFVLRQKFVQIPPRGRVYSVDISSLPKAIE
                     GVRRYLAQLESSNASRETKHTALMDGPAPGKIFRYEHNVVGNFHRILRHGGILLMPGP
                     RTNALADFLGVAAPLAFLARQAGGKASVGKRPVLELSAWTLDMRVPLFIGSMSDVSDL
                     EVCILGHPVPERSIVTASETVSYT"
     gene            complement(<322381..>325569)
                     /locus_tag="CYME_CMT120C"
                     /db_xref="GeneID:16997851"
     mRNA            complement(<322381..>325569)
                     /locus_tag="CYME_CMT120C"
                     /product="ABC transporter, LktB-related"
                     /transcript_id="XM_005539111.1"
                     /db_xref="GeneID:16997851"
     CDS             complement(322381..325569)
                     /locus_tag="CYME_CMT120C"
                     /codon_start=1
                     /product="ABC transporter, LktB-related"
                     /protein_id="XP_005539168.1"
                     /db_xref="GeneID:16997851"
                     /translation="MDANRNGPGERREDITRPNAAGSTRSTGSSRSGAAANLETHGNP
                     MEPAGVVQGRAVENALSIVESSGSSAAQSGTDERHVVAGTASAAAAADGGSAQSESAP
                     RTGLISANNVVAGAHTGDTGSAGHLSSSALSSASSEDEPPTYVPRKYLNKSTPPATAS
                     DAVHGTFQAAMNRSLVDQDAVAITVDDIAGAQPAQGPHPSGKQLAAARQGMQAAFPKT
                     SPSFGSAGPAGRYPGDAQASTSLPAGDSMRGFGKFKALRHVFNKKLRSSPDHGEFFMD
                     YYAMLVYGIYPDGSLYARTLAESMKKALGSSSTATKQCAEESLPQHDANGDSADEPAM
                     SAALPPLWNRRCGLFQCCGFSLCACSVDSDTVERNLAELKSIANLLSPRQWLLNAPLL
                     TVGGLLAALASGVIFPAYLFLFGHVVNYWAQIFYGVIAGNPVSSIHRYLIGFGVISGA
                     AAFVVLWQSRSLGTIGRRVRYRLRLWSFAALLLTTGVGTDRLDRWLFEQNTLDRMELL
                     VLDAVEHLSSVALYAAQAISSFIFGIIESWFLTLVLLGTTPILAGLGMLQLFVTRRAQ
                     QRYEEAARKAREFLQLSRAALPNVVYLEQFQKEFQRLYEFTDVEREHDARLNLLQSLL
                     RGLTFGLVLAIFAVLGIYIGGHLARTKHRSSGRLVTAILFAIMLIISLLRMTENLVRY
                     SHARQNLYAYLDFVLDIVDASQAGLGTVLRVDDRCVRVVFDNVSVKDDPEDWASKASS
                     TASPLEEDRGVSSTTSGRSGSAPASAQSPGTPFGSFAESYTLDPKVPRHGIGSRYAQY
                     VFHSLNLTIEHHQIHCIILRKRREERLLLELLSGKRRPDSGRIMLGEHPMQDYTSAAL
                     TAAIGLVPWRGSRLIAGLTVFENIAFGATGTCFAEVRRAASLVGMHEVILRLANGYQT
                     MVPSARTAQALFTSSQLQALGIARVLLRNPSMLLLDSESYAALLDMTVNGVALDLKAI
                     CTGRTVVFVLRADLVESLYFADMISVIESGHVVEQGPHYVLMERAHGIYAQIARASMA
                     REVDLGNLTLDDDDDVTGGIADDSGRDGAGTS"
     gene            complement(<328093..>329304)
                     /locus_tag="CYME_CMT121C"
                     /db_xref="GeneID:16997856"
     mRNA            complement(<328093..>329304)
                     /locus_tag="CYME_CMT121C"
                     /product="similar to sphingosine kinase"
                     /transcript_id="XM_005539112.1"
                     /db_xref="GeneID:16997856"
     CDS             complement(328093..329304)
                     /locus_tag="CYME_CMT121C"
                     /codon_start=1
                     /product="similar to sphingosine kinase"
                     /protein_id="XP_005539169.1"
                     /db_xref="GeneID:16997856"
                     /translation="MVTKRLFVVINSRSGGKNFQAVKRRWEEVKRTLLAAEPSLEIEE
                     FWTQFPDDLPTRAAVFAPSEPLAVLCVGGDGTFHQVANVLYGTEVPLGIIPLGTGNGL
                     AASFGVVDALEAARRIGTLLHQCTSRGELCGVCERLDAFHYEITDVSAKSWAKETESY
                     RERRCCGCLRFRRRPKAVSSENTPLLTRSNSGEEADEADSVSTESSRMTSRSSLNGRS
                     NGYAFLSLTIGLVADLDIRTERMRCLGQIRFNIGAGWYILRKRVFSAAIEYRHVIRDS
                     QSEMGWRTADELTETIAQREYVLIVIMNVTHASPQAQFAPLANAHDACMDVLLVPAGV
                     SRLRLAQFMFQLESGQHIHDQSCRYFKCSWIRIKLDPPQLVSLDGEAYHRARSVVLEQ
                     GGDHVPVIVGV"
     gene            complement(<330319..>331953)
                     /locus_tag="CYME_CMT122C"
                     /db_xref="GeneID:16997857"
     mRNA            complement(<330319..>331953)
                     /locus_tag="CYME_CMT122C"
                     /product="ATP-dependent Hsl protease ATP-binding subunit
                     HslU, heat shock protein HslU"
                     /transcript_id="XM_005539113.1"
                     /db_xref="GeneID:16997857"
     CDS             complement(330319..331953)
                     /locus_tag="CYME_CMT122C"
                     /codon_start=1
                     /product="ATP-dependent Hsl protease ATP-binding subunit
                     HslU, heat shock protein HslU"
                     /protein_id="XP_005539170.1"
                     /db_xref="GeneID:16997857"
                     /translation="MRLNSRAELSSITRYIRTFTKHNGSVSRQRLWLRSVASFSQHRF
                     SLQRPSSSTVSLTYRTSVRSVCSSGDRHTVNVDDSLSSLHQPDSVATSETPSEQPDAT
                     GALTPRAVVAELDRFIVGQTEAKRAMAIALRNRWRRHQLPPELREEVAPKNILLCGPT
                     GVGKSEIARRLAKLVDAPFVKTEASKYTEVGFHGRDVDQIIRDLVENAISLVKQKQRK
                     RLKNELDKLVEDRILDELTGPAARESTRESFRSLLRKGALEDREIEVEETRPLSNRPG
                     FLQLGDASAERMTEMIRSLDRIFTVQRSGAGGNSSSKRRMKIRDARRVIEEAEAERLL
                     SDESLTRQALQLTEQDGIVFLDEIDKICTPSHYRHGADASAEGVQRDLLPLLEGTTVS
                     TKYGNVNTDHILFVAAGAFHQCKPSDLMAELQGRLPIRVELRGLTEADLYRILTEPEN
                     SLLKQQVALLRTEGVELEFTDAAIHEMAAIAAEVNTTVENIGARRLHTVVERIIETIS
                     FEAPEMRGQRVLIDVMNVRDALGGMLLKTDLSRFVL"
     gene            complement(333294..334844)
                     /locus_tag="CYME_CMT123T"
                     /db_xref="GeneID:16997858"
     misc_RNA        complement(333294..334844)
                     /locus_tag="CYME_CMT123T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461695.1"
                     /db_xref="GeneID:16997858"
     gene            <335149..>336264
                     /locus_tag="CYME_CMT124C"
                     /db_xref="GeneID:16997859"
     mRNA            <335149..>336264
                     /locus_tag="CYME_CMT124C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539114.1"
                     /db_xref="GeneID:16997859"
     CDS             335149..336264
                     /locus_tag="CYME_CMT124C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539171.1"
                     /db_xref="GeneID:16997859"
                     /translation="MELDVPLDAQTQKHWRSCERRVADALRVLQHGALRGERDLVHAI
                     IYRNANQHHKHAYFQGLRSAVRALDRLDAAFAAQKGSFARGTLQLDESNWLAALAQLD
                     QVLIQHLYSRQEVQKRPPQVTHPHGTNASSAPALQLSLETIANALEPLLEVAIEWLAV
                     VRHRLRISFKHAWHHLVLRANFLALGMALVAAAGRLHAIVERAMESLTHARCHLHWIR
                     KTRQKHARHASTREKRPQQHPSRSAQKADQLREPVSSGRQQRHAGITRSTGVIVTGSI
                     EAHARMRSTNDEPLHAAPSLYHALEATRSRTSEWSAAPNVFSTSPPDRAAPQRTREEE
                     PAETMPRSHSVDSLDEIFAAAEASEADSLEHLRRYID"
     gene            complement(336025..338179)
                     /locus_tag="CYME_CMT125T"
                     /db_xref="GeneID:16997860"
     misc_RNA        complement(336025..338179)
                     /locus_tag="CYME_CMT125T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461696.1"
                     /db_xref="GeneID:16997860"
     gene            <338697..>339515
                     /locus_tag="CYME_CMT126C"
                     /db_xref="GeneID:16997861"
     mRNA            <338697..>339515
                     /locus_tag="CYME_CMT126C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539115.1"
                     /db_xref="GeneID:16997861"
     CDS             338697..339515
                     /locus_tag="CYME_CMT126C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539172.1"
                     /db_xref="GeneID:16997861"
                     /translation="MSRFLSRIWTRDVLRAFWVQDRRVLHRCLAPASCRQWQLQGFGS
                     RKLTDTAARSKEEAETAAGGAPHAQTQSEVLSTIEALLSKPWTGEFEANLVPLEPHLE
                     RAATILAREQADWQKVQVATGPSPTAEARAFVHDLHLLFLVKEMAPTASLLAETALDL
                     LRLRMDETGFLGSQVKPSKSQLESEIEDTVRAYEAATRRLESAKEKAVRDAPIREPIW
                     NEAIRKWELDVGIHILQLRQTISIEGYSERFGAIAGHRIVPARVVSIEKSDSTG"
     gene            complement(<341072..>343489)
                     /locus_tag="CYME_CMT127C"
                     /db_xref="GeneID:16997862"
     mRNA            complement(<341072..>343489)
                     /locus_tag="CYME_CMT127C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539116.1"
                     /db_xref="GeneID:16997862"
     CDS             complement(341072..343489)
                     /locus_tag="CYME_CMT127C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539173.1"
                     /db_xref="GeneID:16997862"
                     /translation="MSRYNAINAGVRDTFRHPPDFDFSSTGGEPSTRRLGRRAVQRVF
                     SGKPPISRMSQSEQTYRTSKPQKEVSGAVALQVGQECLAVLELRRVEWESTGRRLLQR
                     MRKQTEKKRFLALTRSSKKGQGVSKQRPTLALHKLSGERLLLTRSWDARDLRAVEWVS
                     ESTESKTRLTLLFNDGSCLFCAPSDLAEATRFVQVLQDSYRECYAAELQLRGQRATTD
                     KVMSSGTMESTAREPPVTLKGITADEGAAVDVEGGARLPLDAAAASSQPVPSSASALR
                     RRSPSPGPQDQVSDGVAVQQTVNNARQNGTDALAGILTPPLLHRTLTSFEGPALDLTA
                     GTTSPELEPPSTLVAFDWGQLTHVEHIPEQLQDLSRLLREHTPEFGAEEKRWRRVFTA
                     LRHRPLFQALEWTRLAALEVEIRNLRRLECELRHALTVCSLSESERRLLDSEPDDVSS
                     LGESLAALAAKLVEWKAFAAEHRSWRAVCETADSQEQSVAKVKILLQRHLVALFAEAL
                     SAGEFAALQGPVTAERWSLWHHNCELLGQLTVGAQATLYDQCIALVGDSQPFRGIADE
                     LQRWAQELRTKLTSHCFEVQITEQLTEILNRLAAVTADRMAHLAPLLAEATPLVFEGA
                     LYQVLEAPFHNWMHDTPELRATAWLTMLLAVECLPSGAPLKPRVRAEWNEAASITTAP
                     LQRQRHSNDAAKSAALEPDAGYAALDAATTLATAATLDGPATATISATWESCLRQWRE
                     RLYRAWREALEQCSAMHSVSSDSAVSAQEWFRNAVAQLLGSCNIPRASQYIREWDEHW
                     STRSSAC"
     gene            complement(<343550..>345112)
                     /locus_tag="CYME_CMT128C"
                     /db_xref="GeneID:16997863"
     mRNA            complement(<343550..>345112)
                     /locus_tag="CYME_CMT128C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539117.1"
                     /db_xref="GeneID:16997863"
     CDS             complement(343550..345112)
                     /locus_tag="CYME_CMT128C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539174.1"
                     /db_xref="GeneID:16997863"
                     /translation="MAGLESEETSRPEQEDHIRRTRVPDTRACFTSQSKKRSNSRARR
                     KNLLWAVLPFTLWWLIYNFYGVVVPAQRRPPVQHLCFLPKLDRALIRMLSLSSALGTR
                     ALQLNRMHALQNTGDSGNEMSWAFIEQTSRDRRPFATIDQTRLLAPNQSSAMSMQLWL
                     CGSRLNDSTESQGHIYTAELLAAFIYSLHAFVPAATFLLLLYLVAGTSKNPRMSATSL
                     DPTTWTVTLDLLSSYGWLNFIAIILHIVWPTAPPWFVLQETGAFWPTSQQCAASTNAK
                     SRRWYSRRQTGSAARLEAIDEWLGLPLYSTLFKRNLWVFAAFPSLHVATATWMAIKCT
                     EYAIRQHSQRRFITSMTPCRKYALMASAFKGQSFVSGNQAAGGHRRRVFFALVSVSWA
                     YVVSVSWAAVFLRHHYVVDCLAGLVEAFLAVGCSKCCRRQSWLPPQSEPRLCENRCDS
                     GNFDARSFRTPSLDPETVSSGARPTRSPRNGSRGQRFSFNTSKSEDALAGCETHTDFS
                     AQVRAKKQSTQG"
     misc_feature    345785..347734
                     /note="repetitive element"
     gene            <347995..>350253
                     /locus_tag="CYME_CMT130C"
                     /db_xref="GeneID:16997864"
     mRNA            <347995..>350253
                     /locus_tag="CYME_CMT130C"
                     /product="GTP-binding protein of Nug1 family"
                     /transcript_id="XM_005539118.1"
                     /db_xref="GeneID:16997864"
     CDS             347995..350253
                     /locus_tag="CYME_CMT130C"
                     /codon_start=1
                     /product="GTP-binding protein of Nug1 family"
                     /protein_id="XP_005539175.1"
                     /db_xref="GeneID:16997864"
                     /translation="MPKQKLKLPRGPQGRLPSSSTDPNRGNRIPGGGGWGRSRATVKR
                     IRMYARPAYERDRNGRIQHDRGDLTSSVVKEPGAGRIAPNRRWFGNTRTIDQESLQTF
                     RESISGAERDPYTIVLRQRHLPWTLIKEGMEARDVERFEHAAGRANLRSHALAEGSEM
                     TRGVRFKSSQALLRLEPFAETFHQRRWRKRPRIAFDSIEELAESVRDTATTAAAAAGA
                     AQATTAEPGAGSEEPRPEAGPDTLRSRSLPPVPGAERSTAGSLKQLASEQVPERSIDA
                     LGKTAYTKGQSHRIWSELYKVIDASDVVLFVLDARDPLGTRIPLIENMLRKEHAHKHL
                     AFVLNKCDLVPKHVTAVWLRLLSREYPTVVFRANDCKRAFGRGALLQLLRQFARLHRK
                     DRQSITCGLVGYPNVGKSSIINALRKEKVVRAAPIPGETKVWQYVTLFRRVYLVDCPG
                     VVHARLAGHMDVSDMVLRGVVRIESLRDDAERHIPRLLERVNRHHLEAVYRVSLDGCD
                     ADGFLDAIARARGKLLPGGEPDRNAAAKLLIHDFILGRLQWYVAPPAMPSSVAKANAV
                     LSLDGSARASVIGTNAVEVSSAGDDRNSQMQRHTGSNAGVSSPGSEALDMDERRAHSG
                     SAATRPLVDGADLLLHDLLAEQSFDEDDEAPEALSVFTTTNTSRDTSAGTQFTPDAAD
                     STAGTSSPVRVSETAERSIRKARKKSTSTRSKRRAGRLSKRLRRLAEWNTEPVLQANL
                     QRTLQKTEPRVH"
     gene            complement(<355438..>357480)
                     /locus_tag="CYME_CMT131C"
                     /db_xref="GeneID:16997934"
     mRNA            complement(<355438..>357480)
                     /locus_tag="CYME_CMT131C"
                     /product="probable RNA helicase with DEAD box"
                     /transcript_id="XM_005539119.1"
                     /db_xref="GeneID:16997934"
     CDS             complement(355438..357480)
                     /locus_tag="CYME_CMT131C"
                     /codon_start=1
                     /product="probable RNA helicase with DEAD box"
                     /protein_id="XP_005539176.1"
                     /db_xref="GeneID:16997934"
                     /translation="MGLKQKQSAPPKISKRKSRRLDAIAELAELQQRRAQLREVLGEN
                     SAASPTDRLRFLSSSRDFSELPLSRRTLQGLKVSGYTKMTPIQRAAIPYALAGRDLLG
                     AARTGSGKTLAFLVPLLERLYLDGFQSQLDGLGAVILTPTRELAYQIFAVLQNVGRFH
                     TFSAGLLIGGSRSTDEERDRLPYMNILIATPGRLLQHLDETPYFTTDRLRFLALDEAD
                     RILDLGFAKTIDAIIQQLKSSRRNPATPEEGRQTVLFSATQTRSVRGLARLSLHDPEY
                     IALRDQEQVDGYDMPKRLEQLYVVLDGAFMKLSLLYSFLRSHLKQKILVFLTSCKQVR
                     ACYQILCRMRPGLPVLYMNGQMKLSSRLQMYERFAEAPAACMLATDVAARGLDFVDLD
                     WVLQVDAPEDVASYVHRVGRTARYQRDGRALLFLTRGKEETLVQKIYKRTGVSLQRVR
                     IRANSYIDVQKKVSAIVAADAHLKYIVQRGLETYLRHIAIQADKDVFDVTEIDAEALA
                     LSWGLAAAPSQLLLAVTDSKQSDERLARDVYGYRQERLETRAATSAAEATSRSELAEA
                     GAPATSSAAMDAAVESEEEIFFSVRGENAHLCEQRDEDNEAQNARRHQSSLAPNHDKE
                     NVQESFRPGWLQEEHAAYAARLLEERLAVDAEDRRRDRERLREKRKRRQRELSPEP"
     gene            357613..359547
                     /locus_tag="CYME_CMT132T"
                     /db_xref="GeneID:16997935"
     misc_RNA        357613..359547
                     /locus_tag="CYME_CMT132T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461697.1"
                     /db_xref="GeneID:16997935"
     misc_feature    complement(361396..364689)
                     /note="possible transcribed region"
     gene            <361576..>364743
                     /locus_tag="CYME_CMT134C"
                     /db_xref="GeneID:16997937"
     mRNA            <361576..>364743
                     /locus_tag="CYME_CMT134C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005539120.1"
                     /db_xref="GeneID:16997937"
     CDS             361576..364743
                     /locus_tag="CYME_CMT134C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005539177.1"
                     /db_xref="GeneID:16997937"
                     /translation="MPPVDTVANEAADASAAASSELLSVVSATNAQKASSHDESTQVS
                     TISSQLAVDDGAEAAAKVALTSEQPVSAAEPSARPGLDGCIEKPRGELAGPNDCTCTA
                     NPGTESQPGRDVVRSPAEWPASDDALLREKIQQCPRMDWNQVALAFQGKYTASECSQR
                     WRQLAGRRHLKGAWSPEEDARIIDLVQKLGEKSWSRLATFLEGRTGKQCRERWFHHLA
                     PGVNKAPWTEEEERILREKHAEFGNRWAMIARFLPGRSDNTIKNHWNGTMRRERSRQE
                     RLKRREEMERRKREKEQERQRAKMEREAKKRAETEAKARASSEQPTGKRARVHAENSQ
                     LHTAASKERKQVASASALRDLSNLPEPARNVHVDTHPFQAEMFTPKAARAAPCAETDA
                     DWLTYSTPFAAYQGGPSISCALPNTAAAPEQYSRVLHSERRAGPSLAGAASAGTMMSM
                     PCSSASNTGMVHPHGPASCWTPVAFPGNLTPDALLNESWATSANLTAYGILDTSSGPF
                     MASPVAMTPSSMAAFSAVAGTHLGIFTPNPSRAMGFAIAPGSSAPQEKPPSTPLRVVA
                     GSFTPMTRYMDVSAGCSSEQREREAAQTCGPMVSQNTAHGDLRQAGPSSAGDRSIISA
                     EFVSKTSDDAMRPVTGPEARVREMPVHAGRSDERQTPIRMPHFGAMVGGRMSTPHPSS
                     LGQALDASEGFESHAQAPALSSGTHSTMLHAGPAVSGRQPIPPPAPSGKPWFSPMYGT
                     RPLSSPQHPGSHSHATTDASRRFRGSTYHVSFTTNNTGATSASTIGGTFTGTAASRHR
                     SLLNWGHARDFPEARQAVACSPSALLVNTPADGQARVGIDSSAYRARYLARVAEHGLS
                     AERTQQPGSITCATDQDELSSSWAHLPCTPLPATPLHSLLLSEKAFEHIMPSDSGNDF
                     LGPARLMVSSSPAEHRQPSPVAHSRPGTPVQSLRERFLQLPSEPPTSPGEISALRAPD
                     WAPGASSPRASPHGASTTSLPKDSDEWPVVTPHTGGRDGEPKSPRHWLRSKPCTKVGP
                     WQHQVDASLMTDTPLRESADRSEYR"
     gene            complement(<365938..>366654)
                     /locus_tag="CYME_CMT135C"
                     /db_xref="GeneID:16997938"
     mRNA            complement(<365938..>366654)
                     /locus_tag="CYME_CMT135C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539121.1"
                     /db_xref="GeneID:16997938"
     CDS             complement(365938..366654)
                     /locus_tag="CYME_CMT135C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539178.1"
                     /db_xref="GeneID:16997938"
                     /translation="MHLISSRDNHGAQFAEPHGDGQTLQTVVESDTATPRGLSSPAPS
                     VQRLTLRSLAAHDTASTASAREQASDVLLPVSVGAEPLAPWSSPGKRSREQIRSGSVW
                     IPKKRGAGRCNWGTLDEICRESARSHGDWCQAALDQRDLNYADDNDEEYVLEEIPVMC
                     DTALASHATSDARAWQPNGETDTLGYSYTAQSGSLITNANSSWELDELDWKNRDAADA
                     AWEENGCSYGTRCSNLYLSQ"
     misc_feature    367834..369002
                     /note="possible transcribed region"
     gene            <369666..>370394
                     /locus_tag="CYME_CMT137C"
                     /db_xref="GeneID:16997926"
     mRNA            <369666..>370394
                     /locus_tag="CYME_CMT137C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539122.1"
                     /db_xref="GeneID:16997926"
     CDS             369666..370394
                     /locus_tag="CYME_CMT137C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539179.1"
                     /db_xref="GeneID:16997926"
                     /translation="MWTAAFVTLTGSSVYRRSALSPLVSGRATASPSFHSRWARFGVK
                     SRQRGRQCARATLQCLLEPLGFLNVAAEEAVQNPLVIQRIADYFKTLSIPEPVVEYGH
                     PVMMTIMVAAMGLGGAYLGWAGRLNPDKRAGVKQKQTHATVMGAFTLLAFLGASGGML
                     SVAMQGFPVGQSAHALSAVLVLVLLSFNGIYAGTGFGAGSKRGREATEAAAQGRRVHA
                     YLGVAIVAALLLHAFLGLQMIIGS"
     gene            complement(<374504..>375913)
                     /locus_tag="CYME_CMT138C"
                     /db_xref="GeneID:16997927"
     mRNA            complement(<374504..>375913)
                     /locus_tag="CYME_CMT138C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539123.1"
                     /db_xref="GeneID:16997927"
     CDS             complement(374504..375913)
                     /locus_tag="CYME_CMT138C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539180.1"
                     /db_xref="GeneID:16997927"
                     /translation="MDAGISGTLPNLSAVETAPQVSTPTNEQMPSGPWRIGRRHASRS
                     SNKTNLGETTSTSTLASVALAELEVDNLRLELEERDEWLSRLQKHLEESQKELESSRA
                     EALRLRQVVAEQNGRLVEFELKQQTLTDQIQRLQLQSVAQSVVDSCVSAAVFKVHSDN
                     AAASSVPAATTASCERLQVTLLRAQRDAREIHDLLRMLARSQKSLIETWRENLPRLAQ
                     ALPQLADLVPAVVLQQLEEQQRKAIEAEYAELDKRLRAREGALRERESRVEDLEARKE
                     SVLQREKELEAWEARLRDMQRTLEEQRVRMERLMQGMVPVELVEARERSLRHRETSVE
                     MYERSIERSLQARKASLLAEQAELESRLHDEWARFHLQCEAERHDLQRELDQERMLFR
                     ERIEAQHFELQSRFEEFSMAAEAEAVSFSNLLRDTVSRFAMEVSAAKQLIAELDSRFQ
                     RILENAERQADLYRQVLRS"
     misc_feature    376375..378019
                     /note="possible transcribed region"
     gene            <378759..>381821
                     /locus_tag="CYME_CMT140C"
                     /db_xref="GeneID:16997929"
     mRNA            <378759..>381821
                     /locus_tag="CYME_CMT140C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539124.1"
                     /db_xref="GeneID:16997929"
     CDS             378759..381821
                     /locus_tag="CYME_CMT140C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539181.1"
                     /db_xref="GeneID:16997929"
                     /translation="MAFWEQCKRLLIFILKLLISEKSKNALRVALVCAAVSITIFFAV
                     LRSRLECYTNNLAYVALVIIAQHPHIGSVLRAGAILSLASLIATVFGLVGLAMADKSA
                     AALYFITLVFAGIATILRTDTNPISPGMGISINFLFGAIFIFYVKTPPSEAWDRTYPT
                     LLSGLFASAASLIGAILIFPKSARRSLRTGLAASLRETGDVLRDLRETLQKPPKDRQF
                     SISIESEMGGQSFAPAALAKVQNLRAALAQHRVMLSYMPFEPNLLPPWQCEPDKAWSR
                     LIDAVEDFVFQVDAIVCVFANEQAFISEALNELFSDSIQVMVDFLEAATESAHKLADS
                     IQAYPRALDTDVVLTRPMRRQLNRVIARARHQRWQALRYEDRDRDVNPASAYEFASLI
                     FVAYNIRALQRLVENLKQRVSELLTERRRLRFAPIANLFRWVPMILMAPVQSWMKTHI
                     LLRNPTNAKFLIKYLLCVAIITFPTLFVSQFSHRVYAFLQHDNAISAYIIVTILFMRG
                     VEMTIFRVFLYFTVTFASCALAYALTVMAPTDQYVIDMWIGVWTWGALLVASIDPAYI
                     VTTFPFLLAQYFIIGCQYGLGFTFVYAASRAVSVSCGCFVVAAVSILLWPYRSEEEVR
                     ALLSQILTSITELFIKTNEIFFRMNKEGGSAIWEETGGAEIESKIRQTETLITVVNLR
                     MMLDITPNYRKSSLPQGLGWVALLMRRFYLLRQVVRASPQIRGCYSTTAYEMFLKHLE
                     PELEVMLNEWKQTAEFAAERLRCRRINRPPPDKLLEALHRLRSARAGVITKYAAVRCD
                     MLRRWRESLIAFHLHSVDTRRSDESSTEPKHDGSLTAISSDSSSSPTNEQCTERNPIV
                     ISPSKDADTPNVMEPGMDVVAERMDTVDLGPPDLHPDDSVRFLAWLYATRLMYTAFDC
                     VSEAIGNLRYGPRRRTRWQRLWLRLAGKSGRDHRPKSSSTSKASKSSDEKAHSASDNV
                     QPTENESNARPDPDDEEASAVEVRTSNQVANTAPSISGSRKDAGHYAC"
     misc_feature    complement(380105..381528)
                     /note="possible transcribed region"
     gene            complement(382978..384620)
                     /locus_tag="CYME_CMT142T"
                     /db_xref="GeneID:16997920"
     misc_RNA        complement(382978..384620)
                     /locus_tag="CYME_CMT142T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461698.1"
                     /db_xref="GeneID:16997920"
     gene            <384941..>387574
                     /locus_tag="CYME_CMT143C"
                     /db_xref="GeneID:16997921"
     mRNA            <384941..>387574
                     /locus_tag="CYME_CMT143C"
                     /product="similar to inorganic polyposphate/ATP-NAD
                     kinase"
                     /transcript_id="XM_005539125.1"
                     /db_xref="GeneID:16997921"
     CDS             384941..387574
                     /locus_tag="CYME_CMT143C"
                     /codon_start=1
                     /product="similar to inorganic polyposphate/ATP-NAD
                     kinase"
                     /protein_id="XP_005539182.1"
                     /db_xref="GeneID:16997921"
                     /translation="MEESVGTYATLHSRQPAFVGELVNARQVSAHSWRQRASIYSNRQ
                     YVFGLPHFQNFASKRKRSRYSVYRTQCEPWRQPGPAEARWAALAGACSTLRAVQRQAD
                     LREPPCTATEPNQRANASTTNGEWRPRLVVVGPPGSGKTTLTEQLRQVYGLVRVGCGD
                     LLRAHVLYGTDIGLASKAYMESNELVPDGIVIPLVLERLRQRDCEEHGWVLDGFPRTE
                     AQALALFDFLDIVGDSADAENSSPSISMGARPAGTIILLEASDECLVERIRHRRIDPV
                     THTVYNMKFNPPEEEDIMERLLRVPSDEPEAFRLRLTQYREALPALLACISQLTRARR
                     GDQANNVGLIRLNVSEPGVQDRFQELEEQLKRIWGAKRRSNQYAEHISGSVWVPHAST
                     ALARARAAGLLNTPSTRTFSDWREDPVETSLNGGAGQRDQLGSGLSTAHADDDAVEPM
                     LDGASMSSGQVSAAEQGAASSPVRRSNDNDAPELTLRSDPERVKASPQPVDAETANRS
                     TASKYEKASITLIRCDGVQCVREVVHLGDIAFHGSATEQVMLRWNERPRTVLLLVKKG
                     ANLCEIAKQAVDYLQNSERLRVLVEPWVQTELFALGTYTDSFHHSQDLHRCVDLVVCL
                     GGDGLILYTSTLFRTAVPPVAPFNLGSLGFLTPFEWKDFQGHIRTMLSSDLMLSLRMR
                     LLATVVRVSGQAEQQFHVLNEVVVDRGASPFLCQLECYWDDAPLASVQADGIIVASPT
                     GSTAYSLAAGGAMVHPSVPAICVTPVCPHSLGLRPVVLPDSARIRVQVSPEARSHAWA
                     SFDGKHRLQLRRGDSLLVEMSKYPMPTVNATDHAADWFGSLNRGFGFNVRGAKPKPRV
                     MGRSSTAEQASVDRFADGTES"
     gene            complement(388435..389497)
                     /locus_tag="CYME_CMT144T"
                     /db_xref="GeneID:16997922"
     misc_RNA        complement(388435..389497)
                     /locus_tag="CYME_CMT144T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461699.1"
                     /db_xref="GeneID:16997922"
     misc_feature    389673..392423
                     /note="repetitive element"
     misc_feature    complement(391210..392423)
                     /note="repetitive element"
     gene            complement(<392499..>394229)
                     /locus_tag="CYME_CMT147C"
                     /db_xref="GeneID:16997923"
     mRNA            complement(<392499..>394229)
                     /locus_tag="CYME_CMT147C"
                     /product="similar to protein N-methyltransferase"
                     /transcript_id="XM_005539126.1"
                     /db_xref="GeneID:16997923"
     CDS             complement(392499..394229)
                     /locus_tag="CYME_CMT147C"
                     /codon_start=1
                     /product="similar to protein N-methyltransferase"
                     /protein_id="XP_005539183.1"
                     /db_xref="GeneID:16997923"
                     /translation="MLLFSGRAEPDQMTVAWLLPSTVWQQRCPVALSVCSGPALSPCN
                     RLMTRFRSSVRATLSREGELGEEKSGEHCNTREHQRSTAGEEPQQNTWTREATRHSPQ
                     LDMTTLNDHSIEVGFMEWAKGAGIETAELSIAHFGREHLRGLRAETALPAGSILARVP
                     GFLALQTRSDDSGRGCPLPEEVCAPMFWKQAPWYARLALLLLFERYKADPESARKLET
                     LVLRRKLKRWEIRPNQRRGPAKVSASNCTLSPWFRLLPTTFDERPLYWTDAERRELQY
                     DCLLRAISEQERKWKDLYGRFVRQTFERGGIDLKVRGGLFSEQDFQWALNVVVTRAFS
                     GPSETTPFGERWRQACFAGALSLASWNFHLMDAFAALNVFLVVVLSQLVFDALYPRIY
                     QSMQGAPLKKYVIAPFIDLFNHSSRVQSKVAYEYFYDAFSLSISNRDTHAGDQVFISY
                     GTLTNDELLALYGFVEEDNPHDTYKLWDDASETTIVFDATGRVRNPESVQHLSATGLI
                     ALIREELARKPTTLTEDEQWQPSNQRLELARRFRIGKKRILERALQQLGHAHPQHSGH
                     ATNSGVSAER"
     misc_feature    complement(394624..395825)
                     /note="repetitive element"
     misc_feature    395834..396744
                     /note="repetitive element"
     gene            complement(<399068..>402118)
                     /locus_tag="CYME_CMT151C"
                     /db_xref="GeneID:16997924"
     mRNA            complement(<399068..>402118)
                     /locus_tag="CYME_CMT151C"
                     /product="similar to triacylglycerol lipase"
                     /transcript_id="XM_005539127.1"
                     /db_xref="GeneID:16997924"
     CDS             complement(399068..402118)
                     /locus_tag="CYME_CMT151C"
                     /codon_start=1
                     /product="similar to triacylglycerol lipase"
                     /protein_id="XP_005539184.1"
                     /db_xref="GeneID:16997924"
                     /translation="MAARGTSVSSFESETFGDSTLRGSSELINGQERGTRTRRSSARH
                     RSRLSSFFAPPQIRSDPKEAKFLLETLSSKQVTWQILNLCSAIVLSVTYTLAMSLFAR
                     RFEAALPALNLVDRVVVYCFCVLQLTFTIVYFLRLYRYGWIRCTFEMRSCFLQGLFIF
                     FTMNIIGNIARTISEASGTTIAILYVSDLVWQWFWIFGFYGHAMAILRLYRDIKDRHT
                     FLERNRVVFGLCLIIAAVETAICGWSRTALGLTWPGMLVQFAMRGHQQQVAYSLTFAL
                     VVTMRIFLDGWIAMELYRTFRVLQQLPYTCCHHKQMGARFYRVFTAISYIFLIANDTI
                     AVGLVPLPSANASLDGVPLRLLGIARFNGGAFAMLFTWSVLLLYVHLPPTVLGVWLPW
                     IVALAPDPAAYQEKRAPQRSVSSEWELSAHSASQAAPWPADALDAERELRKANLYYQT
                     EQEALRNGDSWLSRSLVLETHVLIFNMAYLSYRPWHDPHMYAEMFNHYGVGEMDPLQA
                     RVVRHISSAVTDVHVLVIDLADRIVVSFRGTKSTRNLRTDMNVRRVPLEEHLHARECP
                     QIQDTWRLSACSKHGQRGSLRESPAKATVDGTTRMPRTTNAVSTTALAAGRSGTSAAT
                     CSQIPPATHSKREIDSTRKHQASVEAFAKDDSDIERGLDDALSQELGLDPGGRFAHRR
                     WWQYMLSVRGIRSLRFGDFRAQAGDDFSYLIGRRLPSMVHGGFLHAYLSVREELMETL
                     KPLVAKPSSTAPTAVDAACAPLSSTCGDATCGVATSLDRRVQPSNRFPKVSSADIHGG
                     CEHGQQQQQLSLVGRETAARCRSETATAAAAAAADASEAQPCSAMNSLDSASCNHKPV
                     IFCGHSLGGALATIAALDMTCFENSQSLRLSSDLVMSVTFGSPRVGNRAFAAAFQRHV
                     PFSFRWAAVGDIVTKLPFWGYEHVPVKVMLDPLSGSILMDPSIIEESMVAFRNSLDAH
                     LRPAYIQGFERWCRRYHPRWNVQFWDFHDVFDDHALGAALESIT"
     misc_feature    399501..400098
                     /note="possible transcribed region"
     misc_feature    401631..402764
                     /note="possible transcribed region"
     misc_feature    404672..405590
                     /note="possible transcribed region"
     gene            complement(<405308..>406048)
                     /locus_tag="CYME_CMT154C"
                     /db_xref="GeneID:16997942"
     mRNA            complement(<405308..>406048)
                     /locus_tag="CYME_CMT154C"
                     /product="40S ribosomal protein S6"
                     /transcript_id="XM_005539128.1"
                     /db_xref="GeneID:16997942"
     CDS             complement(405308..406048)
                     /locus_tag="CYME_CMT154C"
                     /codon_start=1
                     /product="40S ribosomal protein S6"
                     /protein_id="XP_005539185.1"
                     /db_xref="GeneID:16997942"
                     /translation="MKFNVANPATGCQKQFEIDDESRLRAIYDKRIAQEVDGEALLGE
                     EFRGTILRIMGAQDKEGFPARLGVLTPNRVRLLMHKGDVGCRGYGMRDGERKRRSVRG
                     CIISSEMSVVNLAIVRQGEQEIPGLTDRIIPRRLGPKRASKIRKLFNLSKDDDVRKYV
                     IRRKVTTASGKTYEKAPKIQRLVTAQSLQRKRRRRAVQRTRALKAKAEAAEYEKLLAQ
                     RQAEARQSRKESRSRRSALHKSRLSAAV"
     gene            <407643..>408467
                     /locus_tag="CYME_CMT155C"
                     /db_xref="GeneID:16997943"
     mRNA            <407643..>408467
                     /locus_tag="CYME_CMT155C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539129.1"
                     /db_xref="GeneID:16997943"
     CDS             407643..408467
                     /locus_tag="CYME_CMT155C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539186.1"
                     /db_xref="GeneID:16997943"
                     /translation="MATLTPTEESTSARSLRRDFRNTFRHLAAALFAAVLSACADHLH
                     QWSLFPVSVSKLVSVGVYASSWLVYSWQCSRKPQRLTSRLVSTTSQRRELATIVVHRA
                     GESFGHTAMVAGLFIRTASYRIILTYFVIEYVATWAGFSVWISGPRYAPTTPNESSQE
                     TRLEKAPARQRVWRLLEFLNGPHALGVTLGWVLPFVLVTYCTFRATRVSPTVHSSSMM
                     AELSAIGLWQSARMRIAEWLMFVAGAAHMLCICGNVLITTIYLATVEPDSRQSKKA"
     gene            <409061..>409741
                     /locus_tag="CYME_CMT156C"
                     /db_xref="GeneID:16997687"
     mRNA            <409061..>409741
                     /locus_tag="CYME_CMT156C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539130.1"
                     /db_xref="GeneID:16997687"
     CDS             409061..409741
                     /locus_tag="CYME_CMT156C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539187.1"
                     /db_xref="GeneID:16997687"
                     /translation="MFILGTSILRAYTNVSGRFRGRHRATTARTNQSELRVRRCGSVK
                     YRAAASRRSRSSVLASATGGNASHLKEALQAGETIAYEVEPGTLPTTLPDGFWYRCLS
                     GDVDNCIINGLVAYSLGYVFDGERDVWETEYVPKEWLQAFPDGAPPDFIGSSKNHARE
                     ADEPVKRAIQKLQQSLPKEYRQFLQRRLPQFHGYQISELTPEKTRRAQCINYLLARID
                     MQEKGLPH"
     gene            complement(<411985..>412521)
                     /locus_tag="CYME_CMT157C"
                     /db_xref="GeneID:16997688"
     mRNA            complement(<411985..>412521)
                     /locus_tag="CYME_CMT157C"
                     /product="small GTP-binding protein of Sar1/Arf family"
                     /transcript_id="XM_005539131.1"
                     /db_xref="GeneID:16997688"
     CDS             complement(411985..412521)
                     /locus_tag="CYME_CMT157C"
                     /codon_start=1
                     /product="small GTP-binding protein of Sar1/Arf family"
                     /protein_id="XP_005539188.1"
                     /db_xref="GeneID:16997688"
                     /translation="MGQLFSKLVYVLFGTREVRVLVLGLDNAGKTTILYKLLEPDSSL
                     KHTPTVGFNLETLKVHGLKMQCWDLGGQDSIRPYWRSYFFNQEAIVFVVDSTDKGRML
                     TAKQELHAILTEPELQGAVLLVLANKQDVPDAARVSEVSERLGLADLERTWTIMGTSA
                     ERGEGLQEAFAWLAQRLK"
     gene            <412961..>413725
                     /locus_tag="CYME_CMT158C"
                     /db_xref="GeneID:16997689"
     mRNA            <412961..>413725
                     /locus_tag="CYME_CMT158C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539132.1"
                     /db_xref="GeneID:16997689"
     CDS             412961..413725
                     /locus_tag="CYME_CMT158C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539189.1"
                     /db_xref="GeneID:16997689"
                     /translation="MLAFIPSFSKKPQLSGVRGIETGAHPSGRRRSGFYQRRAGVGAR
                     TLRSESDDPSELFERISLDKPRRLFRVTAEPETTSNGMSALSPSATQQHNGDAVVLSN
                     EPDALQKSDAELRETIERLGLTEAIFGNTSQTDKQDKNAVPQQVSFEEISAIKCFYTA
                     LLAWCFSWLMWNVMGYLIVKFEALGPVSDWYVVQRLTVVFRALVVASFAMGSGLSFFT
                     GAGLVLLGGRVLYSRSQRTGPTSETRPDSRSESDAL"
     gene            complement(<414953..>415582)
                     /locus_tag="CYME_CMT159C"
                     /db_xref="GeneID:16997690"
     mRNA            complement(<414953..>415582)
                     /locus_tag="CYME_CMT159C"
                     /product="40S ribosomal protein S8"
                     /transcript_id="XM_005539133.1"
                     /db_xref="GeneID:16997690"
     CDS             complement(414953..415582)
                     /locus_tag="CYME_CMT159C"
                     /codon_start=1
                     /product="40S ribosomal protein S8"
                     /protein_id="XP_005539190.1"
                     /db_xref="GeneID:16997690"
                     /translation="MGISRDSIHKRRLTGGKRKIHRKKRKYELGRPPANTRLGPKLVR
                     PLRVRGGHFKFRALRLEMGNYSWASECVTRKTRILGVVYNASNNELVRTNTLVKGSIV
                     HIDATPFRTWYFQHYGIDLGKKAVSSADATDGTTTEAKRSASVLAKLAARQAKRSLEK
                     ALEDQFNSGRLLACIASRPGQCGRADGYILEGKELEFYLKKLERRKKTK"
     gene            <416411..>417013
                     /locus_tag="CYME_CMT160C"
                     /db_xref="GeneID:16997658"
     mRNA            <416411..>417013
                     /locus_tag="CYME_CMT160C"
                     /product="60S ribosomal protein L24 homolog"
                     /transcript_id="XM_005539134.1"
                     /db_xref="GeneID:16997658"
     CDS             416411..417013
                     /locus_tag="CYME_CMT160C"
                     /codon_start=1
                     /product="60S ribosomal protein L24 homolog"
                     /protein_id="XP_005539191.1"
                     /db_xref="GeneID:16997658"
                     /translation="MRIEKCYVCGANVYPGHGSVFVRNDATFFHFCRSKCIRAFRRKR
                     NPRYLRWTKAYRKAHGKELAQDLTFAFERQRHTVPKYDRELVRDTLAAIERVTQVQQE
                     RQKAFYLQRMRVKQRIEQREAAVELARQRATTSLRAIEKLPSVQRRLSHRASHPLVRE
                     ARAALVAASSMQEPAPTHSEHGYMASELTDGAPQPNGTLS"
     gene            complement(<418163..>418849)
                     /locus_tag="CYME_CMT161C"
                     /db_xref="GeneID:16997659"
     mRNA            complement(<418163..>418849)
                     /locus_tag="CYME_CMT161C"
                     /product="chloroplast signal recognition particle
                     component SRP43"
                     /transcript_id="XM_005539135.1"
                     /db_xref="GeneID:16997659"
     CDS             complement(418163..418849)
                     /locus_tag="CYME_CMT161C"
                     /codon_start=1
                     /product="chloroplast signal recognition particle
                     component SRP43"
                     /protein_id="XP_005539192.1"
                     /db_xref="GeneID:16997659"
                     /translation="MFLVSSSPAHATRLQRRLLTRQRLPLRSYSTQKLPRQASSARSL
                     QCIGSFWRKQPDSAQKEQVHLRDTYDPLPLHTALQPPNTNAERARELLRAHLDGRGLP
                     FDVNAVDRDNRTALHFAAALGLAEVVEMLIKAGVDVNAQDSQGLTALHMACGYARPAT
                     VRALTDAACDFLRFELRDSRNRTAQQLVEELLAQEQPRKFGGLVRNSKYEAYSEILEI
                     IKTHTNRTSS"
     gene            complement(<419615..>420523)
                     /locus_tag="CYME_CMT162C"
                     /db_xref="GeneID:16997660"
     mRNA            complement(<419615..>420523)
                     /locus_tag="CYME_CMT162C"
                     /product="APS reductase"
                     /transcript_id="XM_005539136.1"
                     /db_xref="GeneID:16997660"
     CDS             complement(419615..420523)
                     /locus_tag="CYME_CMT162C"
                     /codon_start=1
                     /product="APS reductase"
                     /protein_id="XP_005539193.1"
                     /db_xref="GeneID:16997660"
                     /translation="MFQFTAGFPSSSQRRSKCACSRRVIAWRPLGQPKRATLRSGRSG
                     VLGIHATAVVPSLPAEFASLDENSDPVEVIDAALRVFGSDCAIAFSGAEDVLLVEYAS
                     QTKRPFRVFALDTGRLHPETYRFFDRVERHYEIRIEYCFPDATEVEKLVRNKGLFSFY
                     TDGHQECCGVRKVQPLRKQLATLRAWITGQRRDQSPGTRAAIPVAQVDPTFAGLEGDG
                     MLVKFNPLANMSSKQVWDTIRILEVPYNELHERGYISIGCEPCTRAVLPGQHEREGRW
                     WWEDQTKKECGLHAGNISGSGSSSKP"
     gene            <420940..>421539
                     /locus_tag="CYME_CMT163C"
                     /db_xref="GeneID:16997661"
     mRNA            <420940..>421539
                     /locus_tag="CYME_CMT163C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539137.1"
                     /db_xref="GeneID:16997661"
     CDS             420940..421539
                     /locus_tag="CYME_CMT163C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539194.1"
                     /db_xref="GeneID:16997661"
                     /translation="MTMSVPVFACLSREQPRTCQIVCGPSTSHRSHCRVSSLEFDPVE
                     TGRGRSCVRTPFAWCGVLSWLVAVLIGTRAAVSRRLDVWKSSRDRLGLAYAASRSPRA
                     SSTSATATVANVGIAGAGAPTSALAATSALKSSPAGPAAAVLTAAVWMRSRLTILLVL
                     VPCTLGGWLLVEGLREFEKRKPVWRTASPDVATRDQGNQ"
     gene            421495..423411
                     /locus_tag="CYME_CMT164T"
                     /db_xref="GeneID:16997636"
     misc_RNA        421495..423411
                     /locus_tag="CYME_CMT164T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461700.1"
                     /db_xref="GeneID:16997636"
     gene            complement(<422745..>424514)
                     /locus_tag="CYME_CMT165C"
                     /db_xref="GeneID:16997637"
     mRNA            complement(<422745..>424514)
                     /locus_tag="CYME_CMT165C"
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /transcript_id="XM_005539138.1"
                     /db_xref="GeneID:16997637"
     CDS             complement(422745..424514)
                     /locus_tag="CYME_CMT165C"
                     /codon_start=1
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /protein_id="XP_005539195.1"
                     /db_xref="GeneID:16997637"
                     /translation="MLPGAAASEAVAGSVASKRPSSAITCTIRSMEGFVVSNPFRRRV
                     SGRAAWQAVRRCGSVALSSRVYYVERGAEVCVRLGDGCGAFGLRNSVSIGGRQVGSEP
                     WSPSSWRQRPAHQLPVYPDKDQLALVEAGLRTLPGLVTPKSIRSLHEHLAAACHGEAF
                     VIQGGDCAETFSSRTLEYNISLYHLLAAQAAILSSTGSKRRIVRIGRIAGQFAKPRSA
                     PVDADGLPSFRGDIVHSAAPNGRARTPDPQRLLQAYRHASASLEHLRVLEHLHASPME
                     SLRILSEKLAWDSVVDSNLVKAIQNLVQGIDEEIIVMSSTGRHVTSIDTNVIENVFTS
                     HEALLLPYEEGLVRLADWSPSGNAHTLEHLNRDAGSPIDLLSAPQYYATSAHFLWIGE
                     RTRQIDGAHVEFLRGVSNPIGVKLSGNATLEQVFALAEILNPANTPGRLTLITRMGVD
                     ALQRKLPPLMAAVKRSGLAVVWMCDPMHANTQSVRDKNGNSFKTRDCEQVLDEMRLFF
                     EITAAEGVPAGGIHLEMSGEAVTECLGGATRTAVHDLARAYHSACDPRLNYAQALMLT
                     LALKDSLQWREALPNASSAVLSA"
     gene            <425764..>428142
                     /locus_tag="CYME_CMT166C"
                     /db_xref="GeneID:16997638"
     mRNA            <425764..>428142
                     /locus_tag="CYME_CMT166C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539139.1"
                     /db_xref="GeneID:16997638"
     CDS             425764..428142
                     /locus_tag="CYME_CMT166C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539196.1"
                     /db_xref="GeneID:16997638"
                     /translation="MLACPGAARGERRTVSDDAPSPRRDQRTVSRRNIRRVGPAARAS
                     PSRSMHRGVAIPATVQPRSYLCIVLRGARMVEPSVVWWCLVEALKRRLLRQQRWQLWL
                     LVVGLFLLCTIRPRMQSVLDAASKEPGSLLDPNPMYIPAWDAQTGAVLTAFDPQRHLL
                     PFHFIACSSDDWGRIADSVPLFRDSHARQEFLAVASEELKRSLRQTDWSMATVETVRD
                     LQRLHEFLLRLQEAAGEPRQRFVLSPMWVVGGPDIPAMQNQLDIKREGSTGPLRERSS
                     DAQLWVDARVQRAAATPERRGRMRLVQRSPRERWRNSRQRLHETHAEYPQPGVGQRST
                     DPVGETRRAGVTLQRPDSLKRFTGQSSTWGLLTRPVVPTDAQAVHAAPTGFPYRSMYM
                     CRLSRNGASILPGRDLIESIEVAEWYRKLWYDRVWAPQFHGSAHIHPHRWLEALERTR
                     PLRRQRSTARTRIIRSAYDSLREGYVYAGNITALRSEFADGAWSPASLRKGIETFAGF
                     WGYRPRVMSSPHNTWTPSFVQHLVASHAVFGIDAGTGQCATLVIPNATQRSVSCIDRE
                     PWDTFAGRAARLDARMPLIQERIAALRPGFTSLAWHAQNALSATTSPRVAAAHLEHLE
                     TFVHWVQRQNHTVFVTSNELHQIRLRGWSLEVWPDAFVYRNFLPYDILVLVPCLEDMF
                     SGASPWEAAPLRVVRLDQRLIRAPISQSSPELTQCRPWSALMADSQHGHALPRSLRYI
                     QRQKQKRKQLAATPAFRGCRCQRIRLPSFMDDGVLLLPGNSHWIEVRRLSHE"
     gene            <428876..>430618
                     /locus_tag="CYME_CMT167C"
                     /db_xref="GeneID:16997639"
     mRNA            <428876..>430618
                     /locus_tag="CYME_CMT167C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539140.1"
                     /db_xref="GeneID:16997639"
     CDS             428876..430618
                     /locus_tag="CYME_CMT167C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539197.1"
                     /db_xref="GeneID:16997639"
                     /translation="MLTFEAFVAGAIWDIERNGSWLAPRWRRSSVKRRAPLGQRPPVS
                     GTRNLAGKEPSGPARSEGPFFTSKWGRSESSQAGSQAGAGRQKFLNKSERVPEPLEDP
                     LFESLLGPEPAEKRSKHKSSKKQSVDRLVRGKQKYFFEGAVSETEAYNMFANLLESES
                     LTQYAARAEVEWFDAKRLEAASKNRRGFPSVGEIQDLLYDELIDTDGKRWRETVVPSD
                     NRVLLVLFQVSPIDVEFPRYLEHFHAALNLTPTDAIHLIAVSREKPSTNRKTMRKLNL
                     RFPLLSDEQGALGALFGTGNKPHMLIFYREKTPSGIEGWFFDRCARAELPSKLLENTV
                     DYARKLVAQRLQASMRAKQNPTSTGARAAGTDSVANTGMQPVPPGPGASRSPQAAGAQ
                     ATSTSTAGAAAPERRIGQNPPAAGRTELQQQQQQQQQQSGASASTPTAAERLSAASKA
                     VPLADRTSSTPAAAGRGTVSKNEARARLVLNHSTHLEGLISVLERLAVYESIRKIVPG
                     RLYTARSNAERLSIRVTVPVAGGWKLVARKGTQVQDVFVTLESPSSAYAVAHQRSILS
                     KEQLQRLVDEAIAA"
     gene            <432613..>433983
                     /locus_tag="CYME_CMT168C"
                     /db_xref="GeneID:16997640"
     mRNA            <432613..>433983
                     /locus_tag="CYME_CMT168C"
                     /product="probable alpha-1,3-mannosyltransferase ALG2"
                     /transcript_id="XM_005539141.1"
                     /db_xref="GeneID:16997640"
     CDS             432613..433983
                     /locus_tag="CYME_CMT168C"
                     /codon_start=1
                     /product="probable alpha-1,3-mannosyltransferase ALG2"
                     /protein_id="XP_005539198.1"
                     /db_xref="GeneID:16997640"
                     /translation="MSKKTSDDQRQTVSKSRAVAFIHPDLGLGGAERLVVDTALELRA
                     RHHTVVLYTLHLDPQRCFSHVLDGSCGKVVCVENRVIRFIRRFVWGHALRAALSCAVL
                     AASVPLDYDVVFVDLVAIPLMILWWKRFLQRISLHWKTSRYLEADAARRSRPRPLLVY
                     YCHFPDRLLAPGASFESVPTGVGPPKQSETWWRRWLRSLYRSVVDSLEACSIAHADRI
                     LVNSQFTSRVVERTFPRATRSRKPCVLYPPVPASPADVSEPRIPDMVPKRPFLLCISR
                     FERKKRMELAVHALALLYQDTRVRERRVMLVIAGGYDERLTENVEYHADLQKLAEKLG
                     ITEAVIFAPNVSDAARDALLSRCVALVYTPSFEHFGIVPLEAMRAGKPVVACNSGGPR
                     ETVVHEVTGLLCDEPVTPEAFSQALKSLVMDEEKRQRLGQNARERAVQCFSRKVFGDQ
                     LVSLLG"
     gene            complement(<435122..>436423)
                     /locus_tag="CYME_CMT169C"
                     /db_xref="GeneID:16997646"
     mRNA            complement(<435122..>436423)
                     /locus_tag="CYME_CMT169C"
                     /product="methionyl aminopeptidase"
                     /transcript_id="XM_005539142.1"
                     /db_xref="GeneID:16997646"
     CDS             complement(435122..436423)
                     /locus_tag="CYME_CMT169C"
                     /codon_start=1
                     /product="methionyl aminopeptidase"
                     /protein_id="XP_005539199.1"
                     /db_xref="GeneID:16997646"
                     /translation="MSSKSKNGALDAPSKWGTPQTTDESLNAAAPVQLEKCPADACQE
                     RHCAAAACKHLGRYRCPVCTRLGFKGPPAFFCSVACFNRTWPLHQRLHLALLARSLQR
                     NHTATVNEVNDSAADPPPCFHGYAGYTGPLRPWKVTPQRAVPPTIPRPDYAETGVSAA
                     EEAAKRSNQIPCLRPHEIEGMRRACRLAREVLDLAGKAVDVGVTTDELDAVVHEACIA
                     RGAYPSPLNYYGFPKSCCTSVNEVICHGIPDCRPLEDGDIVNIDVTLYVDGFHGDLNE
                     TFLVGHVDRASRILVKNAYDCLQAGIRIVKPGLAFRDIGAAVEEQAQKLGHNVVRTYC
                     GHGIHRLFHAAPNIPHYRKNKTPGVARAGNTFTIEPMICQGSARDVLWPDQWTAVTSD
                     GGRSAQFEETLLVTNAGVEVLTAKTDASPRYFWERPDWDQD"
     gene            <436917..>438488
                     /locus_tag="CYME_CMT170C"
                     /db_xref="GeneID:16997647"
     mRNA            <436917..>438488
                     /locus_tag="CYME_CMT170C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539143.1"
                     /db_xref="GeneID:16997647"
     CDS             436917..438488
                     /locus_tag="CYME_CMT170C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539200.1"
                     /db_xref="GeneID:16997647"
                     /translation="MRDQQQLAGRPRKRRFSAVNHLDADSGVGSTGTNAAAGSQVSSF
                     LTALAGKRHTADTERSTGNQLAAAGQVASFLTVLAGKRTSADAPSSFSAHGRTTSASQ
                     TAVARENPYVSEPLLQALRESGLADKRRQLHEYVPGSWIRWAHHLRLQRQNEIEWEKW
                     LRYGMNVTSLAVSEARAPHYLVAETMLPSRSSHETQLEPWDELLVATSSTACSYAEAL
                     KMATLFDPTQEAFRRPFDATSLARFIQAPPYPNCMSIDLTLPEERRRIRRARRLQKRQ
                     EMEHLRRAGAAPPPLAHRRAFHGVLAALEARQTRAGAAYGALATDQLRQVAQAMVTER
                     MRQHEARNEANKRSAAERALARKQKLERDRQRGLVTKVYALWTKGMTSPNVRRLLFQL
                     SAAAERIGVNGFILEWRERFFKHWAGGLRFAVFIAIQGGETATRQWDALLERRMSHTE
                     DRLLLDRVWQSTWIRVLAGAAPVTLRGVSSEDSARMLTFEAQVAELYDIARARFLLHV
                     AKDTSTPERNEHDLF"
     gene            complement(<438960..>440249)
                     /locus_tag="CYME_CMT171C"
                     /db_xref="GeneID:16997648"
     mRNA            complement(<438960..>440249)
                     /locus_tag="CYME_CMT171C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539144.1"
                     /db_xref="GeneID:16997648"
     CDS             complement(438960..440249)
                     /locus_tag="CYME_CMT171C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539201.1"
                     /db_xref="GeneID:16997648"
                     /translation="MDTTGGYAAESTASVEARASQGTLLRYVVLCTVLCFAERLQGDA
                     RLPTSKSEVTPAPLVPAALLRAILEDLKHELGAVATVALELFELDPEAFERELERIAA
                     NESEALGILDVKADLLRLLRIRGTAQTVSSQRWRRLLALDQVEALSRKHTEPPGEESA
                     TPTSSSVPDTLVQTVLSLRQRYSVLHWLRVLQRDLEQQMDLVSLGNAACTMTSREFDQ
                     QVYIHWRFSPDSELVHPSYADLQLTANGNLVGTADTVLVARIQRRSFPLDRVGARGVE
                     ASVPAPAATELVDVLDVRLPACLRTAYRSWQPVVETLESAVLRAIGTHWGWRLRWEPA
                     YRRCLDGHRTAFHRGLLRYVSPGVSGDSLSIHAVEEGVFQAGTPTCSETVLLRLRLDG
                     TLVPLRAASAPTTLSLRVPLGGSVENQRHERRLVEEI"
     gene            complement(<440638..>441843)
                     /locus_tag="CYME_CMT172C"
                     /db_xref="GeneID:16997649"
     mRNA            complement(<440638..>441843)
                     /locus_tag="CYME_CMT172C"
                     /product="presumed transcriptional regulator for RuBisCO
                     operon"
                     /transcript_id="XM_005539145.1"
                     /db_xref="GeneID:16997649"
     CDS             complement(440638..441843)
                     /locus_tag="CYME_CMT172C"
                     /codon_start=1
                     /product="presumed transcriptional regulator for RuBisCO
                     operon"
                     /protein_id="XP_005539202.1"
                     /db_xref="GeneID:16997649"
                     /translation="MLGFTTSLQGISLRIRAPALAKCSNSKRSGAAVPAAFRLRADES
                     SDYEQPTERRLSDALKERDVEARLAREEAERRDRARREERLRRQRKIEELMSIPDDKE
                     AGTIDEFLQKEGVLDILQKLDHDLVGLKPVKDRVREIAALLVVDKLRSRLGLTGTTPS
                     LHMAFTGSPGTGKTTVAMRMGQILKAMGYSRSGHLIVATRDDLVGQYVGHTAPKTKEV
                     IKRAFGGVLFIDEAYYLYNAANDRDYGVEAIEILLNVMEEQREDLVVIFAGYEDRMNK
                     FYSYIPGISSRIGNHISFPDYTLEELVDIAKVMVRDMEYRIADDAIPACRAYIEKRMQ
                     MPYFSNARTVRNLINRARMRSAIRIFNKAMDPNADGLVSRDELMTLITEDFPTVQELL
                     ERGETAIVE"
     gene            <443339..>445222
                     /locus_tag="CYME_CMT173C"
                     /db_xref="GeneID:16997650"
     mRNA            <443339..>445222
                     /locus_tag="CYME_CMT173C"
                     /product="ATP-dependent RNA helicase"
                     /transcript_id="XM_005539146.1"
                     /db_xref="GeneID:16997650"
     CDS             443339..445222
                     /locus_tag="CYME_CMT173C"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_005539203.1"
                     /db_xref="GeneID:16997650"
                     /translation="MARSYVPPHMRRQLEQQLRVGAAATERPQPFQGNGAPEGRAASS
                     GGFFRSGSGASRGGSSFGGGVMGARERGTGSAAPGGGRRWGAAPTGPGHQSGASSRLQ
                     RLGLWEETNPYYSSGLGKPQEQDHAAADANGEVLELFNGQNTGINFDKYDDIPVEVSG
                     ENVVPEIMSFETSGMDKILLRNVALSGYRKPTPVQRHAIPTVMAGRDLMSCAQTGSGK
                     TAAFVLPVLHQMLLMGGPAPPPSSSGVGGISSRSRCSYPTYLILAPTRELASQIFSEC
                     RKFCYGTSIRAAVIYGGSENTREQLRAVENQVDIVVATPGRLLDFIDRGRIHLANVRF
                     LTLDEADRMLDMGFEPQIRQIVENCDMPAAGQRQTLMFSATFPREIQRLASDFLHDYI
                     FLAVGRVGSTTDFIVQRIEFCEDHLKREMLLDLLNSIPGLTLVFVDTKRAADALEDFL
                     LRHGYAASSIHGDRSQREREDSLAAFRSGQTPILVATDVAARGLDIPNVAHVVNYELP
                     AAIDDYVHRIGRTGRAGNQGIATSFANEKNRGIVRDLIELLQEAGQEVPSWLYTMCQA
                     PVARSGSGRAGRGGRFGGRDMRRETGAPRRPAFAGNASSTSTMRDEPWGGGNWRASGG
                     SAW"
     gene            <449631..>451805
                     /locus_tag="CYME_CMT174C"
                     /db_xref="GeneID:16997651"
     mRNA            <449631..>451805
                     /locus_tag="CYME_CMT174C"
                     /product="similar to kynurenine 3-hydroxylase"
                     /transcript_id="XM_005539147.1"
                     /db_xref="GeneID:16997651"
     CDS             449631..451805
                     /locus_tag="CYME_CMT174C"
                     /codon_start=1
                     /product="similar to kynurenine 3-hydroxylase"
                     /protein_id="XP_005539204.1"
                     /db_xref="GeneID:16997651"
                     /translation="MASSESFSGKEYTIASNDHTTDPVRRVLHFHSEASKGLKNREEG
                     SSTKPSPAKTLQLSESCEQDALACASEVRIRTVRSSPESGSPGVAASTVLARDPAVVL
                     GAGPAGCLIALELSRLGIPVEVFEYRSAHYFRPYIEYAGGGGDRAPYQRYRGRSINLA
                     LSARGLRALETVGLAQRIQQIGVPMRGRMIHDTAGRVHFQAYGGRPEEYLLSVSRTTL
                     NQMLVETCLLDERGLITMHFGKKCTDIDLDQCVLTFEDGWMSPRHHGWPESNTEDTVD
                     SPPSSRSLERERRARKRAAPARGFLGTKERTPRTPQHDATHREPGAEAVPGSLMSSTG
                     RSTSAGAVSTRHVTASFIIGADGAHSRVRQAMQRLVPFNYEQEYIPTAYKELSIPSRI
                     QRDDTGGSSGGYLLAPHALHIWPRHRFMLIALPNRDGSFTATLFMNRDADPGAPDVPS
                     FATVRTPSQIQQFFESYFPDIYALVPSLVADYQSNPVAPLFTIRCAPFHYRGRAVLVG
                     DAAHVMVPFYGQGCNAAMEDCRILANFFREEIRLAALRAPNRRVRGCVRLPASDLTVD
                     FEDGIAEDDLTDAKGLQRALADDGYLGGVVDSESEGAALLDLERVFSAYSAERKPNAD
                     AITNLALENYWEMASKTSSRLFRWKREIQNQLHALMPCYFMSLYHMISFSNIPYAESV
                     RRAQKQDRVMNALFRSLGLGCVSFAGFMLWRACHLLRKAQRN"
     gene            complement(<452794..>453759)
                     /locus_tag="CYME_CMT175C"
                     /db_xref="GeneID:16997652"
     mRNA            complement(<452794..>453759)
                     /locus_tag="CYME_CMT175C"
                     /product="similar to long chain fatty acid elongation
                     enzyme Elo1p"
                     /transcript_id="XM_005539148.1"
                     /db_xref="GeneID:16997652"
     CDS             complement(452794..453759)
                     /locus_tag="CYME_CMT175C"
                     /codon_start=1
                     /product="similar to long chain fatty acid elongation
                     enzyme Elo1p"
                     /protein_id="XP_005539205.1"
                     /db_xref="GeneID:16997652"
                     /translation="MTRLQPLLEYSENFGFRGAPLSRPVYPLAGIAIYLLVITGLERV
                     MRTRRPFSLRSAVVLHNVFLTLLSLAMGFGTLIEIMLHAVREPDGLRAIACDHRGTVM
                     RGRLLFWMYVFYVSKYYELLDTIIMVLRKRPLSFLHVYHHCVVLPLFWMYLRTSMVIH
                     FILVVANSFVHVFMYYYYAVSALGYRVWWKQHLTMAQIVQFVIDLTATYPFVYFYFRH
                     PKGCSGSMRAFIFGQLVGISFCYLFWDFFRKSYRTPKQSRSREKEAALSSEPTSEAQQ
                     FVKSTHFSADAGDQTTSAAKAGMLASTARGSVTSTRRHTSARRLS"
     gene            <454675..>455463
                     /locus_tag="CYME_CMT176C"
                     /db_xref="GeneID:16997653"
     mRNA            <454675..>455463
                     /locus_tag="CYME_CMT176C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539149.1"
                     /db_xref="GeneID:16997653"
     CDS             454675..455463
                     /locus_tag="CYME_CMT176C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539206.1"
                     /db_xref="GeneID:16997653"
                     /translation="MTSQESGVRRLEWTLTTAESLRKLTEESATAPVVIDYILSKQEV
                     LTTRDVIDALFLVYDLLVWSATSFAMPISTVVRMLSLPLLVALQRSAIAASLQSGPSP
                     WPQWEHVAVGGTFDRLHAGHRLLLSAARYLCRSHLYIGVSGEALVADKAQKHNLQAFP
                     ERCAAVQGFMLLLGSVVSHLSTVNIHLVELEDAAGPAATDPSLQALVVSEETAAAATA
                     INRQRQERGLCEVVLVQVPILWQTRPDGKREKVSSTWLRQMLNG"
     gene            complement(<455661..>458261)
                     /locus_tag="CYME_CMT177C"
                     /db_xref="GeneID:16997691"
     mRNA            complement(<455661..>458261)
                     /locus_tag="CYME_CMT177C"
                     /product="unknown kinase with aarF domain"
                     /transcript_id="XM_005539150.1"
                     /db_xref="GeneID:16997691"
     CDS             complement(455661..458261)
                     /locus_tag="CYME_CMT177C"
                     /codon_start=1
                     /product="unknown kinase with aarF domain"
                     /protein_id="XP_005539207.1"
                     /db_xref="GeneID:16997691"
                     /translation="MQFSGRDKGCCNPEPVNRVRAGARATLQAQPVHPQVPLTAFMLS
                     QPVFWRAQPFAREVYFCGRWDCTGRRGLWRQRRKHAHLDQFWRVTKASLSETESVIVS
                     AHSAPGTSNAIPMDVQQIQRRYRYTEEVEAGLRGWALVRQDWRRLRSWITRRGRAEFL
                     HYDLQAFARFYRWRFDLVIARAAAVAFPLLLWFVRYRWRLRDPELRQALANEKGIRMD
                     ASSAAELRALAVDFGATAIKLGQTLSSRPDIVGPTFMVELQKLQDDVGPFPKEEAWAL
                     LRAELGAEAMHQLFGNGAFDASRMPEPVASASLGQVYRAQLSDSGMEVAVKVQRPRLH
                     LDVPLDLLILRWLADKARKFFRLRSDLPAIVDEFGERLFEEMDYVHEAMNAERFRSLY
                     ARAPSLAANDATLRDKILVPHILWRYTTPYVLALEWINGLKPSQWEKQDALRLIRIGV
                     ASSLQQLLDDGFFHADPHPGNFLCSLPEGRLVYLDFGCMAELDADRRYHLIMAITHLI
                     NKEYAELSRDLVALDFLPPDVDPLPVSRALEEAFEASKRASNADAERGGRRATLTDLN
                     FATLTSNLGRVAFAYPIRIPASLALVMRSLTALEGLALKYDPGFRIVDAAYPYVARRL
                     LFAPTPALREAVQQVLLDTTTRRIRWNRLFTMIRQSSLALGGDGASSGENGSVFPDAS
                     SAASSSDMLRFRGVAGFAVDPFEPMSADAAWNLALEYLLSNEGFFLREGLLNEFVDIV
                     DDLQLAFLQTLSRATFGIVPSSGEPNSARLRAIQELLLEQLLPPLPRELETTSQRFDL
                     NTLRRNPNLLRLVVRELFQDSRMIMGKLLERQSVRFWQLLFQRAEKVLEREIELRKGE
                     EEVSTGSPPS"
     gene            complement(<461665..>462591)
                     /locus_tag="CYME_CMT178C"
                     /db_xref="GeneID:16997692"
     mRNA            complement(<461665..>462591)
                     /locus_tag="CYME_CMT178C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539151.1"
                     /db_xref="GeneID:16997692"
     CDS             complement(461665..462591)
                     /locus_tag="CYME_CMT178C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539208.1"
                     /db_xref="GeneID:16997692"
                     /translation="MLCFAMSTLRRTASFAAAGTHLHAGGRRVAALPQRTLRTQLMPL
                     SGGMGCPLAPGAFVPSFGSAELHWRGHRKALHQSASPRGVVYRLVLSSAAENDDVNGV
                     AGAIHEAFLNACLPQSGVPYVAALRSFIASTVRAYRLGYSLDALEIELRRVGAESLRS
                     GNRSASGELPRPLEADEVELRTIWLTLVFKVLRYVNFPRDRMPPEAPSEQSSRNRAIT
                     EEFRVPDQFDRFVQSIVDAARAGYDLARIRLEQQLQLKSMPQAPGTSIGTSTSQRSPL
                     ESAILNQSTRLVLLTVEIVDTWQRNGGIEPLA"
     misc_feature    463745..465950
                     /note="repetitive element"
     gene            <466021..>467781
                     /locus_tag="CYME_CMT180C"
                     /db_xref="GeneID:16997693"
     mRNA            <466021..>467781
                     /locus_tag="CYME_CMT180C"
                     /product="manganese transport protein"
                     /transcript_id="XM_005539152.1"
                     /db_xref="GeneID:16997693"
     CDS             466021..467781
                     /locus_tag="CYME_CMT180C"
                     /codon_start=1
                     /product="manganese transport protein"
                     /protein_id="XP_005539209.1"
                     /db_xref="GeneID:16997693"
                     /translation="MGPAAAQPPQLAAHGLDESGSFRDSGTGVFEDSYTAQGGFAELK
                     AQPLSEASMPRRKHQTERGKLGRVDGLFEEAPPGDSVVIDTVTAENGSSSARRRFEWR
                     LALRKLGPAFLISIGYMDPGNWATDIEGGSRFGYRLLWVLVVSNVMAWLLQTLASRLG
                     IVTGRHLAQLCREAYPRIIAMTLFALAETAIIATDLAEVIGTAVGLNLVLGIPLLLGI
                     LVTTLDTLLLLMAQRAGGLRRIEQIVLSLLFVITICFALELVLSKPSFIQMIGGLVPR
                     IDGQSLLVALGMLGATVMPHNFYLHSAIVIRDATVRRPADSCVSTSATRTADGTAHNG
                     HDLAGCTDDSDRGRELECVYSAIDCAVALNAAFFINAAILITAASSFWANHVQVATLQ
                     EAHALLERVLPIRLWGRVEVAPLVFGIALIAAGQSSTITGTLAGQYVMEGFLGLSLQM
                     WQQRLLTRLCAVVPSVLVIILLGPESTYRLLILSQVVLSLQLPFAIVPMIRFTGSKAL
                     MGERFASGMWTRICAWCAAAFIIVLNLWMAGSMLFDAFRVQSGRTAGAVVGGVLAVPL
                     TIYLLGVLVWLCMYRGFRNE"
     gene            complement(<468146..>468922)
                     /locus_tag="CYME_CMT181C"
                     /db_xref="GeneID:16997694"
     mRNA            complement(<468146..>468922)
                     /locus_tag="CYME_CMT181C"
                     /product="similar to ADP-ribosylation factor"
                     /transcript_id="XM_005539153.1"
                     /db_xref="GeneID:16997694"
     CDS             complement(468146..468922)
                     /locus_tag="CYME_CMT181C"
                     /codon_start=1
                     /product="similar to ADP-ribosylation factor"
                     /protein_id="XP_005539210.1"
                     /db_xref="GeneID:16997694"
                     /translation="MFGLLSSLANTFWVERHPPYRVVFLGLKGSGKSTLVRAIRKRLA
                     GEVPSSNAHPVAAVAQRWVAEPVHPDSNGSVDGQRERYIPTVGLDRFSVTSAANGPEV
                     TWVLLDLGGDASFRFLWGRYLQQADAVVWVIDGSDATRIEECIAALQETCEHLAPSAA
                     ASVAEAGCSRHGIADAGSKHSQPSPKRPLILVINRLHGGQFEDAAPHWEEALTRLIEG
                     VTKKGAVGPVALQHVDALTGYGVHCVVEWLLANRPTLPSA"
     gene            complement(<470752..>471204)
                     /locus_tag="CYME_CMT182C"
                     /db_xref="GeneID:16997683"
     mRNA            complement(<470752..>471204)
                     /locus_tag="CYME_CMT182C"
                     /product="photosystem II protein M"
                     /transcript_id="XM_005539154.1"
                     /db_xref="GeneID:16997683"
     CDS             complement(470752..471204)
                     /locus_tag="CYME_CMT182C"
                     /codon_start=1
                     /product="photosystem II protein M"
                     /protein_id="XP_005539211.1"
                     /db_xref="GeneID:16997683"
                     /translation="MNTLFVTNLVGYSSKSRLVLKQRVRAPLPSRSTMRVHRAVGCTR
                     AAVLLKQQQQQQRVAGATRAPEAQSGSPVASAVSLAAAMWALPSMGYAAEESGMTVQF
                     GAYLAVFLGTLIPVAFLIILYIQSETRKAAMEAVSGSGSEEEEELEFE"
     gene            <472109..>472432
                     /locus_tag="CYME_CMT183C"
                     /db_xref="GeneID:16997684"
     mRNA            <472109..>472432
                     /locus_tag="CYME_CMT183C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539155.1"
                     /db_xref="GeneID:16997684"
     CDS             472109..472432
                     /locus_tag="CYME_CMT183C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539212.1"
                     /db_xref="GeneID:16997684"
                     /translation="MFVNGSLSVKVKKGAASASVARAAAHTRRTAGVATAKRTGATRS
                     PVQMVLAPHVAQPLETVVAFANTQSTSLLTAANESDFGGYFIPAISLIILGAIILALS
                     PPLRD"
     gene            complement(<472504..>473829)
                     /locus_tag="CYME_CMT184C"
                     /db_xref="GeneID:16997685"
     mRNA            complement(<472504..>473829)
                     /locus_tag="CYME_CMT184C"
                     /product="GTP-binding protein"
                     /transcript_id="XM_005539156.1"
                     /db_xref="GeneID:16997685"
     CDS             complement(472504..473829)
                     /locus_tag="CYME_CMT184C"
                     /codon_start=1
                     /product="GTP-binding protein"
                     /protein_id="XP_005539213.1"
                     /db_xref="GeneID:16997685"
                     /translation="MLGFAGIVTTAAWARPVAVRQTQARYRSRPASLASSRSLRCKLQ
                     TGIVGLPNVGKSTLFNALCEQTKAEAANFPFCTIEPNIGVVTVPDSRLEVLSEIGGSS
                     RIVPTYLEFVDIAGLVKGASRGEGLGNRFLSHIRECDAIVHVVRCFMDERVVHVAGHV
                     HPKQDIETIDTELMLADLAMVEKRLERLRKPGSSRRSAGAGTMTSSQLAEDTERSALE
                     RVTKALDAGMPIRRSLSDCTVDERQALRRLGLLTAKPVIYAANVADSVLAAATETLAK
                     AKMQANVWPDNESPLALVREVFEYAALEQAPVVAVSAQLESELVELPPLEREQYLESL
                     GINDLQNIGLRALVRAAYETLGLCTFFTCGPQETRAWTIPRGTKAPQAAGVIHSDFER
                     GFIRAETVSFVDLVKAGSLTSAREQGLVRAEGKDYVVQEGDVILFRFNV"
     gene            complement(<477154..>479952)
                     /locus_tag="CYME_CMT185C"
                     /db_xref="GeneID:16997686"
     mRNA            complement(<477154..>479952)
                     /locus_tag="CYME_CMT185C"
                     /product="probable MAP kinase kinase kinase"
                     /transcript_id="XM_005539157.1"
                     /db_xref="GeneID:16997686"
     CDS             complement(477154..479952)
                     /locus_tag="CYME_CMT185C"
                     /codon_start=1
                     /product="probable MAP kinase kinase kinase"
                     /protein_id="XP_005539214.1"
                     /db_xref="GeneID:16997686"
                     /translation="MGFFTIGKKKHPKEVHKEQSKGAAGKRSGRSIETAAARAPAAVP
                     VHGLQGSKSGDAAPVRARQVARADVGGRKPGETSQPAKAGQRLLQQQASQRPSEQSIP
                     VASVKGAVGASGSARRRSLVPRQVPTSVRAAAEEASARADADAGHRRTDSASSSSIGN
                     GCSSNTPVENWAAPQAEVQLLRVARIAARSDEARRKLVEREAIPFLVSALRDAKTSDL
                     GKSHAAFALAELSVLEELEEKLVRADAPSALIGFVRSVIPELATATRTTTSLVECGAS
                     AALGVLLSTLASATRALRNLTAGSPRTAEGMVRLGVIPALVQVLSAPQVLVEHEIMQG
                     AMVEATGAFGNIAQEPPCALALVKAKCIKAILRHIDAFRKPAERAEFNFHVASIIAEL
                     SLQSGAVHDYLIDIGVFPALARLIASELASGQLWHEFDRAPSADHSHVFRASDTIAEA
                     CRAFGNLGATARGRAAARNWPLVTQTLCRFIEQCEQRQATHYFESASTNPLADACRAL
                     ANLCLEAATARVAASLSVDLPLLSILELAKPAGELSSETRRALIVLARAGSDIRQTLL
                     THLRQCSIRSVQSGRSEAALIDLRSALVRSAPEGQRSKSNNLASVAVEGQVSALAPLS
                     LKCRPLRPSVGAFQSTGRTVTMRPLANAQKDHFYTVDTFELGQVLGRGGYGVVYMARN
                     VRTNEIVAIKSFHAVDSGQTLYTVDPRAFKEQRLWQRLRHENIVEYKGSFIGEKGDLN
                     LVIEYVDGWSLAEHLAQFNEFHEPLVREITRQVLHGLRYLHSHGVTHRDLKPGNIMVN
                     QNGMVKITDFGVSSCVDLQTAGSGHTMVGTPWYIAPEMIEGRPYDHSVDIWSLGCTVL
                     ELATGRRPYHTLNAMAALFRMVQDRMPPIPPNLSAECASFLKACWVWEPSKRPSAADL
                     LKHPFVRLEVTSNSAARV"
     gene            480217..483294
                     /locus_tag="CYME_CMT187T"
                     /db_xref="GeneID:16997699"
     misc_RNA        480217..483294
                     /locus_tag="CYME_CMT187T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461701.1"
                     /db_xref="GeneID:16997699"
     gene            complement(<480969..>482909)
                     /locus_tag="CYME_CMT188C"
                     /db_xref="GeneID:16997700"
     mRNA            complement(<480969..>482909)
                     /locus_tag="CYME_CMT188C"
                     /product="similar to KRR1-interacting protein"
                     /transcript_id="XM_005539158.1"
                     /db_xref="GeneID:16997700"
     CDS             complement(480969..482909)
                     /locus_tag="CYME_CMT188C"
                     /codon_start=1
                     /product="similar to KRR1-interacting protein"
                     /protein_id="XP_005539215.1"
                     /db_xref="GeneID:16997700"
                     /translation="MELQINQKFAREYDKRKRREELSNLREVERQLNERRDVDQRPAR
                     ARNQAPSPSGASSLHSSSSDADESTEEDDLGLLLTKRLDAQWAQTLELIRRRDARIYD
                     PNYRFYDDSGSISGRSESSPGTTTNDEAEPVAGYDLLALKAEKEKAVCLDQYWREGLL
                     REAEADSSSSMSSSQLSSNSSQVGQRDRTVTPDMETVERRPRIPVYDEQQEALRLEFL
                     ERAARETMKPDGVANYHERSVSEELNEESSEDFFIVKQTDRRLEEILQTHVSGVSALA
                     PGTTTDARRVDATPQSDEERQHAYLEKETVAEKDAFLYDYVVNNRWLGPAHDLLQRVA
                     SVENLRNPQTSDTLEEDEQFLERQDQFEQAHNFRFEEPHGDLIPSHPRRIEGSLRKPS
                     AKQEARRRQREAKAAREDLMKRKQLETLRRLRNVHLAERTERLQRIARAAGLEQSAKA
                     ASSGGRASSEMELVERVLALAESDHDFDATKFDTAMRDLFEREAYQSAPDEGWQPDAD
                     FGIGKSASGPADSSAARSDRVTGSHRMNGHPSEIATPFDNDSDVDQFNREDLLANTRF
                     RYRRVEPRSFGVSPEEMLDMDERELNAYASIKYIQPFRPIETLPKRLRKLHRGNTSMQ
                     RYRLRQVQQRGRFRKTADRAMR"
     misc_feature    complement(483162..485903)
                     /note="repetitive element"
     gene            <488529..>489794
                     /locus_tag="CYME_CMT190C"
                     /db_xref="GeneID:16997701"
     mRNA            <488529..>489794
                     /locus_tag="CYME_CMT190C"
                     /product="riboflavin kinase / FMN adenylyltransferase"
                     /transcript_id="XM_005539159.1"
                     /db_xref="GeneID:16997701"
     CDS             488529..489794
                     /locus_tag="CYME_CMT190C"
                     /codon_start=1
                     /product="riboflavin kinase / FMN adenylyltransferase"
                     /protein_id="XP_005539216.1"
                     /db_xref="GeneID:16997701"
                     /translation="MEYQHAPASIRVRPPRPEKRLLPFVSAAGALTQRVSGSAWPCRP
                     ATRRPPPKRRNTRCWVLCNAQQRRIIVPGKFDALHIGHRELVLRAASYGKPVILTFSG
                     MAEVLGRRAQLPIVARTHMEHIIRNWFAFPGRDADRPLLNSPLKPIVQDADAFEVVVV
                     PFAEIRHLSPEDFIVQFLYRELGAGGIVCGWDWRFGYRAAGDVALLKSLSAALGRESP
                     SGWVFETVPPVLSHGDRVSSSTVRRLLAAGRIHQTTRMLDRFHACTARCTVLRNSTEF
                     LELCVDSWENQPPAPSRLYECRVELRVRCNESTIAKDVSWKRLNAYVWIESSERSESA
                     SVHGIAGAPLPLPLPLPRLIQLWTCDRMDVPVNEFGVSVTSDRGRELGVLERALCNAS
                     AVDVTLEFRSVVTASTPVLVNRSPLTRYT"
     gene            complement(<489828..>491264)
                     /locus_tag="CYME_CMT191C"
                     /db_xref="GeneID:16997702"
     mRNA            complement(<489828..>491264)
                     /locus_tag="CYME_CMT191C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539160.1"
                     /db_xref="GeneID:16997702"
     CDS             complement(489828..491264)
                     /locus_tag="CYME_CMT191C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539217.1"
                     /db_xref="GeneID:16997702"
                     /translation="MFCAFLTPAGAVAGASRRGRYCPERQLVRALHGGRVPRRAYSRT
                     EAALPALVSRRRVRSHGDPPVKLLGNIRVWRSRSSASRRNSDRHLLPGLARTRSVSSC
                     LGLEDRDRHRSQPQPGTVVGSETASLSENVDHGLSGPSPTSGVDSGNNGGNGSFGKGN
                     GGSGGRYEGPDEHGDYWSPDPEIAGVLRAYKRSLQSLPPEVVQAIQHGWIERRTLARY
                     LAQDRGLVAWLLQWRFFRDRVLADPEFIFKLLAQEYIGNGTQLVGEFLVRGRELVDEL
                     EYVLSDLVVGTVVEASFVVLLAPYTPFPQMSQLETGAVQRGLIGSVWQRYLNWATSLP
                     ANAFEKSLPPLRVYTLPSRVLTVLHTSAQYFLIGFASGVVGTAITYGLLHLRKAMDAH
                     YTPVRPMPPVLPNSIGWGAFMALSSNPRFQLVEGLERLSHMLFANHAVLNRSLIVSLR
                     FLNNFYGGIHFVQFFRWAGLQATGQTGP"
     gene            complement(491290..491404)
                     /locus_tag="CYME_CMT638R"
                     /db_xref="GeneID:16997965"
     tRNA            complement(join(491290..491309,491320..491366,
                     491388..491404))
                     /locus_tag="CYME_CMT638R"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:16997965"
     gene            complement(<494422..>495618)
                     /locus_tag="CYME_CMT192C"
                     /db_xref="GeneID:16997973"
     mRNA            complement(<494422..>495618)
                     /locus_tag="CYME_CMT192C"
                     /product="unknown mitchondrial carrier protein"
                     /transcript_id="XM_005539161.1"
                     /db_xref="GeneID:16997973"
     CDS             complement(494422..495618)
                     /locus_tag="CYME_CMT192C"
                     /codon_start=1
                     /product="unknown mitchondrial carrier protein"
                     /protein_id="XP_005539218.1"
                     /db_xref="GeneID:16997973"
                     /translation="MEWLPFASSPALSTRACRGYERAAAHPGLLVREHQVSIEKRYRS
                     SMRTAVDLCSVRHRNAHDVHDVQRARVAESAPAWVNFAAGVMAAFVTRTVLIPLDTIK
                     TNMQSATMAQLRGLPWHRRLVFVARSIVNRHGVLGFWRGLPVAVIGNAPAQAVYMATY
                     EALKSMMHVAEPTPDVVRRSTPRTIVRIAIAAALADTVASLVRVPPEVIKQQVQTGQH
                     QNAISALRALARQPLHRGGLYRGFWAQVARDVPFAVSLFVVYESLNEFFVQRRMHADS
                     KTGDGHHIATADALGNGRKPVWTGSVAGTVAAICTMPMDIARTRLMARPYGEYAGVWQ
                     AIYQIAREEGPMTLWAGTWLRILYKMPSSTLFLASFDWSRAALVRIQRALCCEAANHV
                     EHNLYP"
     gene            <498250..>499395
                     /locus_tag="CYME_CMT193C"
                     /db_xref="GeneID:16997739"
     mRNA            <498250..>499395
                     /locus_tag="CYME_CMT193C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539162.1"
                     /db_xref="GeneID:16997739"
     CDS             498250..499395
                     /locus_tag="CYME_CMT193C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539219.1"
                     /db_xref="GeneID:16997739"
                     /translation="MAPVPRPGPLSPSSRGKTNAAGEECSLSGSCGPEACTRRRDDRV
                     AKPGLSVSCRWSVSTSPGSASKVIEVVGDRAQATVLTKESRSVLGGSPSSGRLLPCLG
                     SGNGVPGQSTALPKGAPARGAGREHLEQSFLDFGQRNGAGPVTCPECGCTYVVGVAAD
                     ERAHTSEHQLFLYGVPVTHPRFLDAAVDLGKAPEQQWPAFERIPGWIVHVSTSRGRAS
                     AAQHQNRSGNILHVQQPWFKTLWRLACKDWSAHAEASEPTIPFGTELSEAVPPIWIFV
                     YIGRQRRNAIGLVVARALTLREPLDHVRQEAPWCGLERVWVHTAYRRCGVATALADTA
                     RAHVWAATVVPRHRCAFTELTTAGDAFAAGYVGGRDRIRLYKPTKHI"
     gene            complement(<500189..>501931)
                     /locus_tag="CYME_CMT194C"
                     /db_xref="GeneID:16997740"
     mRNA            complement(<500189..>501931)
                     /locus_tag="CYME_CMT194C"
                     /product="nonsense-mediated mRNA decay protein 3"
                     /transcript_id="XM_005539163.1"
                     /db_xref="GeneID:16997740"
     CDS             complement(500189..501931)
                     /locus_tag="CYME_CMT194C"
                     /codon_start=1
                     /product="nonsense-mediated mRNA decay protein 3"
                     /protein_id="XP_005539220.1"
                     /db_xref="GeneID:16997740"
                     /translation="MGTTSVQDQSTVTILCCLCGAPITANPSNMCVHCLRSQVDLTQG
                     FPKQCALVYCKFCGRYLVPPKTWVRADLESKELMTICLKRLKRLVKLHLVDAAFVWTE
                     PHSRRIRLRLTVQDEVLNRTILEQSFIVEFVVELQQCADCKREAAKIEAWEAVVQLRQ
                     RVDHKRTLFYLEQLILKHNAHEDVLGIRQQKDGLDFYFVHRSHALKFLSFLHNVACVR
                     QRQSNHLVSHDPSNNVYRYKYTFSAEIPPICREDLVYLPPRVATQLGGLSSLLLVHRI
                     TNQIRLLDPLTGFEHHIDGATYWRLGLTALMNARRLTAFVVLDVEPVERDPAATSCGH
                     LDQRFRLADATVARAADLGVNDQQFLVRTHLGNILKAGDLVLGYDLVSANLNESDLFE
                     SLQSDSLKATLPEIVLVKRGYPQRDRTKQRIWTLRELPKDDGDVGEHRHALREGARVT
                     GRQRDQRDVALERDREEFMQELEQDPELRATVNLYKDPTKFVEDGLGRLGIRYPGDRK
                     WTASERAQGQSRRNVQNANRFDGQRGMNAYAVLEADTDADQSDDYPSVSLDELLDGLD
                     ISDDADQGQDAVTS"
     gene            <502402..>504351
                     /locus_tag="CYME_CMT195C"
                     /db_xref="GeneID:16997741"
     mRNA            <502402..>504351
                     /locus_tag="CYME_CMT195C"
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily d"
                     /transcript_id="XM_005539164.1"
                     /db_xref="GeneID:16997741"
     CDS             502402..504351
                     /locus_tag="CYME_CMT195C"
                     /codon_start=1
                     /product="SWI/SNF related, matrix associated, actin
                     dependent regulator of chromatin, subfamily d"
                     /protein_id="XP_005539221.1"
                     /db_xref="GeneID:16997741"
                     /translation="MSAVHDKQLPDVGAPDRERCSEPATLSVSQPEVVSEKQSAGEKR
                     EHVVDVAMSAVNEARKLARIEFRRSLQRTLEELAEEVPIFGRLLAFERALDMRVARAL
                     QRRDERAAAALLLEAADRGDQLEQARLPGNAPAASNSGLAFPSVAQYPRRRCTFRLFV
                     YNTFEGQEPATGDGAEERTPSWVLRIHGHVLNGPQVAELAFTSVFERVVIAVDPDNHF
                     QQAETIEWRQSLVPGSQVLAGSRLESAFPNADAPSAGPEAAQAACNQGQPRPGQRTEA
                     QHPAAAAAAAAATAADDSIADGIELRRCGQQPVPVTILLYLRRYPPVYQLSPELVALL
                     GVEQDTLAGVLTTFWHYIRRQGLMHPERPGFVLLNEELRRIFGWSKHEPTSAHESHQE
                     NERSPNLPRPERTEEPIDDAFEGSVPMMPLHVIGERLREHLGPAPPLELHYTIQFDSP
                     VEHDCYDIEIEWPDALPMDVCTERTGAEIASSGHVSEKNATAKPLSAPGSAGLVGSER
                     PSEDTDKSGDQRAPLHFGRCSLYAGSIEIQKLQQQFEETLERIHAAYLRRDFYRSFAK
                     APAAFLRDLIVSQARDARLVRGQSGRTIEEERRSGLYYQQWLHEAIPRYLWRTLRSRE
                     HQHRQVQYAASEATKAASPSASPTT"
     gene            complement(<504356..>504943)
                     /locus_tag="CYME_CMT196C"
                     /db_xref="GeneID:16997721"
     mRNA            complement(<504356..>504943)
                     /locus_tag="CYME_CMT196C"
                     /product="small GTP-binding protein Sar1"
                     /transcript_id="XM_005539165.1"
                     /db_xref="GeneID:16997721"
     CDS             complement(504356..504943)
                     /locus_tag="CYME_CMT196C"
                     /codon_start=1
                     /product="small GTP-binding protein Sar1"
                     /protein_id="XP_005539222.1"
                     /db_xref="GeneID:16997721"
                     /translation="MFDWLWNLLSYLGLYYKNAKILFLGLDNAGKTTLMHVLKDDRLA
                     QHVPTQHATSEEVILGNVRFRAFDLGGHEVARQIWRNYYTNVDAIVYIVDANDRERFP
                     ESKAELDRLLADEQLSDVPFLILGNKIDIPYAASEEELRTALGLHHLTTGKAGAPRGM
                     NARGAKDVRPLEIFMCSVVRRMGYAEGFRWLASYL"
     gene            <507240..>507497
                     /locus_tag="CYME_CMT197C"
                     /db_xref="GeneID:16997722"
     mRNA            <507240..>507497
                     /locus_tag="CYME_CMT197C"
                     /product="40S ribosomal protein S27"
                     /transcript_id="XM_005539166.1"
                     /db_xref="GeneID:16997722"
     CDS             507240..507497
                     /locus_tag="CYME_CMT197C"
                     /codon_start=1
                     /product="40S ribosomal protein S27"
                     /protein_id="XP_005539223.1"
                     /db_xref="GeneID:16997722"
                     /translation="MTLLESDLLHPPKESEARKHKLKRLVQSPNSYFMDVKCQGCLAI
                     TTIFSHAQTVVVCGSCATVLCQPTGGKVRLSQGCSFRRKVD"
     gene            complement(<507572..>508135)
                     /locus_tag="CYME_CMT198C"
                     /db_xref="GeneID:16997723"
     mRNA            complement(<507572..>508135)
                     /locus_tag="CYME_CMT198C"
                     /product="NADH dehydrogenase I alpha subcomplex 5"
                     /transcript_id="XM_005539167.1"
                     /db_xref="GeneID:16997723"
     CDS             complement(507572..508135)
                     /locus_tag="CYME_CMT198C"
                     /codon_start=1
                     /product="NADH dehydrogenase I alpha subcomplex 5"
                     /protein_id="XP_005539224.1"
                     /db_xref="GeneID:16997723"
                     /translation="MRIFRAFPPWKTLKRSFAPLYWSELASARIPVLASETGAVASAL
                     LFRRTLCNDTGNGQTRDRARVYLSSGEIDWSQPHPVGYPAGLRPDPDATAKLRAAYRT
                     ILERVQTLAPESAYRRNIELLTRYRLEVTEAHLDDRKALEDKIGAGLVEELLATAYDE
                     LDLIECMAQWKPWEGQESRSIPLHVID"
     gene            complement(<510482..>511066)
                     /locus_tag="CYME_CMT199C"
                     /db_xref="GeneID:16997724"
     mRNA            complement(<510482..>511066)
                     /locus_tag="CYME_CMT199C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539168.1"
                     /db_xref="GeneID:16997724"
     CDS             complement(510482..511066)
                     /locus_tag="CYME_CMT199C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539225.1"
                     /db_xref="GeneID:16997724"
                     /translation="MTGRAFELLVVRRLKNLLGPTLSLSLTGGSYDGGIDALGTWCVQ
                     LQQSGTANVALRRLALAVQCKQLKRAVGPSVVREFEGAVRNWKRELEGHSVNKTGLAG
                     VLGLLCVQPRFTEAAIAVAGRNEVPLVLVVLERPPEQHPEHHEDREACIVEFRLNRAA
                     RYLLPHMTVSTKKIPCESPLGSPLFFEQISLCYE"
     misc_feature    511504..512441
                     /note="possible transcribed region"
     gene            complement(<512570..>513496)
                     /locus_tag="CYME_CMT201C"
                     /db_xref="GeneID:16997708"
     mRNA            complement(<512570..>513496)
                     /locus_tag="CYME_CMT201C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539169.1"
                     /db_xref="GeneID:16997708"
     CDS             complement(512570..513496)
                     /locus_tag="CYME_CMT201C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539226.1"
                     /db_xref="GeneID:16997708"
                     /translation="MLGGVGRVWGLLVRRARSSAAGVKEPGSADVVAGKLFALTTLPA
                     SHPHASRRLLPVNVKAVEAAKKRLPPGMLPQVIERPLTEREALWRQARLLDDSAQPDS
                     LRVGGLTDALTSNTRVVWRPPKVTARQRAYLRRQCLLRGVPWPFDIPRKKLGVVIHTE
                     SLAKSEPSSRTKTVSVATLEEIGAEMYLRYLRKGHKWERERAFRQALIAERMKEMDQL
                     IQQCRAERRALRLGKVIGGKKPKKHELIELVTRDIEERALAIPAGMKRRAELVRVLPS
                     RTMRLTKWPLNASTETSTRGNVSRSEREKRGS"
     gene            <513723..>514700
                     /locus_tag="CYME_CMT202C"
                     /db_xref="GeneID:16997709"
     mRNA            <513723..>514700
                     /locus_tag="CYME_CMT202C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539170.1"
                     /db_xref="GeneID:16997709"
     CDS             513723..514700
                     /locus_tag="CYME_CMT202C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539227.1"
                     /db_xref="GeneID:16997709"
                     /translation="MKRGPSMFVGAVFGPAPCRVGGRCSWSPRFSREAQEVQFPCSFS
                     SGVAKCSPNSSYYSKTAEKSALWRNDAQQRAFARCLADAEHRSIAPRVRRQARRPRLR
                     VLASPSEDLSLAPAALESVLSWCRRDARDALRAALAVTLPSLAPLSAKAATACPQTPE
                     LHQGQRQALSSGVVGSTQDSLDSERRFIAPLEKVFMQEPVPSQIELSIYLCTDAHIQL
                     LNKHYRSVDAPTDVLSFPQQQLRILGDVVISLDTAQRQAGGRLRDELRTLLLHGILHL
                     LGFDHEIDEQHHILFARAEERITQMLEWRGRGLIAMISERDDHESHDGP"
     gene            complement(<515886..>517652)
                     /locus_tag="CYME_CMT203C"
                     /db_xref="GeneID:16997710"
     mRNA            complement(<515886..>517652)
                     /locus_tag="CYME_CMT203C"
                     /product="similar to aspartyl protease"
                     /transcript_id="XM_005539171.1"
                     /db_xref="GeneID:16997710"
     CDS             complement(515886..517652)
                     /locus_tag="CYME_CMT203C"
                     /codon_start=1
                     /product="similar to aspartyl protease"
                     /protein_id="XP_005539228.1"
                     /db_xref="GeneID:16997710"
                     /translation="MHRASELRRRTIRTSAAWLGFVLTLFFLGALIGSIGAYRIKRVC
                     ALKRVQRRALTWDTIRGQSASTHAQHMHVRTLFQLRNSSYRVPISKSRPLALEPNGNA
                     ALHAQISPIELPLYGSLVHIGMYATTIEIDGSPYTLSVDTGSSSLAVITSVCDACPAG
                     KRRLQVDEDRTLHCGSRTAPLGDPPETFSCEPDQHGICDGRGHCIYQIRYGDGTAFNG
                     RYVAGMVGAAGRAAPMVFGGIESAQGRSPDVFGSGIEGMLGLAYPGLSCNPLCTLPFF
                     ETLLQHRLVPEDVFSLCVSDEQGRLVLGAMDSRMDPMEIRWTPIVHHLFYDIELEHVY
                     IDGHDAGIANRHSAFVDSGTTLIALSTGAFAAFRDYLRAHYCHIPYVCPDNAQEPSIL
                     DHAACASYSPEEVRQFPNLTFTLAGAGNLTLTPLQYFVRVDNPPEPTFYCMGIAEEPS
                     LGPSYGVEAILGLVWLRNFFTVYDRAHKRIGFQSARGCIPFTTTHPTGSGSTSDQDEP
                     RSSAPSGHRSETTLFGSIGIFIRKHANVLLFIMVPLLVTSVALWFGLWYYRKRRRLLQ
                     STGDTEANQAMVALRIEQDANG"
     gene            complement(<518505..>521387)
                     /locus_tag="CYME_CMT204C"
                     /db_xref="GeneID:16997711"
     mRNA            complement(<518505..>521387)
                     /locus_tag="CYME_CMT204C"
                     /product="4-alpha-glucanotransferase"
                     /transcript_id="XM_005539172.1"
                     /db_xref="GeneID:16997711"
     CDS             complement(518505..521387)
                     /locus_tag="CYME_CMT204C"
                     /codon_start=1
                     /product="4-alpha-glucanotransferase"
                     /protein_id="XP_005539229.1"
                     /db_xref="GeneID:16997711"
                     /translation="MPGLELHLHINYVTRGDAYLVAVGSHPLLGGGDVSRALPLHPIG
                     EGNWHASVCFDRDRDLVLEDASTPVSIDYKYVVVSGSGAADSQRMEATQAIRSVLVDE
                     TLFQQAGTGVVHLYCYDSWRVAQSSVFATSAFVDVIFRKLNVPKTTSWLQLDTAAAAR
                     MRWAHQEPTSTQAVIRVRFVSYVPRLEAGHQVFVTGSPEALGAWNPMKQIPMFPIGSC
                     LYASMVSIPVAAIPFEYRYVIAKDQEPPNLICAEQGSNRTLRIPQRCPETRFIHVDDV
                     FRYATVWKGAGVAIPLISLRSRHSAGAGDFGDLKLFIDWVAAASLKLVQLLPIHDTGE
                     EPSPYSALSVHAIHPIYMNLKWLLDAMTTISPANRAKLQQELVKDGERLNANYEVAYP
                     EVLEMKLRFLEMVYESSGGSACLQNPDFDVWFKENTSWLTSYALYKVLREKHAPAGGM
                     KRLPSDKWPERGNDQSLVAALTSPSSPAYDRVQLIYFIQYHLHLQLKSVSDYAKMRGV
                     ILKGDLPIGVTRDSADTWQHPEYFRMDRSIGAPALDMSSAQNWDFPVYRWDEMERDGY
                     RWWRQRLQHMSQYFQAFRIDHVLGLFRAWSIPCHNYSGLLGRFEPSSPIHRHEIRSIL
                     SEYYRLCTPHLRRWLIDERFGAESQRIVDTFFDVHEGGHVLTFKKHLATDDAIARYLL
                     IAGEDRTAWHALPAAEQQARLRTFRVLQSLIANQCLIHDDGAGPDAFFPTCHMKSTPS
                     YQRFANKELLDQVWEQYFFRRQNWRACGLRNLRALQSSANMMICAEDLGMVPPEVYAV
                     LEELGILGLRIQRWPGIGKFGAPAAYTYLTVASTSCHDCSTVRAWWQEDRGRAHEMFW
                     SFFGEQGGSPPWDCTEWMSQKIVEQHLGAGSMWTILPLQDYTDCWRSLRSADPRKDQI
                     NYPGRSYEEGSWRWRMPYFIETLLEARDFTQWIADCVHRCRRNCTY"
     gene            <521679..>522701
                     /locus_tag="CYME_CMT205C"
                     /db_xref="GeneID:16997725"
     mRNA            <521679..>522701
                     /locus_tag="CYME_CMT205C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539173.1"
                     /db_xref="GeneID:16997725"
     CDS             521679..522701
                     /locus_tag="CYME_CMT205C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539230.1"
                     /db_xref="GeneID:16997725"
                     /translation="MQQTSGTTAAVRALGANGGSSTDAVDTTETLERKCVVCQSTEEV
                     RVFSANCERLCVPCFVERFERSFRYAVQRWSMLSHGERVAVALSGGPASLALLELLHG
                     LRRGFAHHKGKIRPKHFEIVVFHVIVPAGYGGNGASGAAALQALVQERYGLTVHTVDE
                     ALFLARADALEMSTRDPMATNHQLDVLDPTIAPALVAGIVNALLERMAEAYECKKLFL
                     GTTVTRAAIITIARVATGNPLRLDAEIGVDYHSSTAGCQGSAYASSGPLRWLRPLRNI
                     SLRDVIRYLRARGCTAWITPAEPWAQENIESTAERFIWRALETRPATSFSVVHSIERA
                     LNLSAD"
     gene            complement(<523064..>523414)
                     /locus_tag="CYME_CMT206C"
                     /db_xref="GeneID:16997726"
     mRNA            complement(<523064..>523414)
                     /locus_tag="CYME_CMT206C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539174.1"
                     /db_xref="GeneID:16997726"
     CDS             complement(523064..523414)
                     /locus_tag="CYME_CMT206C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539231.1"
                     /db_xref="GeneID:16997726"
                     /translation="MLCYRGTCVPNHGFYHGEATVTASIGKLLSLGSLVLATCKLGQN
                     CLRRYPRASERPARVMRLTGPFCEMFLERPRTNGCIIPGGKRLEGANSSMRSGSSLGV
                     LSATGPACNTGSIR"
     gene            <524129..>525850
                     /locus_tag="CYME_CMT207C"
                     /db_xref="GeneID:16997727"
     mRNA            <524129..>525850
                     /locus_tag="CYME_CMT207C"
                     /product="chaperonin containing TCP1, subunit 1"
                     /transcript_id="XM_005539175.1"
                     /db_xref="GeneID:16997727"
     CDS             524129..525850
                     /locus_tag="CYME_CMT207C"
                     /codon_start=1
                     /product="chaperonin containing TCP1, subunit 1"
                     /protein_id="XP_005539232.1"
                     /db_xref="GeneID:16997727"
                     /translation="MSTLVLDGQRTSGRDVRTQNVNACQAVANVIKSSLGPVGLDKML
                     VSEIGDVTVTNDGATILSLLEVKHPAAKVLVDLAKQQDEEVGDGTTTVVVLAAELLKR
                     GNELVKAGVHPTSIIAGYKLAVREACRYIRDRLAVPVDRLGRECLVNAAKTSLQSKVL
                     GGEVIEHFAGLAVDAVMAVKTRRDDGANAHRYPIQSINILKSHGRGVRESTLLGGYGL
                     NLTRASRLMPERVTNARIACLDVDLRRAKLQMGIQIQSVDPAEIEKMQQKELDITRDR
                     INMILKAGANVILTTKGIDDAALKYISDAGALAIRRVAPADLKRIAKCTGATIQTAFA
                     DLTGEESFDTSALGQAQEVVEEVVADSAFTFIRGCRDFKAATILLRGPNEFMLDEMER
                     SIHDALSAVRRTLESNMVVAGGGATEAAVSTFLESFAAALGSKEQLAVAEFSDALLVI
                     PKTLAVNAALDATDLVAKLRAAHFAAFASNEGTPAINDTASRDNAPVANGVPSTDAIQ
                     RNELKFCGLDLIKGRVRNSFTAGVLEPAMSKIKSLQFATEAAITILRIDDSIKITEAT
                     EPEEPSY"
     gene            complement(<526970..>527293)
                     /locus_tag="CYME_CMT208C"
                     /db_xref="GeneID:16997728"
     mRNA            complement(<526970..>527293)
                     /locus_tag="CYME_CMT208C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539176.1"
                     /db_xref="GeneID:16997728"
     CDS             complement(526970..527293)
                     /locus_tag="CYME_CMT208C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539233.1"
                     /db_xref="GeneID:16997728"
                     /translation="MRNVPCFRKATQQTSRILHNLRRIHLDQGTLRPPKQPPPLGSQV
                     FRPPRPPAPEDEQPDSTETLPEAEELVDLCNPEAQAGPEYGGPRGYEPTRYGDWAKNG
                     RVSDF"
     gene            <527617..>529002
                     /locus_tag="CYME_CMT209C"
                     /db_xref="GeneID:16997671"
     mRNA            <527617..>529002
                     /locus_tag="CYME_CMT209C"
                     /product="succinate--CoA ligase, mitochondrial precursor"
                     /transcript_id="XM_005539177.1"
                     /db_xref="GeneID:16997671"
     CDS             527617..529002
                     /locus_tag="CYME_CMT209C"
                     /codon_start=1
                     /product="succinate--CoA ligase, mitochondrial precursor"
                     /protein_id="XP_005539234.1"
                     /db_xref="GeneID:16997671"
                     /translation="MRRLLRGPLVAELASQVSKLGSRNQHTCKQFQQVRFLNIHEYQS
                     QALLRSYGVPVPAGEMAASVSETVAAARRLLQSPRDDVVLKAQVLAGGRGLGVFQPSG
                     FRGGVHIASTVDEVQQLAGKMLGQQLVTKQTGAKGRPCQKLLVAKRVYARREMYLALL
                     YDRKVQGPLAIASRRGGTSIEDIARDTPESIQSIPLPLPKRGETMDTATAARIAESLG
                     LSRQRSERLHEDGVALIQNLYRLFLEKDCTMVEVNPLTETPDGEIHCVDAKINFDDNA
                     AFRQRDIFALRDTTQEDSREVDASRFGLNYIGLDGNIGCMVNGAGLAMATMDIIKLYG
                     GNPANFLDVGGGATVEQVGEAFRILNQDAHVDSILINIFGGIMRCDVLAQGIVDAAKR
                     AQVRVPLIVRLEGNKVAEAKEIMRQSTVRIIPADNLDEAAQRAVKIADIVGRARDAGV
                     QVEFRTLSSGA"
     gene            complement(<530264..>531814)
                     /locus_tag="CYME_CMT210C"
                     /db_xref="GeneID:16997672"
     mRNA            complement(<530264..>531814)
                     /locus_tag="CYME_CMT210C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539178.1"
                     /db_xref="GeneID:16997672"
     CDS             complement(530264..531814)
                     /locus_tag="CYME_CMT210C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539235.1"
                     /db_xref="GeneID:16997672"
                     /translation="MHFEVLSADNSTPGARLGVLSRSSGAATDGTGTPETSSIVTPTW
                     VLPTVRGSTPGIANTLLERYCLRVAGAGAHATCGRVPVSTGSNEAAQEYDDHSQSSFC
                     VGVSALDFWNYKGTEEPDGAKFLELNAEKDARHLCSWQAFPGPLVLSMRSALALFDML
                     EKDGHPQVVQFQNRSTRKRLPANEAHRIVAEGLFGDTRGSRMPVTPERILDLQQAMRC
                     DLYETLYEVSSWPQPDSSDPADRDRRDLLEATGYALDAGANAHPRIGTVDTLPAERTK
                     QWGTHTLRCAAIRNTPGHALLSVPISRSEEFDRGTSRWALELANAYRDRVAGFNLVGL
                     GNGGAPMLDVLRQCLKMVQHLRSATSKNLPVFCTGGSAWLVDGSPAIVLGLVSSGVDV
                     LESRYPFVMAECCYALDLFHESQAADSEASDPLLYTSVRDPRWAHDARPILQTCRSAA
                     SARRCTIGRTYTRAYWYHLFQVNEMLGPMLLSLHNIQQYLAFFDEIQDAIRAHTFASL
                     CERFQVPV"
     gene            <532505..>533230
                     /locus_tag="CYME_CMT211C"
                     /db_xref="GeneID:16997673"
     mRNA            <532505..>533230
                     /locus_tag="CYME_CMT211C"
                     /product="similar to U3 snoRNP component Utp11p"
                     /transcript_id="XM_005539179.1"
                     /db_xref="GeneID:16997673"
     CDS             532505..533230
                     /locus_tag="CYME_CMT211C"
                     /codon_start=1
                     /product="similar to U3 snoRNP component Utp11p"
                     /protein_id="XP_005539236.1"
                     /db_xref="GeneID:16997673"
                     /translation="MSLESAFRKASPRRTHRERAQPRGRAKLGLLEKHRDYVERARAY
                     HSKQQRLKALQQRAEFRNPDEFYFKMLRLPSRDGRISVPHPSKFRGADATEDRRMRRL
                     DAQTLHAKLAHEQAEYDRLAAEFPLAAAEVRVSASTRNAAGARASHTRFHPMTCVPLT
                     EHGDRGRAFGTGRDPSAGDAALRAQVVEDLGRRAQRIERLRTLTHQVWIECQIRGKGA
                     KKKIRDYTGKRAAVYRWQPERKR"
     gene            complement(<533509..>534153)
                     /locus_tag="CYME_CMT639C"
                     /db_xref="GeneID:16997674"
     mRNA            complement(<533509..>534153)
                     /locus_tag="CYME_CMT639C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539180.1"
                     /db_xref="GeneID:16997674"
     CDS             complement(533509..534153)
                     /locus_tag="CYME_CMT639C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539237.1"
                     /db_xref="GeneID:16997674"
                     /translation="MLQHPSRNVRHFGSIRGVCATAMSPNMRAIGNRGKKSLVARRGT
                     SSTKTTEETRAPSSATAAPVVDFDALPIGEKLLFVAVETFTQGVASGVMGGLAGLVYG
                     AFSRRTLEGARSEGRKFLMTWGLFGGVYSLGLGLSRTVRQRQDKYNAVIAACASGAVF
                     GREQGVQGMLAGCAQFAGFTYLIETFIVGSQSPRPERDNEIGSPKIEIPVGKRR"
     misc_feature    534264..534817
                     /note="possible transcribed region"
     gene            <538395..>541124
                     /locus_tag="CYME_CMT213C"
                     /db_xref="GeneID:16997763"
     mRNA            <538395..>541124
                     /locus_tag="CYME_CMT213C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539181.1"
                     /db_xref="GeneID:16997763"
     CDS             538395..541124
                     /locus_tag="CYME_CMT213C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539238.1"
                     /db_xref="GeneID:16997763"
                     /translation="MVPNQAPALHWPPRTIDASAPSSFVFETNPAGVSSVSDLFTSDH
                     DVPFPDGSGFLFPKTLHSASTEKILEPLTQLHPTGQRMPNEVPLRSASADGGVFPGNE
                     LFIAATDGRELPSVPGRRRLESEVDELAQLIKLSNEEHRSVQQLLQAEPFMGSTCALA
                     EADDTTADDHAGFLIKNHGSDSTSDLSALLLTPARGTRAPTMASPGTPSPQSPRKSHA
                     LASPAAKEQVTASPQAFAPSQGYLGTSAAARVRSNQRPDASRTSAARSVEGQHRVEPQ
                     NESTAKARPRKSQTETRFVHPEVHLPNSGLTTPPESPGASPSQVPGVRAASGKNALTL
                     PAESVPSKRSESPSSEQKSPSPKSDGAGTNGAAASVDEYTLRKRETHNLHTRVSRKKV
                     SQCFERLVTVLTADCAVEESEFIICNELDGACIPEQSMICACCGLDGCMRQDCRQCKA
                     PTNTSTTNTNNQHAAPASGVDTPPSVAAGDVSADNADPKALLTAPGTCCGWRDRFMPR
                     RERARALRARLRHRAETLQYATQTIVLLRRQRRSLELLLLHESESFRRLWVQHLVEQV
                     QGGQQKPQDEQVVITECCKSVVRAVLEQFHWPFGELWMLGLPPPSTDTDNDNEKEACA
                     EQPCVREGTASASQRRQCSWDTLQHQATLIVPPPAEETGYLDPYWMLALRPDKAQATD
                     PPLPDLLERPSAVSEARLGTERDPAAPPVRGDCPADSPSTLLSSSGVSSCNAADDPQP
                     MATSSSRCAGGCSESLTKREPNPELDQSAALLTDLECFATESKQVLAHPSTTDIQNLV
                     LRDQRAIGARLRAGAFVEFDPRSGSERTSIAFERAPLARRHNLRCLVAIPLLTPVHSA
                     PDKRPRLSSASESSTSIRGVAVLGHVEADAAVQPLLQTLESLWQHLMATLARD"
     gene            complement(<541513..>543546)
                     /locus_tag="CYME_CMT214C"
                     /db_xref="GeneID:16997764"
     mRNA            complement(<541513..>543546)
                     /locus_tag="CYME_CMT214C"
                     /product="RNA cytosine methyltransferase"
                     /transcript_id="XM_005539182.1"
                     /db_xref="GeneID:16997764"
     CDS             complement(541513..543546)
                     /locus_tag="CYME_CMT214C"
                     /codon_start=1
                     /product="RNA cytosine methyltransferase"
                     /protein_id="XP_005539239.1"
                     /db_xref="GeneID:16997764"
                     /translation="MVRRLSTGVKRTAGRRGASGVQSASALRLGQKQKRHEIKQVSQV
                     PSGADRKLRAPSRSKPDEKLRDASREQLPAHTAKRKAAASETAHPNQTDSDSEDMSIF
                     QRKPQNDDRLAFNQEGSFDASTVAPEPFHASTDSEDVERYAFPVTHLSDATDDGVSTS
                     EDEDEYLARHMRQYAATQPLAVADAATDAASKASPQEPEHDLDANDAAAWTSGAAPAA
                     MRPGHLEELKQAIQNRVQELSEPAPQRKGARSRSELVTELLEMICAAYDYLPSLAQRF
                     AELFPPTELLAFIEANESPRPLVIRTNTLKVRRQRLAMALIARGMNVDPVGSWSPVGL
                     TVYQSEVPVGATPEYLAGYYMIQAAASFLPVMALAPREHERILDMAAAPGGKATYIAQ
                     LMKGTGLLFANDVNRERCKALVANLQRLGVPNAVVMSLDGRTLSKSANGSPSEHGGFR
                     HFFDRVLLDAPCTGTGVIAHDASIKHTRDEASIRRCVYLQKQLLLAAVDACNPRSETG
                     AVVVYSTCSILVDENEEVVDYVLRKLGSRVKVVSTGIPFGLPGFIRFREKRFHPSLAE
                     ARRYYPHVHNMDGFFVCKLRVLPESNTTTKASTSRTVEESSPETASKRQRQGRRTGAG
                     SSSEHVAEPAPKPADFTASSPRLDSVEADEPVLIRLEPGRTRRLVRRRSSAAS"
     gene            <544200..>545729
                     /locus_tag="CYME_CMT215C"
                     /db_xref="GeneID:16997765"
     mRNA            <544200..>545729
                     /locus_tag="CYME_CMT215C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539183.1"
                     /db_xref="GeneID:16997765"
     CDS             544200..545729
                     /locus_tag="CYME_CMT215C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539240.1"
                     /db_xref="GeneID:16997765"
                     /translation="MITTLFWVPRGTAAAAASVPLETASEPDDAASHSSEDCSDGERT
                     SDAAEVGLEQVLTLPDDFWETSDPNLHKHKLDWEQQDIEDERFQQEDWVLFAGRLYED
                     DSCGFEVCVVERPDVECCAKPLSWEAIDTNIYVHHDGILAAPPLSSAYTDYDGRCLAA
                     VGTFAPTVELWDLVQMNAVEPLMILDTVAAAQTSPSLGHNAAVKQRTRNAQHRLTRDL
                     QRKRKRPSGDRSQGGSTAASASGVLCLGFHPRERWMLAAGSATGHIHFWDIRDGACVV
                     TLPDLHRDKPQALAWHPLQHSLLLTAGFDRRACLVDLRAHSLHSAASGEIQLTRDPEQ
                     VLWRSENQCLLSDEGGSISAFDIRRIGKTETALLWSFQACRDRPALMTLAPTVPDMLV
                     VGSTDGHLRVYDLSMLEHCGGVSATEASKAPQWTPLAQVNAHAGALFAVESCPDEVFG
                     FGVACGGSKGILTVVDVAESAPQVLQHFRGRASRSAAEVGARLACIDSLEESGSLDVD
                     K"
     gene            complement(<548334..>549812)
                     /locus_tag="CYME_CMT216C"
                     /db_xref="GeneID:16997766"
     mRNA            complement(<548334..>549812)
                     /locus_tag="CYME_CMT216C"
                     /product="isocitrate dehydrogenase, cytosolic"
                     /transcript_id="XM_005539184.1"
                     /db_xref="GeneID:16997766"
     CDS             complement(548334..549812)
                     /locus_tag="CYME_CMT216C"
                     /codon_start=1
                     /product="isocitrate dehydrogenase, cytosolic"
                     /protein_id="XP_005539241.1"
                     /db_xref="GeneID:16997766"
                     /translation="MLVLRKACCALSSAFLSHGGSWKRTGFAPCRSLGNCCCNRRRGH
                     CFPKFLRRTTGRSLCANMSNVPAFSKIRVRNPIVELDGDEQARVIWHLIKNKLILPYL
                     NLDIVYFDLGLPVRDATDDGVTLEAARAVQQHHAAVKAATITPDEARVEEFHLKRMYP
                     SPNGTLRNVLNGTVFREPILVENIPRLVPGWKQPIVIARHGFGDQYKAQDLRVPPACR
                     VELRVLDAQGMELERRQVHQFASSTDGGGVALGMFNTDESIRNFARSCFEFALRRKLP
                     MYLSTKNTILKVYDGRWRDIFQELYERDYRERFTRAALWYEHRLIDDMVAQALKSSGG
                     FLWACKNYDGDVQSDIIAQGYGSLGLMSSVLLTPDGKTLLAEAAHGTVTRHFRLHQQG
                     KETSTNSVASIVAWARGLAHRATLDGTPDVAHFAEALERSCIETILDGKMTKDLSIAV
                     YGTEQGSKRENYLNTEEFIDAVQQRLDVHMLQEHAAAPQQRI"
     gene            <551505..>552602
                     /locus_tag="CYME_CMT217C"
                     /db_xref="GeneID:16997790"
     mRNA            <551505..>552602
                     /locus_tag="CYME_CMT217C"
                     /product="Rab geranylgeranyltransferase, beta subunit"
                     /transcript_id="XM_005539185.1"
                     /db_xref="GeneID:16997790"
     CDS             551505..552602
                     /locus_tag="CYME_CMT217C"
                     /codon_start=1
                     /product="Rab geranylgeranyltransferase, beta subunit"
                     /protein_id="XP_005539242.1"
                     /db_xref="GeneID:16997790"
                     /translation="MTSPALPLQLPRSEHIAFLGQYVNRDVRALPSTFELWVTEHKKL
                     SAAYWTVVALALLDALDLVPRERLRDWVLECRDPCGGFGGDVGQDPHLLYTLSAVQIL
                     FLLGEEARLDRSSIIAYVASLQQPDGSFAGDTWGEIDTRFCFCAALTLAILGVPLQQR
                     EHSRNSPEKTNEIERPIRTDALVDYIMRCENDDGGFGVIPGAESHAGQVFCCVGTLAL
                     CGALYRLRDGGNRLARWLAYRQLRNGGFNGRPDKLPDVCYSWWVLASLKIIAKDHWIS
                     ADALERFIFSCHAQRESQNTYAGGIADRPGDEPDVFHTFFGLAGLSLLERQQLIAIDP
                     VYALPCALVKRIHAANPKAELVDTTEGVSQV"
     gene            complement(<553568..>554524)
                     /locus_tag="CYME_CMT218C"
                     /db_xref="GeneID:16997791"
     mRNA            complement(<553568..>554524)
                     /locus_tag="CYME_CMT218C"
                     /product="temperature sensitive supressor Bem46"
                     /transcript_id="XM_005539186.1"
                     /db_xref="GeneID:16997791"
     CDS             complement(553568..554524)
                     /locus_tag="CYME_CMT218C"
                     /codon_start=1
                     /product="temperature sensitive supressor Bem46"
                     /protein_id="XP_005539243.1"
                     /db_xref="GeneID:16997791"
                     /translation="MAAIVPILGVALGAVGLLGGALYLKQEKLLYLPQIPSRHYDAYP
                     DQFEGLAYEDVALRAVDGTRIHAWLVFPVRSETGQRPRVTIIYFHGNAGNLSHRLQDV
                     RNLIATCQCNVLMVSYRGYGESSGTPSEQGFKLDASAAMEFCLNAGKHAAADDSGTST
                     AAGRVPSARLIESDLLYVFGRSIGGAVALWLGRKYGSKLRGVIVENTFTCIGDMIDVV
                     FPRGLRWLKRLNRNPWNSLALVGKIRSPILFISGRQDELVPPSHMDALYNAARAGSCM
                     LARMVYIPDGTHNDTWYRGGERYYQAIADFIQETRGLRSLTD"
     misc_feature    complement(554807..556337)
                     /note="possible transcribed region"
     gene            <556516..>557727
                     /locus_tag="CYME_CMT220C"
                     /db_xref="GeneID:16997793"
     mRNA            <556516..>557727
                     /locus_tag="CYME_CMT220C"
                     /product="chlorophyll a synthase"
                     /transcript_id="XM_005539187.1"
                     /db_xref="GeneID:16997793"
     CDS             556516..557727
                     /locus_tag="CYME_CMT220C"
                     /codon_start=1
                     /product="chlorophyll a synthase"
                     /protein_id="XP_005539244.1"
                     /db_xref="GeneID:16997793"
                     /translation="MVTPGFISSTVGARGMSSRSCKALALSRIPVLVTWRRTRLNAAK
                     HRGGLRLSQKADDQASPSESKQKSEQSGALDGKQQTTGVNDSEQSLRQLLGMRGASKE
                     TNKWRIRLQLMKPITWIPLVWGVGCGAAASGQYQWNDPQDIAKLLLCMILSGPVLAGF
                     TQTLNDWFDREIDAVNEPYRPIPSGAISEGEVVAQIWALLFAGLGLAYGLDLWQGHQF
                     PRVLAVALFGTFLAYIYSAPPLKLKKNGWLGNYALGASYISLPWWAGQSLFSDNPLDW
                     KIIALTLLYSFAGLGIAVINDFKSIEGDRRLGLASLPVMYGVDTAKWLSVGLIDIFQA
                     LVAAYLALVGETGYALALVAMILPQVYLQWKIFLPDPMQNDVKYQGAAQPFLVFGILI
                     TALAIGHHGQL"
     misc_feature    complement(557604..560061)
                     /note="possible transcribed region"
     gene            <559301..>561580
                     /locus_tag="CYME_CMT222C"
                     /db_xref="GeneID:16997738"
     mRNA            join(<559301..560389,560819..>561580)
                     /locus_tag="CYME_CMT222C"
                     /product="unknown ring-finger protein"
                     /transcript_id="XM_005539188.1"
                     /db_xref="GeneID:16997738"
     CDS             join(559301..560389,560819..561580)
                     /locus_tag="CYME_CMT222C"
                     /codon_start=1
                     /product="unknown ring-finger protein"
                     /protein_id="XP_005539245.1"
                     /db_xref="GeneID:16997738"
                     /translation="MAKRPRPSASQEDLQERDEAIDGKLLRYQIAQLGASLQARQEEL
                     QRLQSRVETLERELAEHDVAQKPELRPEWEPLVQAAVAARKVERLEQDLEDARQQLTQ
                     QRRLLVRLECGVSVTGTSTATDQAPVPKPDSSPASEQSSAPERNDTLAGTAAAEAPSS
                     TSAGPQQVDTKQVSVLQSQVNELETRISLLAEELAQERELARAVREQLESSAREKAEL
                     ASALQVAQEQAQNPEPEVIRASATYKSMEAHLLILLRAEQKWSQDREALVRERDELLI
                     RANQEQTVEKRELLSEIEKLKAKINEKNTETEWLKENVAKLQMMYEEKKKVAVDPVVL
                     DETSRAVRQLQERNADLSTKLQSIRTAEAIETLSSSLTKAEASIAQLTERLIEKEATL
                     GKVLAERLKYIQQQLTLKEQLKVEANRAEKEHELSQQISHALTAARNQVSELQSQLEK
                     MSSEMRIVRKQADIARLGAEKSAAEAYTQRQFAESAQSQVRRLSGELAQLRGQIEQQT
                     EALRAADEAKTRSERRVSRLEHELELLRKRNAATSASDVDWQHEMIEDMRRKLYCTVC
                     KAQEKQVTLLRCFHMFCRDCIQTNIANRNRKCPLCGEKFGTDDVKPIFFV"
     gene            complement(<562116..>563603)
                     /locus_tag="CYME_CMT223C"
                     /db_xref="GeneID:16997768"
     mRNA            complement(<562116..>563603)
                     /locus_tag="CYME_CMT223C"
                     /product="similar to translation initiation factor IF-3"
                     /transcript_id="XM_005539189.1"
                     /db_xref="GeneID:16997768"
     CDS             complement(562116..563603)
                     /locus_tag="CYME_CMT223C"
                     /codon_start=1
                     /product="similar to translation initiation factor IF-3"
                     /protein_id="XP_005539246.1"
                     /db_xref="GeneID:16997768"
                     /translation="MRTRHSGDWCSVWLRGLASAHAQHGLAQEGCPASTATLVRTPLL
                     TYESWRKRCRWDRFCQHLGFIRAFGPVAETSTRVATATAYSRAHAVPACKASTASSVL
                     HMRRITSFSSPPAPHSSRRRRREQTASRGVQTSAPEQRCRLDPLLMPESARVLHRLSC
                     WIRRSVTRWNDNHGYMPRRDAFGMRFSHETLSRTSTQSRRLPGAAADTGYTRVLGHVQ
                     SALYGVTATAAKYSKASCASLVAVEVASTARRSFVVAAASQVKPRMVEKARLRVNDEI
                     PSTMQCLLVDTNGEALGTFSVADALQKASSRGLDLVEVAPKARPLPVCRLVTSARDVL
                     STRSAKAKRNMVKAARKTRQQVTKEIRLSPVTQSHDFALKMRRAREFLMRGLRVRVYI
                     LFRRGHGRKQQEAETLLVQARDALADIGQIQPGSFFESGVETEPETQPGALGSSAPGI
                     ADASPSAPVTRRTLDFVMHPLSRSQQQQQQQQQQQEQRQSEAERG"
     gene            <564045..>565559
                     /locus_tag="CYME_CMT224C"
                     /db_xref="GeneID:16997769"
     mRNA            <564045..>565559
                     /locus_tag="CYME_CMT224C"
                     /product="probable ubiquitin-specific protease"
                     /transcript_id="XM_005539190.1"
                     /db_xref="GeneID:16997769"
     CDS             564045..565559
                     /locus_tag="CYME_CMT224C"
                     /codon_start=1
                     /product="probable ubiquitin-specific protease"
                     /protein_id="XP_005539247.1"
                     /db_xref="GeneID:16997769"
                     /translation="MVIVQIKWNKQVFPTEVSEDETARSLMERLQKLTGVPSERLTLL
                     GLKRGAVRVHTAGTLAALGLQDGCTVMLLGTPVSAGAAAVSQAVANSPLSPEKAGAGV
                     TGTTASGASATPPLKHVRRGLANLGNSCYANATIQCLLQVPELRDYLRSRVQSSASLA
                     PAVTTADAEHRVVMALAALAETLSSPNAVQGSSDNPERFYPQVVMAALRSAYPQFAQR
                     DNHGMYMQQDAEECLSQILGALARMEPPTTGTNWVDATFGTLIASTDRCDEPNEVSTA
                     CTPVVSHECLRLLPCHISKQVNHLSEGIREGLEGSIERYVDSLGRTLNWKRESRIERL
                     PPYLIVHFVRFFWKPVEKVKAKVLRKVVFPLILDTLPFCTDSLQDALRAARTPTATTE
                     ADAEGALQDAQVGGSSSSSSSSSGKPDTPSGLYELFAVLTHQGRTADSGHYVAWVRDP
                     EQPLDRSVWLKYDDDRVETVTEDQILRLCGGGDWHMAYICFYRMRPGPGTNEKR"
     misc_feature    complement(565501..567496)
                     /note="possible transcribed region"
     gene            <567491..>569092
                     /locus_tag="CYME_CMT227C"
                     /db_xref="GeneID:16997807"
     mRNA            <567491..>569092
                     /locus_tag="CYME_CMT227C"
                     /product="carboxyl-terminal processing protease"
                     /transcript_id="XM_005539191.1"
                     /db_xref="GeneID:16997807"
     CDS             567491..569092
                     /locus_tag="CYME_CMT227C"
                     /codon_start=1
                     /product="carboxyl-terminal processing protease"
                     /protein_id="XP_005539248.1"
                     /db_xref="GeneID:16997807"
                     /translation="MSRKQSLRLGSLCFTSVPSDLGCVRRHLQCAQRSWSQPATQHKA
                     RFCTLLRSSAVDRRVQRKQDCSVLGEPSGNACSNSTPSAASAHLARLLVHFSKRTGAS
                     MLGILGALLFSTTATLESDTRVQLPPSHQLMIAGPVQALTDEQFIVAEAWHLVDRKFV
                     DHAQIQNDWNKLRLKYLRRSYRSMDDAHQAIRDMLRTLGDPYTRFLSPAEYNSLLAAA
                     RGELVGIGIELAPPRIDNSEDKQHATGTSKEAAPPGRVSVAAVLDASPAALAGIRPDD
                     EILLVDGEETGGLSPDEVAARIRGEADSFVRLRIHRRGEREPRDLVIKRTPLRLDALL
                     ARGPDPEGVAYIRIRQFNENTAEELRAAVERMAANRSAPLQLVVDLRSNPGGYFPDGV
                     DAARLFLPKDRTVVYTVDAKDRVKELRAQEDGPLLRMVQSPVWVLIDRGTASASEIFA
                     VALHDNGEAKLIGSCSFGKGVIQTVQGLRDGSAVAITTARYETPKHENINKRGVCPDI
                     VATCKAPPLNSETASIRDALACLPR"
     misc_feature    complement(568000..568427)
                     /note="possible transcribed region"
     gene            complement(<569515..>572508)
                     /locus_tag="CYME_CMT228C"
                     /db_xref="GeneID:16997808"
     mRNA            complement(<569515..>572508)
                     /locus_tag="CYME_CMT228C"
                     /product="similar to acylaminoacyl-peptidase"
                     /transcript_id="XM_005539192.1"
                     /db_xref="GeneID:16997808"
     CDS             complement(569515..572508)
                     /locus_tag="CYME_CMT228C"
                     /codon_start=1
                     /product="similar to acylaminoacyl-peptidase"
                     /protein_id="XP_005539249.1"
                     /db_xref="GeneID:16997808"
                     /translation="MAGEDPNTLEEEELAAKIFENFTRETSTPVSAALSTSWFWTRAP
                     PPSLETADTASQPRDAALQAPPKSPQTPCLLVTVEIERQQREPRIGHQYRYTHWEQFL
                     IRANQPPSIPVSGSKRNAAMPLLQIERITPPAAAAQETQHVLKFDSDEVAYRLLFFRD
                     KDKDTSANTSKSSPHAARIEVWQRQQLANGNPSAPHLVRCIPTDRVHGDVYSDALFGG
                     CAYSATQMAFFYVAEQLQPTHPNPALSDQPHINSLTTKTSPEQNTPWPSYSAFRHIDD
                     YGEQFVGKRAPRLYTLEALLHAAADQPATWRVRALRITGAAPAIADADAADPQCRGDV
                     LVWIARQRRTDVPRGHVYCTNRPSVIVVALLERRPIEESESDADGSALVAHVQVVIGA
                     DADAPWYYSRTCPRLHSDALLVWAEAPCDAPHCTAHWIIEAPLLLIDEPKRTLRLGPC
                     RRFLAPNGETWPRFGEWPGGFYPLNPARVLLEGADGCFGSEWIVLNAVVGSRARPVLL
                     DRRTGALAFIGESEHACYQRMDQVLAVKRSWLPEPPTDGEAQPQPHPQRLALDIVVGT
                     SMTLLTAPTIELAARLIKEDAADSGTTRTVQCVSEWCFAPSDQCHRMQWCNTEASLGT
                     VTLGYGAANQAYRIGIASLALSAGGWLSSVSTNPPDRFEAIVVAPNRGALLDAHGRVP
                     LVLVLHGGPHACYLANVWNPGVAVLARLGCVLLLPNYRGSLGQGEARLRSLLGKIGEQ
                     DVQECVLSMECALENADFWRWFRGEHQPLGDGGRSDNENDGSGTSSGRWYPQWSAIDR
                     RRVGVVGGSHGGFLGAHLSAVRPSVVRAVVLRNPVVDIATMVSQTDIADWCYHECGIE
                     IGLERGVERSTSDSNDGIGDASASSTPGNIHRVPQLAELERMRLCSPISHADRVRAAT
                     LLQIGGQDQRVPCSQGFQWARAIRTQAEALRVLFYPRSNHAIEDSPSFDDAWIQCLAW
                     LLKFLPASNADDADDHVRGSASRPA"
     misc_feature    complement(572648..574464)
                     /note="repetitive element"
     gene            <575841..>577403
                     /locus_tag="CYME_CMT231C"
                     /db_xref="GeneID:16997810"
     mRNA            <575841..>577403
                     /locus_tag="CYME_CMT231C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539193.1"
                     /db_xref="GeneID:16997810"
     CDS             575841..577403
                     /locus_tag="CYME_CMT231C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539250.1"
                     /db_xref="GeneID:16997810"
                     /translation="MVSNLLPVPAPSQAHAPSMHLTLMERFWRVCFLVRCFFNSVRER
                     GLYTTSRVRLSLWLNTESKRKRFARGLGLFCAIFAIILTLTSLRIDEDLRRYQTSAHM
                     DYHYRARIARLNKALVRRWWIRAGNASYERTRKNVPPLANSLDLQVNGNIMRDVDDPF
                     VYCSKAPLYLDIAEATRRAVVAAAYPAPAISIIFVTKRPGGYDMLLNSLAQQSRKSPL
                     DYELICVDELAPFRAELVRAQARELGINLVAIVPSKPRQTRYHSLPFGIYNALNTGFL
                     LSRGRIITVLMDNGWLPANYIERTLEFYANPAHARSFLAYPEWFFTTEKPDQQRLHNP
                     LTAHLFPDPWIAPPVEYTKGGRMHGNSSIRNVNPGYMRPEELVQAWRRGDPAGFVQQD
                     PKNGFWEMSFCTCPWSAIEELNGLEEFLDIGDDCHESNLRFRAHRLGYDLWIDGNTII
                     QNVWHKFYEDSKTWNRYASDTNIPRFFTEEMSAIKAGKRPVVSQDAQVDWKVWRSLDC
                     PIQVARPGAIFW"
     gene            complement(<579588..>581222)
                     /locus_tag="CYME_CMT232C"
                     /db_xref="GeneID:16997811"
     mRNA            complement(<579588..>581222)
                     /locus_tag="CYME_CMT232C"
                     /product="protoheme IX farnesyltransferase"
                     /transcript_id="XM_005539194.1"
                     /db_xref="GeneID:16997811"
     CDS             complement(579588..581222)
                     /locus_tag="CYME_CMT232C"
                     /codon_start=1
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="XP_005539251.1"
                     /db_xref="GeneID:16997811"
                     /translation="MSLGRTLPLLKRHSVRCYPGRALANRAWAGVDCPGVVPPTAPLW
                     QSVRELTSLKAVSRLVPLSAAVGASARAPLLGRSTATAVGTRAAHLSTELGCAAGVSE
                     RLPTSSEAATESTLSEVLTTRAGSFFRDYLRLSKYRLTGMVVLSAQAGYLLYPVDARV
                     AGVSPGLVDETAPRALDQDTLRQVGLRDAWERVRRFGWLSVGTFLCAAAANTMNQIME
                     ARLDSRMKRTRFRPLPAGRLSVGHALAFACICGMTGVMSLYWGTNPQTALLGLGNTLL
                     YVSVYTPLKVLTPLNTWIGALVGAIPPLMGWAAASSDTGTAVPGVCGKDAESLRGGFP
                     LAALLFFWQIPHFHALAVLCRADYMSAGYRMLALTSPVWNARLAWVSSAALIPTGVWF
                     VREHLCADGFGFGHTLLALWLTLHAGQLVRRPLDIAVARRLFRQTILYLPLALALTLL
                     TRTRDGKPSTLELRYEAGHWGAPAPAHLTFPEADLSSCRTPNKDSTDSLTFSNEKSSA
                     SARRLRKDASAVMSGIDCAFPDAYIAPLPYLPPPRF"
     gene            <582417..>584261
                     /locus_tag="CYME_CMT233C"
                     /db_xref="GeneID:16997803"
     mRNA            <582417..>584261
                     /locus_tag="CYME_CMT233C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539195.1"
                     /db_xref="GeneID:16997803"
     CDS             582417..584261
                     /locus_tag="CYME_CMT233C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539252.1"
                     /db_xref="GeneID:16997803"
                     /translation="MKVSGRQAESSWSPLTPSAKVVQRTEGTLLDLTEWPTSLDPESW
                     TVDHATYACLWNDEQPLSSLWSNEELDSQQVELPLSTERNILTLNSPGQPCNPSGNDL
                     LTAQLPMKEVKEARASVLDDMAASRALPEGSNLLTLAQRTVHTAGGGTISVRFRDDRA
                     LNADTSLAQSVCEEAAFTEARGFLGASTVCCHTGGHVAAQVLCRDGNMKSCDTGPKNQ
                     VYMKAADSDDFIGASGFAPDASAPGKEITSPLPWTADHRQVPAWPRHARRIRAPLNLE
                     NTLRSTNMALGPEQHIDDKGLPGSGDTSPRKPSTAPEDFEDFGSTAVGMDRIERDSAL
                     SGEASAILDSQSALHCAEWLHEWNESADPWRTSLASSGLASTPNLHSSSRGNLIDPET
                     TATSASNLPAYNICGGLLLGTLQTTVIAIDCSQTAHGDAPTATRWQTSREAETGEARH
                     QGMSLQRCQIGDVLKQKRSRERDHLEDSMDQVPADAHFNAMLHMSKSLVQGDDDDDVP
                     QQTSVTYATPARKRQRRCDDPPGHRHSLHAGLPPLQSTAHPLATGNNAADLDSRRSLR
                     DFVVNRIGAFRRMVPRLREAGPYWQLENGTTWRAPVVLADPTPALHLL"
     gene            complement(<586141..>587502)
                     /locus_tag="CYME_CMT234C"
                     /db_xref="GeneID:16997804"
     mRNA            complement(<586141..>587502)
                     /locus_tag="CYME_CMT234C"
                     /product="cysteine desulfurase IscS, mitochondrial
                     precursor"
                     /transcript_id="XM_005539196.1"
                     /db_xref="GeneID:16997804"
     CDS             complement(586141..587502)
                     /locus_tag="CYME_CMT234C"
                     /codon_start=1
                     /product="cysteine desulfurase IscS, mitochondrial
                     precursor"
                     /protein_id="XP_005539253.1"
                     /db_xref="GeneID:16997804"
                     /translation="MRSQLLLLRNVLRPCWRPGAQQTRALHHEAGVAATEGAAASKLT
                     EEGLVQRRPIYMDFQATTPVDPRVLDAMLPYFLHEYGNAHSRTHSYGWSAEKATERAR
                     EQVAKLINASSPKEIIFTSGATESNNLAIKGVAQFYRQSKRHIVTTTTEHKCVLDSCR
                     HLEREGFQVTYVPVQPDGRVSLETLSAAIRSDTAIVSVMAVNNEIGTLQPIAAIGQLC
                     RERGVFFHCDAAQAVGKIPIDVEAMNIDLLSISGHKIYGPKGVGALFVRRRPRVRLDP
                     IINGGGQERGLRSGTLPTPLVVGLGAACDVAEQELERDYAHVVELSERLYNGIVQRIP
                     HVQLNGSREFRYPGCLNFSFAYVEGESLLMALKTIAVSSGSACTSASLEPSYVLRALG
                     VDEDLAHTSIRFGIGRFTTASEIDYAVDMAERHVQRLREMSPLWEMVQEGIDLKSIQW
                     TQS"
     misc_feature    587923..589697
                     /note="possible transcribed region"
     gene            complement(<589502..>591013)
                     /locus_tag="CYME_CMT236C"
                     /db_xref="GeneID:16997806"
     mRNA            complement(<589502..>591013)
                     /locus_tag="CYME_CMT236C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539197.1"
                     /db_xref="GeneID:16997806"
     CDS             complement(589502..591013)
                     /locus_tag="CYME_CMT236C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539254.1"
                     /db_xref="GeneID:16997806"
                     /translation="MHKFRPYVRRQSKSFTSDRFLVCALFGFFVFLLCLVLALFNRHQ
                     TKRHAAALQDRFILHPRHASFNYVLQPENFTTLALTGPTLYGTSVLRTIDRALARTFT
                     ELQTSSRSEGREPPVITVFFPVWRPGVERSGPRGRATYMEQSIGDAQALEALRNWFYQ
                     RNLRPEFGGRSVLHPRRWLEEIRRQPEVLDVEIIDGFVVPRISTHNPPTYTFQFLKSL
                     ADHAPLSYNGTWSRNAARACLVENRLCGRDSHALHSEFTWWSADHRLAARRLHQRLKE
                     ALTAFREIWGYEPSVFGSPYDEWTLGYINGVCAQRRTLASTQVPGFNVALGQASKLHA
                     LCQGRMPLQPHANGKHSRSRCWGYFDLYESNRIDVPDLDENLDPAFLEEYLLEQIASH
                     LEHNAGRIYLTVSEYLQMRRQGVSREFWPPYGTMYRNYRHETVQIKLDYAPCLLRHWG
                     RSRHPKYISLGPGQSYFHTCPSNSEHKQESQEAPLRDSRTLAFSSGGLLSETL"
     misc_feature    591283..592639
                     /note="possible transcribed region"
     misc_feature    complement(591942..594067)
                     /note="possible transcribed region"
     misc_feature    593558..595272
                     /note="possible transcribed region"
     gene            <596151..>597749
                     /locus_tag="CYME_CMT239C"
                     /db_xref="GeneID:16997800"
     mRNA            <596151..>597749
                     /locus_tag="CYME_CMT239C"
                     /product="similar to palmitoyl-protein thioesterase
                     precursor"
                     /transcript_id="XM_005539198.1"
                     /db_xref="GeneID:16997800"
     CDS             596151..597749
                     /locus_tag="CYME_CMT239C"
                     /codon_start=1
                     /product="similar to palmitoyl-protein thioesterase
                     precursor"
                     /protein_id="XP_005539255.1"
                     /db_xref="GeneID:16997800"
                     /translation="MLLAESLGGVAFVTVHTVLCVAVLYLPWNRGDRESFRVTCLGAL
                     STCAVIALSLVNLQLFFTGLTWRELSRTYHWLRPWHSWQVYLLDSGGFLVLLFLHEYR
                     KRQQTPVKSSSSSTCASTSQSACPNAENGIYRNERRNTWCMFRSLLIAPITEELLFRC
                     VFDAAMRSAQVPELASMIFNGVMFAVAHAHHYFRHQSRSLLGKQLLVTFCFGCVQVVC
                     LRRTDYSLWACIATHALANALDLQKVFSDRGASHFLYGDVGHQLGALLQAAAPLVFIL
                     RYALDMAMQASPFRSSILQVHADPGLLEERREIMRPTTPFSLFLIEYHQRDPIFGRFM
                     ALCSMLPQLLFAAEVTAVYCWRSPRALLLAVGQIVNETLSYALKRSCRIPRPPIARLE
                     ADAFGWPSSHAQFMSYLYVFYVLYVSRPQRKASSSHNGEMMHQTLPKRRKTTDSISET
                     VAVMFLLGLSSVLVAASRVYLAYHYPSQVWYGIIMGTIFAITWFLASENVFLSYVRSL
                     RILVWLGFGEDDSDLFRSILRDVH"
     gene            complement(<598480..>599442)
                     /locus_tag="CYME_CMT240C"
                     /db_xref="GeneID:16997801"
     mRNA            complement(<598480..>599442)
                     /locus_tag="CYME_CMT240C"
                     /product="indole-3-glycerol phosphate synthase"
                     /transcript_id="XM_005539199.1"
                     /db_xref="GeneID:16997801"
     CDS             complement(598480..599442)
                     /locus_tag="CYME_CMT240C"
                     /codon_start=1
                     /product="indole-3-glycerol phosphate synthase"
                     /protein_id="XP_005539256.1"
                     /db_xref="GeneID:16997801"
                     /translation="MPLRLSWIVSLRCNHSERSEGSNEAVDQIRRRSIRNGRQVFAEN
                     VVWGVENPEDKPRNLLEELVWAKEREIEVRRQRMPLFLMKSRLEKSDVAPVRDLNSVF
                     WDSAGPESVLFFQYQRCSPEDTESAPILANVAEEKNDARAVVVNAESRRFYGSYEDIR
                     RVHEVVRCPVICKDIFVYPWQLYDARFYQADACVLIMKVLGLKDTLYFAKASVALGMA
                     PIIEVHDAAELDALLTAKRQHSDDGRISILLLAKRDLDSLVPMLSDSEALLERFAPEA
                     RRLGLRVIVELPREHAPNASLLRGLRERGADAVLASTMRDDRAL"
     gene            <601502..>602545
                     /locus_tag="CYME_CMT641C"
                     /db_xref="GeneID:16997802"
     mRNA            <601502..>602545
                     /locus_tag="CYME_CMT641C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539200.1"
                     /db_xref="GeneID:16997802"
     CDS             601502..602545
                     /locus_tag="CYME_CMT641C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539257.1"
                     /db_xref="GeneID:16997802"
                     /translation="MKSCRGGKIKRTPSLRRLRRNTSMGRMLQDVKCRMLLGIAQRLT
                     RHVVSSTSRLGAYRRSIVLRVLEEGLAAVHIPLDYFDPTIVQQENGCSRQTILDGPVI
                     WFEIRTNASNRTSTCASTTSSLEKCSAVHVPNGIKCLTADRKAYVGEPRELHGAHRVG
                     VVSSSSWARKEELMEGILCSSLYMSATRCHGGDPWHGHVVSRWGRHPYRSAEARGVYS
                     GTRSMRQKKEMIERSRRLPVAYGAARSGQRKTCTRTAFAPNVQRLQESMLHNSHRCIP
                     DDIRASRARVHPATGPEAVCGMESHARDGLRPAQQTSDAEAIASETLGMVGFHRPQYA
                     RANSICAETSAHR"
     gene            <603281..>606298
                     /locus_tag="CYME_CMT241C"
                     /db_xref="GeneID:16997976"
     mRNA            <603281..>606298
                     /locus_tag="CYME_CMT241C"
                     /product="calcium-transporting ATPase, endoplasimc
                     reticulum type"
                     /transcript_id="XM_005539201.1"
                     /db_xref="GeneID:16997976"
     CDS             603281..606298
                     /locus_tag="CYME_CMT241C"
                     /codon_start=1
                     /product="calcium-transporting ATPase, endoplasimc
                     reticulum type"
                     /protein_id="XP_005539258.1"
                     /db_xref="GeneID:16997976"
                     /translation="MEDAFCRTAEEVLEAFQVRKDYGLTEEQVALYAQRYGRNVTARE
                     ESAPLWQLVVKQFQDQLVLILLGAAGISFILALFEDDEDRVTAFFEPLVIVLILAANA
                     TVGVIQETNAEKAIEALREYEPDDATVLRCGELRRVRSEELVPGDIIEVSVGMRVPAD
                     CRIIELASTVLYADQSVLTGESISVSKSPEAITDTQCMIQDKTCLLFAGCTIVRGKAR
                     CVVTQVGERTEIGKVRRNIAETKAVMTPLKRRLDEFGSLLSKIILLICVLVWLINIRN
                     FWNPEHGGFLRGAVYYFKIAVALAVAAIPEGLPAVVTTCLALGTKRMARKNAIVRSLP
                     SVETLGCTSVICSDKTGTITTNRMCVTRVLLVSDVLPAGDGKLLDLEVTGHGDFSPFG
                     NVVYNGSVLESPLKSLPPLAELSIAATFCNDASITFNMKGRQYDKIGEGTEAALITLV
                     EKLRTPDEHYNAEISHMPLVQRATATRAYWNRLFERVATLEFTRDRKSMSVFCRRLSD
                     ESLHMFVKGAPERILENSDYVCIGNGMRIPITPVLRRQLLDAVASLSSGVHALRTLAI
                     ATRDHPPALETVDMRDTQSFARYESNLTFIGLVGMIDPPREEVRAAIETCALAGIRVI
                     VITGDNKATAEAICRQVGIFDDYEDLSGKSYTGREFELLPEDARRQVVRRARLFARVE
                     PLCKQRIVTLLQERGEVVAVTGDGVNDAPALKAADIGISMGTGTAVAKGAADMVLGDD
                     NFATIVAAVEEGRAIYENMRQFIRYLISSNIGEVWCVFLTAVLHTPEALAPVQLLWVN
                     LVTDGLPATALSFNRPAKNIMQQPPRPSNEHIVNGWLLFRYLVIGTYVGVATIAGLIW
                     WYMFYAGGPQLSWSELRLHRQCQSGNDLGTGLAISCDIFRSRHPSTVSLSILVTIEML
                     NALNSLAENESITIVGPWTNPFLVLAICLSLALHAIILYVPFFNRVFATAPLDFQEWV
                     AVLWLSLPVVWLDEGLKYFSRLQKRRQTIKKMR"
     misc_feature    606763..609789
                     /note="possible transcribed region"
     gene            complement(608957..610840)
                     /locus_tag="CYME_CMT243T"
                     /db_xref="GeneID:16997829"
     misc_RNA        complement(608957..610840)
                     /locus_tag="CYME_CMT243T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461702.1"
                     /db_xref="GeneID:16997829"
     gene            <610967..>611911
                     /locus_tag="CYME_CMT244C"
                     /db_xref="GeneID:16997830"
     mRNA            <610967..>611911
                     /locus_tag="CYME_CMT244C"
                     /product="vesicle-inducing protein in plastids 1VIPP1"
                     /transcript_id="XM_005539202.1"
                     /db_xref="GeneID:16997830"
     CDS             610967..611911
                     /locus_tag="CYME_CMT244C"
                     /codon_start=1
                     /product="vesicle-inducing protein in plastids 1VIPP1"
                     /protein_id="XP_005539259.1"
                     /db_xref="GeneID:16997830"
                     /translation="MFVNTALTRVQLVSRSGQSPSKTLVRGELYASPAGAFVPRAQRL
                     VSGVTAARPSRTLARQTLSMNLFSRFFRVIRANLNALVSRMEDPEKVLTQSLEDVQKD
                     LLRLRQAYAEVSASKKRLERQREAALKTAAEWQQRARLALEKGNEDLAREALLRKKQQ
                     EDMAKALENQLRMQAENTAKLYSSMQQLEAKISEAQAKKDEYITRARTAKTAIKVNEM
                     LTSVDTSSALSAFERMQEKVETLESQAEVSRQMIGSGDASLESQFRALEAGTDVDEEL
                     NRMRRELRGDSSYRALQASRDPEIDEEIQRMKREQQQR"
     gene            <613323..>613565
                     /locus_tag="CYME_CMT245C"
                     /db_xref="GeneID:16997831"
     mRNA            <613323..>613565
                     /locus_tag="CYME_CMT245C"
                     /product="retroelement"
                     /transcript_id="XM_005539203.1"
                     /db_xref="GeneID:16997831"
     CDS             613323..613565
                     /locus_tag="CYME_CMT245C"
                     /codon_start=1
                     /product="retroelement"
                     /protein_id="XP_005539260.1"
                     /db_xref="GeneID:16997831"
                     /translation="MERAQVSGKCLAFFRALYADSWMRIRLGDGSRTPCIRIRRGLRQ
                     SDPTSPLLFNIFINDLLNNCRQYGLEVPWIDCGDAR"
     gene            <615611..>617194
                     /locus_tag="CYME_CMT246C"
                     /db_xref="GeneID:16997832"
     mRNA            <615611..>617194
                     /locus_tag="CYME_CMT246C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539204.1"
                     /db_xref="GeneID:16997832"
     CDS             615611..617194
                     /locus_tag="CYME_CMT246C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539261.1"
                     /db_xref="GeneID:16997832"
                     /translation="MVTVEDLLQQTVPTGKRRSVRSSLNDSLNTTASSTVASAGSQEP
                     GHVSAPAAGQRPASPKQQASERVQTAGRWRIGSVFKRLFQRAAHRPAVPQPSAESPAN
                     PDEGPILRRYSEITRELLNNWVESDAPELAPPNDKLGEERVEEDSTLGVDHNLPPSER
                     SYRRRVSRRRRFIRAMTCGIDPNPEDGDAEPTPQLYAFRNQELPAVKPLFLPWFVALI
                     LLVLGVACLGIGIYLSVTNNSLRRSIQVRYDDKCSLNEQDCVVQVNVPERLTAPVYVW
                     YHLTNFYSNHRIYDESRSARMDEGHWPLTYSQVRDCLPKLYGGNVTANNPNGYLVPCG
                     LIQYSQFNDTIHLCSSPDVSASSCTVLSGNDWTDVGVAWESDINALYHNGTVDPPFTP
                     AVNARITSPDYIVWQRISSGSNFLRLYRIINRDLEPGRYSLKIANNFNSYAYRGSKYV
                     NIGKVAVYGMRNTVLQIAYLTTAGVLLVLAPVVMVTYWLSNRRIADPNSRFLKQIMDE
                     IDDAAWIGEAPESANSSAL"
     gene            <619700..>622963
                     /locus_tag="CYME_CMT247C"
                     /db_xref="GeneID:16997833"
     mRNA            <619700..>622963
                     /locus_tag="CYME_CMT247C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539205.1"
                     /db_xref="GeneID:16997833"
     CDS             619700..622963
                     /locus_tag="CYME_CMT247C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539262.1"
                     /db_xref="GeneID:16997833"
                     /translation="MNIVYKLGGTLAASSQDNRPAEAFSINVHNWSFGSAVTHWTLAD
                     WCHQGPDLVAAICLVTGSENASPQNSLGVEGPQSAKTPSVLVFHAESPQELVVLAAPA
                     GLWPNALSWRPPLDTRLFRVITNREGKQRVAEFADVEQSQQLVFGARSNWPRLLVLHG
                     CSLWRIWGPHASGFRVNRWRITHEEECMWQLRDISWMPQLDLPLIGVCGLAANGEVQL
                     WIAPDTEDDKGLFAVHTLTICEPRIILGQLNFINPAVSYFSYGDAELHQPCAAFLRSE
                     QSSAEDKNGIASIQTEDWRLVCARVVYATQDNDDCFQVCEIGFLIPCTRQSNAETCNA
                     VQPLPDRVRIIAKPLGSICLSTNRSGASEFPTGADPLVPSAGLAAEAPAVPCRFQICP
                     STGDIFIVIERREVQRWRFDSKTAQDGLSKALENHTISGRVSEPSPSVDREHGLLGDP
                     SWSRVGSFQHERTIDTMRLSPNSLFVLLGSGDATLTVLKGDRVAWASGSTLTGSLQIG
                     PMEVAAMAIAPSPHAGCAFVLTNAPVEFGSIVQLPADHLDASFIAKTLCRMMQHREGA
                     TERVFDLITRIRDEPKIFAQIVKALEQLHAPRRCFTMLMLCHTLLTPLWLALNTISVP
                     VRILESLSGVIACASHMYASADHNMKPLDVRLERLRLFTRPRLSQLSTGDSERMFCAA
                     QKILCMGAAWIRHAALTTMLFMRADELPPLWAALRRQDWASMIQFIKHQGVASGAVDD
                     RRVTPRDTAAAAAAMGDWGVTPGTGSATSQVLIHDFLRVSFHFVHDPYYVRLINIACC
                     CAVAVLAELRSLSLIPRELIARVRLQFDLETGHQIAAAIQDLRDAWRGMDAELTLLLR
                     TQRNGYMANSPRPADLSDAIRTRLDALKSAIHRHMLANIAVAQRLLENPHFALERLED
                     CAGMFGSSMRGFFLRTAPLRVSSDMLSHDAVTCMPLEAAAGRRRCSRTGLVATELEAS
                     SSTEDALLQTWRNVSPFGGVWYVDSAAPAHELKAKSDVGANQDSFVPSAADREPRSPR
                     DGTATMVERFPDWSLVGNHRDVLLADLDDLGPDIDMRHVASGLRDEVFGETHRINLA"
     gene            623764..625300
                     /locus_tag="CYME_CMT248T"
                     /db_xref="GeneID:16997834"
     misc_RNA        623764..625300
                     /locus_tag="CYME_CMT248T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461703.1"
                     /db_xref="GeneID:16997834"
     gene            complement(<624911..>627847)
                     /locus_tag="CYME_CMT249C"
                     /db_xref="GeneID:16997835"
     mRNA            complement(<624911..>627847)
                     /locus_tag="CYME_CMT249C"
                     /product="similar to S-M checkpoint control protein Rad4p"
                     /transcript_id="XM_005539206.1"
                     /db_xref="GeneID:16997835"
     CDS             complement(624911..627847)
                     /locus_tag="CYME_CMT249C"
                     /codon_start=1
                     /product="similar to S-M checkpoint control protein Rad4p"
                     /protein_id="XP_005539263.1"
                     /db_xref="GeneID:16997835"
                     /translation="MAEACRAARGEVGSLQPCTAPSSPSTGTPAQSSATCSVSRVEET
                     PALHPKHSLDGGGNQKFDTAHGSTHEALCSEIVSMDTAPKHALNPQLMSVCKTNEEAA
                     REMISCLTPARAAIVVTCSGLSAEQRSRIERLCSLVGFEFSGDLRRNVTHILATRADT
                     KKVLVGRRHGIWILRPAWLEECWAQRRRCPEMKHELEPLAGLKFSSAQLLDAEINRLN
                     ALVTKYGGQYVRNISTCSTHLVVHRASGRKVRYALRHGLIILSFCWVERCESEQRLVE
                     CEPYFITAADLADADFTQGSQGGPQPCAAEGFQGSSEFQLQTTNERIASLMGNAVLGP
                     QPESDQLQGLGTYQVSTLLAEADIPPPLACAAVAAIGATSSQDHVPAGHQKNTEHWGT
                     SMCSTLNNATVAVVDEPSSVNSSAANPVSAECSPPQDDDDAETFTSPLEDFHFFLFGL
                     SEDQRYRARAWIRRSGGFLHIFWSPLITHVIAPSELAAELNPQVFDFFQWSWRSGVMW
                     CSLQWLEVCVARQECIPPDFLSIASARVRDHAQAWSENAADSRASKSPRSLLPQTCSC
                     FRGTCVSLIPLIRVQPALAASVAKQLRAAGAQVIDSVNNERRISVATTIDFAVSVHGD
                     QFASKETRNAPLVTLEWVQDCLRDNTLHDYLTDPRYQPLPTRVPLEGLCGKTICVSGF
                     FQSRRTSYGPGATFQMVLCRRTLEHLVRLLGATYSERLRHHHTDMLISESPQGKKYER
                     AVLWNIPALRVQWLLDCVAAGRILPNDKYRWAAEATERVTGSECRRLSFSDTILGLKR
                     MLDAEHDGRFAMQPNQGSVPISSAISARYEQTPQPGAQQETGAQITQVLHTSSHELRR
                     STCAVETCRDEVCDGIRTSVEHVPELSDAVHNDSAGQSLDPHSTMPSAQLRIEKESAS
                     QAESTVKPRDREASSAALANFFRNHLQKSMRRSCDTDSSDDDDYQALPGVSQVVVYHS
                     GPDMTA"
     gene            627634..628774
                     /locus_tag="CYME_CMT250T"
                     /db_xref="GeneID:16997836"
     misc_RNA        627634..628774
                     /locus_tag="CYME_CMT250T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461704.1"
                     /db_xref="GeneID:16997836"
     gene            <628379..>628729
                     /locus_tag="CYME_CMT251C"
                     /db_xref="GeneID:16997837"
     mRNA            <628379..>628729
                     /locus_tag="CYME_CMT251C"
                     /product="similar to light-inducible protein ATLS1-like"
                     /transcript_id="XM_005539207.1"
                     /db_xref="GeneID:16997837"
     CDS             628379..628729
                     /locus_tag="CYME_CMT251C"
                     /codon_start=1
                     /product="similar to light-inducible protein ATLS1-like"
                     /protein_id="XP_005539264.1"
                     /db_xref="GeneID:16997837"
                     /translation="MPAFTIKCNVELSKEKATALCKEASKVMADILGKPESFVTVTYE
                     VPLAMTWDGNEEPAAVCMLLSLGTSSPEHNVKVSAKVAELLRKHCGVQPSRYYVEFVD
                     PPRSDLGWNGRTFA"
     gene            complement(<628782..>630080)
                     /locus_tag="CYME_CMT252C"
                     /db_xref="GeneID:16997879"
     mRNA            complement(<628782..>630080)
                     /locus_tag="CYME_CMT252C"
                     /product="phosphoserine aminotransferase"
                     /transcript_id="XM_005539208.1"
                     /db_xref="GeneID:16997879"
     CDS             complement(628782..630080)
                     /locus_tag="CYME_CMT252C"
                     /codon_start=1
                     /product="phosphoserine aminotransferase"
                     /protein_id="XP_005539265.1"
                     /db_xref="GeneID:16997879"
                     /translation="MCKGSLFITPGPLIKLRENRTEQFRSAKTKYKQRLCSWVMVTAM
                     DSTNTEHSEARPQDRPLSPCFSSGPCKKRPGYDLAKALSDAPIGRSHRSKIGKKKLKE
                     AIEETKRILELPSDYLVGIVPASDTGAVEMAMWNLLGPLPVDICHWESFGAGWYEDAV
                     KHLKLPNVREFKATAYGELPDLSAVNAAEHDVVFTWNGTTSGVAVPDADWIPDQRRGL
                     TICDATSAVFAMSIPWHKIDVLTYSWQKVLGGEAAHGMLILSPRAVERLEQYTPPWPL
                     PKIFRLKKKGKLDVSIFEGNVINTVSMLCVEDYLDALRWADSIGGLSALVERSRRNLA
                     VLEQWVRSRDWIEFLALDERTRSCTSVCLRFTKIQRDAVKQLTQLLEDEQVAYDIDSY
                     RDAPPGIRIWCGATVDATDIELLTKWIDWAYAQVVANNSA"
     misc_feature    complement(630985..632636)
                     /note="possible transcribed region"
     gene            <633468..>634109
                     /locus_tag="CYME_CMT254C"
                     /db_xref="GeneID:16997881"
     mRNA            <633468..>634109
                     /locus_tag="CYME_CMT254C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539209.1"
                     /db_xref="GeneID:16997881"
     CDS             633468..634109
                     /locus_tag="CYME_CMT254C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539266.1"
                     /db_xref="GeneID:16997881"
                     /translation="MQAQPASFVFSGQSRRQSLRSTHRNLVRRIICTFSTRDNSWTDG
                     LVARRGSPADRGVIFRSILSEGMNPLGIRTERFLVVEEKDFQSQKNQIVGFGQLRPLS
                     ATDLELASVYVAPAYRRRGIASRIVAHLLEEQRRSLHSVSGPKKRRIFCLTVGNESLY
                     SRAGFTRFPLDQNFIWNSDIPCGLRFEMLAGRVVAALVKPQDVLVLLYTILEA"
     gene            <634487..>635038
                     /locus_tag="CYME_CMT255C"
                     /db_xref="GeneID:16997882"
     mRNA            <634487..>635038
                     /locus_tag="CYME_CMT255C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539210.1"
                     /db_xref="GeneID:16997882"
     CDS             634487..635038
                     /locus_tag="CYME_CMT255C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539267.1"
                     /db_xref="GeneID:16997882"
                     /translation="MPLEAVKVGLALFGTVAGALGACSVPFLFTRWPYVATTNKALCD
                     LREILKPLAKPTASFLDIGSGDGSVVELAAMTGFGSSLGIESNPVLAFYSKWRLRKLR
                     NATCLWGRYQNMNFSGIDTVYVYGGEQIMTALGEKLTAELKPGATIVCNSFPLPKPEN
                     HIGKRCLFFIRRAGSLYIYRVQN"
     gene            complement(<635035..>636276)
                     /locus_tag="CYME_CMT256C"
                     /db_xref="GeneID:16997883"
     mRNA            complement(<635035..>636276)
                     /locus_tag="CYME_CMT256C"
                     /product="pyruvate dehydrogenase E1 alpha subunit,
                     mitochondrial precursor"
                     /transcript_id="XM_005539211.1"
                     /db_xref="GeneID:16997883"
     CDS             complement(635035..636276)
                     /locus_tag="CYME_CMT256C"
                     /codon_start=1
                     /product="pyruvate dehydrogenase E1 alpha subunit,
                     mitochondrial precursor"
                     /protein_id="XP_005539268.1"
                     /db_xref="GeneID:16997883"
                     /translation="MHLIWMALRASSRRLWGVCSRGRLRFTCAAGSTDSASAAVQRER
                     VEARAEKPSAPSTKNFELSPFALYLLDRGPETLVQASREELLGYHRLMFTMRRMEIGA
                     DQLYKAQKIRGFCHLYDGQEAVAAGMSQVITFDDYLITAYRNHCQQLMRGDTVEGIIA
                     ELLGRAIGCSQGKGGSMHLYFPENNYFGGNGIVGAQVPLGTGLAFAAKYKKENAVSIT
                     MMGDGAANQGQVYESFNMAALWKLPVVYVIENNQYGMGTSANRAAANPLYYTRGAYIP
                     GIRVDGMDVLAVREATRFAKDWCLQGNGPILLEMQTYRYHGHSMSDPGITYRTRDEIN
                     EMRKTRDPIEKVKSRLVDVGWVTADELKQTERAIRQDVDEAIKRALDAPEPAPELLWK
                     HLYTTEATRVRGTSIDNGYEA"
     gene            <636536..>637222
                     /locus_tag="CYME_CMT257C"
                     /db_xref="GeneID:16997897"
     mRNA            <636536..>637222
                     /locus_tag="CYME_CMT257C"
                     /product="small GTP-binding protein of Ran family"
                     /transcript_id="XM_005539212.1"
                     /db_xref="GeneID:16997897"
     CDS             636536..637222
                     /locus_tag="CYME_CMT257C"
                     /codon_start=1
                     /product="small GTP-binding protein of Ran family"
                     /protein_id="XP_005539269.1"
                     /db_xref="GeneID:16997897"
                     /translation="MQSNPVSAQQPNATAGESIPTFKIVLVGDGGTGKTTFVKRHLTG
                     EFERRYIATLGVEVHPLKFYTNRGPILFNVWDTAGQEKFGGLRDGYYIQGQGAIIMFD
                     VTSRITYKNVANWHRDLVRVCDNIPIVLVGNKVDVKDRKVKAKQINFHRKKNLMYVDI
                     SAKSNYNVEKPFLWLARKLTGDPNLVFVEAPALAPAEIQIDEEYKRQMEEELQQAQAV
                     PLPDEDDEEM"
     gene            complement(<641924..>644362)
                     /locus_tag="CYME_CMT259C"
                     /db_xref="GeneID:16997898"
     mRNA            complement(<641924..>644362)
                     /locus_tag="CYME_CMT259C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539213.1"
                     /db_xref="GeneID:16997898"
     CDS             complement(641924..644362)
                     /locus_tag="CYME_CMT259C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539270.1"
                     /db_xref="GeneID:16997898"
                     /translation="MKYGHRLRAFYEVFGAADQVGPDGTAPDARERPAPGTAPKSRAS
                     DWHRQVEPEVVCDVAENAGRDSSAGYETSASSGAGGGRGSSQRSLSPVPAEDTTPEAD
                     PLPDAAVMGPRAPASQLPDLRSELGDRYRALYAMYKAGKAAVRCIRATMDEHAPRAHH
                     RTSVPPEALGRRSRYLKLLGNNLQLSRIPSDLEQVFDAVWVFFDSIIREIGAFRRVFE
                     ERTADLQCRLDVLRQQGASSSVRGALELGAEAEQVLVCLQIAQVAIGKILKKFTKALA
                     LIASDEAAARGWHGWDVADVREDALEGAGQSESEQSSTTTTSATPAGSGGRSDADGVD
                     KRRGGTRGVGNAAPNAIQDAKLERAVRLAMCGSLSSALALDPSEEAPPLVLVTRLRRF
                     LVQQPFVCDQRRLGFLADLRHRKDCAVLALHRILESLTPAATGDDAALGGAPTGQLHT
                     AAACAPGRGVDGDQRTLGALTLLRHVLDDVPPPGEYSLHAPSAHLPALPPGGRVRPFA
                     EECRLLARQLESQLAAYNPTTDPSSPYEVATRFYLANVAASGPAVTAEAFLRAARSVP
                     MHFLCPICLDMLFETVELPCRHRFCEVCIQEARFSAELQGATLSCPLCQPGLYRRHCC
                     ETADTSAVQAARHASASPEECVSSAERDALSPADACARTEQRERRASSIDGLLRAAFP
                     AQWRLRERQARATREMLERRRRFRERVAHLDAAKLRSSGNLESVARKRFHWVCQCFGD
                     RSGRARPVATPPPSAGDAVADVEPAADGRRAGLVDARAGVLGDPKPDAAAQTQGKPAT
                     SVPQNRARSACSIA"
     gene            complement(<645857..>646561)
                     /locus_tag="CYME_CMT260C"
                     /db_xref="GeneID:16997899"
     mRNA            complement(<645857..>646561)
                     /locus_tag="CYME_CMT260C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539214.1"
                     /db_xref="GeneID:16997899"
     CDS             complement(645857..646561)
                     /locus_tag="CYME_CMT260C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539271.1"
                     /db_xref="GeneID:16997899"
                     /translation="MASYRRRKSQRFAQSSVANETHLQENRPVPIKPRLHYMKRGELE
                     GYALPLQSSDPLVVRATARQLGRQNPQSAKIARYCHYVLLDSRTALLRLSFQAMTVFA
                     LSKAGRAGRRILKYWKPDGYGPDEEVRKHTRAEVHFFAEALVSLVESNRQARVRVHAI
                     CNTIEMYEATAVLAVETARCLIVARPALREKAGCFTCGAVLGDELLSRLLHTQSESQD
                     AAIKFNIAEQEFLVIK"
     gene            <647462..>649087
                     /locus_tag="CYME_CMT261C"
                     /db_xref="GeneID:16997900"
     mRNA            <647462..>649087
                     /locus_tag="CYME_CMT261C"
                     /product="similar to Pfam GTP-CDC domain protein"
                     /transcript_id="XM_005539215.1"
                     /db_xref="GeneID:16997900"
     CDS             647462..649087
                     /locus_tag="CYME_CMT261C"
                     /codon_start=1
                     /product="similar to Pfam GTP-CDC domain protein"
                     /protein_id="XP_005539272.1"
                     /db_xref="GeneID:16997900"
                     /translation="MEPVCLSSGQLISASGAFLAAPGTNDDFKAESSTGTLAEDLPFV
                     CAIIGAQGSGKSTLLNDLFHTDFPVLDASRTGPRRTTEGIFYALLHLQERGNSLLIFD
                     VEGLDSKERGSTGRHFEYNVAFFVAYTADIVILNVFSHDIGRQNAATFHALVTVLREK
                     FKLVESSHKKDRTLLLVAIRDFDEVDAPIDDLKQALEDDFHALWPSVVQGSDIKMEEL
                     YDIQFYGLPSKLFEIARFEEKVDHMRKSIMDRWLRTSGGLSSSSSFLMLFKELWTEIS
                     NRTSSPEPLCISATASLVELLIDLHCTRIIQYVMGGAREKVHRALSSILENFSDEISV
                     ASLALEIHDESILKYRWMARHYVHSPTFSRKETELHGLLWSQPDGDLANLVRQYWFVV
                     TENRCRDFEADFASILGGTADFEQQTQQLRGKWASSLADFLREESQKLNSLMPEVQTL
                     QHTCMERFENHVGSCIDERRRQGAVMLPTLDGNWRQYGKPASKKGILQKMRPVLLRIL
                     VIYLNYLQAKQRMKSIQSRKRRCDLNMPLGPTF"
     gene            complement(<649577..>649885)
                     /locus_tag="CYME_CMT262C"
                     /db_xref="GeneID:16997930"
     mRNA            complement(<649577..>649885)
                     /locus_tag="CYME_CMT262C"
                     /product="U6 snRNA-associated Sm-like protein LSm3"
                     /transcript_id="XM_005539216.1"
                     /db_xref="GeneID:16997930"
     CDS             complement(649577..649885)
                     /locus_tag="CYME_CMT262C"
                     /codon_start=1
                     /product="U6 snRNA-associated Sm-like protein LSm3"
                     /protein_id="XP_005539273.1"
                     /db_xref="GeneID:16997930"
                     /translation="MSFTVGKGQLEEPVELLRIALDERVFVKLKGDRELVGTLHAYDQ
                     HLNLIISDAEETLQKAELDEETYEQIVRQERRKLQLVYVRGDTVFLVSPLLRHTGTFL
                     "
     misc_feature    650511..652651
                     /note="repetitive element"
     gene            complement(<655684..>656028)
                     /locus_tag="CYME_CMT264C"
                     /db_xref="GeneID:16997931"
     mRNA            complement(<655684..>656028)
                     /locus_tag="CYME_CMT264C"
                     /product="probable iron-sulfur cluster assembly protein
                     IscA"
                     /transcript_id="XM_005539217.1"
                     /db_xref="GeneID:16997931"
     CDS             complement(655684..656028)
                     /locus_tag="CYME_CMT264C"
                     /codon_start=1
                     /product="probable iron-sulfur cluster assembly protein
                     IscA"
                     /protein_id="XP_005539274.1"
                     /db_xref="GeneID:16997931"
                     /translation="MCRSRAAMTITEAAAKRLRSLLEKHPESYGVRLSLKQRGCNGLS
                     YQLDYAKERRRFEEEVVSADGRVRVLVDPRAMLHVVGTEMDYVENDLASEFVFRNPNA
                     KGTCGCGESFNV"
     gene            <656091..>657110
                     /locus_tag="CYME_CMT265C"
                     /db_xref="GeneID:16997932"
     mRNA            <656091..>657110
                     /locus_tag="CYME_CMT265C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539218.1"
                     /db_xref="GeneID:16997932"
     CDS             656091..657110
                     /locus_tag="CYME_CMT265C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539275.1"
                     /db_xref="GeneID:16997932"
                     /translation="MTRRRLVTFSKACTIVPTYECFNRCTYCNFRKDASGWISLSKAA
                     EIARTNRDAGATEALVLSGEVHPKSSLRRHWIAHTVEICKVAIQNGLLPHVNVGPLSW
                     GEMKELTKFSVSMGLMLEQVTDKLMASVHRRAPSKDPSLRIEQLHLAGQLKIPFTTGI
                     LVGLGEEECDWKTSLNCIAAVHNKYGHIQECIIQPFRPGDRGYISGPKLNAFHSEALP
                     YVVSLARKILPTEIAIQIPPNLVLSDTDRRKGLELVFRCLEAGASDLGGISPVDEVNP
                     TYAFPSITWLREVLLLEGFELMHRLPIYEQYIPWIQKAEKFEHLQRLFPVYKQGNSAK
                     STPKS"
     gene            <662683..>664092
                     /locus_tag="CYME_CMT266C"
                     /db_xref="GeneID:16997933"
     mRNA            <662683..>664092
                     /locus_tag="CYME_CMT266C"
                     /product="MYB-related protein"
                     /transcript_id="XM_005539219.1"
                     /db_xref="GeneID:16997933"
     CDS             662683..664092
                     /locus_tag="CYME_CMT266C"
                     /codon_start=1
                     /product="MYB-related protein"
                     /protein_id="XP_005539276.1"
                     /db_xref="GeneID:16997933"
                     /translation="MDHDFWCSDLEFESYPELMSGNGRESSVDATAADGDGAGCRNPL
                     RETLDSHAKPLGSDQFFEQVLPREGDFLHEGPFLSEDSLQRLLLSVSSPRTHGESQLS
                     EEKSTPDKRRSGQSGKSNKAAQGDILEDPESFVGTQTDAHGDNTVSLRDVLALALPRV
                     DPYSRQRLLELHGLLRKGSLDVYGFISELRRVIGSRMLRELATELETTQHDFLECERT
                     LGAHKTQESFIEPSQQNAMESVEEISLLEPATMAGTEVSSSESTPLSTSQSASTSKPK
                     KRAWTRLEHYIFLKAMQIYGRGKWKYIADVLPGRTPNQVASHAKKFFLRQRKSLKDKR
                     MRSIHDLVLSSPEMREVERALETGAIETPGFNLAALGIVRKVQSVFPRPAPSHHDGSL
                     SGWETALPGISRRAEYTSAPMYPSADYAGTNAHMGDPMTRSCDLRLRRLEYTAHLLRQ
                     TISTMRAQACGTLVDPRGS"
     gene            complement(<664669..>666021)
                     /locus_tag="CYME_CMT267C"
                     /db_xref="GeneID:16997944"
     mRNA            complement(<664669..>666021)
                     /locus_tag="CYME_CMT267C"
                     /product="similar to glycosyl transferase"
                     /transcript_id="XM_005539220.1"
                     /db_xref="GeneID:16997944"
     CDS             complement(664669..666021)
                     /locus_tag="CYME_CMT267C"
                     /codon_start=1
                     /product="similar to glycosyl transferase"
                     /protein_id="XP_005539277.1"
                     /db_xref="GeneID:16997944"
                     /translation="MLPETSNRRSRSVLLPLCVLGAGVVSFLWRPASRVYHIAAILLD
                     AYLLAFLVRKKVTTKKIPEADIDTGSLPFFTLVVPCKNESGVICKTLQKLCFGLKYPV
                     DSYRILVLDDHSTDGSFDRIHHWIRDTLRPLPVCQAIARPQHDIGGGKSGALNAALKY
                     IFYEREQDVIISPKKRHIIGFLDADAQCDPRLLAALAAVFLSEDALVLQVLKKPIRWG
                     SRSLLEDCQVADYMADWFVSSQRQIRRAGCASLRGNGMFFDEAVILHVADGRSALRGF
                     FFNDQTTGDDVDMTCRLKIAGLKIHYIDDTYVMEELAPSWKALFQQRARWVYGGYRRY
                     TDYLESLPCLWWNDPDELVEFCVLLAPIFLLPQFILSFWFNGNRAVWFHLAFLLVWGL
                     GLMCQACASLRLALLGLIFSLHRIFFIYWTVVLCIWKPSECLPYWKTTRRVDMERGTP
                     "
     gene            <666199..>666741
                     /locus_tag="CYME_CMT268C"
                     /db_xref="GeneID:16997945"
     mRNA            <666199..>666741
                     /locus_tag="CYME_CMT268C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539221.1"
                     /db_xref="GeneID:16997945"
     CDS             666199..666741
                     /locus_tag="CYME_CMT268C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539278.1"
                     /db_xref="GeneID:16997945"
                     /translation="MIELQLELFPGHIAGLLLVELSKPVEDFASIFIQGTWECALLDA
                     GVVFHKSQLLTAVNVAFQRFEAGRLKTHSLHNEVMLALSAKLSIRDGLAAVRFSWEKT
                     RCLVVAVDPPASFPQAAESTSNALAAKVRHFPEGANELFNELLVHVDKPSIQNLYGTD
                     IDPHWICTKIATVEYVRQLR"
     gene            complement(<667361..>669247)
                     /locus_tag="CYME_CMT269C"
                     /db_xref="GeneID:16997946"
     mRNA            complement(<667361..>669247)
                     /locus_tag="CYME_CMT269C"
                     /product="probable MAP kinase kinase"
                     /transcript_id="XM_005539222.1"
                     /db_xref="GeneID:16997946"
     CDS             complement(667361..669247)
                     /locus_tag="CYME_CMT269C"
                     /codon_start=1
                     /product="probable MAP kinase kinase"
                     /protein_id="XP_005539279.1"
                     /db_xref="GeneID:16997946"
                     /translation="MLRCLRFAEEHSGEGSTLHSRFAPGYAQVDSRLGRVAPKRGRHR
                     VPLWLSGLLKGKVARSPPPAADETRLQASAVNNRKRPQDNYGSATSNSVVAVSNLLET
                     RSKSLSVRRGLGKLTLNETDLNFGDPLQPNDEYGASFECCAEADEAPTAYSTAERQVM
                     ACSISAGEAGETSYETRQAAADWKSLKQEDVSMKSSRMESGVSRVMQVSDCPTSNSFG
                     TGSGLKANHLQFLRTIGSGSFASVQLAMYKDKSEPIAIKIIDSSSHRAQIRSEVSVLR
                     MARAHDCENIVHYHEIVEDGNRVMILMELMDVGSIDGLYRRSSVKRLSESVVRAIAWQ
                     TLRALQFVHNVCHRVHRDVKPSNLLLNRLGQVKLADFGLSSSISVQKNPQKDNSDLGV
                     HGPVREGKFVGTCLYMAPEMLRASPYDYRADIYSLGISLLECLQGKHPNYDDYLGCRG
                     HLDLIVTLLEKGSPEIPQEIRLSSNARNFLALCLAQDYRQRPSCQELLKHRWFDRLKI
                     PKAPIKNAHLPAPSRSARFTDSMHHCTNTVKRSNSPFPGRPTATREDKQVLSRPSLDL
                     NSMHGSLHPEGIDAVQGRRTASCFSDLEQRIADENSREEIAVFLRLLGITLDGSILQA
                     PQMR"
     gene            complement(<671328..>672074)
                     /locus_tag="CYME_CMT270C"
                     /db_xref="GeneID:16997947"
     mRNA            complement(<671328..>672074)
                     /locus_tag="CYME_CMT270C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539223.1"
                     /db_xref="GeneID:16997947"
     CDS             complement(671328..672074)
                     /locus_tag="CYME_CMT270C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539280.1"
                     /db_xref="GeneID:16997947"
                     /translation="MWAILTRTFRGHLFFRKPLVSCSSDCEPKQERRTRKKRAPGSGK
                     IQDASRAKDSAKAPVKRTSQKRKAEKKPPPPKNSRERVPWNRGKTLPEPLREKIKART
                     IAAHRRPDVVLRVLRRDQRPEAEPLPNVQIVGKQGRLEFSLQELKSLDWNWVAAVEQS
                     AAIPPDKSASAEGELPTRSGTGLENRRRRPPSTRPPPEIFQFEPLQMTPQVLRRMSYD
                     VERKLSDSSYLDAYEGKALPKKTLGPNARI"
     gene            <672190..>672906
                     /locus_tag="CYME_CMT271C"
                     /db_xref="GeneID:16997915"
     mRNA            <672190..>672906
                     /locus_tag="CYME_CMT271C"
                     /product="similar to nascent-polypeptide-associated
                     complex alpha polypeptide"
                     /transcript_id="XM_005539224.1"
                     /db_xref="GeneID:16997915"
     CDS             672190..672906
                     /locus_tag="CYME_CMT271C"
                     /codon_start=1
                     /product="similar to nascent-polypeptide-associated
                     complex alpha polypeptide"
                     /protein_id="XP_005539281.1"
                     /db_xref="GeneID:16997915"
                     /translation="MTEELPRQTEPLTEEETDQESASELKQEDIAEAARESGIDPKEL
                     AQQAALLQAHEHAVGAAGAGAGLPARQSRAEKKTRKALSKLGLKKVPGVTRIAVKKEG
                     TLLFVVSQPDVYKSSASDTYVFFGEAKIGESIGDAGAQAEARRFLDYSADSDQFGLEG
                     KLRDYLGGERAGADGAPGTRSGPSGDVSEQEEEVDETGLDPKDIELVVQQADVSRARA
                     ARALRNNNGDIVNAILELTV"
     gene            complement(<673112..>674371)
                     /locus_tag="CYME_CMT272C"
                     /db_xref="GeneID:16997916"
     mRNA            complement(<673112..>674371)
                     /locus_tag="CYME_CMT272C"
                     /product="eukaryotic translation initiation factor eIF-2B
                     beta subunit"
                     /transcript_id="XM_005539225.1"
                     /db_xref="GeneID:16997916"
     CDS             complement(673112..674371)
                     /locus_tag="CYME_CMT272C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-2B
                     beta subunit"
                     /protein_id="XP_005539282.1"
                     /db_xref="GeneID:16997916"
                     /translation="MASSSAEADSEDQRFEEIALKLLKSLDEAYESLYGAEFFTSVFL
                     KPVTYPTSNCRASARRAVAEETQPKNESGKKSKTNTVPFGNQLASALRVLLQYCATRS
                     LEAFLRDLTKLLNDQKLFSNILCQYVLENVLKRLLLLRQRRVQGFASSTAGAELETFV
                     AVSVLGSRGPSDSSNIFQERNDSSRRLLESCTVEEFRQEETVVELLNELESADSQIAQ
                     QSSEHIHSEEVVLTCGYSPLIMHFLLEAGKKRRFKVFVSEAAPECSGHRLASELAGRG
                     IDTTLITDAAVYAIMARVHKLIIRAEVVLAEGSVITRPTCRLAADAARAHAVPVLVLT
                     ELHRISERFPHDISAIEKSFVPSTLLPYESISPFQSRVGVSNPRYAIVPSSQVSIFVT
                     DIGSFSSNFAYYLLRELYGARNHDGLG"
     gene            <681446..>683563
                     /locus_tag="CYME_CMT273C"
                     /db_xref="GeneID:16997917"
     mRNA            <681446..>683563
                     /locus_tag="CYME_CMT273C"
                     /product="Type II DNA topoisomerase VI subunit B"
                     /transcript_id="XM_005539226.1"
                     /db_xref="GeneID:16997917"
     CDS             681446..683563
                     /locus_tag="CYME_CMT273C"
                     /codon_start=1
                     /product="Type II DNA topoisomerase VI subunit B"
                     /protein_id="XP_005539283.1"
                     /db_xref="GeneID:16997917"
                     /translation="MADNFRVRSPAEFFAENKNIAGFDNDGRSLYTTVRELVENGLDA
                     AEAAEVLPSIRIRLEELRGKDFQARLGLGGIVRRDFSMYKDFHEQRKLAQGKAAALRR
                     KKRRAPNVGPEGTSEPADEPQLEAPSDGATLETCTDEAATADAGAGVDEPQSGDAQFF
                     IVSVQDNGTGIEHERIPQMFGIVLAGTKYSVQQSRGKFGLGSKMALLWSKMSTGLPIR
                     ICSSTDSRQPLSLCMLDIDIARNKPRVLVHKKIENAIGFRGTEVSVTIRGNWKTYRTY
                     ILQYLRHMAIITPYAEFFFSYRGPIASKNFDLYFARRSDCVPPQPTQVKHHPSSVNQL
                     VLQQLMNSVPASTKLIDFLANELSSISRDYAKRLVCELGCSFSEETSVAEVKGNMLRH
                     LLELLRQAHFLPPSGDCLSPAGEYNLRLGIIKELSPEIVATHTEPVGVLDGHPFIVEV
                     GVSFGGAKVKPGINVFRFANRIPLLFEGGNDVVTRTATKLIPWTNYKINPITDRVGVF
                     CSIVSTRCPFKGTGKEYIGADAEPIQKSVRHAIMQCCQQLRIKLVRKSIQQERQERKK
                     RLSKYVPHVARAIHKVLLAMANHMEVLDGTSREKDHGQSLLAKVQAGLISESVIGEHL
                     MRHVAETEVEEHQDSKKGVAQIDLSHVYPGILPPAVQSLLRPSFKSAHDDANIDDIFR
                     LHFLDTQKASTAARLGECDGVPI"
     gene            complement(<683509..>684837)
                     /locus_tag="CYME_CMT274C"
                     /db_xref="GeneID:16997918"
     mRNA            complement(<683509..>684837)
                     /locus_tag="CYME_CMT274C"
                     /product="similar to alpha/beta hydrolase"
                     /transcript_id="XM_005539227.1"
                     /db_xref="GeneID:16997918"
     CDS             complement(683509..684837)
                     /locus_tag="CYME_CMT274C"
                     /codon_start=1
                     /product="similar to alpha/beta hydrolase"
                     /protein_id="XP_005539284.1"
                     /db_xref="GeneID:16997918"
                     /translation="MSYVDPFDADRWPRLTVTEKFISGLTGLATWFAVRLYGNALASR
                     RTDTAAATNLGAGSAGIGASLLSSWIFFNIEYTKRLNKPESLADPDSNFSRFCNLNVR
                     WKERNPEPSSPNASVTRRRIILLHGFGASLFTFRNVMDELARKTGSNVEALDLPAFGL
                     TSRSWSNHHYSLRSMAEVVGQFARMPARQANDICLVGHSLGGLVALQSVAQLPCAPRA
                     LILVSPAIYFRETKQRARGIRRCLQTVLLPLRYALATVQVSFRFLTAQISRGISPVLR
                     GLVRLVVSQERLWRYGLRLAVEDRTLIRPDVIEGYRLPDRVRGWDRALLAFVLNRYQG
                     VFSIKEFAQQVHRIAHGGTAEDYTDLLQNLRKLSIPVLIIHGRDDRIVPLRNSQLLAQ
                     YLGCELCIFDHCGHLPHEEMADRFIDCVERFIAQIGTPSHSPRRAAVEAF"
     gene            <685217..>688405
                     /locus_tag="CYME_CMT275C"
                     /db_xref="GeneID:16997767"
     mRNA            join(<685217..686877,687046..>688405)
                     /locus_tag="CYME_CMT275C"
                     /product="valine--tRNA ligase"
                     /transcript_id="XM_005539228.1"
                     /db_xref="GeneID:16997767"
     CDS             join(685217..686877,687046..688405)
                     /locus_tag="CYME_CMT275C"
                     /codon_start=1
                     /product="valine--tRNA ligase"
                     /protein_id="XP_005539285.1"
                     /db_xref="GeneID:16997767"
                     /translation="MQQPVRAVAFVQGGALLQRRWISDSTCRRLLGDASQRKRFAKEL
                     YSVPGVSLKSRALRLCSTTDASGKSVQTPFRTGSRPVFAENAEDAMPKNFDPAAHEER
                     IYSWWEAAGFFSPRDEGVGDIEKPFVIVMPPPNVTGGLHMGHAIGTTIEDILIRFHRM
                     RGRPTLWLPGTDHAGIATQLLVERALTASGKSRSEIGREAFVEMVWKWKQEKGGYITK
                     QLRRLGASADWNREKFTLSPEMSAAVAEAFVRLYDAGLIYRGTYMVNWSPALQTAVSD
                     LEVEFSEEKGKLYLFKYMLAEPGSEEDAFLPVATTRPETILGDTALCVHPSDGRFQKY
                     IGMHAIVPFVHRRIPIVADARVDPSFGTGVLKITPGHDRMDYEIGKTHNLPVITVIGK
                     DGRIVPYSETDARFVGLDRFLCRERIWADLQSTGQAIEVREHTTRVPRSQRGGEIIEP
                     LVSTQWFVRTRPLAEKALAAVREGQIRILPERFEKIYYHWLENIEDWCISRQLWWGHR
                     IPVYYINGDQENYVVARNVEEARERVRAMTVGDFTLEQDPDVLDTWFSSGLWPFSTMG
                     WPDENQPDYRKFFPGSVLETGYDILFFWVARMIMLSLELTGKIPFEVVYLHGLVRDAN
                     GRKMSKTLGNVTDPLEVISKYGTDALRFTLVTGSSAGRDIPLAEERVAASRNFANKVW
                     NIARFVVNAVGSDASETALWAEPSSNEWTGLSLNLADHFILAQLTQLVHDVTQHLESF
                     EIGDAGQKVYDFLWDDFADWYLEVAKAVLRTANGDSKAAAPSKRILALTLDTSLRLLH
                     PFMPFITEAAYQRLPSAVSNGHGTALMCQNWPMLRFPENQAAVTGFRRFQELVRKVRN
                     ARASYGVEPSRRIAAWVVVRSNNELEDFITSYPSVFASLAKIDEQQMHVVNVPPETDF
                     IRKCVHVIVDENIEAFLPAKGLFDVQVERERLNKQVQKIGADLAGLEKRLGARGFLQN
                     APPNIVEETKAKHQELKETITAIQQRLQLLEDLA"
     gene            complement(687602..688640)
                     /locus_tag="CYME_CMT276T"
                     /db_xref="GeneID:16997948"
     misc_RNA        complement(687602..688640)
                     /locus_tag="CYME_CMT276T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461705.1"
                     /db_xref="GeneID:16997948"
     gene            complement(<691387..>693375)
                     /locus_tag="CYME_CMT277C"
                     /db_xref="GeneID:16997949"
     mRNA            complement(<691387..>693375)
                     /locus_tag="CYME_CMT277C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539229.1"
                     /db_xref="GeneID:16997949"
     CDS             complement(691387..693375)
                     /locus_tag="CYME_CMT277C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539286.1"
                     /db_xref="GeneID:16997949"
                     /translation="MDLPAPNEADDETNPESGLSRATDVQNLTLFDGRPSSGTPREQA
                     VEPGSELRTAQSSVQVAQTSADEEFPAHASLGTQAVAVPAPAAAATNAQQVNCQQNVP
                     QASPPAVPEEAWAYATEEESKNVFAELRCFSARDLPCRTFIYRSGATIPERAWLDLVP
                     GQTRFIEIIIPLEFYTVFNPAFPRKQLWGRGPYTIDSDIVAALVQKGYMEPLLYYVVP
                     PGAYPYTERVLFGRAHEHDIESMAPGMNMVEGLGISAGNERVEGATSMLWASGPDPTA
                     TVESGRKQPSASRELVARLKIRRLTPGRKVLYPSYIHNEVYSRKWIYWGDDKTEPFAE
                     FEISRAELLVPTRTESQAPLHPMECIGYRLRIWKREELSQQTSLERKVYRFLKLSCDG
                     LSLSSPIMSAATAAAFMHAAGDLQSPMQASLINGMDVAKRRRIAFLHDHTFRFSLSME
                     PCLSYGLHLICDRGSRQDLRLSSRLVTEVAYFENAEGRRFELSQGSMDATGTPLYRFM
                     EVPNPHLLDRKQMISAGVPLPPALVRVPPELAEFGEGAEFMAWSDVAFGADHLRVKGV
                     VLPKITGVFFITRPPHAKNRSTKTQTENPTNAVIAHERHTLNESESAESSIGHVQYED
                     ATELASRANKVDQTSGGAPRDNDGMKRDKSLSKRSSGV"
     gene            <696216..>698135
                     /locus_tag="CYME_CMT278C"
                     /db_xref="GeneID:16997950"
     mRNA            <696216..>698135
                     /locus_tag="CYME_CMT278C"
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
                     /transcript_id="XM_005539230.1"
                     /db_xref="GeneID:16997950"
     CDS             696216..698135
                     /locus_tag="CYME_CMT278C"
                     /codon_start=1
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
                     /protein_id="XP_005539287.1"
                     /db_xref="GeneID:16997950"
                     /translation="MFAASALPLWSSRSCNVAVASARANVVRQHSHIEGAGRPRRHRF
                     KMCFAATREHDDDRNFRVGEDFLAKARASAEDLRARLCTVADGKLRVISLITYTDTQL
                     RPLAPEKRTSSTRVNGCTSVTFVEPHFGTTCGGETCVRYLEGYSDSRLASGAIVLLSL
                     ALCGKTLPEIERFRADTLLESFCLREIVMSPRMGGVKAILRHVQERMQVVCSGRHLAP
                     QEPATLTQKSYSANLDVVGPVLGDESPAEVAVLLSGGVDSAVAMASLLERGFRVQPFY
                     LKIWLEDELANLGRCPWEDDIRDAEKVCAALARKYNQRVQLETLSLQEEYWSRVVQYT
                     IDEARRGRTPNPDIMCNSRIKFGAFLDSLGQRYALVASGHYARVVTMRHTERGGETHA
                     VAQLFCSPDIVKDQTYFLSQLSQQQLLKATFPIGDLTKSAVRRLARERYNLPNCDRPD
                     SQGICFLGKLKFEQFLEHYLGTWAGPIMEAESGRFLGTHRGFWFYTIGQRKGLALPGG
                     PWYVVGKDLENNIVLVSRERSQCNVTCRSFIVENVNWIGWEHSNTNEEPMRCRVKIRH
                     GPRSVSAEVHCLEPKNQSWIIALDEPESGIAPGQFAVFYRENQCLGGGVIASVPALQV
                     SRTIQRRSMTEECTI"
     gene            complement(<700197..>701885)
                     /locus_tag="CYME_CMT279C"
                     /db_xref="GeneID:16997969"
     mRNA            complement(<700197..>701885)
                     /locus_tag="CYME_CMT279C"
                     /product="similar to prostatic acid phosphatase precursor"
                     /transcript_id="XM_005539231.1"
                     /db_xref="GeneID:16997969"
     CDS             complement(700197..701885)
                     /locus_tag="CYME_CMT279C"
                     /codon_start=1
                     /product="similar to prostatic acid phosphatase precursor"
                     /protein_id="XP_005539288.1"
                     /db_xref="GeneID:16997969"
                     /translation="MWGRELFSIVFFAVLVLLVAIHILGSADVVRAFQQGLEHRLTVE
                     SKEAWLGGVPLGDVSSYVVPRNASPYESLHSEGKVKAVVIVARHCDRAPQNYAPAYAT
                     GTRRRPYKPFPFDKTKWDVDYGELTALGMYQCYRFGRFLHERYVQGHPNDRLLRARYN
                     HEETHVRATDVDRTLVSAAAVMHGLYPAASNPSHQRRHRYSKKQYHIPGGFQYVPIHT
                     RLYGDDRLLDGSGKGRCQLWDIVSKKMLKSDFVYGELQRRSDLYAALPSLANVSVEAF
                     QSMKKKKKLALAATLRDIRICQKSHSIPAPATVSRFDADLEVLTARLNGAKWDASGLG
                     PLVGGRLLRSISTRLATAIEADNGNVQVLARAKDECNRKGHDGDEIGNCYRKLVYYSG
                     HDTTIFDIRAALGVTAIEDGIAPYASHVIFELRRTGPEENDFRVSVYAGHYDQKPRPL
                     FGPFCDGNFSCTASSFFSWVLNTVPNNVSEACIRTERAPDILRRALGNVAKEDNAFQS
                     GHKAVREQSASGGAFSRQFARVLIIGTIGFILVLSAPIVFRLRRTSIRSEYAAV"
     gene            <703805..>707428
                     /locus_tag="CYME_CMT280C"
                     /db_xref="GeneID:16997970"
     mRNA            <703805..>707428
                     /locus_tag="CYME_CMT280C"
                     /product="isoleucine--tRNA ligase, cytoplasmic"
                     /transcript_id="XM_005539232.1"
                     /db_xref="GeneID:16997970"
     CDS             703805..707428
                     /locus_tag="CYME_CMT280C"
                     /codon_start=1
                     /product="isoleucine--tRNA ligase, cytoplasmic"
                     /protein_id="XP_005539289.1"
                     /db_xref="GeneID:16997970"
                     /translation="MEQFSCGGRLTSAQVKQIAPEAVNFPDRERLVLSFWNDSRAFER
                     SNELAVGKPLFTFYDGPPFATGLPHYGHLLAGTIKDTVTRYAYQTGYQVPRRFGWDCH
                     GLPVEYEIDQKLGIRSREDVLKLSIAAYNEECRKIVLRYSGEWERIVSRMGRWIDFKN
                     GYRTMDTSFMESVWWVFSQLHKKGLVYRGFKVMPFSTACSTPLSNFETNLNYREVQDP
                     AITISFPVLNDPDHASFLAWTTTPWTVPSNVALCVHPELIYVRVRDHSREDRVWILAE
                     ARLGSIFKMNDARKHSSACEFTIIARHHGYELVGLHYEPVFDYYKDSRFRELLRDPFR
                     VLGDDFVTADSGTGVVHLSPAFGEDDYRVCMREGVIGCAGGRPDRPVWLPCPVDEDGK
                     FTEPVDDFRGMYIKEADRGLIRKMKTLSRLVKHETYTHSYPFCWRSDTPLIYRAVPSW
                     FIAVEKFRDRLLDCNARTYWVPEVIREHRFANWLENTRDWNVSRNRYWGTPLPVWTDR
                     TGDEIIVVGSIAELEELAGLPTGSISDLHRHNIDSIEIRSRQNPGNVLRRVEEVFDCW
                     FESGAMPYASVHYPFEHEEDFFQKGMFPAQFIAEGLDQTRGWFYTLMVLGTALFNEPP
                     FKNVIVNGLVLAEDGKKMSKRLKNYPDPMDMIENFGADALRLYLINSPVVRGEPLRFK
                     ETGVKDIVRDVMLPWYNAFRFFIQNFAAFAEANAEADTLLRQAKGTTERSNPMDRWIL
                     SLLASLISFLHKEMRAYRLYTVVPRLLLFIESLTNWYVRLNRPRLKGSGARSALDQAV
                     ALCTLGDLLSRLAVLMAPFAPFMAEWTYQTLRSLPLVSLYEQTADSVHFLPLPSSDEE
                     AVDLVFEEKVRHMQLAITLGRAIRERRNVALKQPLHTLTVIHHNEQTLQNVASLEEYV
                     RGELNVKQVVYSTDEDRYISRRAIPDGKLLGRRLGSAFKEATAEIRSWTPMQVAKVER
                     ERSATVCQGRYQISVDEIFINRDVNREALREGEDVECDVLNGMIVILNLGIDHELFLD
                     GIAREIVNRVQKLRKKLGLVPSDRVDVFIEGGSVVEQALNSRADLVGSMLGCKRLLCT
                     EDLSLLRKRFIPQIPLIAQEHVEPLQGDHVCISLVRAGLWLLPSAFTKRPATFLHALQ
                     SFLLGIRERFAAANENPNILRVVLDGERLELHEHIHFSRYAADIVADLKATAQHTASM
                     EAR"
     gene            complement(<707960..>710014)
                     /locus_tag="CYME_CMT281C"
                     /db_xref="GeneID:16997971"
     mRNA            complement(<707960..>710014)
                     /locus_tag="CYME_CMT281C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539233.1"
                     /db_xref="GeneID:16997971"
     CDS             complement(707960..710014)
                     /locus_tag="CYME_CMT281C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539290.1"
                     /db_xref="GeneID:16997971"
                     /translation="MQRRWNRTGLKVPKNADHWCSELPAHHTTSSEKNAVLYGEFMLS
                     KAEQSLEYVPCYAFLVFLRLSAHSAPVQLYPVRDTATRPKLTCNRVQMFASSSGASSR
                     PRGHAMTRFSADGFLLCRRIVQPKLKLGTADLRVRQRWRLRRLRSAGPQRQQEGYMLL
                     DGFFRQFQSVVEGLRRLAPLSDATSAPPVKLRLRKLDPTPELYNIEEEGLVPLVLVAG
                     ATGRTGRLVVRKLLLQGFRVRALVRDLRPETLDELGTGCEYAKADLLDKDSVLEALYG
                     VDKVICVVSDESERETEAITNLIRAFQDARFLEFGRKDSAKITIFKFNKPRHFALWAR
                     PENLQTAVVKAYQNEVGNVDQLLQDNNEDQSAPVMPQAAMEESGRLRDPLSSTFFQLN
                     DFGNAVFHGKIRDIYRGQAEVFTTSFARKPLNFQGFSGLILRCLGDGQRYSLIIRTKS
                     GDRAGIQFISTFSTTPSRKWITLRFSFPDFIPQRTSDGALLQAEIRDASVYDFSEITQ
                     IGFLYEARNNLSIRSLSNPGSRKGTFMLTLDYMKAFRTQDEPEFVLVSCMGTHADMEE
                     ISRKRSIEDALKAGGLSYCIIRTGVLTDEPGGVTSITFDQSQIQGRGLPSGVVVSEIV
                     RTPFTKKISRADVADVCVASLLDARACNVTFNVFSSAYAPTTRIPTRNYSALFETLKP
                     NT"
     gene            <713075..>714709
                     /locus_tag="CYME_CMT282C"
                     /db_xref="GeneID:16997972"
     mRNA            <713075..>714709
                     /locus_tag="CYME_CMT282C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539234.1"
                     /db_xref="GeneID:16997972"
     CDS             713075..714709
                     /locus_tag="CYME_CMT282C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539291.1"
                     /db_xref="GeneID:16997972"
                     /translation="MLAALGQAQLEDPPVRRLAFAWRIGSWSSRKGVLAWASLACSSR
                     NLGCDTRLQASQQRKCQRSAVPFQWSCSKDPVERSRGAKSPESDDREVFRKPHSPSSE
                     RDAVVAKSAKEQRPVTQTTANVVEGGHNEERNDRGAPADSLAALQEDLPLIRQIFGAD
                     TFFPTEDVVGKRGVVYRGNLRNKPDEVYRRLAKRLESLLGDRYILSLLEGDENGRAFV
                     LIEPNGTLAGDSTARPFSVKKEDVLTIMLALLFCILTGMTIFLRVGTILGPEYGEIRR
                     ITFQNGVKPVFFSFFSTLIAAQLLQRLLAWKYRCSIGTPILLPSPQLGSFGSVYHLDQ
                     SPPDRKALFDIAMASGGLPFIVSILIFTVGVIMTSFAVGLPLASVHGSLMNVRNFVYV
                     PEQWIYRDSFLLGLIARALLSVQPVTLNAAVAADQQLAPLVLVHPLVLVGATLMQISA
                     LSLLPLRQLDGWRILTAIFGRRAASLLSRFTVLYLLIGAARYPYLLLFLTVIPFGPWK
                     LDRQCRNEISETDRIRQIVGYIVIVIMIFAMCPYSK"
     misc_feature    complement(716758..717622)
                     /note="possible transcribed region"
     gene            <717890..>719104
                     /locus_tag="CYME_CMT283C"
                     /db_xref="GeneID:16997977"
     mRNA            <717890..>719104
                     /locus_tag="CYME_CMT283C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539235.1"
                     /db_xref="GeneID:16997977"
     CDS             717890..719104
                     /locus_tag="CYME_CMT283C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539292.1"
                     /db_xref="GeneID:16997977"
                     /translation="MNRNSRLTAQSTVFIGPKEGSSSVGLFLARLWQRRRLHRRVRGA
                     SRSLQATATQPQWSLVQVARRVLFPPLWVELARAHVLAKFSRAFEQVPRKRRDGTAAP
                     AAVSTAVEAAAAPSPSRNAARGGQGVSRTQLLGRIVYEWVDYDQRRLVCARQTADGVP
                     VVDPRCSAIPRTERLRNKWRRLRELSAASSEREAADGAGPQTDNVALVGAPAGPPPVE
                     SPTEQYAVVKLESGPGTLHEDTEEDATLERCAGPALARCWSAPELGDAEDDSTRYEPE
                     RSPLDYLGNVPLLFTTNTPQGRLLQRRLRVARLQMHRLVREGVRTLMQSAPLRLALGA
                     RLRCLDGAAAYESQREARQVTSGPVRDASPAAWKRFSGDGVLRSVSQAALATLGTLRC
                     EWPFHVRRLRDQ"
     gene            <720731..>722689
                     /locus_tag="CYME_CMT284C"
                     /db_xref="GeneID:16997956"
     mRNA            <720731..>722689
                     /locus_tag="CYME_CMT284C"
                     /product="similar to permease involved in the uptake of
                     glycerophosphoinositol Git1p"
                     /transcript_id="XM_005539236.1"
                     /db_xref="GeneID:16997956"
     CDS             720731..722689
                     /locus_tag="CYME_CMT284C"
                     /codon_start=1
                     /product="similar to permease involved in the uptake of
                     glycerophosphoinositol Git1p"
                     /protein_id="XP_005539293.1"
                     /db_xref="GeneID:16997956"
                     /translation="MADPIVDIAPDQIFIGAEEPSAQVHDVESKGAVAEESDKSYIRY
                     NAIGTALGFLVNGYMYQVGTLLLTLYVDAYYTVYASTFLQSALSTSVLYGVLFGLLSF
                     GFIADIIGRKAGLIACSCIVILGSILSTAANGKTTDGMFWMIIVGRAVVGLGMGGEYT
                     CNVPNIVEDSEEVSTKTRGRRVSLLVMLMEVIGNNTPTLIQLILIAAACRHVYITSSS
                     STGVSLPNCRPQVVWRISYGLGLIPCIIVLFLRVRMRDSKMYRKDENLRRKSYDLLDL
                     FVIFRHFIPRMIGTIFMWFLIDWINYSQGTFGGVILSSVIGASLFKTAWISLAQGVVL
                     TLGPVAAALVVDRLGRRKTEVLGWAWLASTQLITAGVYLMLAKHAVGYVIWTTFVFIF
                     QYFVFIPVYLVPAEVYPTRVRATLYGWSSALGKVGGIVGTTVFPYMWSALSPDGNESG
                     HSGLLGLRKIQWIYAGIEYFGLILALLFVPEYSNVSLRGEENRFLAMRARYAARFAKS
                     LGAQPAPAASFESIQIGHYSWWSLLYLRLFRSREEYAAALEQYAQMLLARSYITKVEQ
                     LEQYAAAPVYYNDRTLFSNLIRRIRLGAEGAREYNRLSELMGEESMENPAFGEQQAKI
                     VLSADGGSSDEKVSKEATDTTTDNSMTF"
     gene            <725038..>726804
                     /locus_tag="CYME_CMT285C"
                     /db_xref="GeneID:16997957"
     mRNA            <725038..>726804
                     /locus_tag="CYME_CMT285C"
                     /product="phosphoglucomutase"
                     /transcript_id="XM_005539237.1"
                     /db_xref="GeneID:16997957"
     CDS             725038..726804
                     /locus_tag="CYME_CMT285C"
                     /codon_start=1
                     /product="phosphoglucomutase"
                     /protein_id="XP_005539294.1"
                     /db_xref="GeneID:16997957"
                     /translation="MEFDIKTVSVEPFEGQKTGTSGLRKKVRVFQQPGYLEAFVQSVF
                     CALPEIPGSGFDQPSAEERVLVLGGDGRYFNKEAIRNILRLAAANNVNRVLVGQNGLL
                     CTPAVSAIIRRRNLAGGIILTASHNPGGPEADFGIKYNTKDGGPAPESYTDVFYKWTR
                     QIREYRIAVDPSTADGDPFSEISLERPRVYEFLSRDTKSRFVIEVIDSMDDYVSLLKE
                     IFDFQMLRELFRRSDFSMLFDALHGVTGPYGKRIFVEELGAAPESLRNCQPLEDFGGG
                     HPDPNLVYAADLVSRCDPKQNPNAPQFGAASDGDGDRNMVLGRGFFVTPSDSLAVIVA
                     YAKDAIPYFRKGGLVGAARSMPTASAVDKVTAKLKINVFETPTGWKYFSNLLSSGKAQ
                     ICGEESFGTSSDHIREKDGLWAILCWLSILAYRNVGKTPVGSFIGIQQIVEEHWKEYG
                     RNFFTRYDYEECDAVAAERMMAHLRQYQENGDYAVLERVVGHPVIVADDFTYTDPVDH
                     SVAKNQGLRFVFANGSRIVFRISGTGSTGATIRMYIEKFVQDQAKMFADTAEALSDLI
                     HVALQVSQLEAFTGRTAPSVIT"
     gene            <728900..>729478
                     /locus_tag="CYME_CMT286C"
                     /db_xref="GeneID:16997958"
     mRNA            <728900..>729478
                     /locus_tag="CYME_CMT286C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539238.1"
                     /db_xref="GeneID:16997958"
     CDS             728900..729478
                     /locus_tag="CYME_CMT286C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539295.1"
                     /db_xref="GeneID:16997958"
                     /translation="MDELNSPLGERAQGASLAHVVWSDPQWLERYPLTFENVLTYFSR
                     SPFYDPTCNNELVRMQMHPELQGEMLYYTQREEELLLGMQGVEYVPLCSSDAHELFII
                     RKQVRRSADEVHVTNLYYILYGQVYEAPAFSTVLLVRLRQSADFLVRSLGLLRQWLSK
                     KEYGEPGATGHGHEDTLLLQLLRKAQQRNRQL"
     gene            <731276..>733714
                     /locus_tag="CYME_CMT287C"
                     /db_xref="GeneID:16997994"
     mRNA            <731276..>733714
                     /locus_tag="CYME_CMT287C"
                     /product="unknown zinc-finger protein"
                     /transcript_id="XM_005539239.1"
                     /db_xref="GeneID:16997994"
     CDS             731276..733714
                     /locus_tag="CYME_CMT287C"
                     /codon_start=1
                     /product="unknown zinc-finger protein"
                     /protein_id="XP_005539296.1"
                     /db_xref="GeneID:16997994"
                     /translation="MKYGHRLRAFYEVFGAADQVGPDGTAPDARERPAPGTAPKSRTS
                     DWHRQVEPEVVCDVAENAGRDSSAGYETSASSGAGGGRGSSQRSLSPVPAEDTTSEAD
                     PLPDAAVMGPRAPASQLPDLRSELGDRYRALYAMYKAGKAAVRCIRATMDEHAPRAHH
                     RTSVPPEALGRRSRYLKLLGNNLQLSRIPSDLEQVFDAVWVFFDSIIREIGAFRRVFE
                     ERTADLQCRLDVLRQQGASSSVRGALELGAEAEQVLVCLQIAQVAIGKILKKFTKALA
                     LIASDEAAARGWHGWDVADVREDALEGAGQSESEQSSTTTTSATPAGSGGRSDADGVD
                     KRRGGTRGVGNAAPNAIQDAKLERAVRLAMCGSLSSALALDPSEEAPPLVLVTRLRRF
                     LVQQPFVCDQRRLGFLADLRHRKDCAVLALHRILESLTPAATGDDAALGGAPTGQLHT
                     AAACAPGRGVDGDQRTLGALTLLRHVLDDVPPPGEYSLHAPSAHLPALPPGGRVRPFA
                     EECRLLARQLESQLAAYNPTTDPSSPYEVATRFYLANVAASGPAVTAEAFLRAARSVP
                     MHFLCPICLDMLFETVELPCRHRFCEVCIQEARFSAELQGATLSCPLCQPGLYRRHCC
                     ETADTSAVQAARHASASPEECVSSAERDALSPADACARTEQRERRASSIDGLLRAAFP
                     AQWRLRERQARATREMLERRRRFRERVAHLDAAKLRSSGNLESVARKRFHWVCQCFGD
                     RSGRARPVATPPPSAGDAVADVEPAADGRRAGLVDARAGVLGDPKPDAAAQTQGKPAT
                     SVPQNRARSACSIA"
     gene            <735004..>735990
                     /locus_tag="CYME_CMT288C"
                     /db_xref="GeneID:16997995"
     mRNA            <735004..>735990
                     /locus_tag="CYME_CMT288C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539240.1"
                     /db_xref="GeneID:16997995"
     CDS             735004..735990
                     /locus_tag="CYME_CMT288C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539297.1"
                     /db_xref="GeneID:16997995"
                     /translation="MFVSACCNGTRNLIAVQRQRRVKTSRSGGFACTRRFGPRLKRLP
                     RLVAAVEKETEKVQGSVNGSDADADGGLQGYKSTDPRTGASRELSLGEKERLYLEAVY
                     SFYNGEPILSNEEFNVLKEDLQWNGSQVILMNRDEQRFLNAAQAFYNGKPIMSDEDFD
                     ALKDRLRKQGSQIALQQGPRCNIETGVCYSDCQVDKLRQAVIYAPAAGIGALLWAGLS
                     FELTPLRHVNPVWNLFIGAPVIYACAQLLTGIVLQNDPQIVVGECPSCGSEQRVFFGD
                     ILGVEGYRDVAEIKCERCKASLRLDRKRMRLEQIPRIQGPSIKQRENVAPAS"
     gene            <737442..>737861
                     /locus_tag="CYME_CMT289C"
                     /db_xref="GeneID:16997996"
     mRNA            <737442..>737861
                     /locus_tag="CYME_CMT289C"
                     /product="PGR5"
                     /transcript_id="XM_005539241.1"
                     /db_xref="GeneID:16997996"
     CDS             737442..737861
                     /locus_tag="CYME_CMT289C"
                     /codon_start=1
                     /product="PGR5"
                     /protein_id="XP_005539298.1"
                     /db_xref="GeneID:16997996"
                     /translation="MHKPAFLHIGSLSLNSGTSVRWLRPCAKTHASCCRVLVTQNPAF
                     RVARTGTSSSHHCRLRTTKSRLFMASGQVGIFTPVVIVARAILGKQRFEKIRGRGIAL
                     HSQAITNFCKFAGVDNKVRQGLIRMAKANGSKLGFLS"
     gene            <738776..>740425
                     /locus_tag="CYME_CMT290C"
                     /db_xref="GeneID:16997997"
     mRNA            <738776..>740425
                     /locus_tag="CYME_CMT290C"
                     /product="similar to TFIIH subunit SSL1"
                     /transcript_id="XM_005539242.1"
                     /db_xref="GeneID:16997997"
     CDS             738776..740425
                     /locus_tag="CYME_CMT290C"
                     /codon_start=1
                     /product="similar to TFIIH subunit SSL1"
                     /protein_id="XP_005539299.1"
                     /db_xref="GeneID:16997997"
                     /translation="MTQLCVERSGSCRLHLQRPVQQSALSGRPEGVRLECTSASFIVN
                     APMHLPFTQLEEPARDASERLQWDARAAGLQPREQVAPTSRREDEANYAWERRYERSW
                     EAIGVSDAGGGIFRRDALDQQRQRHRDLERVLQDSAASAARRRVGRALGLIRFLVLAL
                     DLSAAVRSRSRSSLSSSSQDLKPSRWSAILSGAQYFVQDFFSENAVSQLAIVILQDGI
                     AAQVSEMSGSVRLHIDALRSLQRGTNKFLHDGDGGQTSLQNCLELGLRIHASVPRFGT
                     REMLIVYGGLSTCDPGDIHKTIQNCVDASIRVSVIGLGAEVYILRATAERTQGTYRVP
                     MDNDHFHQLLRQQVPPPPPPPQASRSTKHLEPSEAPWTAMQMVMGFPPKLARDRVVVA
                     IDTRKACRLGFECPRCRQWLSEVPGNCILCGLTLTSVLHLARSYHHIFPAPRFEEREE
                     PSSSRASALMSDEEGFSVSPSSVPERMPDAAAPPVKWQCSGCSRTLSTKDDLQLQCTG
                     ICRQLFCIDCDQLVHERLHTCPACLAMSLNMRQRSIPRTIT"
     gene            complement(<740454..>741494)
                     /locus_tag="CYME_CMT291C"
                     /db_xref="GeneID:16997990"
     mRNA            complement(<740454..>741494)
                     /locus_tag="CYME_CMT291C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539243.1"
                     /db_xref="GeneID:16997990"
     CDS             complement(740454..741494)
                     /locus_tag="CYME_CMT291C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539300.1"
                     /db_xref="GeneID:16997990"
                     /translation="MFSELALYQPHVRRGSTRVCCFAVACAEPSASKPQTGKKKLADA
                     NVRNVRRARHPAQSGVTPEAARPRKRSNARPTERTNRKAKYEDAETIPDLVARRNSQS
                     KQLSPATLDMFFRHGSIVEPGPDPSPSDEPDWSACELNGQKCRINEIDTVVKKAPERV
                     LRCLVAYENSPLVPSGEIEEQLRLAMQNLFSRKLDSSTPKTKQTLEELEEKTCCPTCN
                     GSGWETCEYCGGRGIIHESEYQQNFKSNRIMVYLPIRLTYGNLLRCPLCGGLRKERCS
                     QCFGYGDLHVAQSVLEELNREQQIDPNDAPPELGNMMENEARDQSIARFRELERKTIL
                     TEQSNTDFHEFR"
     gene            complement(<743699..>744985)
                     /locus_tag="CYME_CMT292C"
                     /db_xref="GeneID:16997991"
     mRNA            complement(<743699..>744985)
                     /locus_tag="CYME_CMT292C"
                     /product="ribose-phosphate pyrophosphokinase"
                     /transcript_id="XM_005539244.1"
                     /db_xref="GeneID:16997991"
     CDS             complement(743699..744985)
                     /locus_tag="CYME_CMT292C"
                     /codon_start=1
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="XP_005539301.1"
                     /db_xref="GeneID:16997991"
                     /translation="MHACPQFVALRPTLSHPQRSVSLKNCSRWRPSITGFRRRRREAS
                     WAPGSCSRVRIPEAIAEPPEKKQERRGEGVYVSVYEPFVRQSDTVIRSGLNFGTSRLR
                     IFGGSSTGELPDRVARYLGKEGTDRIIRKRFSDGELYVKLPESVRGCDVFLICSTCGP
                     CISDSIMELLITIDAVKRAHAAQVTVVVPYYGYARADRLVEKREALSSKLMANLITRA
                     GADRMILVDIHSPQSCGYFDIPVDHLYASPALVRYLMERIEQSSADTNHHGAARQLAD
                     LVVVAPDVGGVARARAFAKALCDAPLAIIDKRRSGHNVAEVMNLIGEVDGKIAVLVDD
                     MIDTAGTICAAARLLREKGAACVFAMATHAVFSGPAIERLSEPGLFEEVIVTDTIPVP
                     REKQFPQLRVVTIDALLGEQIWSIHRDSSISRSVVL"
     gene            complement(<748189..>748626)
                     /locus_tag="CYME_CMT293C"
                     /db_xref="GeneID:16997992"
     mRNA            complement(<748189..>748626)
                     /locus_tag="CYME_CMT293C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539245.1"
                     /db_xref="GeneID:16997992"
     CDS             complement(748189..748626)
                     /locus_tag="CYME_CMT293C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539302.1"
                     /db_xref="GeneID:16997992"
                     /translation="MFLISVFEPRNFSRPRRDTVGRCQCRRYAKQMRRPVPGLLAVRA
                     EFQRVLTEENVQAVLHEAKETFSTVFGSEENRQVGITGEVSLVGIDGATVVLALKGQF
                     WHQRVVVLQRLDKFIRDRIPECIEVVALEGTTPDTDEFDNRRF"
     gene            complement(<748869..>749228)
                     /locus_tag="CYME_CMT294C"
                     /db_xref="GeneID:16997993"
     mRNA            complement(<748869..>749228)
                     /locus_tag="CYME_CMT294C"
                     /product="similar to apoptotic cell death regulator DAD1"
                     /transcript_id="XM_005539246.1"
                     /db_xref="GeneID:16997993"
     CDS             complement(748869..749228)
                     /locus_tag="CYME_CMT294C"
                     /codon_start=1
                     /product="similar to apoptotic cell death regulator DAD1"
                     /protein_id="XP_005539303.1"
                     /db_xref="GeneID:16997993"
                     /translation="MASTDLTIRSVWRSLKEGYRSKVPSELQLLDSYVAFLAVVLGVI
                     TSFAAVVGTYPFNSLLAAAFCLIGSAVLTVGLRMQINARNRTKLNRWEHRSFESAYVG
                     WLLGHLVLFLTAVNFVG"
     misc_feature    749369..749632
                     /note="pseudo-gene of 3-oxo-5-alpha-steroid
                     4-dehydrogenase"
     misc_feature    complement(751377..751886)
                     /note="possible transcribed region"
     gene            complement(<753870..>755657)
                     /locus_tag="CYME_CMT297C"
                     /db_xref="GeneID:16998005"
     mRNA            complement(<753870..>755657)
                     /locus_tag="CYME_CMT297C"
                     /product="ribosomal protein S6 kinase RSK-1"
                     /transcript_id="XM_005539247.1"
                     /db_xref="GeneID:16998005"
     CDS             complement(753870..755657)
                     /locus_tag="CYME_CMT297C"
                     /codon_start=1
                     /product="ribosomal protein S6 kinase RSK-1"
                     /protein_id="XP_005539304.1"
                     /db_xref="GeneID:16998005"
                     /translation="MTIATLQRHEAGEDEEPAFIPAGALLQMTTTASSDLPAAAVSNL
                     SNRTAGPAVYHHRLELFQILSVLGTGAFGKVYLARYRPTGGLFAIKSMKKEALLRFGG
                     TAQARVERDILALLMDHGYELNPGLGRSPRTNNNMRNEQRAVHPFIVRLHCAFQTSSR
                     VFLVMDYLQGGPLMDYLRKEALFSEEVARFYAAEMYIALQHLHSIGIVHRDLKPENVL
                     LDHEGHVALTDFGLSKAGMGRLDTETGAGMAQSADASLRRAPGNGGTAGAAHADAVSA
                     PNDSAMQTQLESIDASDLVDSGSLTHSWCGTEHYMAPELLAREGHSFAADYWSFGCLI
                     YEMLTGEPPFSVRAQGLVGKRDRGRRAKVAAQAAADNKTGGKAPPENVHSRVALYKRI
                     MKAKIKFPSYVSTEAQSLVRQLICRSPEERLRHALCLQHHRWFRGISWKRIRERLERP
                     PITPVVDSGSRMGSPSASTAHRDDSWSVSPHSPHWMPAEGAPDTHLVAYTYVAPHALH
                     AFGEYLQAWRTRGGHDSSFPIDHQVKLSSSTSSVSERDSSRFCGRNLETESDSTAREV
                     ADALEDIRIAVSEGIEIFSIDGAEYDRAP"
     gene            <756529..>761103
                     /locus_tag="CYME_CMT298C"
                     /db_xref="GeneID:16998006"
     mRNA            <756529..>761103
                     /locus_tag="CYME_CMT298C"
                     /product="large fused protein of putative glutamine
                     amidotransferase and glutamate carboxypeptidase"
                     /transcript_id="XM_005539248.1"
                     /db_xref="GeneID:16998006"
     CDS             756529..761103
                     /locus_tag="CYME_CMT298C"
                     /codon_start=1
                     /product="large fused protein of putative glutamine
                     amidotransferase and glutamate carboxypeptidase"
                     /protein_id="XP_005539305.1"
                     /db_xref="GeneID:16998006"
                     /translation="MCRMVAYFGPAILAADVVTRPSRSIIRQSYDARERLCSAGEYVP
                     ASLNGDGYGIGWYSDDGVPCVYKSIRPAWNDANLHHLAEKGIRSHLLFAHVRAATAGT
                     SVTEESCHPFAYGRYLFQHNGTIAGWHDGRVRRALLNQLNDELYGYAVRNGASDSIVA
                     FALFLNQMDRGTSERYSAAELQEMLLHTIALIVETTTTCLLGTNSPCSDRTPANRKSM
                     PRDDVFLLNFLVTDGETLLATKYVRGLRDLDAPAASLYFGAASSYGPVTHHVGTGAED
                     YAFSYRAATWAGVVVVASEPLTSNPCDWVPLPRNSILVATADRHLLVEKMPDLLMGRE
                     SPRAGSRLSPKLLPQSSALVQALHAFAGSTATRSIADRGDPLPPMRSATAAAHVSWSR
                     QQQHQEQERRKKPLLRSSQQELSSAGSGAISTDLIEIDESDRLFTIRSSRVLCMTTVP
                     VQEDALPQIAQELETMPLSAATATSNRSGCTGSQRQALLVCGTGDGHMYALHQISGLL
                     ASDSFVSADGRDILGIARWQCNNLAAYFEQKGMQPSATFTVCAAADNTVRMHRWTVDG
                     IEEIANFFCGTATGHPLCLVTDQSAVYLGFQDCSVRRLDMQGLLGTVKVEPEARPEGA
                     AHVPVLSEQALFRRLGQRGEHSDLARASQHCGPVYCLALHSKTRRLFSGSGDGTIAVW
                     NTESEEHEATLRGHCGAVLALKLDENVDILFSGARDRRIRVWDVARSANYVCRRILLS
                     WDYHCDDICALELSESFLFSASTDGVVVLWSRPDLAALALLRLPSGTLLTSLCVTPDA
                     SAMRPAATSDAMSTSGMLFAATSDGSVYGWHLGASGSLYGRIYGTDAADLEGTSRVPT
                     KTLPTTAASSCAGSLEAATPNSMLFSLSSPRIRLGDPEWSSVAAFERALRTAIRFRSI
                     AVDTKQSNFREESFHCARWFSRLLENLGADLRIAQPVDGKNPVILARFVDIIGCKGHA
                     CRPGPPAFPSSLARARVQHRHTVDAAHDGEREHQAQQVRRQHFRQTVVFYGHYDVVPA
                     HREDGWSHDPFDLQVSNGYFYGRGCTDNKGPILAMIFAIVDLLQEQQQWRHQQRNIPA
                     DHELAPRTAANTLTSSTRTVPPPAESVHAAVSAGACDNIHGACDDFERSTNVVLLLDG
                     EGEASSAGFRETIALFRDWIVGKDLDQRQAGQQLVPNGDPRPAPNEPVPQVVCVLHAN
                     SLWVDDVRPCITYGMRGQILLSVEITGPSGNLHSGFDGGAVLEPAADLLAILATLSDA
                     GGTARVPGFYDDVRELTPSERSWLSAVHFDRQAYLQHLGVSRLAADNDLDLLQKRWCQ
                     PCLSITELSTSANAVANGAASAARSSTGRLGAISALIPQRAQATVAIRTVPNQSPEKL
                     RAAVEQHLHFEFAKRRSPNQLRITCTKQGDWWLGDIHGERYPSSSSSSSRQVEQRTGC
                     EQRARQRVFAVSERAIERVWGVQPLYVREGGSMPLTAWLEQTLEAPAIHLPLGQSSDA
                     PHLPNERIRVLNLFHGRMILGDIVRSLAVQ"
     misc_feature    complement(759703..761640)
                     /note="possible transcribed region"
     gene            <761794..>763518
                     /locus_tag="CYME_CMT300C"
                     /db_xref="GeneID:16998025"
     mRNA            <761794..>763518
                     /locus_tag="CYME_CMT300C"
                     /product="similar to origin recognition complex subunit 4"
                     /transcript_id="XM_005539249.1"
                     /db_xref="GeneID:16998025"
     CDS             761794..763518
                     /locus_tag="CYME_CMT300C"
                     /codon_start=1
                     /product="similar to origin recognition complex subunit 4"
                     /protein_id="XP_005539306.1"
                     /db_xref="GeneID:16998025"
                     /translation="MPALHPRVQWRERSSWRDAPPCAYGDALTWETMHGPRRPASATA
                     KASACDERSADVGAHDESAARRARTLITEHLTGPVLGEGLSFTPGLEAVCEKLVEFLV
                     AALAPDSEQRRRAVKSLLIAGPQGSGKSSVVETALARYRKRTPRARPAIFYLDGEIFA
                     DGDLSAYRSFVAQLRRELRLYDGRFPSRFAGWESPLPETSSMPDEEVPANDVPHQASA
                     CIEAIVEHVQTLLRWTLESAERSMSDAGVHRIAGIVLVLDNIDYFARRMQHVRQHLLY
                     SLFNMLGFDDASPFVIIGLTRRYDAMDLFEKRVRSRFSQTVLHVPLPESSDAVRTHLA
                     SKLEAFSKPEVVSICPRLAASARALQQVLLEDQRLARSIADLFRHCRVMRLYQGALSH
                     ALVALTYAAMMNTCEATACLEQHLVSHVAHRDIRQRLLGLTSAELALLVAHSRAAQLN
                     ENRFASFQQAFAEYQRFVGKSAMLTTHHSQRATGLVACKTLSQVEVDGQRIGGIFQSE
                     AVALRIFEQLLDLELLVVPDGARYACPSKLQMPLVPTFPEVVLVDVVQEHPHASTSLR
                     IWCKSWLE"
     misc_feature    complement(763416..764984)
                     /note="possible transcribed region"
     gene            complement(<765395..>766456)
                     /locus_tag="CYME_CMT302C"
                     /db_xref="GeneID:16998027"
     mRNA            complement(<765395..>766456)
                     /locus_tag="CYME_CMT302C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539250.1"
                     /db_xref="GeneID:16998027"
     CDS             complement(765395..766456)
                     /locus_tag="CYME_CMT302C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539307.1"
                     /db_xref="GeneID:16998027"
                     /translation="MEAQQERYGLESLLWALSTSAFFPVIFSGTAFANASEWPWLLPA
                     TEWTVTLHRTRTLLGALLNRDLTNTSAKALTDILLTLVKTIYLLQRKRVRMRSLDDAL
                     TDSTEASRLELHNTGDLEVVQSQRRLFHALGLPAPSAVPDATALREMGLAVPEDELEG
                     ASLRKMLFLEAVRRLRLLRHQHPSILSAQRMLASHAHLASVEALDAERLQTLFDDLFT
                     EYTARRALLLERFELTLEVFLAAKRSSALTLWCQLITQRFRETVQPYFHIYDVRAIRT
                     DTEQNRSILPRSAPGVRAAPIKHLRIGEMPDRGGRVTGATALVAGLSALGTSSNGQKR
                     EQKSERSPKKRERAERRRP"
     gene            767284..770374
                     /locus_tag="CYME_CMT303T"
                     /db_xref="GeneID:16998028"
     misc_RNA        767284..770374
                     /locus_tag="CYME_CMT303T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461706.1"
                     /db_xref="GeneID:16998028"
     gene            complement(<769487..>770809)
                     /locus_tag="CYME_CMT304C"
                     /db_xref="GeneID:16998029"
     mRNA            complement(<769487..>770809)
                     /locus_tag="CYME_CMT304C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539251.1"
                     /db_xref="GeneID:16998029"
     CDS             complement(769487..770809)
                     /locus_tag="CYME_CMT304C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539308.1"
                     /db_xref="GeneID:16998029"
                     /translation="MFVLLVQHNCRIFGAWKRPQWYQKNTTQSNRHKQCAGLFLQRPK
                     VGLLCMSTQTKSGAGAAAPTELKPTHGMAPFPGGYRRLGQSDLIVTTCTLGTMTWGEQ
                     NTEEEAHAQLDYAIHEAGINIIDCAENYPVPLNPETQGRTETYIGNWFKKNPGVRERI
                     YVATKVCGPGRDISWIRGGPKLDYDSIIEACNGSLTRLQTDYIDLYQIHWPARPVPLF
                     GSHAYPGPLSAADRNNITRSLEEQLRAMDALIRQGKVRYVGLSNETPVGIMEFTRIAS
                     TLGLPRVVSIQNSYSLLHRQFEGAHAEASTYCDVPLLAYSPLAGGALSGKYLPSSDPS
                     QRERARFTLFKRYMQRYQTPTCMAAVERYTEIARKYKKTPSQLALSFVRSRWFTASTI
                     IGATSMEQLRENLAAFDPKQDSGRWDHSMEDDINNVYLSGYRDVSLGV"
     gene            <772120..>773418
                     /locus_tag="CYME_CMT305C"
                     /db_xref="GeneID:16998016"
     mRNA            <772120..>773418
                     /locus_tag="CYME_CMT305C"
                     /product="argininosuccinate synthase"
                     /transcript_id="XM_005539252.1"
                     /db_xref="GeneID:16998016"
     CDS             772120..773418
                     /locus_tag="CYME_CMT305C"
                     /codon_start=1
                     /product="argininosuccinate synthase"
                     /protein_id="XP_005539309.1"
                     /db_xref="GeneID:16998016"
                     /translation="MSKGKVILAYSGGLDTSVILKYLQNEGYEVICFCANVGQDEDFE
                     AAKQKALALGASKVYVEDLREDFLVNYIFTAVKANAIYESRYLLGTSLARPCIAKRQI
                     EVAHLEQAAYVAHGATAKGNDQVRFGLCYYALDPNIQEIAPWRDPAFLARFKGRQDLL
                     KYARENGIPVPSGPKPPYSMDDNMMHISYESGELEDPSVPADESIYTKTGPMDKWPDR
                     PQVVRIHFKDGVPIKVEDAATGSVYDSPMALFEFLTQVGRKHGIGRIDIVEDRFIGLK
                     SRGVYETPAVTILRCAHIDIEGIAMDREVMRLRDMLSPEFSKLAYNGFWFSPEMDFLV
                     SAINKSQELIDGWVDVQCFKGSCLAIARQSPTSLYDERLASMNEVDAFTPSDAGGFIR
                     INAIRLKAHRRILEKVGTDRLADLKPTPTPTYAALGTTDP"
     misc_feature    complement(773054..775252)
                     /note="possible transcribed region"
     misc_feature    774692..776354
                     /note="possible transcribed region"
     gene            complement(<775481..>777778)
                     /locus_tag="CYME_CMT308C"
                     /db_xref="GeneID:16998019"
     mRNA            complement(<775481..>777778)
                     /locus_tag="CYME_CMT308C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539253.1"
                     /db_xref="GeneID:16998019"
     CDS             complement(775481..777778)
                     /locus_tag="CYME_CMT308C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539310.1"
                     /db_xref="GeneID:16998019"
                     /translation="MFAGCSLGRSRIWQHATPAHTASTQRCSQVAPTHFAHKPWKTWH
                     CSRACNIIGPKSKLLDLLSCVHGLGDSPARGHGSRPQQLAPDHALEDEKRPIAAEMTV
                     NWIVWFRRDLRVHDHPGLQYLRTHIASQKTAPARRSDDRHGMENSLRIAFVYIMDKRE
                     LETYTPEEQKYLRESVAALRETIRSATQGQADLLLLNGPAPRELAVLCGRFANAQVLV
                     EDDWCISSQRCFRECERLGIRFRFWSLGAPHRTTRENTRGSRSPSTSTFLGRDTFSIL
                     QREHWRPMMHRPTENDLLALWDCARENAPETRFVASYELDAPSDHLWETSPSWFPLEY
                     ADYPFLQRIEEDKRMCVATSLDAGGETAAIDFLRRYLRGPDAHQESDFLRSFAYALHF
                     GCVSPRKVLAEIDAARRYRRRMLALWTDSPRHREARALIRSLSWHLFLSQYDKASQRP
                     WHYWRWNGLPVRFSQSGSSTRDAPAVLFIHGFGASIEHWERNVSFLADQGYQVFCLDL
                     LGFGRSTKPITRYTQELWERQVRDFVLQIVRRPVFIVGNSIGAYVSLSFAADHRMELV
                     QASASPRPTTLCKGIVLINPAGPLEPVKNADRASNDSRLRRLLAQPLASRIVGEVLLR
                     YLQFGIRSTLLKVYPVRPDAALHMESIIYRHSLDPGASSVIASGFRLPPSRPIPELLR
                     ALDSVPVLLIQGILDPLNDARKRAEQIAAIHPEVQVVQLRAGHCPHDEVPEQVNEILV
                     NWLQSCEQRGEAPDSKSAEPPMSFA"
     gene            <778152..>779546
                     /locus_tag="CYME_CMT309C"
                     /db_xref="GeneID:16998020"
     mRNA            <778152..>779546
                     /locus_tag="CYME_CMT309C"
                     /product="zinc finger protein"
                     /transcript_id="XM_005539254.1"
                     /db_xref="GeneID:16998020"
     CDS             778152..779546
                     /locus_tag="CYME_CMT309C"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_005539311.1"
                     /db_xref="GeneID:16998020"
                     /translation="MTATGESQFVAVSELAQGDNPVVHVESLCLRCEKQGETRLLLVR
                     IPHFREVLVSSFNCPNCGWRDSGVQETAEIGETGVCYELAVRTPADLQRTVVLSAYAS
                     VRVPELELEAPASGRGRFTTVEGLVTQMVDDLRSYVNECDKLSEDEAGKLRVVVSRLE
                     AFAVDGEGFHIIVDDPAGNSFLDILDADGKPCSSGTMRRYPRTHEMNVRLGLSVDEDA
                     ELNGRTSRTFDQASADGQLTAVDDAASTRDAAPDFSRREVLRISTECPACGKMGENRI
                     HETNIPHFRDILLIAFTCEHCGFKSTEVKPSGHCAEKGQRITLHVQSREDFSRDLIKS
                     DTARLVIPQVHLELEPGTLGSKFTTVEGIVRDAREALGDLRRFVQSEDFKPDEVRQQQ
                     ERFQDFLRQLDMLLDAPNPQFDLILDDPLGNSYIQNPCAPNVDPQLEIEEYERTPEMN
                     EALGIVAPAEGAGR"
     misc_feature    complement(781179..784516)
                     /note="repetitive element"
     gene            <785254..>787428
                     /locus_tag="CYME_CMT311C"
                     /db_xref="GeneID:16998034"
     mRNA            <785254..>787428
                     /locus_tag="CYME_CMT311C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539255.1"
                     /db_xref="GeneID:16998034"
     CDS             785254..787428
                     /locus_tag="CYME_CMT311C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539312.1"
                     /db_xref="GeneID:16998034"
                     /translation="MMNGAWWQEAVLDHNRGAAALEELFDRGTTRTPGVVLAHERRLR
                     ELNSTLHTCLQKLHAFRKAAEQLPAEERRRLLVTLWRQTSIIHFNRALLRLFNGDVFE
                     SRLEAQTSFRCARSAAELRLVGMLEPTPTIEIEQPHTRFGDDADMMFSTTLPADLGWS
                     TADAALALEPALLLVSLWMCSGNSEDLVSAEMYWECNVAPLVSLLQKATPLSDEQLSA
                     KLGKVQILQTLLEWRRGCRSAEHFKKLSGSPQAAYLKMIGAFLLGDRRVAASTIETYG
                     SGYRHEDALRLAERVDTRSHCARTGYTPRNGAPRGDAHVLYQSKALMQRGDWNAAIRL
                     LRALNEKMLSTVGHVNASLASDRHARREISVTSPDDPEVRSRGLDEVRASSKPLDESA
                     NERLPTNRHEFVQTTCTEARAPSSLIMTKLGFTQGDRGVVWAWKTAPSEARALLCASA
                     LATALACVRRWDDCWSVYHEFRRRCGWNLWADTSISFLRGLVDDWRRTLQTAHAQMLL
                     SYSEALLHLGFREQALKVLRKFWSQYGEIDWDPAVHMHLRTRHAILQAECAIHGGEAP
                     ETIRACLTEARMHLAAGAASLPAATQGMHEYLVGMITNAEALIALTSGTACSQSILGL
                     LETAAKKSRYHTAVVYNLTLFIWARMGHITRALRLWLHHRGIDPDHPNAADNDKLRAD
                     AAPDAQLEPFETLTRACIALRQQQIADEQALQNLDFLEQIIN"
     gene            complement(<787804..>789606)
                     /locus_tag="CYME_CMT312C"
                     /db_xref="GeneID:16998035"
     mRNA            complement(<787804..>789606)
                     /locus_tag="CYME_CMT312C"
                     /product="membrane-associated calcium-independent
                     phospholipase A2"
                     /transcript_id="XM_005539256.1"
                     /db_xref="GeneID:16998035"
     CDS             complement(787804..789606)
                     /locus_tag="CYME_CMT312C"
                     /codon_start=1
                     /product="membrane-associated calcium-independent
                     phospholipase A2"
                     /protein_id="XP_005539313.1"
                     /db_xref="GeneID:16998035"
                     /translation="MPGNDCRRVRRELSRLRDTPEWHIETVRQFLTVLSDTAQLVVGG
                     DRSLLAAFVSSCGFALLDRCFSALIGHAGDGIPPNLTHERRPLGGTQSRIHERLLAPA
                     LSHAHTILNWCQSDTLHQVGRSALLQQFCRIFAAAADANCVESSALCLGTIAACDREF
                     ALLIVATSGIVQRLDRILQETPSKEFLVKPTAAHRNASGTDAPTPKLKLLGAHRVTAA
                     CRRLVAALGLERRYGDHGRAARERIFGRLPNLFRRPRPHGIRILTLDGGGARALVSIE
                     ILKELERRTGQPIHQLFDLVAGTSAGGILAVALCIARKSLAECELLYREFCGKVFSTP
                     TSRAVRWLGMGRLLFSRGYYDSAALERFFRAFAGEMNLIDSRAVAHIADDPPCVFCVS
                     TIVSENPAAPFLHTNYAPPPESKPRYRYAAHHRVYEALRATSAAPTYFDAFRCGSETF
                     CDGAILVNNPTAIACHEAKLLWPDLPIDVLVSVGTGRCDPRLVSEPNQRVATAGSSGD
                     SIFELARTLLSSATDTEAVHHAILDLTHGRDMYFRLNPDVAPLSMDESRIEKLEELVQ
                     VTRKYIEQNTKQFSHIAEKLSAGAARKEHLRAAL"
     gene            complement(<791838..>793007)
                     /locus_tag="CYME_CMT313C"
                     /db_xref="GeneID:16998036"
     mRNA            complement(<791838..>793007)
                     /locus_tag="CYME_CMT313C"
                     /product="O-acetylserine (thiol)-lyase 1"
                     /transcript_id="XM_005539257.1"
                     /db_xref="GeneID:16998036"
     CDS             complement(791838..793007)
                     /locus_tag="CYME_CMT313C"
                     /codon_start=1
                     /product="O-acetylserine (thiol)-lyase 1"
                     /protein_id="XP_005539314.1"
                     /db_xref="GeneID:16998036"
                     /translation="MLVSNAMYVLVPCSLKAAQATLRNRKKNSTFVRAKPEQTRILGY
                     ARRSPRARQRVQLALTAPPSVALARDVSDLVGNTPIVELKKIPEEEGVQAHILCKLES
                     MEPCSSVKDRIGKYMIVEAEKRGDIQPGKTVLIEPTSGNTGIALAYLAAARGYRLILT
                     MPDSMSIERRMVLRAFGAEVVLTPAAKGMKGAVAKAEQLFHTTPNAYMLQQFNNPDNP
                     KAHYETTGPEIWAATGGKVDAFVAGVGTGGTVTGAGRYLREQNPHVYIMAVEPAESPV
                     LSGGRPGPHKIQGIGAGFVPGILDTKIYNEVKQVTSMDSIEMARRLAVEEGLLCGISS
                     GAAVVAALELGRRPEMKGKNIVVIIPSFGERYLTSALFDKQREEAYNMVAVEVET"
     gene            complement(<797338..>798123)
                     /locus_tag="CYME_CMT314C"
                     /db_xref="GeneID:16998037"
     mRNA            complement(<797338..>798123)
                     /locus_tag="CYME_CMT314C"
                     /product="phosphomannomutase"
                     /transcript_id="XM_005539258.1"
                     /db_xref="GeneID:16998037"
     CDS             complement(797338..798123)
                     /locus_tag="CYME_CMT314C"
                     /codon_start=1
                     /product="phosphomannomutase"
                     /protein_id="XP_005539315.1"
                     /db_xref="GeneID:16998037"
                     /translation="MSTVKDSRTIVLFDVDGTLTKPRNRVTTKVLAVLRALLQVVAVG
                     FIGGSRIGLIEEQLGAEILKEVDYVFAENGLKTFQHGELLASTSLLEAVGEAKLQEFI
                     NFCLHYIADLKIPQKRGTFIEFRTGMLNISPIGRNCSQAERDEFEAYDKEHHIREQMI
                     EHLRERFKHLNFVYSIGGQISFDVMPQGWTKEYALRFLPEKEYSRIVFIGDKCFEGGN
                     DWEIFSHPRVEGYAVQNPGETIVVLRKLFPQIETLLDPAVLAA"
     gene            <799699..>800265
                     /locus_tag="CYME_CMT315C"
                     /db_xref="GeneID:16998030"
     mRNA            <799699..>800265
                     /locus_tag="CYME_CMT315C"
                     /product="probable oligoribonuclease, mitochondrial
                     precursor"
                     /transcript_id="XM_005539259.1"
                     /db_xref="GeneID:16998030"
     CDS             799699..800265
                     /locus_tag="CYME_CMT315C"
                     /codon_start=1
                     /product="probable oligoribonuclease, mitochondrial
                     precursor"
                     /protein_id="XP_005539316.1"
                     /db_xref="GeneID:16998030"
                     /translation="MALVDPIVWIDCEMTGLDPEKDALLEVACIVTSGDLNTTVIEGP
                     SFILQAPAAALAGMSDKVRAMHSNSGLIDEVYQATLSAESAELKILEFLEAVGVGPQV
                     APLAGNSVHVDRRFLARYMPKLDAYLHYRIIDVSTVKELCRRWYPNVFSRAPAKQGAH
                     RALDDIRESISELVFYRENVFRFPNDTA"
     gene            complement(<801199..>802485)
                     /locus_tag="CYME_CMT316C"
                     /db_xref="GeneID:16998031"
     mRNA            complement(<801199..>802485)
                     /locus_tag="CYME_CMT316C"
                     /product="apospory-associated protein C"
                     /transcript_id="XM_005539260.1"
                     /db_xref="GeneID:16998031"
     CDS             complement(801199..802485)
                     /locus_tag="CYME_CMT316C"
                     /codon_start=1
                     /product="apospory-associated protein C"
                     /protein_id="XP_005539317.1"
                     /db_xref="GeneID:16998031"
                     /translation="MRERALRESSSRTAVLVLRTGQAKELLFFVPATNHYSMFVVCGL
                     SSSCPLGVRTSRQRCCGSLRQARATGRSGSQWTPGLWDRKKGAYVPLSLGLRAKLNNP
                     GQGDASGTRFTDLAAKLAAELTGGKASGLSESGVPSDEAGCLVDGRNGLPCVRLKNEQ
                     TKQVADVYLFGACVTSWKARQGTEEMLFLSEEAVFDRSKPIRGGIPICFPQFGSDGAL
                     PNHGFARNVDWKLRSIDMVENGTASRCVLMLSSEEVPSHYRDLFPFKFSAEYAVTLNL
                     RGLRCELRITNLETDRPMPFTAALHNYLRVRDVSKIRVFGYDNLEYLDKMDANTMKRE
                     ESVLLSGLPVEAAVDRVYKNAPDEMALFDMVALTVMKIDKRGFTDCTLWNPYGQQGSD
                     PDWQKFICIEPAVFHDKGVELKPNESWTGYQELSAE"
     gene            <803313..>804794
                     /locus_tag="CYME_CMT317C"
                     /db_xref="GeneID:16998032"
     mRNA            <803313..>804794
                     /locus_tag="CYME_CMT317C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539261.1"
                     /db_xref="GeneID:16998032"
     CDS             803313..804794
                     /locus_tag="CYME_CMT317C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539318.1"
                     /db_xref="GeneID:16998032"
                     /translation="MAKNQEAPGVDIAPKDEDLEILEMRACLELLGIHRESEGDRYQV
                     LLDPEGVVLQPQSPAGIKGAEVLYEALLERLRAYERGNFYVTDLLSGVRYIFALLRRS
                     GFLSSDPVRVEVLLQNVQAFAASGGPDREARQKHASVALSAAVLLFNAIGNAPAAPRW
                     NLLRIETLAEILRCATAADKADRVIAFMLNHGTDMIERYYSSRSSEYRAVLENNDAEN
                     GIREDGDFTTARCGYYRALFYALKAAEEHVRFRTDIIVDTDFETLLIQTGCRALEVAE
                     TSKLVQDSDREVAVEIVCRALAAPSFTKFAELLRLETIQADTHMRYACEALTLLDESL
                     YESLLAGHGNESEVTEAVHKHRQMIETKLRVLRVSRACARGEYAAEKPERSSEEPACD
                     SKSHRGARILPYAALAKHVGMTESDMNLDEEVEKWIILAIQFGVLRAKIDQAKKMIRI
                     DYAFDPDSSTSRESWQLVAGRLERLRLQIAQIADTTESILLAP"
     gene            <807639..>809363
                     /locus_tag="CYME_CMT318C"
                     /db_xref="GeneID:16998033"
     mRNA            <807639..>809363
                     /locus_tag="CYME_CMT318C"
                     /product="chaperonin containing TCP1, subunit 8"
                     /transcript_id="XM_005539262.1"
                     /db_xref="GeneID:16998033"
     CDS             807639..809363
                     /locus_tag="CYME_CMT318C"
                     /codon_start=1
                     /product="chaperonin containing TCP1, subunit 8"
                     /protein_id="XP_005539319.1"
                     /db_xref="GeneID:16998033"
                     /translation="MLGFARPGASGLLKEGGQHFYGIQEAVLKNIEACKVLASIVRTS
                     YGPNGRNKLISNRLNKIFITSDAATIVRELEVVHPAAKMVVAASQAQERDVGDGTGLV
                     LVLAGELLNQAADLLHQGLHPSEIVKGYKRSCEEALKIMEEGTLQVRRVDDLRDAAAV
                     AEALEACLASKHWGAEAFLARLVAEACIQVLPGYFDGSAVNDVPLAEFADDEETRERL
                     RRFNIDNVRVVKVLGGSLSESSLVRGTVLVRDTEGTVKHIKDAKVALFTNDVDTLQME
                     TKGTVVLHSGKELESYTKTEEQILGERIRKLSEAGVNVVVTGGKFGEIALHYLEMHGI
                     MAIRCPSKYDLRRVVRATNAVAVLSLGDTPPSLEEIGSCDEVSVEERGSTKMIVFGQR
                     SDATRISTIVLRGATQNLLDDVERAIDDAVHMFKVLACRDPRLVAGAGALEMELASRL
                     HDFADRAKGLDQLPMQHFAEALKIIPRTLAENAGQNTTEVMTRLYAAHRQGHSHAGVD
                     IRLESGTMSTGSEARGIINANEYKIWDSLAVKNAAIRKAVDVACTILMVDALIMAKQV
                     SGAGSGHG"
     misc_feature    complement(809720..809863)
                     /note="possible transcribed region"
     gene            complement(<811397..>811936)
                     /locus_tag="CYME_CMT320C"
                     /db_xref="GeneID:16998039"
     mRNA            complement(<811397..>811936)
                     /locus_tag="CYME_CMT320C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539263.1"
                     /db_xref="GeneID:16998039"
     CDS             complement(811397..811936)
                     /locus_tag="CYME_CMT320C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539320.1"
                     /db_xref="GeneID:16998039"
                     /translation="MPFPVRAAHKVPNDHCIVLGVLLGECAVRCTLGQAVFLSIDGFW
                     DTVLSMMRRVPEAKSRLQIRSRNVDSSTVPPCEKVLYTLLEAISSTTQFRAEGPAFHP
                     TQRNESLREHISCGRPRWCRMQLYGCLRRGEDSFFEWNRLLDPTSSVRFRHELVSESS
                     NYNIEYPYSPTQQRDLFCP"
     gene            <812943..>813284
                     /locus_tag="CYME_CMT321C"
                     /db_xref="GeneID:16998040"
     mRNA            <812943..>813284
                     /locus_tag="CYME_CMT321C"
                     /product="probable eukaryotic translation initiation
                     factor eIF-1"
                     /transcript_id="XM_005539264.1"
                     /db_xref="GeneID:16998040"
     CDS             812943..813284
                     /locus_tag="CYME_CMT321C"
                     /codon_start=1
                     /product="probable eukaryotic translation initiation
                     factor eIF-1"
                     /protein_id="XP_005539321.1"
                     /db_xref="GeneID:16998040"
                     /translation="MSDLSDLGVTKPFDPFADADTDSGVVTKNLVHIRLQMRSGRKSL
                     TTIQGLSGKIDLHKLTKAFKKEFCCNGSIVEDKELGRVIQLQGDQRENVRRFLIEEEL
                     VDKDNIKVHGM"
     gene            complement(<815288..>816901)
                     /locus_tag="CYME_CMT322C"
                     /db_xref="GeneID:16998041"
     mRNA            complement(<815288..>816901)
                     /locus_tag="CYME_CMT322C"
                     /product="chaperonin containing TCP1, subunit 2"
                     /transcript_id="XM_005539265.1"
                     /db_xref="GeneID:16998041"
     CDS             complement(815288..816901)
                     /locus_tag="CYME_CMT322C"
                     /codon_start=1
                     /product="chaperonin containing TCP1, subunit 2"
                     /protein_id="XP_005539322.1"
                     /db_xref="GeneID:16998041"
                     /translation="MTQLRLPPTGLQKVLKSSSTEEKGENARLSLLTGALAITDLLKT
                     TLGPRGMDKILLSPSGEVSVTNDGATILKSVYVDNPAVKILVDIALVQDDEIGDGTTS
                     VCCLAGELLREAEQLLERRLHPQLIIAGYRAAHREALKALEEAAMALPAKDTPAGYEA
                     LMNVARTALSSKVLSQCRELFAKIAVDAVIRLQGSTNLDHIKIIKKPGGALHESFLAE
                     GFILEKRFGVGQKKRVENAKILIANTPMDTDKIKIYGARVRTESIARVAEIEQAEQEK
                     MIEKCRRILGYGCNVFVNRQLIYNRPEQFFTDNGINSIEHADFDGIERLALVTGGEIV
                     STFDSPGAIRLGECAVIEEIMIGDDAVLHFQGCRAPEACSIVIRGANQQILDEAERSL
                     HDALCVLSQLVVDSRLVLGAGCSEALMANAVDACAARMGGKAALAAEAFARALRSLPG
                     LIAENAGLDATSLVAELRAAHAQGNTSAGLDILSGSIADARALGVVESFRLKAHVLSS
                     ATEAAEMILRVDDVIKSAPRKMEPAHPHM"
     gene            <819041..>820471
                     /locus_tag="CYME_CMT323C"
                     /db_xref="GeneID:16998042"
     mRNA            <819041..>820471
                     /locus_tag="CYME_CMT323C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539266.1"
                     /db_xref="GeneID:16998042"
     CDS             819041..820471
                     /locus_tag="CYME_CMT323C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539323.1"
                     /db_xref="GeneID:16998042"
                     /translation="MPPVIDVCDSFATSVPWLNMLDSLSLPPFRSPEACTGLFQYSLE
                     SFCCGQSAFSAQKIGEVAVMIVRIACGPGVRKTLHQSLASAKHGVRCTSQQKRANPAD
                     AGRETFIESSSATPSGKDLRLSRSRSKENAPDHAWARSVTGDVLFTVTDPTGVLMDGT
                     MHAGAYHRILQAREHLIGSSIVNESGSIQTTAACALLDGTECGTVLLLRDATLLHFAK
                     SGPHLSVHPVNIAGIFLAGDRPSLRVQRFLDVSRALSRSQLFDSYAFAGHFAAGVLRK
                     ESDALVHAADTDEDRELLDIIEQTAAAESRTPSVSRTIAGSSHEAENKRIRVDLMSSV
                     TGDFRPWVLDDEFGSVESYVPASAQPFREITNMPCSSAPSLTPSKRPSGYLSLSGSTA
                     PNGLAPAETPVHSSEADSFLLELAREAEKKPLARSTNAADPAPQPSNVSGDTVLAARK
                     SVQETPSPASSKDDLDVVLWQLVPET"
     gene            820966..822504
                     /locus_tag="CYME_CMT324T"
                     /db_xref="GeneID:16998043"
     misc_RNA        820966..822504
                     /locus_tag="CYME_CMT324T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461707.1"
                     /db_xref="GeneID:16998043"
     gene            <823395..>825080
                     /locus_tag="CYME_CMT325C"
                     /db_xref="GeneID:16998044"
     mRNA            <823395..>825080
                     /locus_tag="CYME_CMT325C"
                     /product="serine/threonine kinase 11"
                     /transcript_id="XM_005539267.1"
                     /db_xref="GeneID:16998044"
     CDS             823395..825080
                     /locus_tag="CYME_CMT325C"
                     /codon_start=1
                     /product="serine/threonine kinase 11"
                     /protein_id="XP_005539324.1"
                     /db_xref="GeneID:16998044"
                     /translation="MEHSGSRAPLDPEGAGARTQDSFRVFYSQDDVNGGKLYIGEKLK
                     SKVVRKLHSLSIEEGNARIAESSDSALEEGTSDASREGSFAPSPRASSARAAETVECP
                     KVLSGESARDVAAHKDEPMVSIAGPRDHASAEAKSIDNRTWGAARSSKDLSLDDPIRP
                     VVSAHPVEAHSDRHTFAFENLSSRPHIRESRPKFISKYVLGARLGEGAYAKVKEAMDT
                     TTLRIVACKIVDKRFLRKVRGGLENVRREIAIMRSLDHPNIVRLLDVIDGEDSMKLYI
                     FMELSNGCTVQELMERAPQKRLPPGQAQSFFAQLIEGLAYIHSRNIVHRDIKPSNLML
                     ATDGVLKIADFGVAEFLDKFDAEGRITRTVGSPAFQAPEIARGNGMFLGRKVDAWAAG
                     VTLYMMLTGEAPFKGSNQFELFRNIGRGEFHMPSDLIDEECQDLLRRLMEVNPEVRST
                     VDDLRDHNWLRKRYDDEHAWIPIPRRHPKILDMVSRLYEDDPEMSTQSTSPIESDAEK
                     SSVQRAQRPTSIVTTQLGDRRSITNEGAAEPTLEQGESGSPGESSWRKRCTLM"
     misc_feature    825623..827606
                     /note="possible transcribed region"
     misc_feature    complement(826786..827643)
                     /note="possible transcribed region"
     gene            complement(<827620..>829050)
                     /locus_tag="CYME_CMT328C"
                     /db_xref="GeneID:16998047"
     mRNA            complement(<827620..>829050)
                     /locus_tag="CYME_CMT328C"
                     /product="serine/threonine kinase KIN82"
                     /transcript_id="XM_005539268.1"
                     /db_xref="GeneID:16998047"
     CDS             complement(827620..829050)
                     /locus_tag="CYME_CMT328C"
                     /codon_start=1
                     /product="serine/threonine kinase KIN82"
                     /protein_id="XP_005539325.1"
                     /db_xref="GeneID:16998047"
                     /translation="MPGGLGENVSSLTTEARNLSLTEVDAQTKRSPSPAAPPSHSVEE
                     NGAVVSTGKNQNVLAASAAQPTPEFPVSGPIGPHLFQKLKLLGKGDVGRVYLVLLKGT
                     TKLYAMKVLTKEEMIARNKVKRVLTEREILATAHHPFIVTMYASFQTKDRLYFIMEYC
                     AGGEFFRVLQRQPNKRLPEDAVRFYAAEVLLALEYLHHMGFIYRDLKPENILMRADGH
                     IALTDFDLSKQAHPVSPRVIKHQISFLDRMKGAISGNRGSRSNLKDLEIVDSEPVLPY
                     ATNSFVGTEEYIAPEVIQGVGHTSDVDWWTFGILLYEMLTGTTPFKGSYQDETFNNIV
                     HGNIRFDESLHLSPECKNLIKRLLKRDASKRLGHENGASDIKRHPWFRKIDFNLIRNE
                     TPPIIPKLRDPLDFSQYPPLKDKDLQDDVEPFDENSPANPFKNFASRKLERGSSSAAL
                     STADRPATAAQDEETRVLSTKSEPEV"
     gene            <833536..>834696
                     /locus_tag="CYME_CMT329C"
                     /db_xref="GeneID:16998063"
     mRNA            <833536..>834696
                     /locus_tag="CYME_CMT329C"
                     /product="unknown hydrolase"
                     /transcript_id="XM_005539269.1"
                     /db_xref="GeneID:16998063"
     CDS             833536..834696
                     /locus_tag="CYME_CMT329C"
                     /codon_start=1
                     /product="unknown hydrolase"
                     /protein_id="XP_005539326.1"
                     /db_xref="GeneID:16998063"
                     /translation="MFATFGCKVLKSGCFLHLRLIVRPRRTRPTTRFRTAVPAACDAR
                     SVRTVSVAGKSDEAQRSNKIVLDYVHVPPKIDRVNEANLPPIIFLHGLLASWRTYRSV
                     LQRPDLAPDRSIYALDLRNHGSSPHSEEMSYDSMIGDLLAFMTTQNISRACLMGHSMG
                     GKLAMAAALAHPHVVSELIVMDAAPVVYKDHSWQMAEVSEDSPQAVVQAIAKLNPIPA
                     HMRTRRDLEEALRNLGIRSHDVRQFALTNLVRRGNVDQEMAWRVNISAIARNMAEIMG
                     LPKWMQEASRQPTDTAGHSFTQKDAETKHAVVYRGPTLFIRGSRSAYVQDAHWPVIRR
                     LFPNASLVTIDGAGHWLQSEKPDEFTRIVNAFLNRSTTSVRASESPAHEPVY"
     gene            complement(<835010..>835684)
                     /locus_tag="CYME_CMT330C"
                     /db_xref="GeneID:16998064"
     mRNA            complement(<835010..>835684)
                     /locus_tag="CYME_CMT330C"
                     /product="mitochondrial ribosomal protein S2,
                     mitochondrial precursor"
                     /transcript_id="XM_005539270.1"
                     /db_xref="GeneID:16998064"
     CDS             complement(835010..835684)
                     /locus_tag="CYME_CMT330C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein S2,
                     mitochondrial precursor"
                     /protein_id="XP_005539327.1"
                     /db_xref="GeneID:16998064"
                     /translation="MSASQATLRQLLSAGVHIGHKTSAWNPKMRPYIYGERNGMHIVD
                     LQQSAVCLKRALEVFRAAGRAGLRQLWLGPKDPFLESIVRTRARQAGAFTLSGRWVGG
                     TLTNPVASRQILRLGGHLPDLIFCVDAHRHRTALREARIVDIPSIAVIDTDCDPDWAT
                     YIVPGNDESARAIDLYCALAVQATLDGLRERIGKVPDADATVSADRPARDHDAGVLQN
                     DVKLHE"
     gene            <836124..>837467
                     /locus_tag="CYME_CMT331C"
                     /db_xref="GeneID:16998065"
     mRNA            <836124..>837467
                     /locus_tag="CYME_CMT331C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539271.1"
                     /db_xref="GeneID:16998065"
     CDS             836124..837467
                     /locus_tag="CYME_CMT331C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539328.1"
                     /db_xref="GeneID:16998065"
                     /translation="MLLTRATPEIALAPTEKASSLRLPPELSAGSFASRLCWLGAKCF
                     VAASGSETYALQVSSKLQGVSQVADRDYEAFSESAQRTEVVLLPNRQTSAVWSVLAQP
                     RFRTEAQCLASSLVDGDLDGDRQCLVACVDSLGALAVSRLHLTECSSGTQIQNRSSFT
                     GATVEHPRVHPGPSCCALARPGRSKSVRSPYIAVAGYLGCTVSVYEGELLVRHMRTLE
                     HPSSLTFGSGSGAFGAQFHSTPCEHEELLYFTEGPAISLCDLRAPGMSFRRKIIGGHA
                     SMSSGATVSWYSCDLVGYEMALVGPQRCVLVVDVRRWGVLGRWWSCLKYDATTVMWAS
                     ATSPSLDRRRTQGMLLYVSGRDNEMACGTLSATAPETQPQQATHEQGRRPNALSSSRE
                     PVSAPCGWQQKGERLFGFRAENGWIGAARYGECGWAGLTERGILYTLRTWSGKEL"
     misc_feature    complement(837767..838898)
                     /note="possible transcribed region"
     gene            complement(<840679..>842637)
                     /locus_tag="CYME_CMT333C"
                     /db_xref="GeneID:16998048"
     mRNA            complement(<840679..>842637)
                     /locus_tag="CYME_CMT333C"
                     /product="similar to inorganic phosphate transporter"
                     /transcript_id="XM_005539272.1"
                     /db_xref="GeneID:16998048"
     CDS             complement(840679..842637)
                     /locus_tag="CYME_CMT333C"
                     /codon_start=1
                     /product="similar to inorganic phosphate transporter"
                     /protein_id="XP_005539329.1"
                     /db_xref="GeneID:16998048"
                     /translation="MAENIVDIAPDQIFLHAEEPIKSGQDEEAIYAVTETPDTSYIRY
                     NAIGTALGFLVNGYMYQVGTLLLTLYIDVYYTVYSSSFLQSALSTSVLYGVLFGLIGF
                     GFIADFIGRKAGLIACSCIVILGSILSTAANGKTTDGMFWMIIVGRAVVGLGMGGEYT
                     CNVPNIVEDSEEVSTKTRGRRVSLLVMFMEVIGNNTPTLIQLILIAAACRHVYITSSS
                     STGVSLPNCRPQVVWRISYGLGLIPCIIVLFLRVRMRDSKMYRKDENLRRKSYDLLDL
                     FVIFRHFIPRMIGTIFMWFLIDWINYSQGTFGGVILSSVIGASLFKTAWIGLAQGVVL
                     TLGPVAAALVVDRLGRRKTEVLGWAWLASTQLITAGVYLMLAKHAVGYVIWTTFVFIF
                     QYFVFIPVYLVPAEVYPTRVRATLYGWSSALGKVGGIVGTTVFPYMWSALSPDGNESG
                     HSGLLGLRKIQWIYAGIEYFGLILALLFVPEYSNVSLRGEENRFLAMRARYAARFAKS
                     LGAQPAPAASFESIQIGHYSWWSLLYLRLFRSREEYAAALEQYAQMLLARSYITKVEQ
                     LEQYAAAPVYYNDRTLFSNLIRRIRLGAEGAREYNRLSELMGEESMENPAFGEQQAKI
                     VLSADGGSSDEKVSKEGTDTTTDNSMTF"
     misc_feature    844138..845506
                     /note="possible transcribed region"
     gene            complement(<844341..>845555)
                     /locus_tag="CYME_CMT643C"
                     /db_xref="GeneID:16998050"
     mRNA            complement(<844341..>845555)
                     /locus_tag="CYME_CMT643C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539273.1"
                     /db_xref="GeneID:16998050"
     CDS             complement(844341..845555)
                     /locus_tag="CYME_CMT643C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539330.1"
                     /db_xref="GeneID:16998050"
                     /translation="MNRNSCLTAQSTVFIGPKEGSSSVGLFLARLWQRRRLHRRVRGA
                     SRSLQATATQPQWSLVQVARRVLFPPLWVELARAHVLAKFSRAFEQVPRKRRDGTAAP
                     AAVSTAMEAAAAPSPSRNAARGGQGVSRTQLLGRIVYEWVDYDQRRLVCARQTADGVP
                     VVDPRCSAIPRTERLRNKWRRLRELSAASSEREAADGAGPQTDNVALVGAPAGPPPVE
                     SPTEQYAVVKLESGPGTLHEDTEEDATLERCAGPALARCWSAPELGDAEDDSTRYEPE
                     RSPLDYLGNVPLLFTTNTPQGRLLQRRLRVARLQMHRLVREGVRTLMQSAPLRLALGA
                     RLRCLDGAAAYESQREARQVTSGPVRDASPAAWKRLSGDGVLRSVSQAALATLGTLRC
                     EWPFHVRRLRDQ"
     misc_feature    845823..846409
                     /note="possible transcribed region"
     gene            complement(<846564..>849197)
                     /locus_tag="CYME_CMT336C"
                     /db_xref="GeneID:16998051"
     mRNA            complement(<846564..>849197)
                     /locus_tag="CYME_CMT336C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539274.1"
                     /db_xref="GeneID:16998051"
     CDS             complement(846564..849197)
                     /locus_tag="CYME_CMT336C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539331.1"
                     /db_xref="GeneID:16998051"
                     /translation="MLTLWRLQSVQRLPIARPLQKLLGKSSQQALGFRTETTARLGPR
                     QGAAFPWQSRPLTQSPAVGGLHGTAKRLLQFALSVGTCTFVALYGFPTGLSANLGVAS
                     SESITIAGVNTGPGGAASTGTSSPRTDETCTKRIRELMDVVKSSELAAAKEAANEILQ
                     YAVQQGTAVELASCGVGGVLAQTLERPDIDVDLRTTLLEILGEIVRNKQTHSQLRDTP
                     LLRSLLHCLNRDAGVAAQCGGMTSGFLFLFGRQRKPVDWSQLNAPLIQQVARILANLA
                     LSESIWSTATSADETRLMKTLACALASVHEAQKNTTMLISTQAQIRETERALILCIAN
                     VSRLAAFATPKRNFLRELLSALESDDSSVAQYALSGLRSLANQAPMLAALTSEEALER
                     LGRVIARSDEPGLRTMALRILQDAAFAKSPGTTSAIDMRAANRFEKCHIPETLLDVLR
                     ENLSGRNDTGPERDAAQMELPQRAACKTIAALCSVPGAPGEHLSRAFLLHGADRELLR
                     IAETFEGIDRFRPPHATVGAAALDAFAVMMQSARIRVQLIARDASFLVRRLADCVPDA
                     EGVTSRVPSPTCRSLLRLIGQLSEDSDTLYLLANQGLCQALYGILQGRLSLSTNEAQI
                     LVHTIANLSRIDNAKLDLLGSRGALRILMKLPTLWAQASGNQVQAEVIGNNDSLRREL
                     ARALFNVSTGGLSRVMAAQAGGVEAAVRLATDPDPSVRRYGVRALSLFAEQIENSIRI
                     AQANGLPVLASAVAQRRTDPETARAALLALAELTNNVDLHPHLLKLGAGTYFAQYATQ
                     SVDIESQQYALAALCNLSATPTGRATLQSLGVHRLLSGLALSAAVPPELAMLANMVVA
                     NIVRNEQNVMQTVPFSIPPPE"
     misc_feature    complement(852654..854236)
                     /note="possible transcribed region"
     gene            <853627..>856104
                     /locus_tag="CYME_CMT338C"
                     /db_xref="GeneID:16998053"
     mRNA            <853627..>856104
                     /locus_tag="CYME_CMT338C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539275.1"
                     /db_xref="GeneID:16998053"
     CDS             853627..856104
                     /locus_tag="CYME_CMT338C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539332.1"
                     /db_xref="GeneID:16998053"
                     /translation="MDRNVQASFQLDDLWLTLQPGGASESVFRRVEFVFQAVLEGRES
                     FRGVGLRLPELIDCIFGFQDRSRGSWSETVSGWLPDCERRAARPGDADALVSLLEPRG
                     PLFQTLLCHDERYTYDFPLQNLPQPLLDEIAAVLSGEDANVRAAVAASPHPDRKPENL
                     PTGEYSPLAYYLSAHVTDPTHDTVRIGAARYYLLCFLAYPVYARHPTVNERFTSAWDT
                     SARQHIYERVLLAFLQEFASLQQLLHQHVSFERSAATTLSVADLFVHAWVAFWFHWNG
                     ELWPWNGWHDAVANDWGQMQLARYRERHSVPSLLTMKCQRLAMMHVMGVFETHADQVE
                     RWSGCQHIINQDRVPVRHSEPFAGESSASRDTGVPRKIPSAGTPSLQVYLNIPLGLQH
                     VDASWRAWHPNQLGSSGAAQRTNPLLRFLLIVFCRYFCRTIPRMQQMCIDLDASTNVA
                     FLKTISAWLFPWDQATELSALLEKARDQRGRRVALLHGLALLHTPFVEEPRKSSQYKT
                     SCWRRVLALHFPLYVRLLVDMLNILVRSRCLLQSPGALEFYLDLHRSAQCRDWLADLQ
                     KIAHSTRAVESRQQPCIEAWSEFQHSRCSPNLSELAGLDCDAFRQTLRELRLQLERRL
                     HSSWNTSAVFLSRLARDRAAHLVEPWIQLVEPAEFPGSPKARDPLSNASVQALDDTDS
                     LGVIHRRLPALSPDRSVTSPGGAPQHSAAAAGAREPTTPPSMSTSASSRTDSEMLPLG
                     AQIALGRKKCSNLDIVPRGDAWRWPKQSNEFGPALVLARRLALKLEQLTGVSWNLRFL
                     ASYVVIGYLAVGLTLSLLWLMVVSGIF"
     gene            <858690..>859394
                     /locus_tag="CYME_CMT339C"
                     /db_xref="GeneID:16998067"
     mRNA            <858690..>859394
                     /locus_tag="CYME_CMT339C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539276.1"
                     /db_xref="GeneID:16998067"
     CDS             858690..859394
                     /locus_tag="CYME_CMT339C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539333.1"
                     /db_xref="GeneID:16998067"
                     /translation="MATTEDEARTLLERFRTHLETLKRASLRDAVEQAPENCQDSSRK
                     DVSRDGVESIPAVAQWPDGVKCAHELHMLAVLHQQLAEHFYSSLSRLRDTLGRVELLQ
                     LERSALEYQIERFRERRLYVESQRAAAKTIQILGGSGAKPENAAVLKEELQAELASRE
                     KLAAELAELGLQIEEARRRQITDEQRIQACVPAHAELERLVQALCRSLTAEHSDEVAE
                     ISTGMELGCANEKSQG"
     gene            complement(<860330..>860698)
                     /locus_tag="CYME_CMT340C"
                     /db_xref="GeneID:16998068"
     mRNA            complement(<860330..>860698)
                     /locus_tag="CYME_CMT340C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539277.1"
                     /db_xref="GeneID:16998068"
     CDS             complement(860330..860698)
                     /locus_tag="CYME_CMT340C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539334.1"
                     /db_xref="GeneID:16998068"
                     /translation="MPLRGTEFALEGNKSGAVSPRQPAKVTPSLNERFSQSADSKRKA
                     KKKRRPTKSKAGVQSHVIEKPRKVQKEKKPRRGKDGTPRSERKGRKRQQKEAKTTKST
                     AELDMEIERYMQENSAVTPS"
     gene            <860900..>861946
                     /locus_tag="CYME_CMT341C"
                     /db_xref="GeneID:16998069"
     mRNA            <860900..>861946
                     /locus_tag="CYME_CMT341C"
                     /product="similar to RNA binding protein"
                     /transcript_id="XM_005539278.1"
                     /db_xref="GeneID:16998069"
     CDS             860900..861946
                     /locus_tag="CYME_CMT341C"
                     /codon_start=1
                     /product="similar to RNA binding protein"
                     /protein_id="XP_005539335.1"
                     /db_xref="GeneID:16998069"
                     /translation="MQNDDVIWSLIGNKRFCRYKVKTRRQQENFCLNEYNVTGMCSRQ
                     SCPLANSRYATIREAADGRLYLFIKTIERAHMPRKLWQKIRLSGSYTKALSQIDEHLA
                     MWPKFLVHRAKQRLTKLTQYLIRKQRLESVEKTQLLPVKKKVERRERKQEQRALDAAK
                     LSLTIENELLARLKQGKYGEIFNFAQKEFEHVMEQEAEPLELERDLDRSYFEPLYESS
                     DEEAVFGAGDDSDVPGTYANAAPPDDEEASWSDGSAMDDVPSDSADEDWSPAPDLEDL
                     PHPADRNASTFYFDEASDSTEADERLPTRPTPVQRARVAQEASRRRKTKASSSRHRKQ
                     FETEFEFERELEPL"
     gene            <863857..>864132
                     /locus_tag="CYME_CMT342C"
                     /db_xref="GeneID:16998070"
     mRNA            <863857..>864132
                     /locus_tag="CYME_CMT342C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539279.1"
                     /db_xref="GeneID:16998070"
     CDS             863857..864132
                     /locus_tag="CYME_CMT342C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539336.1"
                     /db_xref="GeneID:16998070"
                     /translation="MDAACMTDEAQAELAGKAMAVDRPPLKEAYYRTQLSERSEAENP
                     AQEDGQSLRQANLYVELYEALKQRDLWMREAQALARSLRFLRQAFHY"
     gene            complement(<865397..>866335)
                     /locus_tag="CYME_CMT343C"
                     /db_xref="GeneID:16998058"
     mRNA            complement(<865397..>866335)
                     /locus_tag="CYME_CMT343C"
                     /product="unknown methyl transferase"
                     /transcript_id="XM_005539280.1"
                     /db_xref="GeneID:16998058"
     CDS             complement(865397..866335)
                     /locus_tag="CYME_CMT343C"
                     /codon_start=1
                     /product="unknown methyl transferase"
                     /protein_id="XP_005539337.1"
                     /db_xref="GeneID:16998058"
                     /translation="MAQRPENKAPPQVFYDPKEARKYIYHTHTVEVQTRLAERALELL
                     DLDPSTLEQGPALILDLGCGTGLSGDVLSRAGHLWVGLDIAAAMLSVAVERDVDGDLI
                     QLDLGAGLPFQIGCFDGAVSISVLQWLCHADASDQDPRKRLFTFFMTLYACLRRGARA
                     VFQFYPSHERQVAFIFAQAKRAGFDGGLVVDYPNSTRAKKFYLVLQAGPAERATTMRQ
                     QALSPAVARRFVEPMTDDVSEDEASLCETRAPAGNTAIAAVPKNRQQNVSRKSVHRRV
                     QSVRRLIEKQRLRRLRQGKPVRPLSKYSGRKRSSHF"
     gene            <866894..>867829
                     /locus_tag="CYME_CMT344C"
                     /db_xref="GeneID:16998059"
     mRNA            <866894..>867829
                     /locus_tag="CYME_CMT344C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539281.1"
                     /db_xref="GeneID:16998059"
     CDS             866894..867829
                     /locus_tag="CYME_CMT344C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539338.1"
                     /db_xref="GeneID:16998059"
                     /translation="MVHRDPAEELWCELWQPGVDITRKMNAIFGLKEIGTERAVTLLC
                     AALLDARERSVLVRHEIAYVLGQIQSAASIKTLTDRLIDTDENSIVRHECGEALGAVR
                     AFAVRPILQKLCGDAVPEVRETCVLALERLRWLEEKSTNEERVRETSAKAFKLFETVD
                     PAPAFVAPDDLEASWSNAELGELLLNENEPLFRRYRALFTLRDRNTDDTAGVIAAALR
                     RDTSSALFRHEVAYVLGQMSRACTLPALESALADTHEHAMVRHEAAEAIGAIGNSSAC
                     DILRRFLRDANVIVRESCQVALDIAGISDDCQFMD"
     gene            complement(868720..870865)
                     /locus_tag="CYME_CMT345T"
                     /db_xref="GeneID:16998060"
     misc_RNA        complement(868720..870865)
                     /locus_tag="CYME_CMT345T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461708.1"
                     /db_xref="GeneID:16998060"
     misc_feature    870127..872597
                     /note="possible transcribed region"
     gene            complement(<871340..>875329)
                     /locus_tag="CYME_CMT347C"
                     /db_xref="GeneID:16998062"
     mRNA            complement(<871340..>875329)
                     /locus_tag="CYME_CMT347C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539282.1"
                     /db_xref="GeneID:16998062"
     CDS             complement(871340..875329)
                     /locus_tag="CYME_CMT347C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539339.1"
                     /db_xref="GeneID:16998062"
                     /translation="MFASVAALLSGARWRPWPRRYRWLCALVLVLALLGVSESVRGAS
                     PDWSKFRVSESGVIFGTDFSSCTAPICPIDTSVWKPVDQGSIGAPSFWIETDVDANGM
                     RYESGAVLEQTKNIFSPNSAADPYAGTFLQYIGAGSETLTNYDIYVAINAAVNGLAGV
                     MFRIQDSNNYYRFVWSNTEEPGVRASGAIQQLQVVANGSWNTIATAAHAQPYPLGDFV
                     ELHVRCDHARLQVFINGELSVETSDNTFSSGTWALYNARCPGIRYANVLVTAKSAGSD
                     SVPTPLPFPIASGVRSAQATIAPLPAFRGESSRRVVFPLNFTGLMLSKFTTGVSQNIT
                     EALLRNPDIREALLSDPPLVLVDLRAGSVIATYAGVISASALDAWQTALNRFVCRGHL
                     SNLTALGPVSCGADNVLAVDVQDPNEANAVTAGPAQGISTGAVAAIVAVLIVLALVFG
                     VLLVWCLLRRRRQRRAGFEKKAHFGAAYGFQAADAAEKGTLSPTSLGSEAANEPRWGI
                     PGGILSMDSLSPLMLSLPSFGSIDDSQKPFSIVQRVQRLLVALVHDQVEHFGQRDWLL
                     VLDARTAVLLKYALGPNLAECFPSARICLLEQLPRCGNRELELPTIYILAPTGDWMTS
                     VARYEAKRSAPVPVRLLLTRSPSAPLPRRHAISWADVDGSTVLLPIHVDFFPIEEQVV
                     SIENREDVFGLLYGADAPETCAMRFQLMEELGHQIGTLLHGMGAGTFANEAPWIQIHT
                     SPAASEQATCIARAAQTYAAVHLLPLFCPGLVAGRGALHLLLMDRAVDPVTPLLHVNT
                     YRGMLLELNDAAGNARPQWPSEHDAVWRALRQYTLSDAVAKLQALAQPLLASSEPDSD
                     NRVTHAECIDLDLASLKRALESLQAADPAQLELLSALRWHAKSLERCLQEQQQRNLLY
                     LSALERCIVMGIKQDQGSRISSATMRRTVEKVLEADTYALSDKLRLLLVFLGCRDPHL
                     VRELVQKIPGLDLQTQDSLIRTANAFLQRLRAAKWATRSARVRRRRRARVLVHESLGS
                     LLLPETMASQILLQYMGAFDLQQRHEVAEGHDDSAVASDHEHKEPLGSPAAELFLSTL
                     LVEPRAPSPAPEPHVTAPLAATTTMTTTTTPATQGHDMTHDAAVGMQLDAMPSQNTRK
                     GIHSEDAHMMHSPGTTCNQSDEQRTAADTQTTPRVVQQVDRATPDVDVKRSARRSRLR
                     IAEEAGMLAEALSPSSPPSSAQRNVRSQATVCEALDGTEALQQQQQDATETLPEDAGV
                     HAALVDRLQRAAERYRNDRFLFVVLGGVTALEVEQIRGLATHLQIDVVIGGTSVLSPH
                     QYLASIESL"
     misc_feature    873440..875374
                     /note="possible transcribed region"
     gene            complement(<877238..>877576)
                     /locus_tag="CYME_CMT349C"
                     /db_xref="GeneID:16998106"
     mRNA            complement(<877238..>877576)
                     /locus_tag="CYME_CMT349C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539283.1"
                     /db_xref="GeneID:16998106"
     CDS             complement(877238..877576)
                     /locus_tag="CYME_CMT349C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539340.1"
                     /db_xref="GeneID:16998106"
                     /translation="MDVQVRGPGGPEIAGYWKGNRKILFSPTIERRRASDVEAKDEEE
                     RRCAGHGACPTGQCRDCSGSDGARVLAILALVSSTRGNKRMEFVTRGFNAAINIRRCV
                     VLKTRHDGLT"
     misc_feature    877993..878625
                     /note="possible transcribed region"
     gene            complement(<878472..>879128)
                     /locus_tag="CYME_CMT350C"
                     /db_xref="GeneID:16997952"
     mRNA            complement(<878472..>879128)
                     /locus_tag="CYME_CMT350C"
                     /product="DNA polymerase delta, subunit D"
                     /transcript_id="XM_005539284.1"
                     /db_xref="GeneID:16997952"
     CDS             complement(878472..879128)
                     /locus_tag="CYME_CMT350C"
                     /codon_start=1
                     /product="DNA polymerase delta, subunit D"
                     /protein_id="XP_005539341.1"
                     /db_xref="GeneID:16997952"
                     /translation="MPVSTRTRQGGRSRAAKQHVTSEGVSKATGGAAAASSPRASARN
                     QKHDRQTLRMEATSRKSTLSGASKSGAAQTASARSVPGSTTPVRVLHKAHQPGTFEEA
                     APRSGTLSPETPTKAPRPSRTLTTATLQGATVGGGASTLTASPEGYENAEDILRMFDL
                     DVRYGPCVGISRLERWERAQALGLEPPLLVRDVLTSASGLPSAASLMEPIFSFPQRYL
                     "
     gene            <879450..>880196
                     /locus_tag="CYME_CMT351C"
                     /db_xref="GeneID:16998108"
     mRNA            <879450..>880196
                     /locus_tag="CYME_CMT351C"
                     /product="eukaryotic translation initiation factor eIF-6"
                     /transcript_id="XM_005539285.1"
                     /db_xref="GeneID:16998108"
     CDS             879450..880196
                     /locus_tag="CYME_CMT351C"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor eIF-6"
                     /protein_id="XP_005539342.1"
                     /db_xref="GeneID:16998108"
                     /translation="MALRVQFENNNDIGCFARLTNAYCLVAVGGSEAFYSAFEAELAD
                     HIPVIHASVAGCRIIGRLCVGNKHGLLLPSTTNDQELLHIRNSLPESIVVQRVEERLS
                     ALGNCIACNDYAALVHTDLDRETEEIIADTLQVETFRQTLAGEALVGSYCYFTNQGGV
                     VHPMCRVEDLDELSGLLQVPLVAGTVNRGSEVIGAGIVANDWLGYCGFATTATELSVV
                     ESILKLRTWADNNAYDSSGAFKSALIDALA"
     gene            complement(880524..883476)
                     /locus_tag="CYME_CMT352T"
                     /db_xref="GeneID:16998109"
     misc_RNA        complement(880524..883476)
                     /locus_tag="CYME_CMT352T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461709.1"
                     /db_xref="GeneID:16998109"
     gene            <884500..>890046
                     /locus_tag="CYME_CMT353C"
                     /db_xref="GeneID:16998092"
     mRNA            <884500..>890046
                     /locus_tag="CYME_CMT353C"
                     /product="unknown snf2 family helicase"
                     /transcript_id="XM_005539286.1"
                     /db_xref="GeneID:16998092"
     CDS             884500..890046
                     /locus_tag="CYME_CMT353C"
                     /codon_start=1
                     /product="unknown snf2 family helicase"
                     /protein_id="XP_005539343.1"
                     /db_xref="GeneID:16998092"
                     /translation="MNTSPRLRGQRRSDYAAYAGRRRQPASSLSCAVGAELKAAAHAE
                     PVSPGNEIPRTTGEGERTGTAVQGPTTSRIDALLTKQALSDELLMSKLSDRLRELARR
                     AAASRDEHLRQAQLLQTRAEREQKRKLVRSHGDVRPLKRDAAGSSVLHTTAPRGTGEQ
                     ASPPRSTFRDAGSMDWKSSAEEPARLTLDEQVLQHLTKGHESGGTSTSAALEKRCQAS
                     IEALDTTVLGFSDADAASQRLAEDRILREATEIQQRNLELAKARLPKQPEPPRSKTHH
                     DYLCEAMIWLATDYRERFKWHAAFRARLARAIHRFHEERKQRDARDSQAREVARIRRA
                     RLLSRHVQKFWESLFHMMIWEQQAQDERLAKRKRQRALDSLVHQTEDYVKVLAEELAT
                     CDSEQMVVDGEPYSTAELATGRESDRASQTQLPEITADTAANGTIRESDTQSLMPRAT
                     NEVHLSTSRARRPLPGCLMSSADASVDDVGTGGYGTQRQIGSMPGTADSVYSSAQRLG
                     DASPEDRGDGDGGTALLPTKPEVAANMSERLPNTSLGAAAAPDVEEHSGNATQTSCAA
                     LSTKEALERPASFRSVDDALRILFRGRLRPYQHAGLQWLIALNEKGLNGMLADDMGLG
                     KTIQTIALLAWLATAKQDWGPHLIVVPTSVVMNWNIEFKKFAPGLKVLCYFGTPTERA
                     AKRRGWTKPNAFHVCVTSYHMVVQDATVFRRQQWSYLVLDEAQHIKNFQSQKWQTLLT
                     FHSRHRLLLTGTPLQNSLIELWSLLHFLMPNVFQSHSEFREWFQEPIETLIQADASVQ
                     ESMVERLHRVIRPFVLRRLKRDVERELPPKTEEIVWCSLSKRQRELYDDFMSRAATRE
                     KLLSGNYLSVMNVLIQLRKVCNHPDLFAGRPIDEPYASQRPLTIFIPHIIRAEAASET
                     AQRRAPRLVDESMSREDAARIRALTAAARMLAETSACPTTCSDSQAISRASFASLLAR
                     IDRAEQTERNQLRLVSCSRRIAEPVIGASIRQLVRVPLRSAPALHPVATLERLVDRAL
                     AQALPFTLVVHRAIAPVPQLVSKAAFRYQRRTACGTTSPPLAYLFGLWRPLAIRQQLR
                     FPDARLLQWDCGKLQRLAVLLRELEQKGHRVLIFTQMVRMLDILEQFLCLHRFAYIRM
                     DGSTPTGLRLRLCERFNNDRRYLVFLSTTRSGGVGLNLTGADTVLFYDSDWNPTVDAQ
                     AQDRCHRIGQDRPVRIYRLVTEGTVEAPILRRALQKQRLEQLVLADGLFTTEVLQRVH
                     PLELIEGGPAPPPVHPNPYGGLEACGLTEQEYIQLERTILEAEDDEERRMRQAMELAA
                     SADASLDAVDFAETPAMAATRTDKPAGDTSTWWPVWHTAWRIAQHLGGPVAAAAAVAW
                     DTRQAPERVANTNDSNLDEGAANTSLNDEADQNSAALPLVYPPVPDPNSSGTKNGSGG
                     LDWRRTTRAYHSEKRSGDTAAALVMVYGPPVETPVDLILDPEAGTEDAAFFIHCYWRM
                     AHSGAPTALQRGRVSDVQQIASHLRNDDAFVDSLTAGLGAAAATTTTTTTTTTTRVPV
                     AEARNAVDRIRAPEATATAKSGARADSSTMRTLPLGPTRQVYVNLQAWLRHRVQWSFQ
                     EDAALLQAWQRYGSNPRLLGDILHAQASVRLGLLHRRTVREIEERLQLLLAKKITEPS
                     ALAQWHEAVSQTRATSMRKHHRRSIQLAQRRVLGMRARLDTKRVLRTSRGDAGNNAFL
                     DPDRAREASPRTVTADRAAAKRDALPKRTQTNEGARTPADAVPGAVAPAPAQVMDPRV
                     LVPPPGTSGCGTAEATAAGSLVHRPGVKLEEELRRRRPFRRYIARLGPLLGFELRTSN
                     RGLDND"
     gene            complement(<891754..>893148)
                     /locus_tag="CYME_CMT354C"
                     /db_xref="GeneID:16998093"
     mRNA            complement(<891754..>893148)
                     /locus_tag="CYME_CMT354C"
                     /product="probable GTPase activating protein"
                     /transcript_id="XM_005539287.1"
                     /db_xref="GeneID:16998093"
     CDS             complement(891754..893148)
                     /locus_tag="CYME_CMT354C"
                     /codon_start=1
                     /product="probable GTPase activating protein"
                     /protein_id="XP_005539344.1"
                     /db_xref="GeneID:16998093"
                     /translation="MDSRALNTVWWSIRSLSGAPGDCLGELVPQFSEWEAQQGGITAD
                     SAPHNTTATSADAAPTTHCSRVGTAVQALCQGPLLAENKREASTDAGLKRGSAALVTK
                     PATAPAVALETEDAEGVGSKASTTLWTQLDAIRQAWRRGDAAELSRISAVDRGLLEQL
                     AWSGVPGAQRALAWKVLLDYCPPQPSRLLRSVSRKRDQYWQAVAELGLVTDPRLGNRL
                     SSEDWARKRQIDLDVPRTAPEFPLFHTGAVQQAMTRILHLWSVRHPAAGYVQGLNDIL
                     VPLLYVFYADQAPEFSQLDRTTLPEDAEPLLREVEADTYWCLSTLLEALQDQYVFGQP
                     GIQRRVALLERIMQRIDASLCAHLAKEQVTFMQFAFRWMNCLLVREFPLPITLRLWDA
                     YLSERGTFAAFHVYVCAALLERFSLDLVRLTFPDLVLFLQNLPTRSWTEQDLSTLLSR
                     AYMFKAIFEDARRL"
     gene            892256..893824
                     /locus_tag="CYME_CMT355T"
                     /db_xref="GeneID:16998094"
     misc_RNA        892256..893824
                     /locus_tag="CYME_CMT355T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461710.1"
                     /db_xref="GeneID:16998094"
     gene            <893487..>893756
                     /locus_tag="CYME_CMT356C"
                     /db_xref="GeneID:16998095"
     mRNA            <893487..>893756
                     /locus_tag="CYME_CMT356C"
                     /product="dynein light chain"
                     /transcript_id="XM_005539288.1"
                     /db_xref="GeneID:16998095"
     CDS             893487..893756
                     /locus_tag="CYME_CMT356C"
                     /codon_start=1
                     /product="dynein light chain"
                     /protein_id="XP_005539345.1"
                     /db_xref="GeneID:16998095"
                     /translation="MQGRKCVIKSVDMPEDRQQFAVETATKAIENYQVEKDVAAAIKK
                     EFDAKYGPTWHCIVGRNFGSYVTHETGCFIYFYLDQIAVLLFKSG"
     gene            complement(<894850..>895620)
                     /locus_tag="CYME_CMT357C"
                     /db_xref="GeneID:16998096"
     mRNA            complement(<894850..>895620)
                     /locus_tag="CYME_CMT357C"
                     /product="similar to splicing factor 3b subunit 2, 145kD"
                     /transcript_id="XM_005539289.1"
                     /db_xref="GeneID:16998096"
     CDS             complement(894850..895620)
                     /locus_tag="CYME_CMT357C"
                     /codon_start=1
                     /product="similar to splicing factor 3b subunit 2, 145kD"
                     /protein_id="XP_005539346.1"
                     /db_xref="GeneID:16998096"
                     /translation="MVEDSDLAKDLPHYDKQEERFREQPSTQHQAGSSAPPLPGRASR
                     RLRRACRPRVIDLKLHVPYPFVVEPWDCSAPEPFALVSIKSEQGTVPVPAHWRAKRRY
                     LENKRGLPSGALAFVRDAYERLMECLQEPQTPLSESLTEEWRLWSRLRGLGDVYVPLD
                     EFDPLRGCTFRPGVVSGALAQALQISELETFSIPSSPWRDGWRRSGHRCPPLYPAMKE
                     ANFCWRIEPGPAGCAHHLYDTGNKVHHWGSLRDAADPP"
     gene            <896284..>896820
                     /locus_tag="CYME_CMT358C"
                     /db_xref="GeneID:16998101"
     mRNA            <896284..>896820
                     /locus_tag="CYME_CMT358C"
                     /product="similar to N-terminal acetyltransferase complex
                     ARD1 subunit"
                     /transcript_id="XM_005539290.1"
                     /db_xref="GeneID:16998101"
     CDS             896284..896820
                     /locus_tag="CYME_CMT358C"
                     /codon_start=1
                     /product="similar to N-terminal acetyltransferase complex
                     ARD1 subunit"
                     /protein_id="XP_005539347.1"
                     /db_xref="GeneID:16998101"
                     /translation="MVSVRRATPADLLAMQYCNLQCLPENYQIKYYMYHLLSWPHLLY
                     VAEDLDGSIVGYVLAKMEESPGSTDAGSSSNTAATSGAVKPVRHGHITSLAVQRSHRK
                     LGIAKRLMCIAHQAMREEYNAAYVSLHVRLSNVAAQHLYRDSLGYQIHTTEVRYYADG
                     EDAYDMRLWFCSDSIPKA"
     gene            complement(898205..900876)
                     /locus_tag="CYME_CMT360T"
                     /db_xref="GeneID:16998102"
     misc_RNA        complement(898205..900876)
                     /locus_tag="CYME_CMT360T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461711.1"
                     /db_xref="GeneID:16998102"
     gene            <898363..>900120
                     /locus_tag="CYME_CMT359C"
                     /db_xref="GeneID:16998104"
     mRNA            <898363..>900120
                     /locus_tag="CYME_CMT359C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539291.1"
                     /db_xref="GeneID:16998104"
     CDS             898363..900120
                     /locus_tag="CYME_CMT359C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539348.1"
                     /db_xref="GeneID:16998104"
                     /translation="MAPESAQVTSFDAFLHSVSAWEHLLESDAQETAQKQLNVLRRSV
                     PRQRTPNEPTPRDAAHALETLWLKKHAALWYRWTPTLCQGVRNGRAASCSLLCFLFDG
                     AQRFLYPLCGMVLKAPRRATRMEGAPNATSTMKSARQQTFVPMSERYRLHLQLVYDTL
                     VETMQAQLTQAATALTGIVSRGGVDSSTSTCQLMRCLGVVVQNTPSRCLPSAQLKTAG
                     NLLWDQYALSLGPELETLRAAAISCLKSIHDRLQTIPPLEQLLANPLRWNDAHVVSFV
                     EAMLTLRMRHLSRVQESAPDSTAVDELVLAMVEHHFRSASTSPALRLQSARLLRLLLR
                     SRPSIASSRNALLFRMLKDPFHAVRVVAIACLSQPGIGAAGTPLFRELEALTADPIAS
                     MRAAACTALGRLAADPGAFIPQTEPTIILDNDWNALKGRAMDLLLKRLEEDPNVHVRA
                     AAAYSLSQFCTHAERLAARLPERIIELAIDELRRAPYSSQASAYCRLLGASVPSEAQR
                     TQIVVVIGDIVQGARRKALRQQAILALAKHVRPADGAARWSLAQKPDNELDLDQCGRN
                     AAPAETPHQDAVASNRTGA"
     gene            <901188..>902342
                     /locus_tag="CYME_CMT361C"
                     /db_xref="GeneID:16998103"
     mRNA            <901188..>902342
                     /locus_tag="CYME_CMT361C"
                     /product="mitochondrial phosphate carrier protein"
                     /transcript_id="XM_005539292.1"
                     /db_xref="GeneID:16998103"
     CDS             901188..902342
                     /locus_tag="CYME_CMT361C"
                     /codon_start=1
                     /product="mitochondrial phosphate carrier protein"
                     /protein_id="XP_005539349.1"
                     /db_xref="GeneID:16998103"
                     /translation="MLVRFSQLVTWSQTPMVTALQQRKDNGGSNCGVDQVLRAAPSTL
                     PTVWGALGGRPATLVACSADENPTFGTYLKFALAGAICCSVTHSAVVPVDVVKTRLQL
                     SDKYHGMTHAARTIVKEEGALALLTGLSPTAVGYFLQGWFKFGLYEYFKRLYSSLAGP
                     EAAEKGRFGIWLAAGGTAEFFADLALCPLEATRIRLVSQPTFASSLPEAFGKLISNEG
                     LRGLYAGLFPILLKQIPYTMAKFAVFEAASEFIYRTLERMGKPKADMRDSTKLLISLN
                     SGIFAGICAAVVSQPADTVLSVINKSRVTGSIAEATFRIIRELGPRGLFRGLGARAIM
                     VGSLTAGQFFIYDGLKQLLGVAPVHKKEVAPLVGSAAQPASVAARAQQSQ"
     gene            <902699..>903676
                     /locus_tag="CYME_CMT362C"
                     /db_xref="GeneID:16998110"
     mRNA            <902699..>903676
                     /locus_tag="CYME_CMT362C"
                     /product="sedoheptulose-1,7-bisphosphatase"
                     /transcript_id="XM_005539293.1"
                     /db_xref="GeneID:16998110"
     CDS             902699..903676
                     /locus_tag="CYME_CMT362C"
                     /codon_start=1
                     /product="sedoheptulose-1,7-bisphosphatase"
                     /protein_id="XP_005539350.1"
                     /db_xref="GeneID:16998110"
                     /translation="MDLENFLEQVKDPDLRQIVHAIAEASVSIDQVLRNGVQDVSSSA
                     VAAAPGQQHNAFGDAQLSEDLTADHLARSRLLQVPCVSYVSSEENPTEQRGPGHKYAV
                     AFDPLDGSSVLESNFSVGSIFGVWRTAERLVGCQGRDMVAAAVTLYGPRLVLVVAVDP
                     GLMSSDWPGGVASFRWTTSNDARWRLLKQWSPDLLRHSSASLFAPGNLRATQELPPYD
                     RMVRSWIESRYTLRYSGAMAPDVFQIIAKGQGIFCNPSVPGKAKLRLVYEALPLAFLV
                     EAVGGRSSDGSRTSTSLLDKRITLLIERTPVVLGSPSEVQRYIEAMNET"
     gene            complement(<905007..>906896)
                     /locus_tag="CYME_CMT363C"
                     /db_xref="GeneID:16998111"
     mRNA            complement(<905007..>906896)
                     /locus_tag="CYME_CMT363C"
                     /product="similar to glycogenin-interacting protein"
                     /transcript_id="XM_005539294.1"
                     /db_xref="GeneID:16998111"
     CDS             complement(905007..906896)
                     /locus_tag="CYME_CMT363C"
                     /codon_start=1
                     /product="similar to glycogenin-interacting protein"
                     /protein_id="XP_005539351.1"
                     /db_xref="GeneID:16998111"
                     /translation="MDSDTDLSSLECSVGDDRLSDTALSGLVSPRAGSPPLSADSEEL
                     APDRTPESLDWMQLVAQLARLCRVEERGDRSSGTVLSQPSEQCLALEEVHPTDLNATG
                     QPPVTSTNANPWTTQLEHHLNCLICAELPREPLLCPSCGVLFCERCATKWWREPSTAS
                     SQGHRRIASTQPCPHCRQPVARHELVLVRCLRELLQNIRRGPKLALPEQPAEKNPGAP
                     RSLSALKATLWCCSVHAHEAVRYYCQRCNRFICAECCAPLPECEHRYHPLERAHERLQ
                     SLASELEQGLQPLRERLQRFECQLLEYEQTSRFFLRQREALSQRIQRFMDSVLEQIDT
                     QVQQRIQSQQAARTRLVDMRMHLRRLLRDMERRLLAYRQDIAGHYAERAHALPSSAES
                     LLRAHQEWKERWEALSALSVIDASDAVCSAWSESAGTTMLVALPEDQAPIPLKCAVLP
                     PFAWARVPGTLKVCGLRWQVQWMDACSWDATRSPRIPDRKTPPRAQRPTPSDGVAAHA
                     GPLARSESRGLLVKLEHRPGLEREPEDIRLQLEFVVMHQQRSVWGGLFSVNATDGWQA
                     MLDVPDTVVVLVERARCPQDELQVGLRFPDIVEHSKQQTAYIQWMEQRQAPDQESVDR
                     SRSAI"
     misc_feature    complement(906941..909551)
                     /note="repetitive element"
     gene            complement(911750..911823)
                     /locus_tag="CYME_CMT365R"
                     /db_xref="GeneID:16998112"
     tRNA            complement(911750..911823)
                     /locus_tag="CYME_CMT365R"
                     /product="tRNA-Val"
                     /db_xref="GeneID:16998112"
     gene            <912002..>912886
                     /locus_tag="CYME_CMT366C"
                     /db_xref="GeneID:16998113"
     mRNA            <912002..>912886
                     /locus_tag="CYME_CMT366C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539295.1"
                     /db_xref="GeneID:16998113"
     CDS             912002..912886
                     /locus_tag="CYME_CMT366C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539352.1"
                     /db_xref="GeneID:16998113"
                     /translation="MSTESRGKSVTTSVSSLYSKAKQRVLNKFGRRTHLTRNPKVDSL
                     NEIQSGIRADESKLASRITSYRRSLRDAILSGLELQTLYLTIYKRNVGALKFNVERNE
                     YSREPSAAQVIFIQKLEKELSEVETVLKREIDAFTARFKDYADHPLTNKTLEEADELR
                     RVETLKADYKKARTLYSDRAIEVEAGSSNQAALTEAYQEYMRQSDLLCQEMIQYQDRV
                     AREVGNKVRGFFEAQHRIYSTLNEQYDKLLPMARQLESLPFQNGLPGVTVAAAAPIDV
                     VKQHESATPSSDTMSLFD"
     gene            complement(<914096..>914641)
                     /locus_tag="CYME_CMT367C"
                     /db_xref="GeneID:16998114"
     mRNA            complement(<914096..>914641)
                     /locus_tag="CYME_CMT367C"
                     /product="ankyrin-repeat protein"
                     /transcript_id="XM_005539296.1"
                     /db_xref="GeneID:16998114"
     CDS             complement(914096..914641)
                     /locus_tag="CYME_CMT367C"
                     /codon_start=1
                     /product="ankyrin-repeat protein"
                     /protein_id="XP_005539353.1"
                     /db_xref="GeneID:16998114"
                     /translation="MCEREKVLSERSAASAALLRREDLAAELRDYARANDEAGVRDLL
                     SESVWPDPSDRIAFVNTADEHTGNTALHMASANGHTEVVRLLLEAGADPAAQNEAGNT
                     PLHWASMNQQVQCVEVLLGALRQTGASPFVLNKSGRSAYDEAVLVGCRQVTAMLMRFA
                     EEHPSQASADAYFNETTAETQ"
     gene            <914896..>915699
                     /locus_tag="CYME_CMT368C"
                     /db_xref="GeneID:16998119"
     mRNA            <914896..>915699
                     /locus_tag="CYME_CMT368C"
                     /product="similar to oxygen-evolving complex component
                     psbP"
                     /transcript_id="XM_005539297.1"
                     /db_xref="GeneID:16998119"
     CDS             914896..915699
                     /locus_tag="CYME_CMT368C"
                     /codon_start=1
                     /product="similar to oxygen-evolving complex component
                     psbP"
                     /protein_id="XP_005539354.1"
                     /db_xref="GeneID:16998119"
                     /translation="MLFVSLIQTNCNLWKWKRELQRIQSGRCDSKPPRIRVQRGAVHA
                     SIPVSRREVLYALVSALLVPHTGGIQSRPFSAELVLAAETMQDGVSSATGTTAFAGPR
                     ADAVYSAPGARGVQFRYPSRWRIRMKPIKTHAFEVLVVSDTDANTSIGVVSDAVRISR
                     VEDFGSATDIGERVIDLERKKDGVLSAGLVRTAQSVSENDEQPLTYYLCEYRVNSTRG
                     GERHYAAKVTIANGQLYVMTVQCKESQWVMYEPLFKEVLDSFQVRASQT"
     gene            complement(<917238..>918602)
                     /locus_tag="CYME_CMT369C"
                     /db_xref="GeneID:16998120"
     mRNA            complement(<917238..>918602)
                     /locus_tag="CYME_CMT369C"
                     /product="similar to
                     O-demethylpuromycin-O-methyltransferase"
                     /transcript_id="XM_005539298.1"
                     /db_xref="GeneID:16998120"
     CDS             complement(917238..918602)
                     /locus_tag="CYME_CMT369C"
                     /codon_start=1
                     /product="similar to
                     O-demethylpuromycin-O-methyltransferase"
                     /protein_id="XP_005539355.1"
                     /db_xref="GeneID:16998120"
                     /translation="MSSIWEQMRSLLFGASGSYADAADTPQGLAFEQRLVARHGNTLP
                     PWPLFKLGAVYGVGPVPPNLRALLDGSFFLIGACLGTAALFDFAGIIGRRGGGVTAAE
                     VAKECNCADVNAVGRVLRACENWGYFESYVPRDCDSKSVSNEQRLWRNTLLSALLRED
                     HPHSVRAQIMHLYVDIFPASALLFETIRDTPSNDVETDGLRARADASATKQPSAFERV
                     HQCTFWEYLSSHPDRWDVFNRAMRSSDALLGSTIMKDIDWGRYLRVIDLGAADGSLVY
                     HLLSAFALKAVIFDLPPVIEHAKAYWNTSPERSAMVASGRVQFAAGDLFDATTVPAAE
                     EGDIYVMRNIWHDWRDPDCIRIGRSVRAAIGDVRNVKLVILEASIDQYPRGSLLERFR
                     VALDQIMFTAFRSKERDRIEFDALLRRCGFQLTEVRHLRASLVAVIAEPLSHWVQSPE
                     PADQ"
     gene            <918331..>918780
                     /locus_tag="CYME_CMT370C"
                     /db_xref="GeneID:16998121"
     mRNA            <918331..>918780
                     /locus_tag="CYME_CMT370C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539299.1"
                     /db_xref="GeneID:16998121"
     CDS             918331..918780
                     /locus_tag="CYME_CMT370C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539356.1"
                     /db_xref="GeneID:16998121"
                     /translation="MIPAKSNSAAVPKHAPIRKKEPSRRARRLGGTGPTPYTAPSLKS
                     GQGGSVFPCLATSRCSKASPWGVSAASAYDPLAPNSRDLICSQMDDMATYWYNTKSCL
                     LSNAVHRFSKRPPPARALRLDGALRRSRRSLRLSVAQAALLDALQWR"
     gene            complement(<921133..>922122)
                     /locus_tag="CYME_CMT371C"
                     /db_xref="GeneID:16998122"
     mRNA            complement(<921133..>922122)
                     /locus_tag="CYME_CMT371C"
                     /product="small GTP-binding protein of Ras family"
                     /transcript_id="XM_005539300.1"
                     /db_xref="GeneID:16998122"
     CDS             complement(921133..922122)
                     /locus_tag="CYME_CMT371C"
                     /codon_start=1
                     /product="small GTP-binding protein of Ras family"
                     /protein_id="XP_005539357.1"
                     /db_xref="GeneID:16998122"
                     /translation="MAEGDQQPVSTRVPRGNAVPDSAGSLLSTSYYGGVGMYAAAAAG
                     AQRVRRIAVLGARGVGKSALTIRFCEGTFPESYLPTIEDTYQTTLRGRDGTVYALEIV
                     DTAGQDEYSSLGAQATIGIDGYVLLYSVRDASSFEMVRYIFQRLVAILGSDQIPMILV
                     GNQIDQALDREVSFEEGAHIAETIGAAFCECSARTGTNVAEVFRILLDEIERSASDDG
                     FGPIDEEDQEADDQYLEERDPKTWRAPVRDAKTARNRGQLTPQDPPTIESSQGESKPG
                     EQSRSAVTTSSSSTARRTREAVSAEGSATLCAGGFRSGADGSGSMLLSRCGLQ"
     gene            <922731..>923720
                     /locus_tag="CYME_CMT372C"
                     /db_xref="GeneID:16998131"
     mRNA            <922731..>923720
                     /locus_tag="CYME_CMT372C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539301.1"
                     /db_xref="GeneID:16998131"
     CDS             922731..923720
                     /locus_tag="CYME_CMT372C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539358.1"
                     /db_xref="GeneID:16998131"
                     /translation="MSPARTTTRKSQVAAADKAYGSSEGTGAGTGVRSGTGLRSTQFA
                     LLGLSFQAANPEGKLAAGPLLLERSASETSDALLPWPPLDRLRLLFDRGAADWLRQEV
                     LGFFLDASSQCADPLAPPGTVLSFTGVHSAAGAEDGAPLASTAPTASTAPNTSGSVTV
                     NRLGGKACGSWLPLELMESAYEQGAWLAQHRVVLEQLGVSPDTFRSFEGHAATKRRPQ
                     PKIIGSNNVEPVQEAFSRQSNAVREDPGWLRSPETAHRIERGSALRRHSRAPGVDDER
                     TLSSDESRSPSTDRDTLDSSELDSDWTMDTFDDDESYEADEAFATAAEREAVF"
     gene            complement(<924258..>925994)
                     /locus_tag="CYME_CMT373C"
                     /db_xref="GeneID:16998132"
     mRNA            complement(<924258..>925994)
                     /locus_tag="CYME_CMT373C"
                     /product="GTP binding protein HflX"
                     /transcript_id="XM_005539302.1"
                     /db_xref="GeneID:16998132"
     CDS             complement(924258..925994)
                     /locus_tag="CYME_CMT373C"
                     /codon_start=1
                     /product="GTP binding protein HflX"
                     /protein_id="XP_005539359.1"
                     /db_xref="GeneID:16998132"
                     /translation="MFIGTWLWRGGVTGTSYRCSLEPRGHCYAWAPRLPGPRQRAASL
                     APAIWCCQQNEEQYAERRMEPAWRARLRYVPPTRCFLVGAELKSARLGGAASTRITLE
                     QSLDELAELCSTAGMEVMGRTVQKLTEFQSRTLIGSGKVLQVRAMMQSVGATACVFDE
                     QLSPSQQRALEEAFGGERSGIQVLDRTAVILDIFAQHAMSREGALQIELALLQYRLPR
                     LTRMWQHLERQSGGLGVAFRGPGETQIEVDRRIIAQRIARLRRELEGIRQQRQQRRRQ
                     RAAQHLPSLVLTGYTSSGKSTLLNALTHARVFADPMLFCTLDPTTRRAEIPGLNVAPE
                     VLITDSVGFIQKLPTELIAAFRATLEVVVDADIILHVIDRSSPSWRAQAAVVEDTLSE
                     LGVLRSKPRIVIWNKMDLIEHATSVRHQAAILSRQDPPVVPLSALTGEGLDDLMECIS
                     DTLRDMYIPVECLIPYTEAALASEALSHGLCDHQDYTPHGIYLSIRVPRRLANQLQKY
                     KIPDAFERSVSTGADTDFVRYRGKLRGAGGILCPGDSETEGHHGDLAERSREGPYDDS
                     DWRRLARGRHRL"
     gene            complement(<926649..>929498)
                     /locus_tag="CYME_CMT374C"
                     /db_xref="GeneID:16998133"
     mRNA            complement(<926649..>929498)
                     /locus_tag="CYME_CMT374C"
                     /product="zinc-finger protein"
                     /transcript_id="XM_005539303.1"
                     /db_xref="GeneID:16998133"
     CDS             complement(926649..929498)
                     /locus_tag="CYME_CMT374C"
                     /codon_start=1
                     /product="zinc-finger protein"
                     /protein_id="XP_005539360.1"
                     /db_xref="GeneID:16998133"
                     /translation="MWERLQSFATQSKATHDSNSTTDTPSTSEPRLEGTWSRIGSTRA
                     DSHEKEHTSAAACEHKSIGDKASRGEATGFASAAESHRSPGPTPRSHRSATAPNEQQQ
                     RRQQQRPAPANKGGRLETSNNRTEPSSAPRGPSDDAQEPAVSSLRERPLGFGQTVAPA
                     CSSTELSDSRAETGSESVCLVCRERATFWAIGSCAHRICLLCAHRIRCLYRLRRCVVC
                     NQDLEEMLVIPAGEMQSSPELKQDATTDSNPDIAQDMWDATAAMKYSNRTAWEQMRAL
                     QIPTCPACGFQSASPSGLRRHVQKTHPSYALCEVCAGSGRKYWAELRLYPVRTKAVHS
                     RAARSSPEERMSGGSRDGTLRDHLRSEHAECRFCKRFYYDDDALYEHLTQSHETCALC
                     ERDGIQYVYYRNFEALEEHYRSAHYVCDAPSCRGLAFATLLDLQAHQRRACPGAHQST
                     ASSATALGRTFRFQELQQQQQQQQRSGQSSWNVSETSSARQYDGIIHRRDEPTITAAR
                     RRGFSGSAVVYASATESTTEQVALRRTPETSESRNRQRQTVDQRPRTDHDTLPCDSMA
                     HAADARYRPYETNASNSDPRFATSNPGIGTNHRQRQALDTEVAHSSRDVQSQRAGDAE
                     FRTAADHAMHPIPKTEEEAMRRGARLLERVKALLRAESPGGQESWLAFCAHCERLVRG
                     ELQAGACVQALERLLMESGASRSVAAAILFEMCALQPDPRLREALFAACRALAAHPRV
                     QSNEAPPAGNLPATRTLSSVVRNTNAHQLSSNARARAQIPPGPDAFPCLRRTSTPAAA
                     ADASTHASATERRGRLSASARIDASAPGEGAHNLSNSISDTENALAMMRVGGVESPGT
                     PQQSCNAGRSAVSSSAQATRFDGGTLFEPGRGGKVLHVAQLAREHQAQRLERGVWIGR
                     RGFAWEHERDAQRRLAAKTQLKDIAATRSPESSAS"
     gene            <931002..>932660
                     /locus_tag="CYME_CMT375C"
                     /db_xref="GeneID:16998134"
     mRNA            <931002..>932660
                     /locus_tag="CYME_CMT375C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539304.1"
                     /db_xref="GeneID:16998134"
     CDS             931002..932660
                     /locus_tag="CYME_CMT375C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539361.1"
                     /db_xref="GeneID:16998134"
                     /translation="MNGHAQGNTLGTQPLGPPQFIGSRISLLSKMNVRYEGVLYSINA
                     QDSTVQLQNVRCYGTEDRVRPDGGPPVPPSLDIYSFIVFRGADIQDLKVVVPAPVAPP
                     QLPPQQGASLQSVAPPAPPHGYPPGTAPSSMMGPPYFPPYGGNMMPTTNASGGHAAWS
                     AGSSLPMPQAPPQTFAPPRSDTTSYGQPYPQQPSYRYDVPPVQQALQGYPGAPLPTFM
                     GSAVDWEDRPSPSAGAPVPGRNVIENPPSGRGSDTEINKESTAVTATRQSQAEPSATR
                     VPVGNEDMHMDPKRHPEQQNEPRSTKQEEWKSKETTGEGPERKTYGRPVNPTRSDRRE
                     PEATTKPPAPNGRFRRQMQRSTGAADRHAGDTNHRHGQHLHDTTRRGSGPSNTRTHWT
                     RRQSSTPAAIEEFDFESMREKLQKSLLIEEEVLKKIREQPKKYDKNKSFFDSLGDETA
                     SEVLAPPAGSESVTSDGAQLSERPKATQRSSDAKNVETFGEAAIRLRRQRSRNSGHAR
                     QYRRPPDGRPTNRQRVPASRGDAAPKRAAPPEASTRDAEPAVSV"
     gene            complement(<935431..>936348)
                     /locus_tag="CYME_CMT376C"
                     /db_xref="GeneID:16998127"
     mRNA            complement(<935431..>936348)
                     /locus_tag="CYME_CMT376C"
                     /product="exosome complex exonuclease Rrp4"
                     /transcript_id="XM_005539305.1"
                     /db_xref="GeneID:16998127"
     CDS             complement(935431..936348)
                     /locus_tag="CYME_CMT376C"
                     /codon_start=1
                     /product="exosome complex exonuclease Rrp4"
                     /protein_id="XP_005539362.1"
                     /db_xref="GeneID:16998127"
                     /translation="MEEQKATANGRFHTPLEQRIPLPKVAPAASLALPGDAIYAPEQN
                     TLRGHGIFWTPSDESKVLRATLAGTVERINKLVTIRSWRGRYVPNVGDVVVGRIAQVL
                     PASRRWKVDIQARQDAVLTLFAIRLPGAVQRRRTREDELNMRAFYAETDLIAAEVQEI
                     KADGSIMLHTRLEDKFGRLSQFGVFVSVPPGLIRRTGRAFASLGYPHLWVVLGVNGYI
                     WIYWNPEETDRAGAVADEAEPTSTSLLTTGDAEALCRARNAVLVLSMLSLNVSIESIR
                     YVFAAGAVTDPAAMLEPRFLQAMQKMLGE"
     gene            complement(<937923..>939536)
                     /locus_tag="CYME_CMT377C"
                     /db_xref="GeneID:16998128"
     mRNA            complement(<937923..>939536)
                     /locus_tag="CYME_CMT377C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539306.1"
                     /db_xref="GeneID:16998128"
     CDS             complement(937923..939536)
                     /locus_tag="CYME_CMT377C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539363.1"
                     /db_xref="GeneID:16998128"
                     /translation="MLCFFPGNLLPLEAGTASLGLRAHRWVQQERHSGRWRTLPQPRL
                     RHPFWNVSERARTGLTTATRAGELVALAKKGRTRAKRKPGGGDGATTGARQQPAGAPR
                     QERAEQAASRTHSELEPQDAENWNDENSHRLETEPNYGPALNDAEDGEFEGRNGRHLA
                     NLRSDMNGSGALQTDERHELLLEQPQAEEALQKLLSGISLRSNQELLRVAQALQLSAD
                     KLRRNRAPMSYQFRELLVFAEKLLLRDEDLSRLENARAASTGEPPYAAVQRVALQGLS
                     EQALTAVAANRHYFDNRFFYGLSASRLLAEHRGNSEERDRLTLLAFRAQQSVRIIDAP
                     LMRALNHAERTVQMLLDTVLGSSVETLEYAVDSIIGEVSAADLEAIWLVLYAAAAAWE
                     IRRLQDPRTVNHSVVQAIVYIRRQLRTRDVYREKLPLDFHWLTQVALAVSPQDEELLL
                     RSPPNLVETTARVGGLAAALAQTTSNAYIALSRVFSTVYDSLRRLGFEVGDVLEDADD
                     IISSPQIEIREPKVRSRFEKFSVDMIEAP"
     gene            complement(<941711..>942256)
                     /locus_tag="CYME_CMT378C"
                     /db_xref="GeneID:16998129"
     mRNA            complement(<941711..>942256)
                     /locus_tag="CYME_CMT378C"
                     /product="mitochondrial ribosomal protein L11 precursor"
                     /transcript_id="XM_005539307.1"
                     /db_xref="GeneID:16998129"
     CDS             complement(941711..942256)
                     /locus_tag="CYME_CMT378C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L11 precursor"
                     /protein_id="XP_005539364.1"
                     /db_xref="GeneID:16998129"
                     /translation="MSSARSKSKTALSSAPKVLRQRMRMLLPAGKAAPGPPVGPRLGQ
                     AGVNIAQFCKEFNQATANLEDGVPIPTLIAAYTDRSFSFETRQPPVSFFLRRLAGVEK
                     GSSQPGRSFVGQPVPLTAVYELARIKQKDDNLRTVSLQALCKSIIGTARSMGVRIVDD
                     RVLEQPANNKESSPGKDVVSE"
     gene            <942472..>943320
                     /locus_tag="CYME_CMT379C"
                     /db_xref="GeneID:16998130"
     mRNA            <942472..>943320
                     /locus_tag="CYME_CMT379C"
                     /product="20S core proteasome subunit alpha 4"
                     /transcript_id="XM_005539308.1"
                     /db_xref="GeneID:16998130"
     CDS             942472..943320
                     /locus_tag="CYME_CMT379C"
                     /codon_start=1
                     /product="20S core proteasome subunit alpha 4"
                     /protein_id="XP_005539365.1"
                     /db_xref="GeneID:16998130"
                     /translation="MSRYDRAITVFSPDGHLFQVEYALEAVKKGTAAVAVRSPESVVF
                     AVERKATAKLQDPRTVRKIVKLDQHLLMTFAGLTADARILINRARIECQSYRLTVEDA
                     PSVEYIAKYVAQIQQRYTQSGGVRPFGISTLIAGFDEDGQPRLFQTEPAGTYLEWKAA
                     AIGRNAKVVLEKLEKLYREPTDTAASSAATPPELNPASGDPMDAIVVDSEAAALRLAL
                     LSLLEVVESSSKNIEVAVVRRRGDIHVFSDELIAQHVTQIEEEIKAAEESKSQRPAEA
                     DADGML"
     gene            complement(<943847..>945175)
                     /locus_tag="CYME_CMT380C"
                     /db_xref="GeneID:16998123"
     mRNA            complement(<943847..>945175)
                     /locus_tag="CYME_CMT380C"
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
                     /transcript_id="XM_005539309.1"
                     /db_xref="GeneID:16998123"
     CDS             complement(943847..945175)
                     /locus_tag="CYME_CMT380C"
                     /codon_start=1
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
                     /protein_id="XP_005539366.1"
                     /db_xref="GeneID:16998123"
                     /translation="MQRFHGNLLKNRVGTSTDARGKSMIVALSGGVDSAVSAWLLQQA
                     GYRVKGVFMRSWGTGDDAEDCTYRDDRLAARRVADFLRLDEFQEIDLRAEYWHSVFVP
                     HLLEAYRRGLTPNPDLACNRYIKFGALLDVVAKRADILATGHYARCTGGQLYRALDRA
                     KDQTYFLASIDPSALRKLHFPLGDWQKHEVRALARHLRLPNATRASSRGICFIGRHKS
                     IASILDEFAPPGDFWPAVDIDTGRTLGRVSSYRTIGQRAGIGGLPQAFYVCDKDPARG
                     IISVCAGRSHPALSCWGYEVEAFDLWNAWMEHQHLKESAGWLHRSFSFQAWYRQTPLS
                     CLIRRLEADSLATSNDRAQPRVRVAAMPPQRLLVLVPGRSASAPVTAPGQAVVIYDED
                     QCVGGGFVRRLIRNAAEIPHWTVAKELFSTVPACKFSANTDARSWASSER"
     gene            <946181..>947179
                     /locus_tag="CYME_CMT381C"
                     /db_xref="GeneID:16998124"
     mRNA            <946181..>947179
                     /locus_tag="CYME_CMT381C"
                     /product="enoyl-[acyl-carrier-protein] reductase [NADH]"
                     /transcript_id="XM_005539310.1"
                     /db_xref="GeneID:16998124"
     CDS             946181..947179
                     /locus_tag="CYME_CMT381C"
                     /codon_start=1
                     /product="enoyl-[acyl-carrier-protein] reductase [NADH]"
                     /protein_id="XP_005539367.1"
                     /db_xref="GeneID:16998124"
                     /translation="MAFVSSWKGLRFDASAPTTWRPAVATAHARKHASLLSPRAWSVS
                     RSRRSFVVCAVSDQASGVGQVVPLVDLRGKRALITGIANQRSIAYGIAQQLRRAGAEL
                     GVTYLPVNERAESKVSKLVEPLGASFLHPCDVQSRSDLEGLFETVKQKWGGLDLLVHC
                     LAFANREDLEGNFSETSRNGFSVALSVSTYSLIEMCGLAKPLFRPGGSVVTLSYLGAE
                     RVVPNYNIMGVAKAGLECSVRYLAAELGPACGVRVNGISAGPIRTLASSAIGGITTMI
                     RNVEQNAPLRRTVTQEEVGKTAAFLLSDAASGITGQILYVDSGYVIMGSPTFESPA"
     gene            complement(<947418..>948329)
                     /locus_tag="CYME_CMT382C"
                     /db_xref="GeneID:16998125"
     mRNA            complement(<947418..>948329)
                     /locus_tag="CYME_CMT382C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539311.1"
                     /db_xref="GeneID:16998125"
     CDS             complement(947418..948329)
                     /locus_tag="CYME_CMT382C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539368.1"
                     /db_xref="GeneID:16998125"
                     /translation="MRSRSLQRRLRRRRRVYHSASTLEQRARRYRWHREDALTKTRNV
                     RRRQSKASIDDAEDELVDHLTVAVSFESLTGTYQEEVSRMLRWYGRSAQALAQVLIQH
                     PEVSTVVMIEGFPLAVIACIPYATYADILPRTRFPQTETAWLVWGTLCLNFPIALLPQ
                     LWRVVHDDQANACAMAGSQAGDPLFKRAASRFVHIGFAERRASDVSSAAQSRQGASRM
                     TTHAPRQLRIKQRRSNREAAMEWSFPSVADQMLYENASDAVCLSLDSGFHVHEELVPI
                     AMLIDAEDLLRVGRQLEQHSPHQVKEH"
     gene            complement(<952909..>954138)
                     /locus_tag="CYME_CMT383C"
                     /db_xref="GeneID:16998126"
     mRNA            complement(<952909..>954138)
                     /locus_tag="CYME_CMT383C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539312.1"
                     /db_xref="GeneID:16998126"
     CDS             complement(952909..954138)
                     /locus_tag="CYME_CMT383C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539369.1"
                     /db_xref="GeneID:16998126"
                     /translation="MNVRGQRGPVFEDDDGASLATQAFPGNSTQTPRKGSSLPERGSG
                     EDVPPGSADSFGSSSSALAQLASVATVAAAAAAQRQRYPFPNFMQNLSPPTSFNLNGS
                     DFSFQFPFTDLRSLPTTTELLGSPTLLMQNSSAGLVDDEDPLVRLLRQEGSFGGNQVA
                     ERPASATKRPRPHTPLDNAIDARVVSDVGSEHDPAGPAMGRLPTRPLMSETKTEAPVA
                     NEAASSFLSPSPLKRIEPSPWSASDSARTCGAPEAVTAADALDSRKRFESEPAEQLQA
                     TSNDRVPDGLRAERNRQAAAASRERRRAMVNDLEARNRVLSEQNAQAQIEVLTLKREM
                     SELIRHFKAQLERQEREKAQLMALIQKLQEDNAQLRKVDEETEKLMGLSNADAIGADA
                     VSEKLKIKSSKPASKRQ"
     gene            <956884..>959130
                     /locus_tag="CYME_CMT384C"
                     /db_xref="GeneID:16998143"
     mRNA            <956884..>959130
                     /locus_tag="CYME_CMT384C"
                     /product="adenylate kinase"
                     /transcript_id="XM_005539313.1"
                     /db_xref="GeneID:16998143"
     CDS             956884..959130
                     /locus_tag="CYME_CMT384C"
                     /codon_start=1
                     /product="adenylate kinase"
                     /protein_id="XP_005539370.1"
                     /db_xref="GeneID:16998143"
                     /translation="MGGVSAHEPPAAFVIGASRNRVPQADGTRACVWKSNSSFRASRV
                     PRFRTRITLWCESDREILKYTGSEAPPTANGHNAHTDLGVQRTGQGLMSHFHGSKNPA
                     HSNGHQPVEQGMKHSASGLSTGRRDAGTDAQPRPPDGAPPQQRGALEPEPNSRTGDSS
                     AVSERESISVTPDDYLSDLPRSVVLESLRDESLKTLLSPLPRPARLRIILMGKPASGK
                     GTQAPLIARRFGMVHISLGTLLRNEIRSNTELGRLTSEYVHRGELVPDDLALAILKKR
                     LSQEDCRNKGFILDGFPRTERQAVLLNRAGIEIDYVIVLERPDEDLLDWARERLLDPI
                     TGIMYHPRLAPPPPHVVHRLERRCDDKLEIVHMRLRQYAQEAPKIMAQYSDRLSIVRT
                     DNTRPYLDTFREISEILERLILPRDDEEKCEVRLERTGLWRPRGIHRVALPRGALFKA
                     LDSFAHRIRERDYVPLYASTAQDAPRIGLVGRNWAAELLSADTDHEVFDIQLETCSVF
                     DASETTDSGFVRFHDDATTERLQQVMQRMRDRGLIEGWRNERVPLRLGNGRYLEIERA
                     CMPYLGIETSGVHINGYFYKAGQDGRPELFVWLARRSWKKPTYPGRLDQLTAGGVPAA
                     ATSVLQQVMLELYEEAAYVGPAPVPVGCVRYRYETRKGISAKVLYLYDLELEENWKPY
                     NHDGEVDAFYAVSAEEALASLVEAQHEWKPNSALVLVDFLVRHGVLHADNEPDYADII
                     TRLHCCGI"
     gene            complement(959427..959499)
                     /locus_tag="CYME_CMT385R"
                     /db_xref="GeneID:16998144"
     tRNA            complement(959427..959499)
                     /locus_tag="CYME_CMT385R"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:16998144"
     gene            complement(<963344..>964468)
                     /locus_tag="CYME_CMT386C"
                     /db_xref="GeneID:16998145"
     mRNA            complement(<963344..>964468)
                     /locus_tag="CYME_CMT386C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539314.1"
                     /db_xref="GeneID:16998145"
     CDS             complement(963344..964468)
                     /locus_tag="CYME_CMT386C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539371.1"
                     /db_xref="GeneID:16998145"
                     /translation="MQRLEEGPEDSIYFDAWDNPAIADARALYEEEQLFAARRVLVQQ
                     GITAARAASFGPLIEEIFRETDDLSLFLQDLNDESDPAYSIAVQTKRMIVRYRRIPGS
                     VLHKYHVTAELSAPLENLCCVLAEPDLFGQLFWYVRDIKLLVPSGRVQRAVYARFYAP
                     WPFADRTIYLVGRGIDALDEPSQSVYIVIRSVRPADGAAWRAAERMRERVADQRSVTV
                     EARACFELHPVSRGRTRVRLVGVFDPRIKFIPASLINWASRKIIRHGTKQLGWVAAHL
                     SKLQTEHWKRLHDPEWCFGVYPWLRRRLASFWWTREAVSESQSQSKGTTSVPWSGSRL
                     SGSESEPSDVEMPADVDSNTRLLRTVGKSAASTGHASPRT"
     gene            <966700..>967806
                     /locus_tag="CYME_CMT387C"
                     /db_xref="GeneID:16998146"
     mRNA            <966700..>967806
                     /locus_tag="CYME_CMT387C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539315.1"
                     /db_xref="GeneID:16998146"
     CDS             966700..967806
                     /locus_tag="CYME_CMT387C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539372.1"
                     /db_xref="GeneID:16998146"
                     /translation="MVEPCAPTPLVPEPGLSVPTSSEQGPGTPGTEPPPLAAEDSSDL
                     LELEQLEATDLNRWQEFVTDPKRKACVLAARSLRTLNKSKLLRYYLNAIVQRFTCANS
                     KPSIVDVHWLIHLTNTLVERCASQLYSEEPENQDQHMLNAMRLAIRTVSGAGAAVIQA
                     WIPAMRSGTMACLLALGAAPDRLAGALLDRVVREPYQESEYALAIGALARNAPRALLL
                     HEALVQRNPAAIDAIVCMRERLASAGNSTATIQANATAETGSDEQLSHCTWLDALTRL
                     ARNEFALYALGLDTRMTAEDEERLRLDTVERIRAAFDSPDVSLRASAALAAVEALRSG
                     QARHPSELSIPTSLKPLLIEIIRRTKRKRDDEVS"
     gene            complement(<969156..>970130)
                     /locus_tag="CYME_CMT388C"
                     /db_xref="GeneID:16998135"
     mRNA            complement(<969156..>970130)
                     /locus_tag="CYME_CMT388C"
                     /product="unknown phosphatase CbbY"
                     /transcript_id="XM_005539316.1"
                     /db_xref="GeneID:16998135"
     CDS             complement(969156..970130)
                     /locus_tag="CYME_CMT388C"
                     /codon_start=1
                     /product="unknown phosphatase CbbY"
                     /protein_id="XP_005539373.1"
                     /db_xref="GeneID:16998135"
                     /translation="MEGTLSFVSGFAPAVYRRELFRHRCVTTAPEARAWPRLGLLRAN
                     SGARLSRVDITPEIYKRLVSMAKRTEGNFSAVAGAILESYLTAATNRDLRAVIFDMDG
                     VLCDSERLSRAAGVEYFRRYHGVWPTEKDFADFAGTGEAAFLSGVARRYSVKDFDVNK
                     AKEGFFNIYVNEYVSALEPFEGVREFIQQIKTMGLKTALASSADAIKVHANLSAIGFE
                     RDMFDFVTRSDEIANKKPAPDIFLAAAEGLGVPPESCVVIEDAPAGVLAAKRARMRCV
                     AVATSVSAQLLWDAGADIVRPAPQYIMLDDIVITDDADASAPASASQE"
     gene            complement(<970211..>971377)
                     /locus_tag="CYME_CMT389C"
                     /db_xref="GeneID:16998136"
     mRNA            complement(<970211..>971377)
                     /locus_tag="CYME_CMT389C"
                     /product="cystathionine gamma-lyase"
                     /transcript_id="XM_005539317.1"
                     /db_xref="GeneID:16998136"
     CDS             complement(970211..971377)
                     /locus_tag="CYME_CMT389C"
                     /codon_start=1
                     /product="cystathionine gamma-lyase"
                     /protein_id="XP_005539374.1"
                     /db_xref="GeneID:16998136"
                     /translation="MDLGTKAIHVGQEPDEATGAVIPPISLSTTFAQLAPGTPRSHYD
                     YARSNNPTRENLERCIAALEEAEFAFVFSSGLGATTTLLHLLSSGDHVICIDDVYGGT
                     QRYFRNVAARFGVTFSFIDFEGDAYPKALAEHPNTRMVWLESPTNPTLRVTDIAMVAK
                     QTPPRVLLVVDNTFMTPYCQQPLKLGAHIVMHSMSKYLNGHSDVIMGAVALRDRALAD
                     RLRYLQNALGAVPSAFDCYLVHRGLKTLAVRMERHCDNAMKIAEWLEQRSRMEPKRIH
                     RVIYPGLASHPQHEVAKRNAARPGAFGGMIAFSMDNAAECLSRMRLSTLAESLGGVES
                     LIEVPALMTHQSVPAAERERLGIDERLVRWSVGIEAVGDLLRDLQDALDASNAS"
     gene            <971593..>972822
                     /locus_tag="CYME_CMT390C"
                     /db_xref="GeneID:16998137"
     mRNA            <971593..>972822
                     /locus_tag="CYME_CMT390C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539318.1"
                     /db_xref="GeneID:16998137"
     CDS             971593..972822
                     /locus_tag="CYME_CMT390C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539375.1"
                     /db_xref="GeneID:16998137"
                     /translation="MAGGRPCLLFGVACPALCIPSTPPVVVTNWRSLRYVAPYLFTYR
                     VNVKERWLGTTLTDVFTKEFYGTREFWANQMKHGRLLVNGASIAADYVLQPADTILNT
                     VHFHEAPVSATDVPRVIDEQPDWVAVYKPAGIPTHVSGQFRYHSLTAWLSRLLSEHHQ
                     RTAPALYTLYRLDRVTSGVVVFAKNVELARRWHQHASGGNRSVPRHRKVYLARLQGRF
                     REALTCRVPLRLDRGEQGYARSFPDFQSGKASITLFKPLGYDTRTDTSLVECVPVTGR
                     THQIRAHAAFLGHPVANDALYGGTLAADEYTTVVADAIAGMLGTGESRSSAEPTLMQL
                     FPDLQVADPLCHHCPYAAPVRWREDPLYRQLGIWLHALSYRYDDDDNAPTARFSWHAQ
                     TEWPSWAQNCALETDLA"
     gene            complement(<972802..>973707)
                     /locus_tag="CYME_CMT391C"
                     /db_xref="GeneID:16998138"
     mRNA            complement(<972802..>973707)
                     /locus_tag="CYME_CMT391C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539319.1"
                     /db_xref="GeneID:16998138"
     CDS             complement(972802..973707)
                     /locus_tag="CYME_CMT391C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539376.1"
                     /db_xref="GeneID:16998138"
                     /translation="MQRRGQLSRRLVNSADRDPSDENSLSRAPAPACTSRGTHVVETT
                     SLKRHSKVLRSQDASGTAESVNSQTPDDEVDHTLWTLVREVSDAEAAFWALRNDSRLL
                     GFVLRSQLLALVHDDSSVTDFLEAAQQPTDVGDVQAEFILCWVPVPGGPAILWRADYQ
                     RLIEEQVARRLSELEDPARKAALWGTTREQVERDTHIRAADGSCWLRTLPCPPSVIRA
                     LTQGQKALVQQVKRMGRYGRLPLHRAELLRLSRTCFSARFHILDAVGCGTLALDAQNT
                     LSKEPYLCLPEVRTTNIVDSGEIGF"
     gene            complement(<973774..>974616)
                     /locus_tag="CYME_CMT392C"
                     /db_xref="GeneID:16998158"
     mRNA            complement(<973774..>974616)
                     /locus_tag="CYME_CMT392C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539320.1"
                     /db_xref="GeneID:16998158"
     CDS             complement(973774..974616)
                     /locus_tag="CYME_CMT392C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539377.1"
                     /db_xref="GeneID:16998158"
                     /translation="MLSRRSAGPLVAWCVQPRLWAADAARGHQSVACRLPYRCREGRA
                     PAVARSTWRWIRLYGGTVVVMGPKRAHNRTQRPTKREPVTEHKPAAARHEPPSTPATQ
                     TEIAPDSTATIPSETVPALQASEQCRAEELALSDIRQVAAGLFGESIRVESASFSPDR
                     RLYRVFLCTDATIGDCETLTKALVADNSWEHGMDIQSLEVSSPGVGDVLQHDRAFQAF
                     RSFPVIVTFTEEHPKYGMMVQGNLVDRDETSVRISQGGKVLRLERAAVREVRLVPAEE
                     GDNL"
     gene            <975042..>975449
                     /locus_tag="CYME_CMT393C"
                     /db_xref="GeneID:16998159"
     mRNA            <975042..>975449
                     /locus_tag="CYME_CMT393C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539321.1"
                     /db_xref="GeneID:16998159"
     CDS             975042..975449
                     /locus_tag="CYME_CMT393C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539378.1"
                     /db_xref="GeneID:16998159"
                     /translation="MQRSRVLSLYRTILRTAKRRFQDQPETVDSVCAEARQLFRRNAS
                     LRDPQDIERKLFEAESRLELALHYGIPFPRAYHLSPGATPRSPRRVAYPLYMDSYVET
                     LQPTSQRRNTPPIDRPPIYHGEDQASLHTGRKA"
     misc_feature    975539..976322
                     /note="possible transcribed region"
     gene            complement(<976445..>976819)
                     /locus_tag="CYME_CMT394C"
                     /db_xref="GeneID:16997953"
     mRNA            complement(<976445..>976819)
                     /locus_tag="CYME_CMT394C"
                     /product="similar to Sm-like protein LSm1"
                     /transcript_id="XM_005539322.1"
                     /db_xref="GeneID:16997953"
     CDS             complement(976445..976819)
                     /locus_tag="CYME_CMT394C"
                     /codon_start=1
                     /product="similar to Sm-like protein LSm1"
                     /protein_id="XP_005539379.1"
                     /db_xref="GeneID:16997953"
                     /translation="MSDALVDDLDKRVLVYLRDGRFFLGYLRSFDQYGNLTLEDATER
                     VVVNDEAFADIPRGLQVFRGENVVLFGAVDSEQRELEFLRKLRRVTEEEIRRMEQAVA
                     EDHAALRRRERLEWPAFDDGAL"
     gene            <977279..>978523
                     /locus_tag="CYME_CMT395C"
                     /db_xref="GeneID:16998161"
     mRNA            <977279..>978523
                     /locus_tag="CYME_CMT395C"
                     /product="methionyl aminopeptidase"
                     /transcript_id="XM_005539323.1"
                     /db_xref="GeneID:16998161"
     CDS             977279..978523
                     /locus_tag="CYME_CMT395C"
                     /codon_start=1
                     /product="methionyl aminopeptidase"
                     /protein_id="XP_005539380.1"
                     /db_xref="GeneID:16998161"
                     /translation="MRGGYNSVQPSFVASETLGLRPVLRGAFRTAPRKPRSAASPVYQ
                     LAAAAGGGQRRQERPSPSSYGKGAGASSKKGKDEKKTVQQFTRGQGFAKTASTKSTRT
                     LLRPGVQSPPRTVPSHIPRPKYAAGDIPARSQRLLPRMPWDIEVKTPEQIERMRKAGR
                     IAREVLDAACKAVHVGMTTDEIDAIVHEETIRRNAYPSPLHYNGFPKSCCTSINEVIC
                     HGIPDSTRLRDGDIINIDVTCYVEGVHGDCSEMVLVGNVDKRGRELVRVTFECLEKAI
                     SICSPGAEYSMIGAVIEDHATQHGFGVARDFFGHGIGEEFHDNPNILHFRNREPYGRM
                     KVGHTFTIEPMLHETMNTRYRVWSDGWTAVTEDGGRSAQYEHTLLIVEDGVEILTRKT
                     SDSFPYFWETEAAADAPRESDS"
     gene            <979754..>980419
                     /locus_tag="CYME_CMT396C"
                     /db_xref="GeneID:16998162"
     mRNA            <979754..>980419
                     /locus_tag="CYME_CMT396C"
                     /product="similar to class 2 transcription repressor NC2
                     alpha subunit"
                     /transcript_id="XM_005539324.1"
                     /db_xref="GeneID:16998162"
     CDS             979754..980419
                     /locus_tag="CYME_CMT396C"
                     /codon_start=1
                     /product="similar to class 2 transcription repressor NC2
                     alpha subunit"
                     /protein_id="XP_005539381.1"
                     /db_xref="GeneID:16998162"
                     /translation="MPGAVGTHGSRFTAGRVKRLLQTNDEVGHMAASVPVLVGHATEH
                     FLRDLSLQALAYAKESGATTITSSLLRYTVEKEPRFQFLRPLFAKVPPLTEKELQEMS
                     RNRDSRSRVKHSERRPRAKRKTTAGTGTGKRGGAAPRRTKPAGATTADASHETGEDTP
                     ETGSALATEAPAPEVALQVAAEEESRMPLASSSSGAGATTADASAKAGAWHILEEDYD
                     VEE"
     gene            <982543..>983193
                     /locus_tag="CYME_CMT397C"
                     /db_xref="GeneID:16998163"
     mRNA            <982543..>983193
                     /locus_tag="CYME_CMT397C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539325.1"
                     /db_xref="GeneID:16998163"
     CDS             982543..983193
                     /locus_tag="CYME_CMT397C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539382.1"
                     /db_xref="GeneID:16998163"
                     /translation="MTLEPNANKRQRAQEQVRRARLRDFLESLERDNWEDTSSDDGYD
                     SELQEGELVAETSLSFPTAALPVNALTGTTHRVPDSQQVRQRRKRRDSRAEIDSERAS
                     NSGGAVADQRTMESTPTSDLDSQLGNGPRRPPWKLSHLVRLNYRYAWLAQRGSLEGWL
                     YFTSAPATASARPARHLCDVCGFGACYTCPRCGGFTCSLACTRTHRETRCLRTWQT"
     gene            complement(<986944..>988839)
                     /locus_tag="CYME_CMT398C"
                     /db_xref="GeneID:16998164"
     mRNA            complement(<986944..>988839)
                     /locus_tag="CYME_CMT398C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539326.1"
                     /db_xref="GeneID:16998164"
     CDS             complement(986944..988839)
                     /locus_tag="CYME_CMT398C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539383.1"
                     /db_xref="GeneID:16998164"
                     /translation="MLLYFVSASSSFRRNACFTHFSRKCCWRSRWMRRAAHPPAQAVA
                     LVAVTGSGGYERHSGTSSAADCNEYPKNGNNEWIVPDQKEPAALEARQAQWKRVALLV
                     VLTACWSISSAPSVQALAQTVHARSGDRQTLARSGTREKSREQTGRRRLVLPSERAYQ
                     ESLARRKQRQALVHRTTRVVVPGALLIGGTGGGVAWYLRHRQRRRAAEFEEFLKTTLQ
                     DLGGGPDPDDVELEDTDSSFELSSDTVEQNRPSTADPSAVAKRIHDRADLAGRLRVDL
                     STKPDVVMLDGSTFPSDSLEYRIHRFLSEDATESESSEVDLTESLRKALQDEQWTQDR
                     LLAVSNGSITRIISNAIEEMRRQSQTFAASDFGMQKLLQVVYRCDMLATALPPAEAEA
                     ASPTWTSKSMPFAQRLRYAGRQRNRQDVQDLYRRYVIRALMQEQPTDEREAGPVDLSR
                     LEKTMSSLAILERILRIDEASATSIKDEAARFVFQMAVSATFSNPNASVDETYLQDLM
                     KLLEGLLTPEIAERIRSEVGMMRILYDIEKMVKEGNITREDKRALRTLCTQLGFNVQD
                     FLESTAQLKEVLGAEGERYARLFQQIFGDDNDEDGGSERSNRGELSDSETTDTQAVRM
                     DTSSGSP"
     gene            complement(<991507..>992196)
                     /locus_tag="CYME_CMT399C"
                     /db_xref="GeneID:16998165"
     mRNA            complement(<991507..>992196)
                     /locus_tag="CYME_CMT399C"
                     /product="similar to Golgi transport protein SFT2"
                     /transcript_id="XM_005539327.1"
                     /db_xref="GeneID:16998165"
     CDS             complement(991507..992196)
                     /locus_tag="CYME_CMT399C"
                     /codon_start=1
                     /product="similar to Golgi transport protein SFT2"
                     /protein_id="XP_005539384.1"
                     /db_xref="GeneID:16998165"
                     /translation="MMGSISFSEPSSEISEPPWYALQSSLTVPNFSWASVRDLFQGNG
                     SHAYDVEATVDSSGPAPTEYDAWGFRELCQCSRSQRLLLFAMLFGTGVVVSFLSVGML
                     PMLILRPQKFAFAFSLGQVLLITSTWLVVPLQVQLRALSVTERATAAAMYGIALVLAL
                     VTSLRHLALLALCFVLIQLSALAWYLLTFLPFGRGWLWAWFSSATGLHRLDGSVQAPW
                     RWMPSSVSGGN"
     misc_feature    complement(993063..994400)
                     /note="possible transcribed region"
     misc_feature    complement(995131..996669)
                     /note="possible transcribed region"
     gene            <996952..>997353
                     /locus_tag="CYME_CMT402C"
                     /db_xref="GeneID:16998149"
     mRNA            <996952..>997353
                     /locus_tag="CYME_CMT402C"
                     /product="40S ribosomal protein S17"
                     /transcript_id="XM_005539328.1"
                     /db_xref="GeneID:16998149"
     CDS             996952..997353
                     /locus_tag="CYME_CMT402C"
                     /codon_start=1
                     /product="40S ribosomal protein S17"
                     /protein_id="XP_005539385.1"
                     /db_xref="GeneID:16998149"
                     /translation="MGRVRTKTVKKSARVIIEKYYSRLSANDFHTNKRVCDEVAILPS
                     KRMRNKVAGFITHLMKRIQRGPVRGISLKLQEEERERRMDFVPDVSAVNTETIEVDPD
                     TKAMLRSIGLGSMSGVVVIQPGERRPYHTRK"
     misc_feature    complement(998191..1000346)
                     /note="possible transcribed region"
     misc_feature    1001550..1003770
                     /note="repetitive element"
     gene            <1003772..>1005799
                     /locus_tag="CYME_CMT405C"
                     /db_xref="GeneID:16998151"
     mRNA            <1003772..>1005799
                     /locus_tag="CYME_CMT405C"
                     /product="unknown hydrolase"
                     /transcript_id="XM_005539329.1"
                     /db_xref="GeneID:16998151"
     CDS             1003772..1005799
                     /locus_tag="CYME_CMT405C"
                     /codon_start=1
                     /product="unknown hydrolase"
                     /protein_id="XP_005539386.1"
                     /db_xref="GeneID:16998151"
                     /translation="MSSSNTGVRVPAAASDVESTDTGYEQDEEQLPNQQDSEATDPEV
                     QFDGGTDWLNSSEAEPVELSRAYSAPEPLDEGPKPNLLDISSAWGQDFVERADSELES
                     YAEEHPGPEEHGASQQERQRSRSYLRALRAKMDRTWRADWTHRLGRTLDGTVDRARPY
                     WRHLRSSSGLRRRVLSRSPSMLLQNLNHSRKIIARKSVEAASEAAEFISSPTLLFRPA
                     KMAFAIAFPLLIPLLITPWRILLILFVFYAVWYLVVAAIFATEVMMRPPWYRVGLGGQ
                     LPMVEIPPYWRGVCHNPKQDLQLDYVSVSFESLHPPRRTLRGWYIPAESTGMTFESGS
                     EQSAPETGAAKPSEASSADAPNPHATTPSGEHATTSRSRGTTSTGRTCVVCVHGAGRD
                     RRNFLRHAGALHRHGYDVLLFDLSEHGLSDGSGRGTTFGAREKYDVLAAIAYAYNALQ
                     AERIVLLGTSAGASSCLLAAAEWIRLHRFLKLQIVGQRHESSQALSEQHSLDFPVQCI
                     IAENPLARPDELFIFHLERLSLNYLPKDSYHLARKTLFWFASRVLLFRLAWVDREPSA
                     VPGSHLRRLWVVISTLSRVLGGRTRCGAVDVMTDIHCPLFVLHGTGDEIVPVDHGMRI
                     FAAANEPRQLWLAPDAAHCALFDQYPTEWENRVVDFIEKSLSEESNAKSRS"
     gene            complement(<1007540..>1007953)
                     /locus_tag="CYME_CMT406C"
                     /db_xref="GeneID:16998152"
     mRNA            complement(<1007540..>1007953)
                     /locus_tag="CYME_CMT406C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539330.1"
                     /db_xref="GeneID:16998152"
     CDS             complement(1007540..1007953)
                     /locus_tag="CYME_CMT406C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539387.1"
                     /db_xref="GeneID:16998152"
                     /translation="MKQGLAPAVSRPPQEDQQQLDELFERARESSKKLTRNAAAQRSR
                     SSQGNRKPERSLRRFGNTPKKDGRIGVQRTLTKQDTKQLPRRHSRVDAASPVSRTRSA
                     RTEEGYRVFSLEELATDQPEGLNGPCPFDCNCCFY"
     gene            complement(<1008548..>1009390)
                     /locus_tag="CYME_CMT407C"
                     /db_xref="GeneID:16998171"
     mRNA            complement(<1008548..>1009390)
                     /locus_tag="CYME_CMT407C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539331.1"
                     /db_xref="GeneID:16998171"
     CDS             complement(1008548..1009390)
                     /locus_tag="CYME_CMT407C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539388.1"
                     /db_xref="GeneID:16998171"
                     /translation="MSETGLEHSQVDVVQSSGDEAEIRFVTSKRSGYVARAHRNPLAI
                     GGFAVPLSPKLVTWTGVFPGVASPKVRVVDIGSGYGGLLLYLATRVAPDCCVLGLEIR
                     TAVWQQAHQKLLELRSTCGAYRRVAFLHTNAQRYLWNYIERASLDALIFAYPDPHFKR
                     KKHRQRIISRTLLPLYAYLLRRGGRIYTSTDVEALYEWMHDRFEESALFVRKCRLIER
                     HGKSRYNPNRVPESKPIEDSDEASIQFFKNDPYAAAVRDWTDEGRRVSRVQGDKFLLV
                     YEKV"
     misc_feature    1009053..1010898
                     /note="possible transcribed region"
     gene            complement(<1011963..>1013504)
                     /locus_tag="CYME_CMT409C"
                     /db_xref="GeneID:16998173"
     mRNA            complement(<1011963..>1013504)
                     /locus_tag="CYME_CMT409C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539332.1"
                     /db_xref="GeneID:16998173"
     CDS             complement(1011963..1013504)
                     /locus_tag="CYME_CMT409C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539389.1"
                     /db_xref="GeneID:16998173"
                     /translation="MNLERGADILGSGQSAGHNVDHVVPDLPVTAEGQALPLVQNEAS
                     LSGFGEQPRTSRRRSERVVSRAPVEYSETALPKQAERKAKRREAAGSEPAAGLAVRSS
                     EQELLHNPEVVALVSEFARYGRPRWFTPERSVPRGMPPRARNDLPIAELLNLLTGASA
                     SLGRVVSEQDRWSSALEEFCPPGILELLKSRTDTMYVNPIERGIALVQSNRETRAFLQ
                     YLISTLVTPFTDHPLATVSKWLELVSDYLALNADELLLMLIYLVRYIALNAKHPLRGA
                     AENAGSTEQEVLRERRSEIASKAHEPSMTFGLAPSDFERPLFRPIDVSTGKPMRACNE
                     PRAQQWEQVLAVAAYTAVFSLEEFPRRTELEIRDLLGGVRWSMRAAQLLVYDALEWRL
                     LVLEAEYVAVRDLVLQAAIHGEQSPSQLLADTISVVRLERARADRERQTFLRSAGIAP
                     DCWSESSVTSPSMLQYEHVIADEHEKVNDMRRAFLENMNTLSGATAHDEVMIEPLPFS
                     PTMDD"
     gene            complement(<1017352..>1018248)
                     /locus_tag="CYME_CMT410C"
                     /db_xref="GeneID:16998174"
     mRNA            complement(<1017352..>1018248)
                     /locus_tag="CYME_CMT410C"
                     /product="40S ribosomal protein SA"
                     /transcript_id="XM_005539333.1"
                     /db_xref="GeneID:16998174"
     CDS             complement(1017352..1018248)
                     /locus_tag="CYME_CMT410C"
                     /codon_start=1
                     /product="40S ribosomal protein SA"
                     /protein_id="XP_005539390.1"
                     /db_xref="GeneID:16998174"
                     /translation="MATLASRQDDIAKMLACNTHLGTKNCDCLVSPYVFKRRADGVHI
                     FDLSKTWEKLQLAARIVAAVDTPADVVAVSARPYGQRAVLKFAQYTGATACAGRWTPG
                     QLTNQMERRFTEPRLLIVTDPRVDAQPVREAAYANIPTIAFCDTDSPLQLIDVAIPCN
                     NKSRASIALMWYLLCRQVLRLRGEIPATGDWDVMVDLFFYRDIEEVKKEEEAAAAARE
                     AEAAAIAAAAAAASTVPGPADMFSGGNFGEMMTMGAYAVGPTEWSAAAVPHEAAVSSW
                     EASAGAFESALPGEAPTYPTQF"
     gene            <1018623..>1019717
                     /locus_tag="CYME_CMT411C"
                     /db_xref="GeneID:16998166"
     mRNA            <1018623..>1019717
                     /locus_tag="CYME_CMT411C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539334.1"
                     /db_xref="GeneID:16998166"
     CDS             1018623..1019717
                     /locus_tag="CYME_CMT411C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539391.1"
                     /db_xref="GeneID:16998166"
                     /translation="MRQRYRVAVRNARFLHLLVLFGVFVVSLAILYASSLTQLDAGKQ
                     DTRSAVAEAARAQQRLVRLYRKALSLDDPTHCTFIIGVGLQPRGQDLRGLFQHFGAGR
                     WFRKPRVYYYGGLSADALRLAHGARRRASRSDILFSRPERDGAIDGVIGCAVSHLLAV
                     RSALQRGCKTALFLEDDTSLGLVRYWDKPVAAAIHDYASDEYPVLQMELKLRSFLERG
                     DSGALGLEHLPVRCGWRHTVPHRFKVTYGTGAYGMLRTGMERTLQRFTANEAFAGRAR
                     ASHLGPVDVSKVIAAGGHADVYVILNATTTKVLWPPYFHEAFDSKSIVRPREGRGNSH
                     QPQHIASARYAIKANMRWAEACREYVLENE"
     gene            complement(<1020344..>1021588)
                     /locus_tag="CYME_CMT412C"
                     /db_xref="GeneID:16998167"
     mRNA            complement(<1020344..>1021588)
                     /locus_tag="CYME_CMT412C"
                     /product="isocitrate dehydrogenase subunit 1,
                     mitochondrial"
                     /transcript_id="XM_005539335.1"
                     /db_xref="GeneID:16998167"
     CDS             complement(1020344..1021588)
                     /locus_tag="CYME_CMT412C"
                     /codon_start=1
                     /product="isocitrate dehydrogenase subunit 1,
                     mitochondrial"
                     /protein_id="XP_005539392.1"
                     /db_xref="GeneID:16998167"
                     /translation="MVHTLLRQAATCFRKCTLDTLCRGQFLRRFVSGSAQGHDITDVR
                     RFVSPALRQGSPIISPTSIDGDVYNVYPAATAVGDTKLITMLPGEGIGPECMEALVAV
                     FEAAHVPVEFETYHIPEPEKGLPASVIDAVNRNRLVMKGPFHTPYGFKGTSINILLRR
                     GFDLFANVVHVFPMPGVKAKYDDIDIVLVRENTEGEYSGLEHSAVDGVVESLKIVTEE
                     HSLRIAEYAFRYAMRNNRKKVTCVHKANILKSADGLFLECARHVASKYPFIEFESMIV
                     DATCMRMVSNPEQFDVVLLPNLYGNIVGSVATSLGGGTGLFPGANIGPSGAMFEQGVR
                     HAGKGISGRGIANPTATILAGVMMLRYLKMFDFADFIQDAVMSVYQETDIRTPDMGGK
                     ATTKQFTAAVIEKMDAIMEELS"
     gene            1021897..1023256
                     /locus_tag="CYME_CMT413T"
                     /db_xref="GeneID:16998168"
     misc_RNA        1021897..1023256
                     /locus_tag="CYME_CMT413T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461712.1"
                     /db_xref="GeneID:16998168"
     gene            complement(<1023923..>1025401)
                     /locus_tag="CYME_CMT414C"
                     /db_xref="GeneID:16998169"
     mRNA            complement(<1023923..>1025401)
                     /locus_tag="CYME_CMT414C"
                     /product="monodehydroascorbate reductase"
                     /transcript_id="XM_005539336.1"
                     /db_xref="GeneID:16998169"
     CDS             complement(1023923..1025401)
                     /locus_tag="CYME_CMT414C"
                     /codon_start=1
                     /product="monodehydroascorbate reductase"
                     /protein_id="XP_005539393.1"
                     /db_xref="GeneID:16998169"
                     /translation="MLEVHRLVTRSHLSSFVCFLEKLGNHQRLFGKGVSAPKVKGSTR
                     LSSVCKRCLVMSATSVKSYEYVILGGGNAAGYAARQFVEKHGLSGHKLAVISRESVAP
                     YERPALSKAYLTANPPTRLPAFHTCVAGGGAPQTPDWYAKNGIDLLLSTEIVDCDLNS
                     KCLTAKDGSKYGYGKLLIATGSDALHLDELGMQGAHLGGIHYLREIAEADKLYEAMKA
                     CAGKHAVVVGGGYIGLECTAALVINGVRVTMVFPEPHVMARLFTPEIAAHYERIYAQK
                     GVNFIKGTVVDSFADENGSGQVKYVRLKNGPVLEADLVVVGVGAKPRTTLLEGALAME
                     ARGIKVDGHLRTSHADVFGAGDVITFPLKMYGNRMARVEHVGHARQSAMHAVDVMMGA
                     TTEPYDYLPFFYSRVFHLSWKFWGDTPAQAKTIVVGEMNPKLVAVWIDQDGHVVGTFI
                     ESGTEHDENKLKELARTRPKANVARLEEAAAANDVDGFLNAL"
     gene            <1026292..>1028595
                     /locus_tag="CYME_CMT415C"
                     /db_xref="GeneID:16998170"
     mRNA            <1026292..>1028595
                     /locus_tag="CYME_CMT415C"
                     /product="similar to psbB mRNA maturation factor Mbb1"
                     /transcript_id="XM_005539337.1"
                     /db_xref="GeneID:16998170"
     CDS             1026292..1028595
                     /locus_tag="CYME_CMT415C"
                     /codon_start=1
                     /product="similar to psbB mRNA maturation factor Mbb1"
                     /protein_id="XP_005539394.1"
                     /db_xref="GeneID:16998170"
                     /translation="MVVRCQRYCGRGHAQASCFVSVLARLEQTQLRHFCRAGTFSTRR
                     VCPAVHQKPLIVCSGDERRDPPHSLPKTDGERNKRTSRFTEEELRRLSQLVQAELFRD
                     EQKPLDVLADADLAGNASSGAHATPVRVNVDLGLYRARRAAQRGRFDLARALYLRCLE
                     WDVSEGRAWLGLARLAERANNFALARRLFQYGVRFAATTVTATTPGTGTSQDATVSER
                     ATSSTEEESRPASRETANARRPRRARVAPTLNGSPSVNIHLLQAWAVMEESAGNVDRA
                     RKLLRSALRAAPHHVASLVAFAMLEHRQGNDEAALLYVSEANKVDPENYYALHVRGLI
                     EWRAFRRYEVARRAFEKSLALNPSNSVTYHAYACMEAWALGNVQRARELFDTALKKGN
                     PRNRFILQSWALLEAEKADDLQAARALFAKGTQAHPRDAAIWQSWALVEARRAKDVEK
                     ARKLFAAALHADPQHLAAWQAWAMLEADASRGGSGIEEARKLFQRAVWAAPDSPDIGR
                     VWHAWATAEFTYARDLERARRCCQLGLEAEERIRDPANTSDVDGRAVWSPFGVSPGQS
                     GSGTSVQNFMVETEGIQDLPLIAAGSSYLRRQRLRGRGGSLRKRSQTRCRHGALPMLY
                     TLLGQIEALCENIAAARRCFEKAVEMDPGNSDIWEAYENMERDHGGGAVAAQAVSQRA
                     LIATSALERSRARIAAARATDLSQDDNTNRMNERSTDPALSVNELPIQLTEPQPGDFA
                     STGTWIEYRELLRLSHSEVTRRLRQGP"
     gene            complement(<1032001..>1033659)
                     /locus_tag="CYME_CMT416C"
                     /db_xref="GeneID:16998179"
     mRNA            complement(<1032001..>1033659)
                     /locus_tag="CYME_CMT416C"
                     /product="similar to carbonic anhydrase precursor"
                     /transcript_id="XM_005539338.1"
                     /db_xref="GeneID:16998179"
     CDS             complement(1032001..1033659)
                     /locus_tag="CYME_CMT416C"
                     /codon_start=1
                     /product="similar to carbonic anhydrase precursor"
                     /protein_id="XP_005539395.1"
                     /db_xref="GeneID:16998179"
                     /translation="MGFLLCRACFRRNSKRFLSTKLQRCALTRDLHLRRHSKLCSFSA
                     LKMANFGNGSKRLLRIALSWDRGAVMALLSAALLLGQPVLVHAQGGPAPAAGALNVTS
                     NLAGSGQRQTSTQAQAPDTQSPKVASGNQNLCWDYGSERGPSQWGSLADAYRLCSCGR
                     FQSPIALSEREALRFEYSAAAAPFEIRSNVAQWKRLEPSPPGVQPPLAMFEQYIPPPP
                     PIVGDVPPVTGFEAPLPAATLILREIPPELPKVTDGDGTSVVATEAPTPVKLSDAQVQ
                     QYRLVNIHFHAPQSEHVIERFRGDLEMHAVFRNVADENDVAVIGRIWRAVPEANPASS
                     GSGAGAAAVGAPDTAVPRWLDELLSLLDEAPAGQPPAQKDAGATNGETSLTYTSAAAG
                     ATRASVHAESLVADASNSSLPPSSTATSQTAPSRPGRLRTTRFVEFNFADTLLRENTA
                     ASLASRSPAGEIESGMALAAEELDPEARPCFFYYRGSLTMPPCSENIKWIVLTHRDSL
                     PQRIVDRILAAQQGQPNVRPLQPRNERAVLYYTPQPASTQPLGS"
     misc_feature    1033861..1035577
                     /note="possible transcribed region"
     gene            complement(<1035138..>1037378)
                     /locus_tag="CYME_CMT418C"
                     /db_xref="GeneID:16998181"
     mRNA            complement(<1035138..>1037378)
                     /locus_tag="CYME_CMT418C"
                     /product="similar to bifunctional aspartokinase/homoserine
                     dehydrogenase"
                     /transcript_id="XM_005539339.1"
                     /db_xref="GeneID:16998181"
     CDS             complement(1035138..1037378)
                     /locus_tag="CYME_CMT418C"
                     /codon_start=1
                     /product="similar to bifunctional aspartokinase/homoserine
                     dehydrogenase"
                     /protein_id="XP_005539396.1"
                     /db_xref="GeneID:16998181"
                     /translation="MDAHASSVSGSAPDLESWLAEVRQGIEKLLQQLEGGPDLLSHTL
                     RGLLTSVQTGPNLQEPRFRSRGERFETLPDSSGLETQRISQEQRTQTPSALAEDCVQP
                     TPCDLEQPPKERTFKVGQGLRSSSIASSAKQLFERGALLQSLAERLAHLTLSICAAPK
                     DCDLSRVVEADQWLEPARAKKKVGVVLLAGGTVGPAFVGLMLKTLAAQAAWDTQSGRS
                     VAAVDVCETAAVPAVFYEDERIVLELVGISFGPTHWQPIATVHDINKLWHEGAEFTYT
                     SARDTGDEHTTSLWAALRSMLASTAATGRLSSSGPAYVRPAVGAAQVPCLDGVVVVDT
                     SQAAHAGALLALVRQFYPKVRIVSANAVCFAAPHEEQTADETGMGLLERINRLYPDQD
                     PQVTNLNRQFAVQASGFLLRHPAVHSNAAIGADIPLLAFLKYLSKMKPNLVCFEAVMS
                     PGIGHVLERMERGLSFSAAVRESRSAGHLETWDCREELSGILCATRAMVCARALGFTD
                     LNLVRDARVCIQPLYDESRQSMTGCDLDCVEHRLRDSPFVGCRSLFEQEPATFLPPPG
                     HAETYPTDATNVSSFHRFMTSRNFMDSPDGISSLDSLYESLFEQARTNETVLQFLVRF
                     TGTHDPKETNAHGLECPDNHLIRFVNVFQEAPQTSGREAQSSESQSVVIRGPTNASMQ
                     VGLAQVDRKLSWLGEGAVSDFRIVVKWKQSGQWHRTCFRGEAMSSIEIAQLVLADVVQ
                     AAELFQ"
     gene            <1037940..>1038770
                     /locus_tag="CYME_CMT419C"
                     /db_xref="GeneID:16998182"
     mRNA            <1037940..>1038770
                     /locus_tag="CYME_CMT419C"
                     /product="mitochondrial ribosome releasing factor RRF"
                     /transcript_id="XM_005539340.1"
                     /db_xref="GeneID:16998182"
     CDS             1037940..1038770
                     /locus_tag="CYME_CMT419C"
                     /codon_start=1
                     /product="mitochondrial ribosome releasing factor RRF"
                     /protein_id="XP_005539397.1"
                     /db_xref="GeneID:16998182"
                     /translation="MSQLNAVFRARALFRVAAWPGFSQQTRPVSGACLHTCQTFDLLA
                     TEHLWRRSCLDVENAFKAHIIQRRWKRSSSKRAPAVTSAESTGDTTDWARWLHEAEAQ
                     VRSTHTALQRDLDSIRTGRADPGLLDSVIVVLSDGSRVPLRKLAHVSLRDPRTLQVLV
                     HDASWAGNCEKAIRSAGLGLNPVAGTGNASHALFVPVPPPSVDARRQMIRLASQRAEE
                     ARKAIRLVRRDLLEQIKSHVIREDDRFALREKVEVEVQRWVRAVDQVLHAKVRELEHH
                     "
     gene            complement(<1040132..>1041328)
                     /locus_tag="CYME_CMT420C"
                     /db_xref="GeneID:16998235"
     mRNA            complement(<1040132..>1041328)
                     /locus_tag="CYME_CMT420C"
                     /product="malonyl-CoA:Acyl carrier protein transacylase"
                     /transcript_id="XM_005539341.1"
                     /db_xref="GeneID:16998235"
     CDS             complement(1040132..1041328)
                     /locus_tag="CYME_CMT420C"
                     /codon_start=1
                     /product="malonyl-CoA:Acyl carrier protein transacylase"
                     /protein_id="XP_005539398.1"
                     /db_xref="GeneID:16998235"
                     /translation="METPVGFVSVSKGAGVGTGVRPVLQCAQHKRLRTVWRKAAAAAP
                     WFVVAPVRRLSERHGTRWSHASTLHMREGEPVVVLCPGQGAQTVGQGRAWYEASSAAR
                     EIIQRADRYLGRSRLPNGQSLMDIMFNGPKHVLDRTDVAQPAIFVTSLACWYGLQQFE
                     LAPGTRREPSYVAATAGLSLGEYTALTLAGAFEFEAGLELVTIRGDAMQKAAEDSEGT
                     MVAILGISEEQAMDLCEACRKRNEVLVPANFNAPGQIVLSGSKDACRRAMEYATATLH
                     LKATELSVAGAFHSQLMQPAADRLADALQTIDVNLPLQYPVMCNVTGRPHENQKDAIK
                     QRLVEQLTAPVRWQACIQTAIMDHGDRTNFLELAPGRTLAGLLKRIDRKRAISNYDAP
                     VTQAMS"
     gene            complement(<1043382..>1044113)
                     /locus_tag="CYME_CMT421C"
                     /db_xref="GeneID:16998236"
     mRNA            complement(<1043382..>1044113)
                     /locus_tag="CYME_CMT421C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539342.1"
                     /db_xref="GeneID:16998236"
     CDS             complement(1043382..1044113)
                     /locus_tag="CYME_CMT421C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539399.1"
                     /db_xref="GeneID:16998236"
                     /translation="MGTVLRQSALRASTLWTLSRPCSRLWRRTFSAAASEGASHHREA
                     TFEELVRYARQIRAESNIQTADEPPTSPLPEGHEVGPGESDFCNYLDDHSDTSNRQVI
                     QGLGLAGGVLACLAAFSVYRYRNSKPQFVPRTVPFWEKEVPGFERVQPAGNRAKLASA
                     PLPSSDSAGAVNGTEPESATLPSTQTGHLSSVLQANETLSNEGMENGVQAAPAAETSN
                     TGDDDGTVDAAHDAHAASVAEASGV"
     misc_feature    1044297..1045906
                     /note="possible transcribed region"
     gene            complement(<1045226..>1046305)
                     /locus_tag="CYME_CMT423C"
                     /db_xref="GeneID:16998238"
     mRNA            complement(<1045226..>1046305)
                     /locus_tag="CYME_CMT423C"
                     /product="chloroplast molecular chaperone GrpE"
                     /transcript_id="XM_005539343.1"
                     /db_xref="GeneID:16998238"
     CDS             complement(1045226..1046305)
                     /locus_tag="CYME_CMT423C"
                     /codon_start=1
                     /product="chloroplast molecular chaperone GrpE"
                     /protein_id="XP_005539400.1"
                     /db_xref="GeneID:16998238"
                     /translation="MDTSGFRLVAFVPITVRGAGTLTRRCFRVQGQSPVSFDRSRTYG
                     KCTRLAFARARSNNGYVMALGGDAGPKKREQQPASEAQPSEPPSNHDGAKGADAAASS
                     QAENETHLTHEETTGEQEGEEEAMEGEDLLNSPPFLKRKIEILEKELQSLREELEAAR
                     KAADSERDSVLRLSADFDNFRRRVAREKQQEELRGRMRAVQQLLPAIDNFDRAAQTLK
                     PQSEEAQKVHQNYQVLCKQVLDAFAKIGVETLDPVGMQFDPKIHEAIQRVESTEHPEG
                     YITHVFQKGYIMRDVHAGQATQEGAVESTLIRAAVCAVSMGPGPGPAAPASSEGASAA
                     ETDLNATETPDDDTPTGQNGDEASK"
     gene            complement(1046546..1049369)
                     /locus_tag="CYME_CMT425T"
                     /db_xref="GeneID:16998239"
     misc_RNA        complement(1046546..1049369)
                     /locus_tag="CYME_CMT425T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461713.1"
                     /db_xref="GeneID:16998239"
     gene            <1046646..>1049186
                     /locus_tag="CYME_CMT424C"
                     /db_xref="GeneID:16998232"
     mRNA            <1046646..>1049186
                     /locus_tag="CYME_CMT424C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539344.1"
                     /db_xref="GeneID:16998232"
     CDS             1046646..1049186
                     /locus_tag="CYME_CMT424C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539401.1"
                     /db_xref="GeneID:16998232"
                     /translation="MAKRPASHRRNPASVALQPYLELLTKQLLELRDRRPHCVTDNEA
                     LEIDAEIDTLCANLFQELSGKQLLVLRDVVNARLMEQLLGLLLAPQSGTMEALTSRAA
                     EAVSALMAGPCRAALMRASSETTWMKLLLCDPIGSHVLQKLLWRLTEPDLHQAITGAL
                     VHPKEHTSDDGQLQRLVHAARAVADALESLSNWWFAPVVDDEPEHTPLDRAGCWFTTM
                     VHPSGTHVLRAFLLVISALPARRFGPAQNWQTHALEQFLSGDQPVPTAPVCPALLVNK
                     IIPSLTGLSVQALRRLMRYAPASATLQTLLLATVQVHRHHCDASDDGDETNGTETSGS
                     RVRRHYGYQLIALFLGAAREDLLTGPAASRLLELTLRCACAWSNSTERGSSPDIRNLL
                     EAFYAKHMSGAERLRRLYLHPRANYCVQGLLYSANLGLVQRMLVDDALLEHLEASKRA
                     THPEPRHDRSGVLCAVLRAVLRASVASDAALTHLVQCTIAAAEQWVGVGAVDTQKATQ
                     HNVRCIMQTLFPNDDEYEPTGTQKRTRAVATSPAAVEASERAAARGSVNGSLLLQLLV
                     HHSSAVLHAFTQLDLPELLTIAKDMVACHALLAYLDAVDARQAERIQTRAQLYRCIPR
                     VLELANSASGSRFLEKAARFMQQDLVWQRKVTEQLAPALTMLAGTHHGARCIRLFQVR
                     LWLDYPQLWLSTRRKQASVKRVLSEILESDTNDGSLSRPSRDHRASTRASAKGHPLNA
                     ASAFLHSGSSDGCSLDQNAELERPQKKPSLLASDSSGDPSCDAEFYASLARLDPLHFT
                     RKDSSCTTEKRSVPAVQPLPSTSVRSTDLAPVLEAIHRASTAKMGRTP"
     gene            <1051629..>1052366
                     /locus_tag="CYME_CMT426C"
                     /db_xref="GeneID:16998231"
     mRNA            <1051629..>1052366
                     /locus_tag="CYME_CMT426C"
                     /product="similar to Bax inhibitor-1"
                     /transcript_id="XM_005539345.1"
                     /db_xref="GeneID:16998231"
     CDS             1051629..1052366
                     /locus_tag="CYME_CMT426C"
                     /codon_start=1
                     /product="similar to Bax inhibitor-1"
                     /protein_id="XP_005539402.1"
                     /db_xref="GeneID:16998231"
                     /translation="MDPFGSDRFFRPETFKNFRELTPAVRQHLALVYRTLFYAVVWAA
                     LGCFVQLNYGASLPLPTGLLTTLATFGTLFLCNSGGLSLETRQRLLMLFAALQGYGAA
                     PVVQVALDVDEWLLLQALLATAAVFGAFSLAALHAKRRSYLYLASWLGSALSVLTFLG
                     LWGLITGGLGDWSLAVLIYGGLMVFAGYVILDTQVIVERASNGDRDHVRHSLELWMDL
                     FAIFVRVVIAMLRSQETRERRRREQHK"
     gene            complement(<1053245..>1054681)
                     /locus_tag="CYME_CMT427C"
                     /db_xref="GeneID:16998233"
     mRNA            complement(<1053245..>1054681)
                     /locus_tag="CYME_CMT427C"
                     /product="RuvB-like DNA/RNA helicase reptin"
                     /transcript_id="XM_005539346.1"
                     /db_xref="GeneID:16998233"
     CDS             complement(1053245..1054681)
                     /locus_tag="CYME_CMT427C"
                     /codon_start=1
                     /product="RuvB-like DNA/RNA helicase reptin"
                     /protein_id="XP_005539403.1"
                     /db_xref="GeneID:16998233"
                     /translation="MITESVQELVKIERIGAHSHIRGLGVDPETLEPLETRQTAPDNE
                     KYERYGLVGQYRARRAAAVVCRMVQEGKLAGRGVLLAGQPGTGKTALATAMAQQLGPE
                     TPFTKLTGSEVYSLEISKTECLIQACRRSIGVRIREETDVIEGEVVELEVDRDAQQNQ
                     VGRIVLKTTDMETVYELGRRMTEELLRRRVRPGDVISIDKGSGRVTKLGRSFARSREF
                     DTAGEDTRFVACPEGEVQKRRQVEHIVSLHDIDVINSRQQGFLALFTGDTGEIKPEVR
                     EQIDARVAQWCEEGKAEIVPGVLFIDEVHMLDIECFAFLSGVLESQFAPLLVCASNRG
                     VTRIRGTEFCAPHGVPVDLLDRMLIIPMYPYDEPECHEILRIRSEEEDIVLSRPALAL
                     LAKIAVETSLRYAMYLMTTTAVLCGQRRGSQVEIDDVKRAYLLFMDTRRSTQYLLAHA
                     DDYMMSEVDGQAEEPAPSTAETPKAASP"
     gene            1054865..1056472
                     /locus_tag="CYME_CMT428T"
                     /db_xref="GeneID:16998234"
     misc_RNA        1054865..1056472
                     /locus_tag="CYME_CMT428T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461714.1"
                     /db_xref="GeneID:16998234"
     misc_feature    complement(1057154..1058861)
                     /note="possible transcribed region"
     gene            <1058391..>1058960
                     /locus_tag="CYME_CMT430C"
                     /db_xref="GeneID:16998227"
     mRNA            <1058391..>1058960
                     /locus_tag="CYME_CMT430C"
                     /product="zinc finger protein"
                     /transcript_id="XM_005539347.1"
                     /db_xref="GeneID:16998227"
     CDS             1058391..1058960
                     /locus_tag="CYME_CMT430C"
                     /codon_start=1
                     /product="zinc finger protein"
                     /protein_id="XP_005539404.1"
                     /db_xref="GeneID:16998227"
                     /translation="MSEQQQQQQPQQPPLPCATGCGFYGRPETQNMCSKCYRDHSQSS
                     ELSSNRASGTSSGSAVPTPATREAPDSPRDVQDNMSVSGVAALTSTLESQPKLETETG
                     PAAVSAEGCKAEVQVESPKREQKDHGNCFKCNRRVGLLGFKCRCGFTFCSLHRYAEQH
                     DCDYDYRARAREQLASANPVVAASKLEKI"
     gene            complement(<1061948..>1062919)
                     /locus_tag="CYME_CMT431C"
                     /db_xref="GeneID:16998228"
     mRNA            complement(<1061948..>1062919)
                     /locus_tag="CYME_CMT431C"
                     /product="26S proteasome regulatory subunit RPN8"
                     /transcript_id="XM_005539348.1"
                     /db_xref="GeneID:16998228"
     CDS             complement(1061948..1062919)
                     /locus_tag="CYME_CMT431C"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit RPN8"
                     /protein_id="XP_005539405.1"
                     /db_xref="GeneID:16998228"
                     /translation="MQSRKQLPITNAVIHPVVLLGIVDHYNRACKNTRKRAVGILLGT
                     IDRRGHAEVLNSFAVPFEEDERNPTVFFFDHDYVENMAAMFRKVTARERIIGWYSTGP
                     QIRPADMGVHEIVQGFCSSGHALYVICQVDPKETGLPTEAYVSLEEDSVALEGSAPGQ
                     PRRIFEHVPNSIGALEAEEVGTEHLLRDVRNWSVSTLTGEVRAKLDALQSLRARLENI
                     RRYLEEVASGNLPLHQEILHALQLVLKGLPRNAASSELTQAFAVCSNEQTLLIYVATL
                     LRSVLVLHDLVNNKTELLETERKMEVAFSNATTAMDAPGSPTVADSL"
     gene            <1064120..>1066510
                     /locus_tag="CYME_CMT432C"
                     /db_xref="GeneID:16998229"
     mRNA            <1064120..>1066510
                     /locus_tag="CYME_CMT432C"
                     /product="similar to charged amino acid rich leucine
                     zipper factor-1"
                     /transcript_id="XM_005539349.1"
                     /db_xref="GeneID:16998229"
     CDS             1064120..1066510
                     /locus_tag="CYME_CMT432C"
                     /codon_start=1
                     /product="similar to charged amino acid rich leucine
                     zipper factor-1"
                     /protein_id="XP_005539406.1"
                     /db_xref="GeneID:16998229"
                     /translation="MGRQVVDSRSFASHGRQRAMRAFASPKRDRKNGRSSKRVRVEAG
                     SLSEQPGASFDETDWMNTRSAAIERDTPRFQSGNDSDSELDGLGNRSAGHNSRRILSG
                     SVSPYDVSASPDASSASELEASHGRAARERRTAANDRVDSSYGADLMADFSASSQSSD
                     SENTELLEMEETRDSDASSALDNDVEADYESASDPGPEDDTDEDEDVHDALWDERPDG
                     RRRSLYYDADTAVREDQLDIDELDEEEAEAMRLQRQQLSRLQAQDFTGGIAVSELARA
                     VDDTAPGGTPRPYAADAASLEATASDHDQVAVREVLRSLSTALQEIIEDLEQLLETAK
                     REQLTTHMERDPLLGLLELKRQLLLNYGTNLAFYLALKAECSSIRDHPVMDRLMEIGV
                     TLDKIRPLEEHVRVRLEALKRAGQQQSTSALRPEFAQGSESDDSLPASNGTSTTDQTD
                     EGATGRYRPLLTTAETYEDERTRRRREQAVARADADQRPYRFEVRQLARELSDKPEQV
                     SLNADPEAMTRDDMRLVRQAEARQAYEEEHLVRLPESKKDRRARRLAEATRGLTAIDS
                     KTRTSGMTDLLSVANRIVEVSQRDQSQVHAMPPKALHAERTSRAVDRHRSDVSSRPST
                     DSQAAAAAAAASNQVSEAFLQRAQHSTFDQSATDKRAALSAFEGSSAPSDWSSLLYKA
                     AADTMQRKRQKRTQGSAEALVASPDDDLLAENRPRRITDEIRRNRGLTARRPRNAAHR
                     NPRVKRRVRYAEALVRRKGQVRVYDDRTRSVAAAGAYKGETSGINKRTRQSVVLRT"
     gene            complement(<1066610..>1068772)
                     /locus_tag="CYME_CMT433C"
                     /db_xref="GeneID:16998230"
     mRNA            complement(<1066610..>1068772)
                     /locus_tag="CYME_CMT433C"
                     /product="transcription factor E2F"
                     /transcript_id="XM_005539350.1"
                     /db_xref="GeneID:16998230"
     CDS             complement(1066610..1068772)
                     /locus_tag="CYME_CMT433C"
                     /codon_start=1
                     /product="transcription factor E2F"
                     /protein_id="XP_005539407.1"
                     /db_xref="GeneID:16998230"
                     /translation="MFPYRASPMRGYGEPGTSRSSSQPLVSGDAYSRKDKSLGLLCEN
                     FLSLYGVLEQARGNSSCEICLDEAATRLGVERRRIYDIVNVLESVGMVTRKAKNKYIW
                     LGQSRLKESIQRLRQEAESAGGVAGLGDSSQLNGDDDELANDPVSGPLSTTAKASEVE
                     RYATCPESLLASNALSKPSVASTKNHRMSRKEKSLGALSQRFVQLFLLAGGDTISLEY
                     AASILLSGSVGNREAEENPLNGGMKTKVRRLYDIANILSSLGLIRKTHTEYRKPAFVW
                     CGEDNVRLEELRTPRELLPNPYSNQVVRPASADKLQAAGLTDAAIARSTQRLPSLHST
                     NEALRYASCALPGTDSVADGAWLAVANAEDPAAYVNTVMPSFQEMRVPDGHELREISS
                     PKRPRTANAALTENKEDRAAWPGLAAAPGAPRGMTSTASRSVLNPRPLFPRPSSVPPS
                     PVRGLGNRSVPPSPGALPAVQGMPRTDAAVPAACGYPSNMPSRGPTSPEHVALWGWSP
                     LPGPFSAKLYAAHGMSPHALGSSYTLTSNTPANYIHSSGQAASQWLEWLDHVQQQQQQ
                     QQLQQQQPQQQVTGWKGFGSRPNTPPSYSFHFDIDAYMRRAQAAGPEYYARAQEWYRE
                     MLEWKQRWLRPAGAAPVAATAASPIPSSLETAGMQNGQHAAAGSDQQRHPRLNGSATR
                     AMDASRSTHDVQDASPVESPATASTMAAMEATLAPPTN"
     gene            complement(<1072287..>1073981)
                     /locus_tag="CYME_CMT434C"
                     /db_xref="GeneID:16998218"
     mRNA            complement(<1072287..>1073981)
                     /locus_tag="CYME_CMT434C"
                     /product="mitochondrial F-type ATPase F1 subunit alpha,
                     precursor"
                     /transcript_id="XM_005539351.1"
                     /db_xref="GeneID:16998218"
     CDS             complement(1072287..1073981)
                     /locus_tag="CYME_CMT434C"
                     /codon_start=1
                     /product="mitochondrial F-type ATPase F1 subunit alpha,
                     precursor"
                     /protein_id="XP_005539408.1"
                     /db_xref="GeneID:16998218"
                     /translation="MNRALRPFARALVRSSDLLVRGRAAVHGALWVTANRDQRQRSLS
                     SWRATGAVRRSALSAAELSAILEEKISGVEEPFDVNEVGRVLTIGDGIARVYGLNNVK
                     AGEMVEFADGTKGMALNLEQDNVGVVVFGSDRDITEGSLVKRTEAIVDVPVGEGVIGR
                     VVDALGQPIDGKGPIRAVQRRRVDVKAPGIIPRRSVHEPMLTGLKAVDSLVPIGRGQR
                     ELIIGDRQTGKTAVAIDAILNQKKAHDENRPEKIYCIYVGVGQKRSTIAQLVNRLEQA
                     DALKYTCIVAATASDAAPLQFLAPFSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQM
                     SLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDTAGAGSLTALPIIETQAGDVSAYIP
                     TNVISITDGQIFLESELFYKGQRPAINVGISVSRVGSAAQPKAMKQVAGSMKLELAQH
                     REVAAFAQFGSDLDAATQQLLNRGDRLNELLKQGQYKPMPFEEQVCVIYGGVRGLLDK
                     VPVSRIREYEAAMLQNMRSNHGDLLAKIRQEGQLSKESDEALRKILTEFIATFHKA"
     gene            <1075340..>1076446
                     /locus_tag="CYME_CMT435C"
                     /db_xref="GeneID:16998219"
     mRNA            <1075340..>1076446
                     /locus_tag="CYME_CMT435C"
                     /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /transcript_id="XM_005539352.1"
                     /db_xref="GeneID:16998219"
     CDS             1075340..1076446
                     /locus_tag="CYME_CMT435C"
                     /codon_start=1
                     /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="XP_005539409.1"
                     /db_xref="GeneID:16998219"
                     /translation="MFLAPTIHFTHRKHRIGTLGNRVVARYHRPCTNVPKPRARVPSL
                     QRRLSVQASALRVGHGFDLHRLEPGLPLILGGVRLEHDRGCAAHSDGDAVYHAVTDAI
                     LGALALPDIGQLFPDTDPQWKGATSDVFLRAAGAMMLQQGYRIANLDVTVILERPKLA
                     PHKEQIRQNIAGLLGLSLEQVNLKAKTHEKVDSIGENRSVGCHAMILLERQPLGNSDE
                     PSTSASESFASSASGAPNAASPNSLESGVFAALAATLSRVHEVIESRRSADPEKSWTA
                     KLFAKGRHKIAQKVGEEALEVALDAVQNRPDRVVEESADLLYHLLVLWADLGVHPNQI
                     AAELEKRQGKSGLREKQHRNEYKDTKEQHDLVQH"
     gene            complement(<1076710..>1090824)
                     /locus_tag="CYME_CMT436C"
                     /db_xref="GeneID:16998220"
     mRNA            complement(<1076710..>1090824)
                     /locus_tag="CYME_CMT436C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539353.1"
                     /db_xref="GeneID:16998220"
     CDS             complement(1076710..1090824)
                     /locus_tag="CYME_CMT436C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539410.1"
                     /db_xref="GeneID:16998220"
                     /translation="MREGFIVRTLQKWLNQYLEQLAPEQVAWSLRRGFLNLHRATLLP
                     QTLYPANTGVTTGRLELSGGQIGQITLSLPWLHSWRKSFALVLDEVFLELRYERTSVE
                     TASSSETGTTHCTASNAGYAPNSEQTGESTPRHPDAETASSALRAAQQRATGRSSQRA
                     AASIAWYLLERLGVYACSFRIDVTHCTVSIHLPGLLDTSGEQRAKTDPTLDAGAFWIT
                     WERLMLFSPANESEAIRFLDAMKLEDKAPSPEQFLHWLRLDGTICKCLHLDALALRWK
                     DQIVVKPLYLRVMLLMNAYAGNIIRIWFQISPLQIRIPGGLRPLAALLAAQPQRQGTA
                     TPSAEAEAGEAALHGNYCISPETTEAKANLSVPWVPFWRAFEHRALQVACAGQLEALQ
                     IDTKWLTEYVSLLNDWPPLSIGLRTETWNVELQFWRNKLTTACLTLASLTLELHPSTR
                     PAVNDLQVATASSSKTSTPLASLRLTLRPTSTQLVALRLHWLSGMLSGTQEDAPEPST
                     LTTAGSWVLSAPETARTRAILAENTADAFVCQQLSAAIAAIDLQLSDALLLHRHQGNT
                     NDRNVSNSNAGNVVMEPQLSASVQRFSVSDTQPAAAAAATRGEHAAFPKRTRIVAVVE
                     VDRLHVELIHETSGRLSLELHGIRVPWVDPVDALALDSASIANATATGQDAIAVACRV
                     YREQERPQAAAPLKSHHREEQAAPCLAGLQVHTGTGHWSACCTTLPIEQLDASAPTEM
                     TLFASEEPFLLTAWYWAGHSRSQLVAVDGARDPHARIPMVILSQVSVRLVPVAILRYV
                     YQAQESLLRIMRTPWVSAASTEQPPVDTSLDGSSDVQCQRLHLVIDWAGFDGTAAAGA
                     CILKASRMRLQVRKRLALASPGACLVFEAETLALELAQRCLLVQLSDLTAQLPLIRRE
                     ASSVLASGVQTDAVSSMGIVRVGCLALEWHPSGICAQIVQMLQLWITWCAPLCTTIPA
                     SSWLRLQTLVEDHIRRAEAAAQAANAPVITPADEKTWRLSLFAIDLVCDDVDALFLSS
                     SSSSLDREQLQAVRQHLACFVQGGQVTNQTAQPLLRFGDVLLDHRTANASSTEDAGRS
                     YDLRPAALTCHWQQTTHAGAPTASKCALQIVKVRIHADEAKCRQLWSMWLQLEWLLHL
                     DVYDVLMQRSTHDLVDTIGSADGHTAPCSGQTATARQQCPVDQEARTATKQPASTALL
                     EDKLPPHAPAKKDAYVVFVELHIQDVQLHMQAATLPATLVLEVGEIETPNLMDCVCRL
                     RIQESQLWRLTGSNDKEKALTNQVDWVLCWQRDKAATFIRVPTVHALGTVHDLALLND
                     VLDWIRRLEDAVYQYQLEQYETCQVPSSKPPVMTSTSASTNATKYRSTRDTLTQHSAS
                     ASEPAMTMTFTEDGGGASVARNAQAANSTVAGVPQGSTQLHLERFFFTLWPQHHTSKT
                     DASASRTPGEQAPSSSSLRNPGQYLDQQDHPASIDELALADLAASKLTLQYRYCGRSE
                     ALRFQAQAVRLRTERSHYLGAQGELVMLPCLRVRYWNDTSAATEASTQARVQIRLQDA
                     RVFLELALLKRIWQEFRAADGTDDSTASAAEIRAPIPTVQDPNDTSDSKSSIDETNEV
                     HQQQHQQSVSSDAVAAPESSREGDVAITHEAGAISWQLHLEAGAAPSLLLIPLNLDDQ
                     TQDNSSDNSSSTSTSSGSEASIDVERRTADRTLVVGLCFSGKAVFWDRPKWYRVPGYE
                     QAYPRDLVVASLVATASSLASYIDEQGRWRSRPQIPPMNHRHYHCQTRYRDASTGQHD
                     SISALSSQADKNGTDDDDDDDDDDRFSAFDVRAADSRPLSTPAGGLAASALWLRGCAL
                     HLQQCLVRNCAYPHVEKRLSWSTLDIHWNNDWWRRRASSSVGQHRNSFSSGSSSSSLS
                     SLSTSDEAPCALSEPRWYQVDGRLVTLTMHVAGAAVSIPVDAGAGAGASAGAYATSSL
                     QWSLQIDNLSVRVLQHVIPWTALWLQVQGSCRAFLTDELVLEPARLQLQLQQLERQTA
                     AVNNDNDNDNDNSNGIAADACCGSHEASTLPARQTLLRLSSTDALCLNITPRIAAAVE
                     RTLQIQAGRPERAALVVPVRPQCGTLALVNASGLPLHLSAYGTLAVDEMRYVPRASFY
                     QDIAVHALDQNPQVLRLSEWRRFLTSSSSSSSLDAPLDNRSGGVSRSEALSWVAPDAA
                     LELVAIQALQWPCLVLVVVLYRRKSVVSEKVTATGQTAATPDPQWLCRFESPLYWENQ
                     TPLCLSLWTHDTTSNVRNTPCCIARFEATANPTAVQNGASSFASRTNIRAASLFAPTP
                     CVWQLCTELDDDAMVPDVDASSTRLPAPSMLGCEAQQPRQVQCSEHDACPQVTAPNVC
                     RTGEHGVSNASAVASVHPASYLWSWFVDLAQNVRDDESRVLWLGPLAPSPIPSRRPRT
                     RSARHLNPEPDPIWGALLTAQVIRRVPTSNEAVSVPLVLVTLHAPWQIRNASIEPVFV
                     DRATLLWPGQVYRSCRMDALFDLECALSAAKAVASTTGAPSAPTDPSRKRLATRATLG
                     GAPESETNLHDQHQHQHQHQHPARNASDSAEDTSIPTSCCWQPAHWVSLALPEAFEPP
                     PMALLEELQVDSTAAAANANAKDCTRAGVPGARRATVQEVAGWRQQRRPKAATSHQRH
                     LPRYRGHQSKSTSTAASDSSAFLLPGRVWIQLPTTASTDLFPIHPWLDELVTSQTEAV
                     VASDRGALALSSQVCRSLAIRDRSPHRTANEPNAAAAAAEAAEAAAAEAATIHADAIE
                     HECDDYRRRVVYDAPRWLAPWPWKPAETMSPLGTCFAVDFGWEHPRALRQITLCVPEL
                     WCSLWTASPTTLMQAIPAERRSWCSQLRRHLANWIDTGRPGVQSDLETVQAEQATATA
                     APQTPIQSVAYPCSSSSSSSSSSSMPLTCRECAPPRPISAHTTGAFDAFENARYGRLP
                     YQARGGGHNGGPVCGQVLPLTLAPCPWTAWSLPELALSWRTAHTEWSAWCAGTRLAHE
                     ALVISLYAVAGERKPHRWTRAMLASPAAVLQQPSAWQRLASAHGADRAPTQAAVTVAD
                     AVVHVAATGTPEVKTSPLRLVRSRHASVSTPLETDARWPWLVSSSLAAAPAAAAATTP
                     HSRLSQVSRSIAPRFSAWSPAAAVAETWPSSSSSTPTTFDGAYVPRPRQLDAVVCVQP
                     LGYPLERSRLLVVYPRYRLVNLWPAYTLLVWPVDQDTGDECLSFGAANPRAGTHSPGS
                     DLDLVDVRPTAANDIDRLLADGSVFRLEPGAMATLHWPAGTNKPCLRIRIAAPGWYWS
                     GRVPVTAGSDWCLRLRQASTGACQFPRVHTAAGTSPVTPVHLVTILPPHPLLVPYRIR
                     NQTIERIRFAQRLEPAHCRSGCCMKQTQDVIDDDALQALDPLSECAYTWDEPLAEPIL
                     ELWIDGIGYVGAFRLEPELHSHASVAAVHGETQVATDSGVSGDRTNGRSRHRGYHDGK
                     RTGQAVQLRVIPRLQQCRTRLWQLVGLGCRRRRHRRRRVHVASQTAVHLVCNQSVRWC
                     VANSAGAPGAASRSRTFQIRLQRCQATLALIIAENEQQQEQPAVPRRSSQSRGASTSL
                     QRSVDERHDVSTETSPSETPLDALPASTTMHYAGAGIDRHASAFTCELCVPEMGISLL
                     RMTTTTREPPLFEQVVYLGIRGVDARWHHVKRTQDGSDMLRQKASLDESYHGEVAFVC
                     EALQLDHSSALQHPTLPGAWCVPLRLHSVAANDAASRTSRALSLASDHERHSKKKKKK
                     KSSIRPDHNTSRQLDRLAVVSWFSLRRRPVSYACQGSASAPGASSLSASVASRRWTSD
                     DGAWRAPKQAACVLRTRFESSSTGAHTFLRIHSGQVRCGRLDLDIDASLVVQMVDWFV
                     AWRRQVDAMTPVETSADALRMASVGAEQQDQELEIFWTPSMGLVAATSAQRLTQARAR
                     SSSSRRAGAAARILRDGNAPASRYCWTCRSGDTSSSRSSLSSMPLSRSLRESLTQCTA
                     RRESDCSCCQYDAGANEALGSSAAQYRAGADACQLLRRALEQALLRGVPSVSQVQQRS
                     ERSLRLAFHDVVCAPLACTLSVRTDLVSLGTLLQYRGSEWPRLTALMLTPLMNVQDAS
                     LWLRELVLDGTFETSDDLVQHLVRHYQQQLNREVWKVISSAEWLGNPARYARHLSRLV
                     RQIARQLGALLRQRHRHRILGAAAALSLGYGAGLGAASLDAFHRMIALAAGTLRQHIG
                     LATLALDIAARMPGAAHNRSIPDANSGAARFLERRVQVSGTGGASHGHQHQQRYSKTD
                     AVVPGSPAERASSSKVERLRRRWRWRWWWHAAAGQRMGILLATPLLFMMQATATVLAI
                     ARDLLDQAAWHLIESAAGETAWTWSVAEWSAPLRPPRMPSTKLDHSYDIEDAVLGYEL
                     WQMLDQASSSELLSEQYRFCCRPVPNEAVLCTNRRLWHLRLPTNGPFSVNRSSCSWQV
                     LDELQWSDVIMLWLMPPGYDKLHVLALAPEQVMPQIRCPCVLNLKQRQHPVRADTAAQ
                     ATLTKESRCWRCFWRRVYWFIQRWVPASADDLVLRLKMLPRRTSRGWRLLTIPLTSAV
                     VANAVADRLQTVWYVALCRSRSPCSRVVVMERWWLPQLRLDQSGPREQAECPEAPWRV
                     QKRSKASPDSRCNTTASIIGRTDAKQAGYGESATPNAWQRCRQPHLFQGFVPVPRGWA
                     DALYAYDASVSFPLGVYFRS"
     gene            complement(1093102..1094894)
                     /locus_tag="CYME_CMT438T"
                     /db_xref="GeneID:16998221"
     misc_RNA        complement(1093102..1094894)
                     /locus_tag="CYME_CMT438T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461715.1"
                     /db_xref="GeneID:16998221"
     gene            <1093126..>1093764
                     /locus_tag="CYME_CMT437C"
                     /db_xref="GeneID:16998202"
     mRNA            <1093126..>1093764
                     /locus_tag="CYME_CMT437C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539354.1"
                     /db_xref="GeneID:16998202"
     CDS             1093126..1093764
                     /locus_tag="CYME_CMT437C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539411.1"
                     /db_xref="GeneID:16998202"
                     /translation="MTLQWALAHAVCDRMGRGLVTVPRLWRAARLASQNGRPRGRGGS
                     QPARPYTALGYHEAVLSAERFYTRCAALRRTAPPKTSSSDSKSTRPQRSRLALSLARR
                     KPDPFRTILKSLAHAHSGERKASLDAPPRAAISAHSGPCGRLAKTARGISGRIAQTCC
                     CLECSGCAQLHFGSPLLSGNGTCVFEHVEGDLLASQRKSVESGVPPMYAGTN"
     gene            <1095008..>1096471
                     /locus_tag="CYME_CMT439C"
                     /db_xref="GeneID:16998201"
     mRNA            <1095008..>1096471
                     /locus_tag="CYME_CMT439C"
                     /product="probable histidinol-phosphate aminotransferase"
                     /transcript_id="XM_005539355.1"
                     /db_xref="GeneID:16998201"
     CDS             1095008..1096471
                     /locus_tag="CYME_CMT439C"
                     /codon_start=1
                     /product="probable histidinol-phosphate aminotransferase"
                     /protein_id="XP_005539412.1"
                     /db_xref="GeneID:16998201"
                     /translation="MFLWFSAPLFTRSNTGTRWIPVGKHPLAWEQARVWRCLHEPAVL
                     ALRGQDAAAMSKKRVSSASMEPFNVESLVRDELQRMEPYAPILPYEVLARQLGRDPSE
                     IIKLDANENPYGVCPAVRNAVAAAPFPHIYPDPESRELREALAAFTGVPASRLLVGHG
                     ADELIDLIFRLVIRANHQDTVVNAPPTFGMYQFDADLNAAKVVSVWRKADDGFRFPTE
                     QVEAYFAEIAAARERGVDQSYPRIVFVTCPNNPDGSRISDSDLRRLLRLPTLVVLDEA
                     YIEFADSEEERYPDASGGSETRATVTEPPTRIRWVLEYQNLIVLRTFSKWAALAGLRV
                     GYGAFPEALLPHLWKIKQPYNVNVAGQVAALEALCQRDLLFQQVSWMKAERQRLYQIL
                     QAPQFAWLHPYPSQSNFVLCRVRSDDALCNGSRRKVASARALRDFLRDRGILIRYYDS
                     KGLTDCIRISMGTPAQMDRLYEVLEAYARVLGYGNER"
     gene            <1098266..>1098736
                     /locus_tag="CYME_CMT440C"
                     /db_xref="GeneID:16998203"
     mRNA            <1098266..>1098736
                     /locus_tag="CYME_CMT440C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539356.1"
                     /db_xref="GeneID:16998203"
     CDS             1098266..1098736
                     /locus_tag="CYME_CMT440C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539413.1"
                     /db_xref="GeneID:16998203"
                     /translation="MATGTTGARVLSMASILRHRASLPTRAIARVLLEADGGPIEHNA
                     LWKLARRVKRLETKGNPVHATQDSAATVEASPALADNVRTTTPATPVLRSKTHFKKVL
                     YQMKRMQTVEVRAEPLTEARESTTRRQFLVRLTDKGLRKYTQELDTLYKNQILE"
     gene            complement(<1099089..>1101023)
                     /locus_tag="CYME_CMT441C"
                     /db_xref="GeneID:16998204"
     mRNA            complement(<1099089..>1101023)
                     /locus_tag="CYME_CMT441C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539357.1"
                     /db_xref="GeneID:16998204"
     CDS             complement(1099089..1101023)
                     /locus_tag="CYME_CMT441C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539414.1"
                     /db_xref="GeneID:16998204"
                     /translation="MLASVRTGREKGANGVSRARGALAPPGSLQVDAAQPHRYVCFHE
                     FAVHKMNLKPSSEATGRAYVFQTALVSVFGSDASRSPRLESPRVPHRRRHCNPCFVSE
                     WTVWRRNAPAMLMLKHGTISGASVACEPRLGARGRLSTRTHTSLRSPRKARYRRSIGS
                     ALLCQMDHAGATRKPPRLVLLGGGTGMHRLLHGLVYWSQVHMPLDITAVICTSDDGGS
                     TGRIRAELGMPAMGDIRNALEGVCSALALSARCNAEVSGSERYDSAADANASSTAEDI
                     AWWRLLGHRLGTGSIRVETNGEQALTGHALGNLVLAALYESCGRRCSRAVQAFCHLLG
                     IPVERCRIWPASDDLLELVGSKASSPGSNPRHSGSKPVCETIRGESNFARSPGRLFQV
                     HVERTAAANGTTASTNDDTRGEPSACPEALEAIRTADAIILGPGSLFTSIAAVAAITP
                     IRDAIRKWSSVDPRSPKRPIYVCNLWTEPGETDGMDVWAHVDALRAILDAEESEFEQP
                     ASRIPLQVLIDVSQVQSHAVEASLVEPQHREVSVATKSSQTHPVLVSLLPSSSSSSSS
                     SSAAAAAATESLIIEAHSGVSFQVDRLRAPSEESAASGAMLSTSKPPGHDPHLLTRAL
                     LRLLFHQRHTGAASTATVGK"
     gene            <1101652..>1102941
                     /locus_tag="CYME_CMT442C"
                     /db_xref="GeneID:16998205"
     mRNA            <1101652..>1102941
                     /locus_tag="CYME_CMT442C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539358.1"
                     /db_xref="GeneID:16998205"
     CDS             1101652..1102941
                     /locus_tag="CYME_CMT442C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539415.1"
                     /db_xref="GeneID:16998205"
                     /translation="MNILAGVLWVLGSGFKALLLCSVLALSLAFCSAALYVSHRIAFP
                     PWHDPRPGSSSLTQKRMPEAWAGFTLDPYTSLGLQFESVAFRSRSGRWLRGWWVPAPV
                     EPPAPIGVVCVHGGGRDRRAFMRQSVLFHRRGWSVLLFDCTGHGTSDARHRFPLGAWP
                     GAAITYGTLEWSDVIDALRYTYERIREQAQRSAAASSVRIRVALVGTSQGAVSAAYAA
                     AYLTRRFEQGDGAACPPVDVLVLENPFTSPLALFAHLASHVAMPVARYGSRWCFLRHV
                     VRFWVMTCTTLALFRTGNVALTCRMLAKACEREGQPYRCAWWQGIATLGQLLSVSLSL
                     SSSSSSSSRETPPAGGFDSVAEAVQALKCPVFFMHGMKDWIVPYKHSVQLYKAANEPK
                     ELWLSAEAGHTMMYHCEPDTFETRVCGFMERYLRGSM"
     gene            <1104355..>1105542
                     /locus_tag="CYME_CMT443C"
                     /db_xref="GeneID:16998210"
     mRNA            <1104355..>1105542
                     /locus_tag="CYME_CMT443C"
                     /product="RING zinc finger protein"
                     /transcript_id="XM_005539359.1"
                     /db_xref="GeneID:16998210"
     CDS             1104355..1105542
                     /locus_tag="CYME_CMT443C"
                     /codon_start=1
                     /product="RING zinc finger protein"
                     /protein_id="XP_005539416.1"
                     /db_xref="GeneID:16998210"
                     /translation="MTDRQLYWGPGQSPADVSVQVVAVRENGGAISDDSDVEFVGEWQ
                     TEPTTAAACSLIEPDTMVLSERPSTSGPDARLASTQLQPGRRRRRSTAQATAIRTVPP
                     EHGPGMAPGGNRRQRTVYQRIYRRLRELAGNRREVSSSRRNDSVIALPSSATFLESLE
                     PFFSGEGWTLETLTSIPLSTDALDATVEPTWSPASAALDEHNRSSSTNNNNNNNNAIA
                     PWNATSTRRVVRSGRSSRRTSRQQHWAVAMLNSFLQPSFDSLPSPRPNPCPRALVELL
                     PLQTATEREESDACPICLSNYERGERLRRLPCLHLFHRTCIDRWFSKQNSCPVDKMSV
                     ADGFTDECAQSKLQALGVSNDEATACSSGVFHPGVEAPSDTVEALMSPPRRRQRVRQR
                     RLS"
     gene            <1108618..>1111635
                     /locus_tag="CYME_CMT444C"
                     /db_xref="GeneID:16998211"
     mRNA            <1108618..>1111635
                     /locus_tag="CYME_CMT444C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539360.1"
                     /db_xref="GeneID:16998211"
     CDS             1108618..1111635
                     /locus_tag="CYME_CMT444C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539417.1"
                     /db_xref="GeneID:16998211"
                     /translation="MVQEYPAWASFGTGWQGAGALAPTAAAFISQGRLVLVPQGRSLN
                     VYRHGLTSWPGSSPSETTGTALILQRRLQAHEGRVTGVDVLAPVNVFQAVSASLDGTL
                     RVWDLEEGTLLRTIDLGVPLWRCLVDSQQGRTCYVLASASDGTAAALAMNWSERATVS
                     RAPIQTQAIGPEVDRPVHMATAASSDAGPASSAQPSGSNERKHLSRAAARACFVARVD
                     LRTGRWKTLFQLPFGEACMDLSADGQLLVASSGNQLYVWRSGAPGDVRRWEHTGAPVT
                     TLSIDAKRERVAVGDSSGVISVYQLQSLFQSVDSEQKQHSQGAPLRQRWHWHARPVRA
                     LCFGPGSSSTTLFSGGHEGVLVEWHLHQIGNLQPTKRFYPRLGGPIQGIAVEPQTQTA
                     ALTLYPGSLIVVHLPSYSSRTLLRTVIAPFPGSDRQEAVASELRSDAKTRPGSATRQV
                     GASLDPILNVHCRMQTVSLMPAVCLASKPGTVEPMLVYSSPDGALCVYDIIRDSVTDV
                     LRVTTAPPVAIARNPRAYPFAFHLDESGCFLVTSEEKTPLGERWLNMASLEARTSRQV
                     CLRFWCIPPAAAKASVTDTNEAELQLRPCESVTLLHRDPLVLLAVRHSQAFSLDCSGT
                     WAVWQWTLGNVAGTPVQDTSQAIWSVHAFSTTKLRCPVRLVAALLTRDASLLVTLRAD
                     GVLQIFAVQETLQLVHQEAVSELVHHFLSSGDVIGASQAPLMQLDALEVVASGQLLIS
                     VRGERMPPQLVVYDMARAQVRWRLVLAADAVAALTPTAALATLTNEASIPMDVFAVAL
                     ASIPAVLLFRALGEPTPMAIWRLPSGTRPRILLTHPLVPLAVLDDDAHLHLPEGPLDP
                     FAEEDMAVLRMALLTRSQEEAWRESQAPSWFEHLPTEDPLEPPRVQVSPQVPVESLLS
                     DTVPAFMSLETCLDALLGHPGTQMPASQTAATVEEPAQLSVSSSGAQRSLHSPQEPPE
                     STLHIPLGPEAVANILGGHGARFRQLRLQRLSG"
     gene            complement(<1115213..>1117561)
                     /locus_tag="CYME_CMT445C"
                     /db_xref="GeneID:16998212"
     mRNA            complement(<1115213..>1117561)
                     /locus_tag="CYME_CMT445C"
                     /product="acetoacetyl-CoA synthetase"
                     /transcript_id="XM_005539361.1"
                     /db_xref="GeneID:16998212"
     CDS             complement(1115213..1117561)
                     /locus_tag="CYME_CMT445C"
                     /codon_start=1
                     /product="acetoacetyl-CoA synthetase"
                     /protein_id="XP_005539418.1"
                     /db_xref="GeneID:16998212"
                     /translation="MDDDADAVDVWCEGHQVLDSTPWQPDDPVVRFAAAFERRLYGKE
                     AVQHHESFDFERLHRLSVEHDADFYRTFIDFAGIRLYDDTGAPVTDANVPITNREATL
                     QLETACRGTRIGTGANQNDNESSSPVHSHTRTTVGTMPITGLRWLPNIRVNYAENILR
                     NPQASIVFRSEPGSGIPRRELSYRQLYAWVARVAEALEQQLHLSCGEHVVGFLPNIPE
                     TIIAMLAVTSLGGIWASCSPDFGEDAAVDRFGQLQPRLLITADAVVFKGKRHDCLKKA
                     QKIASRLGTEKRNENNEENAVTGIPVWIVPYGCPRDALVEHLDAPNWQCFPSASPEPA
                     VDEALPAIPFRRIRFDRDPVVTMFSSGTTGRPKCMAQGAGILLTQEKEQLLHYAMGPE
                     HTLFFYTTCGWMMWNWSVAALARGCRLILYDGAAVWSSLEHPASVEAGAPENTQSTPR
                     DTDPSLSTGYAPQDALWRIVAEEQVTHFGCGAKFLQIQEQLGVHPARWSLGRLQAVLV
                     TGSPSTVANFRYVWARVGRHVRYWSMSGGTDINGCFALGLQRRAVYAGELQSCALGLG
                     VQVFDAHGHPVENQDGELVCTNACPSMPLFFWNDTTDASMYRSAYFRTFGETVWHHGD
                     YARVVVREPGHERSLIIRGRSDATLKPGGVRLGSADFYTVLERMPEVSDSLVAGQRWH
                     DDVRIILFVKLAHEAPLGPLEDSELRSRIVNRLRQSLSPRHVPHTVIVVPGIPYTRNM
                     KKMEVAVKRILDDEPLDNTHACMDPELLETYRELKRKYLARG"
     misc_feature    1119401..1122649
                     /note="repetitive element"
     gene            <1122763..>1122990
                     /locus_tag="CYME_CMT447C"
                     /db_xref="GeneID:16998213"
     mRNA            <1122763..>1122990
                     /locus_tag="CYME_CMT447C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539362.1"
                     /db_xref="GeneID:16998213"
     CDS             1122763..1122990
                     /locus_tag="CYME_CMT447C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539419.1"
                     /db_xref="GeneID:16998213"
                     /translation="MASPKKTATKAASAPKKAAAKTKGERKPNAYQEFMKAESAKIRE
                     YNKAKGIEMRPPDIFKECAKRWNEKKSKTKA"
     gene            complement(<1124687..>1125544)
                     /locus_tag="CYME_CMT448C"
                     /db_xref="GeneID:16998021"
     mRNA            complement(<1124687..>1125544)
                     /locus_tag="CYME_CMT448C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539363.1"
                     /db_xref="GeneID:16998021"
     CDS             complement(1124687..1125544)
                     /locus_tag="CYME_CMT448C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539420.1"
                     /db_xref="GeneID:16998021"
                     /translation="MVQSAAKTLSERKTNSVAGRPSNALAVSRAKLTELLAGPDGLPA
                     LFHRAARFATTHQLHQDSALNVENDEQVEYFLFELLWLLRDWQRSFAPGLSLAEFIAE
                     IESLPVRTVLQYVEAVDVGTACPDGRFGDPTSVELQHEVPALAEEDALETRSVASCAS
                     TPSTRDEAHMTCPISASSAAGTRQRLRHAREVCSVSTSVSSSSESSRASARDLASAAS
                     SRRRHIMRACDADACSESDQEVDQIDSILERISNGHQRRLRKLESLTPSSLQAVSDAD
                     PELHRRPDG"
     gene            1125817..1127327
                     /locus_tag="CYME_CMT449T"
                     /db_xref="GeneID:16998022"
     misc_RNA        1125817..1127327
                     /locus_tag="CYME_CMT449T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461716.1"
                     /db_xref="GeneID:16998022"
     gene            <1129486..>1129881
                     /locus_tag="CYME_CMT450C"
                     /db_xref="GeneID:16998023"
     mRNA            <1129486..>1129881
                     /locus_tag="CYME_CMT450C"
                     /product="similar to nuclear transport factor 2"
                     /transcript_id="XM_005539364.1"
                     /db_xref="GeneID:16998023"
     CDS             1129486..1129881
                     /locus_tag="CYME_CMT450C"
                     /codon_start=1
                     /product="similar to nuclear transport factor 2"
                     /protein_id="XP_005539421.1"
                     /db_xref="GeneID:16998023"
                     /translation="MANKPQWELLAEAFVNHYYSVFDTDRTQLAALYREVSMLTFEGN
                     ACMGASAITEKLVSLPFQKVRHQVVTCDAQPVLPESLNGVLVFVNGDLTVDDSNQPIK
                     FAQVFHLLPDQGNPGMFWVYNDLFRLNYG"
     gene            complement(<1130929..>1131399)
                     /locus_tag="CYME_CMT451C"
                     /db_xref="GeneID:16998024"
     mRNA            complement(<1130929..>1131399)
                     /locus_tag="CYME_CMT451C"
                     /product="RNA polymerase I, II, III common subunit"
                     /transcript_id="XM_005539365.1"
                     /db_xref="GeneID:16998024"
     CDS             complement(1130929..1131399)
                     /locus_tag="CYME_CMT451C"
                     /codon_start=1
                     /product="RNA polymerase I, II, III common subunit"
                     /protein_id="XP_005539422.1"
                     /db_xref="GeneID:16998024"
                     /translation="MTTILEDTFICQEVDMVYKDPRNPALGKVREKKFDRVSRLVAES
                     LQQRMRLTLDVHSQLFPVRAGDRFLLVLMSSVRLDGAPCDGTYDQSGAPTVINRYDYV
                     MCGKVFHQESEGAHQSAVCISFGGLLMRLQGSRNVIDLADLRLDNRVYLLLRRV"
     gene            complement(<1133358..>1135826)
                     /locus_tag="CYME_CMT452C"
                     /db_xref="GeneID:16998139"
     mRNA            complement(<1133358..>1135826)
                     /locus_tag="CYME_CMT452C"
                     /product="mitochondrial DNA helicase Twinkle"
                     /transcript_id="XM_005539366.1"
                     /db_xref="GeneID:16998139"
     CDS             complement(1133358..1135826)
                     /locus_tag="CYME_CMT452C"
                     /codon_start=1
                     /product="mitochondrial DNA helicase Twinkle"
                     /protein_id="XP_005539423.1"
                     /db_xref="GeneID:16998139"
                     /translation="MTYWKDGARLVQWKWVSLSRQLFPSLGPVRSFLAHSFSLKRAGS
                     TPVRLKRTLRSDKANQGSPGPTTDNAARREASNDPTPADAGAPPADLFPPEIYGEPLN
                     YTNSDHDALRRGVSNAWSLRDLRAAALWPAVARWPQRRTRPPIRETPTGTPFVSQFFE
                     LPPGHMVRYLEDKGLEVRMMDQHAVVRICPFCPPVRGKADNMFKLYVHTSSGVFFCHR
                     CGAKGNHWDLKRSFGDILEPLSWRGQFPENAHLAPGAHPTSARPADSGAASVSANTSQ
                     IDSVATEQLPVVDAALAAQCEARLESSDAVKQFLKSRGLQLATARKFRVGAGRFRFRD
                     SGSTADIWSEHDCITFPWIEPEWLTTRAPSTLVELDHRRDPNPAGSNLGSEESACQDS
                     SVPPPSRVLRLKIRSVLRKSAMRLEPRGGYWGLFGMHLVPADAECLVVTEGEFDAMAV
                     HQSTGLSAVSLPNGARSLPPALLTWLERFKRIYLWLDDDIPGHDGARQFAHKLGLQRC
                     FLVGSGNGSGPKDANEALLQQRDLFAMIERARPVPHERIVTFADLRADVQRELANPVQ
                     VRGLQSQTLPGLNRLLKGHRRGELTIFSGPTGVGKTTVLSQLSLDYCMQGANTLWGSF
                     ELNNVRMAKVMLSQFAGIGLDAMGERFDQVADQFEQLPLYFLRFFGSSDVDQVIHAME
                     YAAYVYDVAHVVLDNLQFMTSGQGRGYERFEIMDRAIEKFRAFATEHNVHVSVVIHPR
                     KEDEDQLLKTASVFGSAKATQEADNVIIIQNGRHYKYLDVRKNRFDGELGNIPYRFDP
                     VTRRIRELLPDEIQQLEDGYRVCS"
     gene            <1136560..>1139712
                     /locus_tag="CYME_CMT453C"
                     /db_xref="GeneID:16998140"
     mRNA            <1136560..>1139712
                     /locus_tag="CYME_CMT453C"
                     /product="similar to nucleolar RNA-associated protein
                     NRAP"
                     /transcript_id="XM_005539367.1"
                     /db_xref="GeneID:16998140"
     CDS             1136560..1139712
                     /locus_tag="CYME_CMT453C"
                     /codon_start=1
                     /product="similar to nucleolar RNA-associated protein
                     NRAP"
                     /protein_id="XP_005539424.1"
                     /db_xref="GeneID:16998140"
                     /translation="MHVALNAFEGLTWESRARVLLAAAQVSLPADTGAFLQQIRAALE
                     ALDPRRLESPDEIAGLLKSQKLFSGDLEPVHLDQMRLHSVAYLAPSRVELVGSYALGT
                     VVALPEPPLVDVAFEVPRKFLLEKDYLDGRYHVRRLVYLAEVVRQLRDRVPDLEATWV
                     PSNSFTRSENPLLHAALQKPVVVLSSPKVSGRIRLLPALTPDKFPKLMQRPELYCFRA
                     FQDLPQENERIALNTHYVNSIRSDWSIWADFDLLVATTKRYAIVSDCVRLLKLWSANR
                     QLTLIEPVEAARRLVSGHELALQTAQLVEQGEFPAHAASLSRLVLAVFRAIRARLPVE
                     PSIVRVEVEAALRSFASRLRELDQVGGIYYTLAGCCMEPLAYFDSILQVTQRRSAKRN
                     PRDATLDTLRGEWLQRVFRTLRRALGDRVAYLGVLPRRQHANTNFVQVGIKWQPQNML
                     RTIDRDPDEQFWGSGRLEWRRFRSGEILHCLVWAESSIERFQIPQRIVDAALKKEPDA
                     QAKGNTLWLLEERHTPGLWTREHLDLRRWRYVKDPRSLALYQARCVLLGKMYQALCQL
                     LMDADGAIGISKVLPLRVQAVHVAVNDGEWLRHTAVEWPELQENLQGRWASRYRLTAH
                     VELESTHLWPDATESADAAQAVRVAFTIALYRALKRGLRKHAERLPVPVRFIQATRHG
                     DLLLLLGCFPIRLRVCSAAEAVSMSAAFRLHAQLSSISSRFPAFGPTARLAKRFLAAH
                     GLVDLAGIDGLSPAAVELLLSRLFTDPLPWGDCPATAWGGLVRFLHLIAKTETALTEP
                     LVIPILNLSEDEPPWYPETGGLESSVASKHCWLRLCTASDPCGTLLTKQVAAEVVRRM
                     RLVCRAALQHLGDALHQDGGLEPDHLGVIFRPPPLASFCDLVLELEHALVPEQVIVDS
                     GLGVADREVHAPDELRQRFGIADATTEQWLVGFDPIGMYLRWLREMFGDLWVFLYDAY
                     GGRWIGGIWRSAASQPALSLDVSRTSYRRVVKSGARIPADSRLEWNLPEILHDMHAVG
                     AGLVREIRLCGQLTGACSGY"
     gene            complement(<1140233..>1141243)
                     /locus_tag="CYME_CMT454C"
                     /db_xref="GeneID:16998141"
     mRNA            complement(<1140233..>1141243)
                     /locus_tag="CYME_CMT454C"
                     /product="similar to chondroitin 4-sulfotransferase"
                     /transcript_id="XM_005539368.1"
                     /db_xref="GeneID:16998141"
     CDS             complement(1140233..1141243)
                     /locus_tag="CYME_CMT454C"
                     /codon_start=1
                     /product="similar to chondroitin 4-sulfotransferase"
                     /protein_id="XP_005539425.1"
                     /db_xref="GeneID:16998141"
                     /translation="MHLWFRWFFWFTVFWVLLLILASHRVLQTLMVPSPGLETSSPSE
                     YRSHTVNFSWQAPVLASLFNEKPLAEYFQNISDLWRREQEQSFVGVIVFAKQQRLLCS
                     IPKAGCTAARAFALRETLGVVLDPLDADEIHLIHPQGRANLTQLLHLQDEELLRVLSD
                     PSWKFGALVRHPLTRLLSAYLDKVKAGRELERYPLKNRYPHSFERFVDYLEEAAKTMT
                     PDLTPFDEHWRPQSGFCLFRMLPRTFFDCIGKVDEPESLRKFYVDMFGQAGLEWHESM
                     RKRAQASGRNTLHSQSAASLLHKHVNERLAQRVRKLYAEDYERFGYDLWPPYYRKASA
                     TL"
     misc_feature    complement(1141371..1144668)
                     /note="repetitive element"
     gene            complement(<1146163..>1147236)
                     /locus_tag="CYME_CMT456C"
                     /db_xref="GeneID:16998142"
     mRNA            complement(<1146163..>1147236)
                     /locus_tag="CYME_CMT456C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539369.1"
                     /db_xref="GeneID:16998142"
     CDS             complement(1146163..1147236)
                     /locus_tag="CYME_CMT456C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539426.1"
                     /db_xref="GeneID:16998142"
                     /translation="MSWVSLVRSRRMGIRLFMSSRLSWRQVLTVLFILWCLAVASTAF
                     NIASRSALWGPLSSEQLPKRTDTTIGQGSIGPATPSAAERLVNGKHNISLKLKPEWRV
                     EQKLSYVGVIVFPKEKRLLCSIPKAACTNLRAFALRKQLNVELNPTDAQNFSYIHPVS
                     KRFLLQLGSLSDDQVHYALTHPDWRYAAVVRHPLSRLLSAYLDKIVGQRELWRRPLQR
                     QPVTSFEHFVSILEDVARRYRKNWDWVDEHWRPQSGFCLFRFIPRQLYDYVVKVENRS
                     ALRQLFIDMFDEDGRRWVQDQDARAAAHRQQAAHARSANAKLRAYVSEDLAKRIQRLY
                     AEDYINFGYDLWPDEVDADGALS"
     misc_feature    1147470..1148277
                     /note="possible transcribed region"
     misc_feature    complement(1148007..1151450)
                     /note="repetitive element"
     gene            <1152727..>1155201
                     /locus_tag="CYME_CMT459C"
                     /db_xref="GeneID:16997663"
     mRNA            <1152727..>1155201
                     /locus_tag="CYME_CMT459C"
                     /product="long-chain-fatty-acid CoA ligase"
                     /transcript_id="XM_005539370.1"
                     /db_xref="GeneID:16997663"
     CDS             1152727..1155201
                     /locus_tag="CYME_CMT459C"
                     /codon_start=1
                     /product="long-chain-fatty-acid CoA ligase"
                     /protein_id="XP_005539427.1"
                     /db_xref="GeneID:16997663"
                     /translation="MGFVSGRAHNGRALSGSTKPNDTTCSCCRVSALWRAGPGHRLAR
                     RSAIERALPRPGVARPRARSKGAALEVQLRTPGRAPSPSETLEPDSSVSERNRDAGAL
                     PALDETQRQAAYRKLRDPWFYPKGTLMRTFGWASVPSIWETLAEAYSEITALIDEHNP
                     YRQKISWTYAEVHEEIRELAAGLRHHGLTNLQPGDIVALFSENSARWLITDQALMWNG
                     AASAVRGTAAPLDELAYILEHSDACGLVVDTPTVLEKLIRNEQATRCLAKQVRFIMVL
                     WNRKGAIAEPIRSAVGSVPIYTYEEVTETGRAKVRDALNRTSRSPADAEMERALWRPI
                     AEREMLATLVYTSGTTGQPKGAMLTHRNLLHQIMANSFSRAWRPLLPSQDASAGDVMV
                     NILPCWHIFERIGELYALSRGVSMVYSKLLHFKEDLARHRPHLLVGVPRLYESIYQGI
                     KSQLMKQGRFRRALIFGLLGISTRFVQWRRIRDGALFDRHVSTLERIYAGLWTLLLWP
                     LHMLANLIAWRQLRRMALGGRVRTLVSGGGSLAMFLDDFFEAIGVLLIVGYGLTETSP
                     VLANRLREHNIRGTTGLVVPGTQVKIVDPETRQTLPPGQTGIICARGEQIFQGYYKDP
                     AATARVIDSEGYFDTGDLGFFSQYTGDLVIAGRLKDVIVLNNGENIEPTPIEDAMLGS
                     DYIDQVMLVGQDQRALGALIVPNLEALAVDGLVSAETRERIQSLQRQRASCERAEAAA
                     LDAALAREAAAMEQDPRLREALQREITSRVEARKNYLAIERVSRFRILLTPFTVDDGT
                     LTQTLKVRRNVVAERYAELIRAMYES"
     gene            complement(<1155577..>1156707)
                     /locus_tag="CYME_CMT460C"
                     /db_xref="GeneID:16997664"
     mRNA            complement(<1155577..>1156707)
                     /locus_tag="CYME_CMT460C"
                     /product="similar to RAB geranylgeranyl transferase alpha
                     subunit"
                     /transcript_id="XM_005539371.1"
                     /db_xref="GeneID:16997664"
     CDS             complement(1155577..1156707)
                     /locus_tag="CYME_CMT460C"
                     /codon_start=1
                     /product="similar to RAB geranylgeranyl transferase alpha
                     subunit"
                     /protein_id="XP_005539428.1"
                     /db_xref="GeneID:16997664"
                     /translation="MHGVRRTWNQTIEQAQRYEQWSAEARQVLQQRYALSRECFLKRS
                     EPVLLRNPEEYSLWNRRKACLVERYRLELATASENAGLSPPPALREQVEAEFRVTEAA
                     LRQNPKSYATWAHRLWLLRAVLPLSPDSTSTAVPGLGNCQWRPPWIVPLDLAQVYLAR
                     EEALCKQLLALDDRNFLGWRHLVEVLTLTKGIGLDLSSSSSSCGEGGAPVAGAAAGKR
                     LLHITRTVLDQNSCNYTAYHYRSIAVKEAPQDFDWLEELDALHQVMYTEPNDQSVWFY
                     YHWCMEQLQQHRQLDQASHTQNQAHDHRHYLEKELDLLDALLELEPTARWALEAKARH
                     LMNLGQHKEAARILGEELPMVDPLRKGMYEELADACMRNSLA"
     gene            <1157300..>1159918
                     /locus_tag="CYME_CMT461C"
                     /db_xref="GeneID:16997665"
     mRNA            <1157300..>1159918
                     /locus_tag="CYME_CMT461C"
                     /product="probable retinoblastoma-binding protein 2"
                     /transcript_id="XM_005539372.1"
                     /db_xref="GeneID:16997665"
     CDS             1157300..1159918
                     /locus_tag="CYME_CMT461C"
                     /codon_start=1
                     /product="probable retinoblastoma-binding protein 2"
                     /protein_id="XP_005539429.1"
                     /db_xref="GeneID:16997665"
                     /translation="MGSGTNEAGSGLDSIPPAPVFYPTEEEWSDPFNYVRRIQRQASR
                     YGICKVVPPGSWNPPKTGSPVVRFRTKQQNIHQLFRRRGLYERFMTFLRQFHRAQGDW
                     ATCRAQVPRIKGRIVDLMLLYRAVIGHGGYEQVNRSGLWRRIATVELRMIWTTSISAN
                     TKALYHRWLLPLEHHERKRRGMRAMQRDPLELEFTKFACDTECAQCLVEHIRENDTLS
                     TGNGQKSMGNSYAPAGATTVCTEAGFPCNAEPCSTESKLWRCMQCGDSWHPNCYAQAM
                     SDYGTSATAPSRMEINPTMFVCPQCDDDHRFGYTEGTVFSYKEYVRFARDFKAAWFRI
                     GSSASMNDCKTQGPTAEEIEGEYWRLVDTAEERCEVLYGSELDVNIVGSGFPRLGSVT
                     TEKMNADQLALWEQYAMHPWNLNMLPLLGSSLLRVLSARYSGITDPWLYAGMVFATFC
                     YHAEDSDMYSINYMHSGEGKVWYGCPGGDGCRQFENAMRDTVPELFAAMPDLLYNMIT
                     MVNPAVLREKGAPMCRTVQRPGEFVLTFPQAYHGGFSLGVNIAEAVNFALTDWLPYGR
                     QAMVRYREMRREAPFAQEEIIFSALERRDVWSTMAPAELERLCQELRYLIQEELALRE
                     AAGCFGGVPERLADPRAPTYVSHQGGSDRDTCPSCRQPFFLSAVRCACMPERRTCVRH
                     AFATCACPAAAKTLLYLYSDAELKRLLSDPSQAVLLAEHRKTNGETGANRKRVHSASR
                     ADLDTRERIAKQAAGGSPPKAVSLANGVDGAPSVACKRMLGKYSGENGVESSIRPEIN
                     QACSGNDGNRALEATPSGVQSEWCTSNATKCSRTKMHTELLAKTSQVEQPCLVKFIPA
                     ADGQAPSILLFRVPSE"
     gene            <1160447..>1164802
                     /locus_tag="CYME_CMT462C"
                     /db_xref="GeneID:16997666"
     mRNA            <1160447..>1164802
                     /locus_tag="CYME_CMT462C"
                     /product="bacterial DNA polymerase I"
                     /transcript_id="XM_005539373.1"
                     /db_xref="GeneID:16997666"
     CDS             1160447..1164802
                     /locus_tag="CYME_CMT462C"
                     /codon_start=1
                     /product="bacterial DNA polymerase I"
                     /protein_id="XP_005539430.1"
                     /db_xref="GeneID:16997666"
                     /translation="MFAVCWYSLPRPPLTNGPPERVPVSAWQNARLTRTRSGRRVWFS
                     VSTGCNDTRYTNLCEWMGSEALAAKIYAKQRKLVEARLKSAAFCSFGRQNRSSFRLWL
                     LLPTRPRISCGSERVRELCLVSSFSFRLCCCFMASVRSSHGCCERSRKVPLTWGTPWA
                     GRLLLSLAVLRTASRARRCVRGPELSVVRLLLSTTSKQRGRVRQSGARWRSTSCGGSQ
                     SGFCSLADVKTRPSPPAVRCLAQGPEAASASAQWSVPANSRTGPWTQTTGIEHANKNA
                     SPAHEAGVMASDAQDQWLPTLFLVDALSIVYRSYYAFQKNPLYSSSGINTSAIYGFIQ
                     TILLLLQKYNPEALAVVFDSHTTEPGPGSFRQLLFPKYKANRERMPDGVRDALPYVKR
                     AIHQLGLQSFELESFEADDVIGTLAALANHNGYRVVIVSNDKDFKQLIKAGWVRLLRP
                     TRSSGSGGFDEVTEADLAAECGTSIRPQQYPDVLALAGDAVDNIPGVPGIGIKTAARL
                     IRQFSSIEDLICNLDAIEPPRIQEKIISKADELLRNKVLAKIHQNVPLEKLQSERSPS
                     ADAGNELVTDAPAYDAMWIASCRRGPWQLNALLTLLRELDMEALSRRIQYLARSLGQS
                     DHEKRTSASARDSLETGFMAAPRERLDSPLANDEVINQPLASEQEIPPDSQHNNLHDH
                     VDDRLQPAAGPARDVPFTSVTDDSATAVPGSAQESTRSTSAQSAELRPNSASVPANWS
                     ADELSMYLGAPLRYQIMEADALLHFLDGSGTHEPIGLFMAHVMPETRRRPRHRTKEAA
                     AAPADAVNTVRLSPNSADATTTTTTTTTTNTHTTAATAAVAEHPLILMGIATDQGNAA
                     GAVLPATAPWLDTWLRQLRERLDQAHQRHVGFDLKHVLRFLLARDDVRADGVWIDPAV
                     AHALLYPEEAFERPELLAKRYLGDLGVALWNRYVEAPLTSASTSETRTEALALAAAFQ
                     ADLARHIFHRQVTRLDAVGMRALAFQVEFPLTLVLADMERTGVYVAQQELRELEEKME
                     RELRDIETQIYALAGTTFNIRSADQLARVLFEQLGVDAPLRTPGGKASTADRVLAALV
                     RRYGQEGERGTAALVGASPREHGAEASAIDASKASRAASIAALTQEYRQIAKLLSTYV
                     RGLVGHIDPKTQRIHATFHQTGAITGRLSSSAPNLQSIPIRSTRGRALRSLFRATPID
                     TVHRAGGTEPAGNVLISADYEQIELRIIGALSGDAVLLQAFRDQVDVHATTARHLFGL
                     PFDAKVSAAQRTAAKAINYGIPYGVTAYGLAQNLRISVAEARKLIREYHDAFPGVARL
                     KRELLDKARATGYASTLLGRRRYLPALHSRNYAERTAAERAAVNMPIQGSQADMIKVA
                     MVRIWQALRSQHLRTRIVIQIHDELVFEAPESELASVMPLIQVQMERALILPNDVPVK
                     VRIGYGVSWAAAHAP"
     gene            complement(<1166428..>1168644)
                     /locus_tag="CYME_CMT463C"
                     /db_xref="GeneID:16998012"
     mRNA            complement(<1166428..>1168644)
                     /locus_tag="CYME_CMT463C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539374.1"
                     /db_xref="GeneID:16998012"
     CDS             complement(1166428..1168644)
                     /locus_tag="CYME_CMT463C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539431.1"
                     /db_xref="GeneID:16998012"
                     /translation="MGAHSEHALGITEYVTHHTGFHATIKTLFSDFVVHEVDSSGQVL
                     SLRQELEHAPQASAFPDSDARGRTVTAELPLDALRECFGAVFDAEETDRILEFVQNHW
                     NPASAPATAGATILTLTVCPDKDRRRARHTALRVLAPRFASVTNSSNQIQVYPTDEDG
                     RALLGSDPDSIQESAARLRAAKRRRACDRRERCARHGGSYLRFLLCKQNLDTNEVVMR
                     LARSLGLKPNAFTYAGTKDRRGVTTQEMRIWQCTPARLEKAVERAFGQVDADSGAPQI
                     RVGGFRCTKEPLRLGQLQGNYFRLVLRSLAPNALEEVDSAIVSLREHGFINYYGLQRF
                     GSGRVPTHHIGLALLRGKWREALDLILTASLVETRDEQQSLRVGYVRPILEAYLRERD
                     AARALTQLAALPRAVQRGLHLEKRLLQAECQYGARDLPAIFHSLPRNLRTLYLHAVQS
                     YVWNEMASERIRAFGAKELHPGDLVLEPVPAGAPSAHTIADADTIVDDDHDHDGDVDD
                     DAPSAPATDTVTDPESAAPSLTHADNAGTASKATVDATTSGFAPVSVHPVTQADIDSQ
                     RYTIFDLVVPVPGLQTEAISCPAAARAYRRFVETYGVSLMGTDAPALCKQYTMRGTYR
                     RVLVRPERLTYRFVRHESPREPLLDTDLSGLPARDAQSIMNVNDAPVESRFLSCVLCF
                     QLPASSYATMLLRELTKNQTDRTTQTRFMEEQAADHADTAAATTTSVEAGAPSLHS"
     misc_feature    1169031..1170710
                     /note="possible transcribed region"
     gene            complement(<1169593..>1171191)
                     /locus_tag="CYME_CMT465C"
                     /db_xref="GeneID:16998014"
     mRNA            complement(<1169593..>1171191)
                     /locus_tag="CYME_CMT465C"
                     /product="similar to dual-specificity phosphatase laforin"
                     /transcript_id="XM_005539375.1"
                     /db_xref="GeneID:16998014"
     CDS             complement(1169593..1171191)
                     /locus_tag="CYME_CMT465C"
                     /codon_start=1
                     /product="similar to dual-specificity phosphatase laforin"
                     /protein_id="XP_005539432.1"
                     /db_xref="GeneID:16998014"
                     /translation="MARIRTSDRRNTNDQAGSESRHRVPSMARAPAADSSGAQSTPAA
                     RRASEGVSVAEPPSKPAADSSGAQSTPAARRASEGVSVAGPPSKPAADSSGAQSTPAA
                     RFASEGVSVPEPPSKPAADSSGAQSTPAARGASEDISVPGPPSDIADTISKNDRSVTP
                     TIPTLFRVYCHTEFGDAVVAAGSHDKLGNWEPAKALRLRHQCQVDTPFRDCWEGEVDL
                     VPETSFEFKFVRLIGGDPQRALWETGPNRRAVIQRNSKDGCLIEVEWERTRVLFSIYY
                     PTKEKQHLCVTGDLPEIGRWVEPGPVPMALSTTEERLETGGKGRRWSLTVSVPSTVGK
                     FAYRYVLVDDNRQQTIWEREPNRYATLERAVNGRLECFDANFVASLEFDEICPDIYIG
                     PYPQTPEHVEMMHEAGITAVLNLQTDEDFAHRSIPWSTLMETYTALEMQVIRCPIPDF
                     NAEALMQLLPDAVRALDAALKAKRVVYVHCTAGMGRAPAVVVAYLVWRRGMTLEDALS
                     HVKARRAVAAPNVTVLEKVLRNPL"
     gene            complement(<1173379..>1174278)
                     /locus_tag="CYME_CMT466C"
                     /db_xref="GeneID:16998015"
     mRNA            complement(<1173379..>1174278)
                     /locus_tag="CYME_CMT466C"
                     /product="similar to transmembrane calcium/manganese
                     transporter Ccc1p"
                     /transcript_id="XM_005539376.1"
                     /db_xref="GeneID:16998015"
     CDS             complement(1173379..1174278)
                     /locus_tag="CYME_CMT466C"
                     /codon_start=1
                     /product="similar to transmembrane calcium/manganese
                     transporter Ccc1p"
                     /protein_id="XP_005539433.1"
                     /db_xref="GeneID:16998015"
                     /translation="MQSQRDVENGTCWNPDTAPYSAVGETTGLRAPELAQLAATGSVR
                     HQHPVLHSSRARQLILEAHHARHQEKHSDSSGAVQDAILGAADGLTVPFALAAGLSGA
                     FTKSSYIVLAVLSELVAGGISMGLGGWLAGRSEVQTFESEREREEREVQHTPLAEEAE
                     IYEIFRPFGVPESAIESVLAHFREHPRDWVDFMMKFELGLSEPDRNRPWRSALTVGGS
                     YVLGGLVPLIPYLLISDAREALMWSILFTFLALLLFGWVKAGFTGQSRWKSAIETAAV
                     GGCAAAAAFGVARWFDSLTSLST"
     gene            complement(<1177759..>1178808)
                     /locus_tag="CYME_CMT467C"
                     /db_xref="GeneID:16998008"
     mRNA            complement(<1177759..>1178808)
                     /locus_tag="CYME_CMT467C"
                     /product="probable GDP-fucose transporter"
                     /transcript_id="XM_005539377.1"
                     /db_xref="GeneID:16998008"
     CDS             complement(1177759..1178808)
                     /locus_tag="CYME_CMT467C"
                     /codon_start=1
                     /product="probable GDP-fucose transporter"
                     /protein_id="XP_005539434.1"
                     /db_xref="GeneID:16998008"
                     /translation="MDKATIFNGDDKLNLATKSTRIAVAVASYWIISIAMVFLNKAVL
                     SQPGTRVDAPLFVTWYQCLCTVVGCYVLGVLGIGGVPRFEVQRAVLWKMLPLSAVFVA
                     MTATNNVCLKYVEVSFYQVARSLTVVFNVLLDFLILGQRTSLEAMVCLAVVIFGYVLG
                     NDQEVRWSLMGVLFGLASSFFVALNSIFVKKNLAHVDNNPWKLTLYNNLNATVLFVPL
                     ILLTGEVSEIFQNPTTRTPLFWTLMSVGGMLGIAISFAAAAQIKWTSPLTHNVSCTAK
                     AAAQTFLALLVYRNPITVLGLLSIFIVLGGSLAYTMVRRSEMIAGSERSSRSAGLTTT
                     AKAEEPAHPTSIRVS"
     gene            <1179755..>1180048
                     /locus_tag="CYME_CMT468C"
                     /db_xref="GeneID:16998009"
     mRNA            <1179755..>1180048
                     /locus_tag="CYME_CMT468C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539378.1"
                     /db_xref="GeneID:16998009"
     CDS             1179755..1180048
                     /locus_tag="CYME_CMT468C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539435.1"
                     /db_xref="GeneID:16998009"
                     /translation="MTQMPAELSILRATIQTHHIKMNLGCRAACYIQLMHGNATKGVS
                     RETDRNREKHFLCAAVTRPFEGVDVLGPPSDIERKAKMKLAVEIAEDLKRHID"
     gene            <1181636..>1183483
                     /locus_tag="CYME_CMT469C"
                     /db_xref="GeneID:16998010"
     mRNA            <1181636..>1183483
                     /locus_tag="CYME_CMT469C"
                     /product="probable tyrosyl-DNA phosphodiesterase"
                     /transcript_id="XM_005539379.1"
                     /db_xref="GeneID:16998010"
     CDS             1181636..1183483
                     /locus_tag="CYME_CMT469C"
                     /codon_start=1
                     /product="probable tyrosyl-DNA phosphodiesterase"
                     /protein_id="XP_005539436.1"
                     /db_xref="GeneID:16998010"
                     /translation="MRKDGVGDARQEHALKRQRLLGTRASEREIVESDVQLGNSCLGF
                     YLNQMDVVDDGRNGAHAPYVVSLAELFQDGRLLRGCSSGTCPVSRSGPSSDGAAPRRV
                     SREPFPGITDALLANFVADYDASFFFDQCPSLYQTTGQLVLITGDAPSRIAALRGWVR
                     DHLHALAERTRVLGVSGLFSGRAPSACEQGPDSLSARVDGAGGGGGGVHHSKFMILRL
                     RDDRVRLVIHTSNDIAYDWFFKCQGIFAVDLPLRGAGSASPNTGFCADLQQYLGAYIR
                     AGERALHGGVTSARRFGTMVAPGDAASLVDAVSHFRRLMTCCDYSAVDGVRLVSSVPG
                     WHRISGQSRTSQTSRTASHAVCAFGHLRLANLVASSLRHCTEAARHPNSLAFVLQGSS
                     LSSVDARCPRAASETLARYWLTSELFRSLCGGDGGGGGVGEESVFAKLAEGSAQVYLV
                     WPTRTQVLTSIVGIDSGMGLIARAQAFLDPEIRQLLTRWNADWCARTSVMPHMKTISC
                     WDTRTDQCLYCYLGSANVTPAAWGITQKQGSLLRCMNWELGVLFTSGYLATPKLYREL
                     RHYADRSNERELNEPRSIILLPLPYTPGACAGARYQERLDQPWSSDAMI"
     gene            complement(<1185417..>1187186)
                     /locus_tag="CYME_CMT470C"
                     /db_xref="GeneID:16998011"
     mRNA            complement(<1185417..>1187186)
                     /locus_tag="CYME_CMT470C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539380.1"
                     /db_xref="GeneID:16998011"
     CDS             complement(1185417..1187186)
                     /locus_tag="CYME_CMT470C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539437.1"
                     /db_xref="GeneID:16998011"
                     /translation="MFSGASAASTVLWVPLQRWDCSRGARSCYAPLVPVSRKRPHRAS
                     VYIDTCCHFGNNGGPQSDQNQASRARDLFQNLTKRIGRFAVALKTRSRGTPSKEPQTH
                     EKAQNQATETPVESPEVSRIFTQVSGEDSWNTNAPELAHGTAEAFVRALCAYGLARDI
                     VEQIALQPVPATWPSALEYLAAFGCTPTNLQALLERDMKSLEVETAKQLGAAVQQISS
                     ASSITAAECWNLLMDPMIPLEVWCSIPENQSEQLRQLRRFGLDTAQLVRLLLLEQAQR
                     RLCDCQQLETMLTFLVQNPPQGCGFEPSSDILRRLFPRAPWLLTDFPMETAAAAVQHL
                     CSCLELNFAPYIRQIVYAHPEILRTDTGQMQAIEEFLNASIQLSSKSIAAMVRSYPRC
                     LTLSLTQVERVTEFLRDLGLTTDDLNKAYRAFPALLALDIDRNAMPVVALLRDWGIAD
                     VATMVRGLPPLLVYDIHTDIQPKLKFLRSVMNMDTKKVLEFPAVFSYSLRDRIAPRLL
                     YLRRLGIDVSRMRLSVVIAPSDVDFCRRVARTSMQNFSAFKEEFNQLIEKRLQQVASQ
                     QRLSTEHSDVMASAARQSDAKPH"
     gene            <1188852..>1190327
                     /locus_tag="CYME_CMT471C"
                     /db_xref="GeneID:16997675"
     mRNA            <1188852..>1190327
                     /locus_tag="CYME_CMT471C"
                     /product="UDP-glucose dehydrogenase"
                     /transcript_id="XM_005539381.1"
                     /db_xref="GeneID:16997675"
     CDS             1188852..1190327
                     /locus_tag="CYME_CMT471C"
                     /codon_start=1
                     /product="UDP-glucose dehydrogenase"
                     /protein_id="XP_005539438.1"
                     /db_xref="GeneID:16997675"
                     /translation="MRTFFPRRVRDYKARFKMPGSQPLRVACIGAGYVGGPTMAVIAA
                     KTPPEAVQVRVLDLSAERIAAWNSERLPIYEPGLSELVFAARGRNLHFSTAIDDGIKW
                     ADIIFVAVNTPTKECGIGAGAAADLTYVELAARQIAAAADTPKIVVEKSTVPIRTAEA
                     LSAILEACGRTSFEILSNPEFLAEGTAVRDLCEPDRVLIGGDLKTERGRQALEALVEL
                     YAYWVPRERILTTNVWSSELSKLVANAFLAQRVSSINSISALCELSGAQIDEVARAVG
                     LDRRIGPRFLQCSVGFGGSCFQKDILNLVYLCESFGLNVVADYWRSVIAINDWQKQRF
                     TARILHSLYNTATNKKIAILGFAFKKDTADTRESAAIDVCGSLLQECAKLSIYDPQVP
                     AEQIWSDLTRRCRRTRDELAAYVTLAATADEAAAGSHAIVILTEWDEFRTLDYSKMYK
                     SMCRPAFLFDGRSVCDLKALSEIGFLCYAIGSPDDSRIQLR"
     gene            complement(<1190402..>1191076)
                     /locus_tag="CYME_CMT472C"
                     /db_xref="GeneID:16997676"
     mRNA            complement(<1190402..>1191076)
                     /locus_tag="CYME_CMT472C"
                     /product="similar to FKBP-type peptidyl-prolyl cis-trans
                     isomerase"
                     /transcript_id="XM_005539382.1"
                     /db_xref="GeneID:16997676"
     CDS             complement(1190402..1191076)
                     /locus_tag="CYME_CMT472C"
                     /codon_start=1
                     /product="similar to FKBP-type peptidyl-prolyl cis-trans
                     isomerase"
                     /protein_id="XP_005539439.1"
                     /db_xref="GeneID:16997676"
                     /translation="MVFVGVQPVPGHGVALNARNLQRTRSGKELPRKHRSRCFLSAGS
                     NGRTTLRAALPLALSLTRRQLLERLLFMAGVSAWLRLPGLEGARAAGTTTPQKLDLSK
                     FVRDPSGVLYRDYKEGTGASPKDGDLVVINYIGYLSDGTIFDNTTAKGRKPLAFIFGK
                     KQMVPGVEKGIETMKTGGKRRIIVPSELGFGERGVCIEGQGCLVPPNETLTYDVELMR
                     VSIAPF"
     gene            <1193836..>1194510
                     /locus_tag="CYME_CMT473C"
                     /db_xref="GeneID:16997677"
     mRNA            <1193836..>1194510
                     /locus_tag="CYME_CMT473C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539383.1"
                     /db_xref="GeneID:16997677"
     CDS             1193836..1194510
                     /locus_tag="CYME_CMT473C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539440.1"
                     /db_xref="GeneID:16997677"
                     /translation="MNGRKSILVYEKSSAPLLRVLGAVGVFQVAAWAAFGAVSWRNSG
                     ASTKATAATSQDTEEDAPGTRSVTENTHSPSSRYQTWWPAGGLLVSVLFLQLMSFYAK
                     RNVKSIRFVGDFAERARIVTHSLFRSGREDQPSRLVLEVPTFQLHASATGRTATKEDL
                     VTFGIRGYNSFFQIDRKRGQIYDATLLNALLEKGGQGVMQAAAQRMKTSTPKRTPSAR
                     ERAVNS"
     misc_feature    complement(1195331..1197556)
                     /note="possible transcribed region"
     misc_feature    1195372..1196060
                     /note="possible transcribed region"
     gene            <1197783..>1199296
                     /locus_tag="CYME_CMT476C"
                     /db_xref="GeneID:16997981"
     mRNA            join(<1197783..1198767,1198866..>1199296)
                     /locus_tag="CYME_CMT476C"
                     /product="probable phosphate transporter Pht2"
                     /transcript_id="XM_005539384.1"
                     /db_xref="GeneID:16997981"
     CDS             join(1197783..1198767,1198866..1199296)
                     /locus_tag="CYME_CMT476C"
                     /codon_start=1
                     /product="probable phosphate transporter Pht2"
                     /protein_id="XP_005539441.1"
                     /db_xref="GeneID:16997981"
                     /translation="MLDLGSTVLAVCGVALAVGVLCMMGANDVANVLGTAYGAGALHV
                     PVYSGPASLWARIKGAAPLILFAGVFEFAGALFAGASVTEHVSSQLVSGGSARQRAIG
                     ALGCLLASFSLVTGSTVAALPVSASHATASAVVASGAYQVWRQRFARVLSSSAASGQP
                     EAPMLVHWPAVWSMLTAWTMSPFVGFLSGYVLYFICGARCISEEVLGLPLLAGAIIGT
                     LSIFVFTAGPPDLRFLLRDWMAPIAAATSSLAFAVAATVFLVKRRALLAPYVDTVVPP
                     GQSRVPHSGQDAFSSEWQAESSSEEPAHSRAIGLRILMVFTAAALAFAHGGNDVSNGI
                     APLVHIINYARHDSGDRETVASGAISLSLLALGGASILCGLTLFGYRVMQTVGYAIAE
                     LDFATGLAAQTAATLCVLVATTAGIPVSTTQILVAAVAGAAYSQGKPIQYRTLVRIVL
                     AWLLTIPLSASISVIVPWLFQ"
     gene            <1201028..>1201762
                     /locus_tag="CYME_CMT477C"
                     /db_xref="GeneID:16997983"
     mRNA            <1201028..>1201762
                     /locus_tag="CYME_CMT477C"
                     /product="20S core proteasome subunit beta 6"
                     /transcript_id="XM_005539385.1"
                     /db_xref="GeneID:16997983"
     CDS             1201028..1201762
                     /locus_tag="CYME_CMT477C"
                     /codon_start=1
                     /product="20S core proteasome subunit beta 6"
                     /protein_id="XP_005539442.1"
                     /db_xref="GeneID:16997983"
                     /translation="MSHPDPGFVSMSFDSDTQRKIVSHQRTWSPYVDNGGTVLALAGR
                     DYAIVAADTRLSVGFSIPSRNFTKIVQLTDQAVLASAGMGADRQYLHKILRSRLEIYR
                     YQHQKEMSLGAIAQLLSNTLYSRRFFPIYAFNVLGGIDANTGEGFVFGYDAIGSFEKV
                     KVVCSGSGQTLVQPVLDQQLAGRQKYDVPDDQRMASLSLAEAIELTRDVFNSAAERDI
                     LTGDALELYAVTASGVRCERFELRRD"
     gene            complement(<1204967..>1206403)
                     /locus_tag="CYME_CMT478C"
                     /db_xref="GeneID:16997984"
     mRNA            complement(<1204967..>1206403)
                     /locus_tag="CYME_CMT478C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539386.1"
                     /db_xref="GeneID:16997984"
     CDS             complement(1204967..1206403)
                     /locus_tag="CYME_CMT478C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539443.1"
                     /db_xref="GeneID:16997984"
                     /translation="MSPVGLRESCPGFAGMFPTHAVNGGFGHAFLRRSRAVAMLRSRA
                     QKPCSVLGRSTRILVRCSDANPTERYVVEPASPPNDAGDEQLQPVASASLSQATCWTL
                     SGMTLKELENFVSGMGEKPYRARQLYKWLYRPPVASQVDDMTDLGKLFREALASSARL
                     HALSLREVREAQDGTRKLVYQVDGDSPGAVESVLIPASGRNTLCISSQLGCAMNCQFC
                     FTGKMGLQRNLTAAEIVDQVTLTKARYESPRQASTQISNIVFMGMGEPFQNLDNVLRA
                     LEILLDPKAMGLSHRKVTVSTSGLVPEIRRYLRETSANLAVSLNATTNEVRNWIMPIN
                     RKYPLEVLLETLREEYARDARRGDKVFFEYVLLGGVNDSLDDAKRLLRLIAHIPCKVN
                     LIPFNSHAGSEFRPSPLPQMEAFRQYLHERGVLVTLRRSRGDDKMAACGQLGNPGIGR
                     TPPRMRVPDAFQKVLGTAPLQTRRSAGA"
     gene            <1206652..>1207740
                     /locus_tag="CYME_CMT479C"
                     /db_xref="GeneID:16997985"
     mRNA            <1206652..>1207740
                     /locus_tag="CYME_CMT479C"
                     /product="similar to transcription initiation factor
                     TFIID, subunit TAF7"
                     /transcript_id="XM_005539387.1"
                     /db_xref="GeneID:16997985"
     CDS             1206652..1207740
                     /locus_tag="CYME_CMT479C"
                     /codon_start=1
                     /product="similar to transcription initiation factor
                     TFIID, subunit TAF7"
                     /protein_id="XP_005539444.1"
                     /db_xref="GeneID:16997985"
                     /translation="MDAPQESHFILRLPERLAKRLRDALEASAWDTVEDATTSVGGRR
                     TVAATAVDSVDQGFSSAGNSLAADNTGQASTRQLLASTKTEQFWLVFFPENRNGRLAA
                     LRIGNETQYEEHFGFMFDLPCIVESWKTLDGRTVYKCADVHQILQIYEDPKDLPTGTE
                     ETLGDGLTPASRGFLERHRPEEPKYSAIEVAQHEEIIKYALDFRKPWNGPMPVSVDVD
                     EEVVEEEIWVPLPKEEMPKPPEASVITQASASVANMEKLPNETPREAAPVSLPTETDQ
                     LASELEEALLQDSEPATTEERPSATAVSAARQAEQARKDLLRRNLEQRIAELEREISR
                     IANPLLRSRVQRRLEQTKAELDQLNAAD"
     gene            complement(<1208633..>1209394)
                     /locus_tag="CYME_CMT480C"
                     /db_xref="GeneID:16998071"
     mRNA            complement(<1208633..>1209394)
                     /locus_tag="CYME_CMT480C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539388.1"
                     /db_xref="GeneID:16998071"
     CDS             complement(1208633..1209394)
                     /locus_tag="CYME_CMT480C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539445.1"
                     /db_xref="GeneID:16998071"
                     /translation="MHSSGEYTRERLGFLSAINVAQPLVNGCRTGRRVCYSRSRWNLA
                     TTKRAAKVMIESQSSLPVDVPHCEALTRRWVRDFVLALQLCPYARAPFLANQVRIAVD
                     GATSIQQVERALEREAQVLQHAPEEALATTLLVLPNFHPRDFERFYASTLLLERRWEA
                     RGLSDSFVLVFFHPMHMYAKHGAPANGCIPVDQLDYERRAPLPTINLLRDDQVDAAVA
                     SGKSTEMLEHNAAHLSTIPLEALEIRFRCLYKTDA"
     gene            <1209647..>1210396
                     /locus_tag="CYME_CMT481C"
                     /db_xref="GeneID:16998072"
     mRNA            <1209647..>1210396
                     /locus_tag="CYME_CMT481C"
                     /product="similar to p53-related protein kinase"
                     /transcript_id="XM_005539389.1"
                     /db_xref="GeneID:16998072"
     CDS             1209647..1210396
                     /locus_tag="CYME_CMT481C"
                     /codon_start=1
                     /product="similar to p53-related protein kinase"
                     /protein_id="XP_005539446.1"
                     /db_xref="GeneID:16998072"
                     /translation="MFDAIEMGSQTPASQPAASPGLAAVAQGAEATIYRTRLFGDQDV
                     AIKQRLPKRYRIPELDEHLNRSRIIAEARALARAWSLPHVHVPAVYLVDPHRLRLVLE
                     WIEGLSLRDWLRTRESVEGTTHIAAVLEQVGRMVAAIHAVGLIHGDLTTSNFIVRESA
                     DRNESTVFVIDFGLAQQYPIQSDTTVEAKAVDLYVLERALASVHVQQAAAYFAQVLRA
                     YESGSSIENAKLVLRRLDVVRARGRKRAMIG"
     gene            <1211360..>1212118
                     /locus_tag="CYME_CMT482C"
                     /db_xref="GeneID:16998073"
     mRNA            <1211360..>1212118
                     /locus_tag="CYME_CMT482C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539390.1"
                     /db_xref="GeneID:16998073"
     CDS             1211360..1212118
                     /locus_tag="CYME_CMT482C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539447.1"
                     /db_xref="GeneID:16998073"
                     /translation="MDASQRVPLDFRRAVRRSDEIAREPLFPRCPIGWENFVPSGWVV
                     PLGQSLVSVSVPAANKAESQPRFSNTGRLPDSAAEGTPVRGPVPPGSTDAENTLSVCT
                     VLASRLLVDSLPIVVLDTAERGGRFGRPGFRKPKPAEIYLVEWMRPCTLDDFTCNGLV
                     NIGSGMPGMTWGSGGGTGSPRAQGTASPSTERATSQRMKLTWVTISVLECFGNEALEY
                     FRKRQQAAETVAALRKPDVGIMPSKRYTRYRSLD"
     gene            complement(<1212878..>1213588)
                     /locus_tag="CYME_CMT646C"
                     /db_xref="GeneID:16998074"
     mRNA            complement(<1212878..>1213588)
                     /locus_tag="CYME_CMT646C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539391.1"
                     /db_xref="GeneID:16998074"
     CDS             complement(1212878..1213588)
                     /locus_tag="CYME_CMT646C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539448.1"
                     /db_xref="GeneID:16998074"
                     /translation="MRLATCEVLCETCNKAVARKYCQESCICDGCWDSFAQRSASQPL
                     GSSVTALPLCERCEQVPVAYETALCLTCQTGIKPGAFSEKMDFTASLWSNSPQSTSTP
                     SVTSPRTAQGPLQSEDAPVCSAPEQAVSSEALRYAPANDKVLSHEPATNAAQPADAKL
                     TSEESRAVDKGTLPAWFALLCEDVQRRNVWFRRRRKRRNASSVDVCLSATASSSDHEL
                     DAQQIARKRSAKNHVEPR"
     misc_feature    1214711..1215464
                     /note="repetitive element"
     gene            <1215678..>1216409
                     /locus_tag="CYME_CMT484C"
                     /db_xref="GeneID:16997954"
     mRNA            <1215678..>1216409
                     /locus_tag="CYME_CMT484C"
                     /product="probable flavin-linked sulfhydryl oxidase ERV1"
                     /transcript_id="XM_005539392.1"
                     /db_xref="GeneID:16997954"
     CDS             1215678..1216409
                     /locus_tag="CYME_CMT484C"
                     /codon_start=1
                     /product="probable flavin-linked sulfhydryl oxidase ERV1"
                     /protein_id="XP_005539449.1"
                     /db_xref="GeneID:16997954"
                     /translation="MSRSVWFEKLRAGIGTVATPLPLPNTAIRRSQSWSRRFVARTIV
                     AFITVAGLATIAWHSSSWREAVFPTKVFSQASTEAAAAAPDTARAAPGLPRTMLTKAP
                     GKIPFQDEKPPTRAELGRAGWTLLHSIAANYPEVATPEMQTHARQFIASFAALYPCPT
                     CREHFQGYVRTHPPALESREQFVKWCCRAHNAVNLRLGKPTIPCTDLQLLDKRWRDCH
                     CDEQEPQNMIRAARRLIESRRPNAG"
     gene            complement(<1216406..>1216840)
                     /locus_tag="CYME_CMT485C"
                     /db_xref="GeneID:16998115"
     mRNA            complement(<1216406..>1216840)
                     /locus_tag="CYME_CMT485C"
                     /product="mitochondrial ribosomal protein S7, precursor"
                     /transcript_id="XM_005539393.1"
                     /db_xref="GeneID:16998115"
     CDS             complement(1216406..1216840)
                     /locus_tag="CYME_CMT485C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein S7, precursor"
                     /protein_id="XP_005539450.1"
                     /db_xref="GeneID:16998115"
                     /translation="MSLYTADSVLSKLVNILMRDGKKSTAQRIVDEAFWILKREYQVP
                     DPASYAKEAIEQAKPVVELTRYRLSGRNLQVPSPLMPHRATALALRAIRDAVRSERRE
                     RGAAARLAAELVDIHRQQGVAWKRRQDLHKMAEANKMFTHLR"
     gene            <1217902..>1218756
                     /locus_tag="CYME_CMT486C"
                     /db_xref="GeneID:16998116"
     mRNA            <1217902..>1218756
                     /locus_tag="CYME_CMT486C"
                     /product="similar to ribosome binding factor A"
                     /transcript_id="XM_005539394.1"
                     /db_xref="GeneID:16998116"
     CDS             1217902..1218756
                     /locus_tag="CYME_CMT486C"
                     /codon_start=1
                     /product="similar to ribosome binding factor A"
                     /protein_id="XP_005539451.1"
                     /db_xref="GeneID:16998116"
                     /translation="MCTRDTAAFSQMVTCFVAVSAPGRVRSTSTPQKLVLAQRPTAPR
                     LGAFALRAKRRGHSRLSRPVSAGSDLPRRPSRVAEQIRRDLAEIFLHELVTFKKVGKE
                     LVPPTFRTKDISVLEVSVTSDLRTAQVEISVLSAEPSPRSCVEWLMRNRWEIRHALAQ
                     RMRHQKFVPELRFRESRVPQVMRTLQLIDRLAAERRGRESTASEDPEIMQAAASPASD
                     FETDDTIRPEELFLSLPPAKPDAEETDILGDDVASIGSDFETDDRIRPEDLFVRNLPA
                     ETDGEETD"
     gene            complement(<1219591..>1221675)
                     /locus_tag="CYME_CMT487C"
                     /db_xref="GeneID:16998117"
     mRNA            complement(<1219591..>1221675)
                     /locus_tag="CYME_CMT487C"
                     /product="similar to DNA cross-link repair protein SNM1"
                     /transcript_id="XM_005539395.1"
                     /db_xref="GeneID:16998117"
     CDS             complement(1219591..1221675)
                     /locus_tag="CYME_CMT487C"
                     /codon_start=1
                     /product="similar to DNA cross-link repair protein SNM1"
                     /protein_id="XP_005539452.1"
                     /db_xref="GeneID:16998117"
                     /translation="MDEELSAQWLADAGLEASVYLPLFSQGDGVRLAALIELWRENCL
                     DEALQALGVTALGARRCLTLAVERSAQQYTSGGLATSLRPETVISRTLEERAVTSKPV
                     AGSIDISEKQVAKALSARPKPRQLDNQKNADTVGHSLTNDPVRGSALLETGSHAMERL
                     SRTSAAAPAPEQRTERVPRQAKPSVGQKRKNSSAGNVRHEASSARQQTLFEWGIQRRV
                     AEPVARTLVSRRMVASTVVPISDTSGETGGRPLESLALRLADGSHADEAHLESGKTLR
                     RSVNIETGSGKTPDPRQLSNMHGTRSRHHPSKHVAGLPGCVVDSFRVPIRANDGYYHF
                     FLTHYHADHYGGLRRTHFRPGCDRRLYASPITVSILQVEYQFDDAVLVRLPVGDPDGI
                     TIVDRPGSPGAKPVARVLACDANHCPGAVILIFQVFETGQTIIHCGDMRYNPICMNRD
                     PVLRRFAATEGDHVQRVAYLHIDTTYSDPRYDFPPQEAVLRALVETAQRDAARAPSLF
                     LCGTYFIGKERVWASLAKALGTNVYIDPSWKRKRRVLLDCVRSLPTDSWRFSDVLTER
                     VEASCVHLVRMADVQPMRLLRFMRRAQSLGFRQVIGVMATGWCQASRPPRGCQRLDGS
                     PADKCSLLERLVLPSNHSCILYKLPYSEHSSYSELRAFIDWIQPEQIVPTVATTAAHL
                     QRLWPRRPASSR"
     gene            complement(<1224525..>1226885)
                     /locus_tag="CYME_CMT488C"
                     /db_xref="GeneID:16998118"
     mRNA            complement(<1224525..>1226885)
                     /locus_tag="CYME_CMT488C"
                     /product="glutamine-dependent NAD synthetase"
                     /transcript_id="XM_005539396.1"
                     /db_xref="GeneID:16998118"
     CDS             complement(1224525..1226885)
                     /locus_tag="CYME_CMT488C"
                     /codon_start=1
                     /product="glutamine-dependent NAD synthetase"
                     /protein_id="XP_005539453.1"
                     /db_xref="GeneID:16998118"
                     /translation="MRLVRVATCNLNQWSLDFAGNLERICCSIARAREAGARYRLGPE
                     LEVSGYGCEDHFLEPDTFVHSWEVIAEIIARGYTDDILVDLGAPVLHRHVAYNCRVLL
                     LNRRILLIRPKLALADDGNYRESRWFTAWPANGRRALEKYPLPDCVRQVAAGAQAETL
                     FGEALLDIGGVVVASETCEELFTPDAPHIRYSLNGCDIIGNGSGSHHNLRKLNQRIDL
                     LRSATAKGGGAYLYANQQGCDGGRLYYDGCALICINGEIVAQASQFSIADEVEVITAT
                     IDLDEITAYRIAIASRGVQAASTAPVPRIDAAGRSVSLRHEDIAGRIDGMPTGCAFSP
                     AFIGDASQRAVPASVDPSERSFRLVLSDGEQLQYMPSQPVPVRLLSAEEEIAYGPACW
                     LWDYLRRSGASGFFLPLSGGADSSATATIVASMCRLVAVEAQQRNDHVIREARRILGL
                     GTDAELTENAADAYIPRDAHEFASRILHTAYMRSENSSRATRERAAQLAKEIGAYHLD
                     LPIDAVVAAVLSVFTLVAGERPRFRVQGGSAVENAALQNIQARIRMVLSYLFAQLLPW
                     ARGHGQRTLLVLGSANVDEALRGYLTKYDASSADINPIGGISKHDLRRFLLWAVHELG
                     FETLQQVVEAPPTAELEPITGEYVQTDEADMGMTYAELTVYGRLRKIGRCGPVSMYER
                     LSRLWKAHLSPSQVAEKVKFFFRMYSVNRHKMTVLTPSVHCENYSPEDNRFDLRPFLY
                     NIRWPWQFRQIDALTSKVATAASERDALPSERDCHANLAQIAGASP"
     gene            complement(<1228548..>1230671)
                     /locus_tag="CYME_CMT489C"
                     /db_xref="GeneID:16998191"
     mRNA            complement(<1228548..>1230671)
                     /locus_tag="CYME_CMT489C"
                     /product="2-methylthioadenine synthetase"
                     /transcript_id="XM_005539397.1"
                     /db_xref="GeneID:16998191"
     CDS             complement(1228548..1230671)
                     /locus_tag="CYME_CMT489C"
                     /codon_start=1
                     /product="2-methylthioadenine synthetase"
                     /protein_id="XP_005539454.1"
                     /db_xref="GeneID:16998191"
                     /translation="MLVRSATDNPAQRTQRRAHRFPSETMRLPHKTRCIAWSVVTSPV
                     NPRFGATCGLHLNQSSGWCGATVETRKVLARRARCERRSQGCAFRTWGMSAAPHASGT
                     GPATTALDATPETLASSTLINPNPNVAFPVGEEVVDRVRVRHILLATEQMADLVLQQL
                     SADAASMDALARTLSLDESSRANGGDLGWHARGSLDAELEFYCFNSAPRVVFKLQTQR
                     GFHIVRVEDAEYKLVPTATKSRYIRSGELVPQLYARENPNSRTRRRLYNVQTFGCQMN
                     LADSERMAGELERCGYRHTPDPYEADLILLNTCSIRDHAEQKVYSFLGPFVRMKEKSN
                     PGLKLIVAGCVAQQEGVKMLRRIPALDLVMGPQYANRLADLLEDVENGNQVVATEPIH
                     IMEDISKPRRQSQVCAWVNISYGCNERCTYCVVPYTRGLEQSRSVESIVNEVVQLKNE
                     GYREVTLLGQNIDAYGRDMRPRVTFAQLLRHVSATGIDRIRAITAHPRYWSPRVIQAT
                     AELPNIMPYFHIPFQAGDDEVLKAMGRGYTAKRYRRIIEMIREYLPDAAITADAIVGF
                     PGETEEQFQRTLELMEALQLDNVNTAAYSPRPFTPAASWENQVPEAVKMERLHRINEL
                     NMRIVDARSQRYLGRIEEVLVEEVNPKSPELGVCGRTRTNKKVFFEAPGGIQRWRGRM
                     ANVRITQARAYSLTGELVATCPQGY"
     misc_feature    1230907..1232097
                     /note="possible transcribed region"
     gene            complement(<1232285..>1232758)
                     /locus_tag="CYME_CMT491C"
                     /db_xref="GeneID:16998193"
     mRNA            complement(<1232285..>1232758)
                     /locus_tag="CYME_CMT491C"
                     /product="similar to thylakoidal sec-independent protein
                     transporter Tha4"
                     /transcript_id="XM_005539398.1"
                     /db_xref="GeneID:16998193"
     CDS             complement(1232285..1232758)
                     /locus_tag="CYME_CMT491C"
                     /codon_start=1
                     /product="similar to thylakoidal sec-independent protein
                     transporter Tha4"
                     /protein_id="XP_005539455.1"
                     /db_xref="GeneID:16998193"
                     /translation="MFVLSLSKTNQHLHESVSCSSFCLKNAASLVRESRRGRAAQRRQ
                     LQETRALPERAGHCTRPSAASALQMGLFGLGWPEIAVIAGVGLLIWGPSRIGELGRNL
                     GTLAGNLKRASSEFKEGLETSLADAEKEEKQKEEMKLKSLKSADPTAATTDSKRS"
     gene            <1234742..>1235623
                     /locus_tag="CYME_CMT492C"
                     /db_xref="GeneID:16998194"
     mRNA            <1234742..>1235623
                     /locus_tag="CYME_CMT492C"
                     /product="similar to 3-methyladenine DNA glycosylase alkA"
                     /transcript_id="XM_005539399.1"
                     /db_xref="GeneID:16998194"
     CDS             1234742..1235623
                     /locus_tag="CYME_CMT492C"
                     /codon_start=1
                     /product="similar to 3-methyladenine DNA glycosylase alkA"
                     /protein_id="XP_005539456.1"
                     /db_xref="GeneID:16998194"
                     /translation="MPAHHLSAKWRQVKTKRTRKTPATVAPKSVALPETVRQRLEQAR
                     REAIDFAALEYLYASVPPLRSVIDAHPPPHFLACDVFTVLVQAIVWQQVSARAAAKLW
                     PRLVEVLETQVPGSIRRSMPHLYVNPGPLASIPDPALLRAAGIPQSRCAAIVEAARAF
                     HAKPDLYHNWNDSIEDDEVVRRLCCLRGVGEWTAHMVLMFAMRRMNVLPVGDLGVRRG
                     FAVVFDLKPDARREQGAAGRRSVLPSPDAVKKFASSAACGNGRFLTVVSYYMWRAAGA
                     DVLVPDGTLVPDLASTV"
     gene            complement(<1236379..>1238184)
                     /locus_tag="CYME_CMT493C"
                     /db_xref="GeneID:16998195"
     mRNA            complement(<1236379..>1238184)
                     /locus_tag="CYME_CMT493C"
                     /product="mitochondrial division protein FtsZ1-2"
                     /transcript_id="XM_005539400.1"
                     /db_xref="GeneID:16998195"
     CDS             complement(1236379..1238184)
                     /locus_tag="CYME_CMT493C"
                     /codon_start=1
                     /product="mitochondrial division protein FtsZ1-2"
                     /protein_id="XP_005539457.1"
                     /db_xref="GeneID:16998195"
                     /translation="MFQHWRTRVHGCPAGLWDDRSARVLICWKRFRWHGDMLSQAQSQ
                     AESSCIRAVHTPAKCTEALRRAPEPAVTQLANDLRTTEQRCTVEGQSLRVFSRPRMVA
                     LGVGGAGGNTINNLVRSLRQQNQQRSADRNSELHLDPFQGLRLLAANTDAQALSFSLA
                     DRTFCLGERLTAGLGAGANPSVGREAARACLPLLMEEIRNAHILFLTAGLGGGTGTGA
                     APVIAQAARAAGVLTIAVVSTPFAFEGRHRMRLAEQGLDELEPQVDTIVTIPNQNLFR
                     LATNRTTLQSAFQLADDVLCKTIRSVTDLMYTNGFINLDFADLDAITRNAGRAVFGMG
                     EASGCSAPMANGNASLPQRSVDTASSPQARIDRGRRAIELALNNPLLDGISLGQARGA
                     LISISGGRDLLLDEVNEIASLIRDRTGPHANIIFGSAFDESLTGTVRVSVIITAGRTL
                     QTTPAPAAAPFSIRSWFAKASDVAEMSTSRRQKVANETFRETSQNSESLVRPPAGPHA
                     TVDRHRRQGAPSAPRNASQGTPERTFPKKTDADKPGRAEARTQTTARHNSRYVATNDG
                     FSSAGASPESGNWSHWMQNLLAWRTRAVDFLKHNW"
     gene            <1239651..>1240727
                     /locus_tag="CYME_CMT494C"
                     /db_xref="GeneID:16997889"
     mRNA            <1239651..>1240727
                     /locus_tag="CYME_CMT494C"
                     /product="similar to pheromone shutdown protein TraB"
                     /transcript_id="XM_005539401.1"
                     /db_xref="GeneID:16997889"
     CDS             1239651..1240727
                     /locus_tag="CYME_CMT494C"
                     /codon_start=1
                     /product="similar to pheromone shutdown protein TraB"
                     /protein_id="XP_005539458.1"
                     /db_xref="GeneID:16997889"
                     /translation="MSTVAVRARWLSGIWRWRGFRQFVRSEQWWRREPRPAAYRTLVP
                     QAQPAFRVWVSGSLSTSAGNSTFGSAPGDETTNSTGTAAALTDDNPLRLVNGSTGAVA
                     HVLGTAHISALSVSQTRELIRRVQPDTVVVELDDERVQTVRERLDKKDPSQDSSLFSE
                     LLRVFTDPRGGSLGSRMFEVYFKLMYRALRMAGFLPGAEFVAAIEEAERIGARVVLGD
                     RNIHETMERLRAAVFHNFSDVLHALVSPPPPELESLLDNLKDQARGGNARKISTDFVD
                     ALLDRKSVRLLTRFLSRSLPAVSKVMLDERDVILASKIATAPGQKIVAIVGAAHLDGI
                     ERWWLQNIEPDPIIVSSSPLPSQS"
     gene            <1245144..>1246805
                     /locus_tag="CYME_CMT495C"
                     /db_xref="GeneID:16997890"
     mRNA            <1245144..>1246805
                     /locus_tag="CYME_CMT495C"
                     /product="similar to 5'-AMP-activated protein kinase,
                     gamma-1 subunit"
                     /transcript_id="XM_005539402.1"
                     /db_xref="GeneID:16997890"
     CDS             1245144..1246805
                     /locus_tag="CYME_CMT495C"
                     /codon_start=1
                     /product="similar to 5'-AMP-activated protein kinase,
                     gamma-1 subunit"
                     /protein_id="XP_005539459.1"
                     /db_xref="GeneID:16997890"
                     /translation="MPKTSDVFPMNQGHTKQRRVSRDDRVQVGDSIQSQVELARVAIT
                     RFMKERRVEDVAPLCSRVLVLDVRLALSDAFGALLEQQSSVAVLWDTVKQSLVGLLTP
                     ADLAEMLLFLRESLQREGTPTPNDGNEQGHQDSGAVDDADYNRRAVRLLTSRTLGTWL
                     ELCSEQSNQSKLLSRDITDTGQGPVPGAGAAEAPPVTLATAVAFAGSALEKHAPLLAN
                     SRPPRPSALQLISCRANGSLYEAAVLLRDHAIHHVPLVIGADSTVLCILTHGRLLAYM
                     NEQFGLYRLEKQWQQQQQQQQQQRERPARPRTDARVSAQELQTAALDAMRTSCTPEVE
                     ELAVVVDLFSVPIETLGIGTFRNISQVHLKEPLWRAIAKLVDSNVHAIPVVDDTGALQ
                     QVYTRADALWIIAPETVTVPEGRPASPWGRPSETKSPGGNMENIGARIASGGGRYHML
                     RDHVLVEDHFRMLRREGRNRRLPVTCSPRDTLRTVFERMGHDFRIHQVFVVDDRQHVL
                     GVISLSDILEFFMDSSASVPSSPDLRHHDSPFSHTGMDLPVRPIL"
     misc_feature    complement(1246979..1248641)
                     /note="possible transcribed region"
     gene            <1248774..>1250498
                     /locus_tag="CYME_CMT497C"
                     /db_xref="GeneID:16997892"
     mRNA            <1248774..>1250498
                     /locus_tag="CYME_CMT497C"
                     /product="glucose-6-phosphate isomerase"
                     /transcript_id="XM_005539403.1"
                     /db_xref="GeneID:16997892"
     CDS             1248774..1250498
                     /locus_tag="CYME_CMT497C"
                     /codon_start=1
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="XP_005539460.1"
                     /db_xref="GeneID:16997892"
                     /translation="MASSGVHMHQVWRKLKTHASDVISNLHLAQLLQDEQRCTAFRAT
                     LNDLVYDYARQRATPETLSLLIEFADASELGAKIDRMFQGEKINLTEDRAVLHVALRA
                     PRDPTIWPASVRLPEQAVSEVHDVLAQIERFSERIRKGREWVGATGKPLTDVVSIGIG
                     GSYLGPEFVYEALRTDHKAAEAARGRRLRFLANVDPTDVHRALDGLNPETTLVVVVSK
                     TFTTAETMLNARTLKRWLMDALGESAVAKHMVAVSTNTEAVKAFGIDPQEGMFRFWDW
                     VGGRFSVCSAVGLVPLSLQYGFGIMREFLAGAHEIDWHFATERDWRKNIPVLMGLFGV
                     WNASFLGYSTRALLPYAQALLRFAPHIQQVDMESNGKGVDIHGEALIDPTATGVVDFG
                     EPGTNGQHSFYQLMHQGRVIPADFVGFRRSQTPIVLEGEPVSNHDELMSNFFAQPDAL
                     AIGKTREELVAEGVPEALLNHKIFPGNRPSSSMLFDCLDARTVGRLLALYEHRAAVEG
                     FLWNLNSFDQWGVELGKVLAKRIRNELARRRQAEGKPAAGQAATDHHWNASTRFLLDA
                     YFTPSTGQ"
     gene            complement(<1250969..>1252483)
                     /locus_tag="CYME_CMT498C"
                     /db_xref="GeneID:16998088"
     mRNA            complement(<1250969..>1252483)
                     /locus_tag="CYME_CMT498C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539404.1"
                     /db_xref="GeneID:16998088"
     CDS             complement(1250969..1252483)
                     /locus_tag="CYME_CMT498C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539461.1"
                     /db_xref="GeneID:16998088"
                     /translation="MRTPPVSTPRPPSTSNSASILSESLVRLHAAVFGLLFGNIGGVR
                     QSLPSFARHVTVSSRKGPTWITRAHVETWLHEETTWLDEHSATRDALETSFSSPVKDA
                     SVSATDTLEDKNAALERVLQRLVAYGVLVASPLRSPPETGVNGHPTASGVAGLADAPD
                     YGVVHFMQNESECSLNTLLRLPESLRRSARYPARTLALETERVLDALLQVALPVEDYA
                     DYGLRYEAVFADPCFPEWLTLASLLAWCRRPDDSLADDGQKLAFYCNIFNGMVIQAVI
                     QELKLRGTAKSSRFPDAMELLRRTHFVLCGELMTLEDLRDQVIRFGCRQSLGKDQERF
                     APLLVSVCEPRVHFVLHWGARSSPLPRCVHLSRWECDLDAATTSFLLNPRQVFIPLQA
                     KSSIQLSRLFEWFGEDFAADCRRVRAEGHTQLATLRWIHAHLAEDTTAERALSERLAR
                     LEGASADSETEQEADRSTRCFPCRRIVTLPKPRMIQYMDFDSRIAIAASENAQS"
     gene            complement(<1254122..>1254700)
                     /locus_tag="CYME_CMT499C"
                     /db_xref="GeneID:16998089"
     mRNA            complement(<1254122..>1254700)
                     /locus_tag="CYME_CMT499C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539405.1"
                     /db_xref="GeneID:16998089"
     CDS             complement(1254122..1254700)
                     /locus_tag="CYME_CMT499C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539462.1"
                     /db_xref="GeneID:16998089"
                     /translation="MACSPGSKSAQLLLYQCQALPTLRPASTTAALLGYRHRRGSAAA
                     SGTFCRTEHAKRFVLCRKVRSTRRRTSGALLCRALLAIGIQELASAFAGGSIGVLGTL
                     LTLELAQTRARERMQCPYCSGRGKLVCGQCLALGTLPNRKSPDGTVPCRLCGRSGYVP
                     CNHCEGTGRLFQEEVERAALQTYEQEWLGREP"
     gene            <1256652..>1258352
                     /locus_tag="CYME_CMT500C"
                     /db_xref="GeneID:16998090"
     mRNA            <1256652..>1258352
                     /locus_tag="CYME_CMT500C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539406.1"
                     /db_xref="GeneID:16998090"
     CDS             1256652..1258352
                     /locus_tag="CYME_CMT500C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539463.1"
                     /db_xref="GeneID:16998090"
                     /translation="MNESSTHGGPGKTQQSSRRAQEPRQTRSRPSVVVSGAGSRASRP
                     LLRGTEEAEKVDHAPLESSRNSLASKQPNNQTATLSQATKSNSMTRGSGSTPGQRPAP
                     VHQSAAPSTVAAAASSTRELYALRAEVAKLRLRCEELENELALLRKQVSTVALPPVAS
                     SASTNTSNAKELAQASQAPAPEASQVAATGAAGTPASQTTARLASTSRLHNDITWHSE
                     SQVLDWADEMETMELERRGRNSSTEKSVVNVPRPTPGTWTRKPASASGAGPERPPQPP
                     LPSTRDTGQQQRQLSEAQSLEHPQRIRQREPRPHGTEQNREARQQQRRQRRERPFQER
                     TLTADAKTQPHASSAASKSAEAPPPVQRPHRETVERPPASAWLFAVHARAQPDKLRFL
                     VSSRAAGPESAPDRFISLSFSVSRWINDQAFHKTLMRMLLQLWRRLAPPALDSGTTQQ
                     QQQQIPPPLAELLRQPETEEQRPLDRQQVWALCEPVLLEACRHPTLLVLLDCHGLNDK
                     TKQAVRFNVAYFVEAAAAARERFEATFAIPPRLVLVLESYPVQRRPVLGGHPVYPVQC
                     "
     gene            complement(<1259154..>1261538)
                     /locus_tag="CYME_CMT501C"
                     /db_xref="GeneID:16998091"
     mRNA            complement(<1259154..>1261538)
                     /locus_tag="CYME_CMT501C"
                     /product="probable transcription elongation factor S-II"
                     /transcript_id="XM_005539407.1"
                     /db_xref="GeneID:16998091"
     CDS             complement(1259154..1261538)
                     /locus_tag="CYME_CMT501C"
                     /codon_start=1
                     /product="probable transcription elongation factor S-II"
                     /protein_id="XP_005539464.1"
                     /db_xref="GeneID:16998091"
                     /translation="MSDWEPYLGAFVWAKLPSYPWWPGVIAPDAKGNHRKGNRFNVNF
                     FNDSQHAWVTRENLVAFAENMDKCVKPTHRFYDAVRKAIAEAIEEGALSTAAMQTVTA
                     ATTDAAATDAALTEAASTLRGARVAPASTASAAAADHATSDKRAGFLDSDPSEATATR
                     RRLKQRRKIPAEDSDGTETAASSSEYAVSEPEHDLSEGDDGSAKCRDAYPARIDEASS
                     ESTAERRALDRSHDPNKRRAHKRKSSTGTEWTPLSDGISSGTASGPAGASPGSLGTGN
                     AQQVRMAERSRGAGSSSHGTGASRTEHSRQLAALRQQNAQMKARLALLERKLEKYPPA
                     PPEPTPLTLDAIRASATGLTSRRSIGAEDLTRVVHGLEERSAMLSELHQAWSDRCSKY
                     RECAAQLEDLRLAAARAAEAFELEERRIALQLAELLRYQVTLEVLRTSRAGKPIKTLG
                     RSLHGKSAVIGRLAEEIISKWKAIVTEAQRESQEPSLLPTGESERLQTRDPSSSGSEL
                     LAAPNDATNARSGLNGAGRVQPDDLGPSLHTTADARMDVHGSVAGVADAAGREGAFAA
                     VQQVATETGSFDAGPVSTLESAWNTANATEVDGDQQQQQHSDRMQTEPMVSALPLPPG
                     KRGDIVRALTDVFIAAATEEATPTEHVNAATINLCRSLCIELERALNAKFSFDFARPD
                     YSAKYRELKANLRRNADLRWRLLRQELSPAELVDMSAEALKTEQAREREAEIAERMLF
                     HKQRGIPQAASTDQFRCGKCGQRSCTYFQMQTRSADEPMTTFVTCTHCGNRWKC"
     gene            <1262038..>1263618
                     /locus_tag="CYME_CMT502C"
                     /db_xref="GeneID:16998183"
     mRNA            <1262038..>1263618
                     /locus_tag="CYME_CMT502C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539408.1"
                     /db_xref="GeneID:16998183"
     CDS             1262038..1263618
                     /locus_tag="CYME_CMT502C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539465.1"
                     /db_xref="GeneID:16998183"
                     /translation="MHIDQTGSAYCAAVAALRRERFRNLGAAVSLVHAAGALLVEACV
                     LLPRRTAGTAAATFIRLLFVACSVPFFLVGSLIGSDWYATARRPARRRVALSLLVAAG
                     ALHQVAILGSLQPLLPCSARSKRLIPLSDGLILGALCGWWFWLVFDRAERFAFELPLL
                     ATKRMTRLLSALRSLRHPRSPILGRSYMPRIVAGFGLFVIALRVHRRASLWANLFFLS
                     TLMLSACLMVLLWSALLQLVQVWMTSPVTLGGNSSLGSHHRGKRASVTVARFEHALRN
                     RVAATLSLSPQRQSTPKRTAIASGAGEELLCLVLEHSVHFGHVDMFLYALYDLERVAL
                     FVPERRRRLFADPHGRVLLALLDICLAILEPGALVERYTAPKDQKQQRLSRTRHVYRL
                     SNAGLLHAYRMTATSLGALILHSSHEDPFGLVQRRTGLTQQRLEQLAAALTAIRSRCG
                     TLRPRPGLEQAAFNALCDTLQRCRAWAAVEAAPTCTGTLTHSSTMPRVWREWPTSIEE
                     AARHLEQVRAFLTHHTLK"
     gene            complement(<1265833..>1268001)
                     /locus_tag="CYME_CMT503C"
                     /db_xref="GeneID:16998184"
     mRNA            complement(<1265833..>1268001)
                     /locus_tag="CYME_CMT503C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539409.1"
                     /db_xref="GeneID:16998184"
     CDS             complement(1265833..1268001)
                     /locus_tag="CYME_CMT503C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539466.1"
                     /db_xref="GeneID:16998184"
                     /translation="MDRQKRVFLVRLDICELLAVPDSIGVFHVKLKAFRAGLFRQHVQ
                     WRGFTSDRPVENHRVVWNESLRFQATLMARGSEDSVLAPFFLSLKVKRTIPFGRSTQT
                     VCIGELQVDLAQYAGIEGTHTTHLPLEKSYTTALLRFTLTIRQNEGSRTFKRQPVAQS
                     ILQSGLGRPLRAPSTSTDESFDNSPATGASANRARALALIRNEDNCHKQERAADQQSH
                     AQERVVTGSAPEAFTDESDLSDFNSDGDDHESMIEHDQDARDGPRYGYLGDGLVAGTV
                     GTGERDRDIGYRTSLALATPAESALHDDAEAFMYRESTADKRGAPAKRDVAFRAPSMA
                     TMPRSVETNTADAATAALVPHPSTSWDKGLPPDWYQHQHGHTSLPGIRIRTGSNDGWF
                     GEKRALDASVLSSGSKPSSSTHGTGKRDHPLDSLPHDDHDFIEDRDSNEHRLSEDDPG
                     ADAAGAAPGADDDDTNSITSMSTAPDTTLSSQDERTTTATSPDALPSTSEVYDAEAAP
                     TEPGVIDQARSPAPVRSLPTGPIQRHYRQARVAAQLLGMTLGEQSDQTFTSTVPSTEQ
                     TTPADPVNRRWRGRRTQSAVPHLPEWTSLVGASRPKPAQSVNRRTYSRSSMNWWSGER
                     PRKPSTKPSKPTFSLSDIIDTGLDKYVAVLAAEMRRERLVPETVRSTRTDLDAAVADV
                     LRRLGRPATTNTIPLPGDRLSPKSSLPAGTVPWRQQQGRR"
     gene            complement(<1268609..>1269955)
                     /locus_tag="CYME_CMT504C"
                     /db_xref="GeneID:16998185"
     mRNA            complement(<1268609..>1269955)
                     /locus_tag="CYME_CMT504C"
                     /product="alpha-tubulin"
                     /transcript_id="XM_005539410.1"
                     /db_xref="GeneID:16998185"
     CDS             complement(1268609..1269955)
                     /locus_tag="CYME_CMT504C"
                     /codon_start=1
                     /product="alpha-tubulin"
                     /protein_id="XP_005539467.1"
                     /db_xref="GeneID:16998185"
                     /translation="MREVISLHIGQAGVQVANACWELFCLEHGILPDGTMASRDSAIA
                     AANNASFGTFFSETSSGKHVPRCLFLDLEPSVVDEVRTGPYRQLYHPEQLMSGREDAA
                     NNYARGHYTVGKEIVDTALDRIRKLADNCSALQGFLIFNSVGGGTGSGLGSLLLERLS
                     VDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHALLEHTDVAVLLDNEAIYDICRRS
                     LDIERPTYRNLNRLIAQVISSLTASLRFDGALNVDLTEYQTNLVPYPRIHFMLSSYAP
                     VISAEKAHHEQGSVAEITSAAFDPANMMAKCDPRHGKYMACCLMYRGDVQPKDVNSAV
                     KAIKSKRSIQFVDWCPSGFKVGINSQPPTVVPNGDLAKVQRAVCMVSNSTAIAEVFAR
                     IDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYIEVAADTNEEEEEY"
     misc_feature    complement(1270128..1272884)
                     /note="repetitive element"
     gene            complement(<1276336..>1276491)
                     /locus_tag="CYME_CMT506C"
                     /db_xref="GeneID:16998186"
     mRNA            complement(<1276336..>1276491)
                     /locus_tag="CYME_CMT506C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539411.1"
                     /db_xref="GeneID:16998186"
     CDS             complement(1276336..1276491)
                     /locus_tag="CYME_CMT506C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539468.1"
                     /db_xref="GeneID:16998186"
                     /translation="MARSVCHQARRFRRRSTQVMAEVPSSAEPGPGPVPAARVSCPCP
                     VDVPQVL"
     misc_feature    1277154..1280545
                     /note="repetitive element"
     gene            <1280654..>1281073
                     /locus_tag="CYME_CMT508C"
                     /db_xref="GeneID:16997703"
     mRNA            <1280654..>1281073
                     /locus_tag="CYME_CMT508C"
                     /product="mitochondrial ribosomal protein L17 precursor"
                     /transcript_id="XM_005539412.1"
                     /db_xref="GeneID:16997703"
     CDS             1280654..1281073
                     /locus_tag="CYME_CMT508C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein L17 precursor"
                     /protein_id="XP_005539469.1"
                     /db_xref="GeneID:16997703"
                     /translation="MKHRINLRKLGRDSAHRLALLRNLVSSLIEHESIETTVAKAKEL
                     RRVADKMVTLGKRGDGLSRIRALGFVRGPHLVQKLFRTLAERYRERNGGYTRVMRSRN
                     RRGDNAPMAIVELVDSPKGVIRRPLEHYQRSEQRQSV"
     misc_feature    complement(1281933..1283100)
                     /note="repetitive element"
     gene            <1283470..>1286583
                     /locus_tag="CYME_CMT510C"
                     /db_xref="GeneID:16997704"
     mRNA            <1283470..>1286583
                     /locus_tag="CYME_CMT510C"
                     /product="similar to psbB mRNA maturation factor Mbb1"
                     /transcript_id="XM_005539413.1"
                     /db_xref="GeneID:16997704"
     CDS             1283470..1286583
                     /locus_tag="CYME_CMT510C"
                     /codon_start=1
                     /product="similar to psbB mRNA maturation factor Mbb1"
                     /protein_id="XP_005539470.1"
                     /db_xref="GeneID:16997704"
                     /translation="MPGQPAIRVHDTLGFAVNVRFQTDVLGTQLATRDTTFVHVALQQ
                     QRRQRAYPNRSGRRHVHQSEQRLDVLHRNSAWRPQGTVQRSSSRMELWLSTDEGEVFG
                     PAPAFSVKTKAAPRTEVPGKTASGSTAMLSASREQGSGDGRTRVDRRRLKLLFQLACD
                     AESKGRFAEAASLARQCLELDEYDARSWLLLARLEASLVHADDRSCTVSVVNGTEGIH
                     VCTSHQRARNTYRQGVLMCPDSVHLLHAWAMFEYRLGEIETARELFRRGLALDPANAY
                     IYHSWGLMECRRGGVEKAQQLYVEASACCLNDAICSAWAELEARGGRMRLARCIFELG
                     LVMLLRDFADTLHLTGSDTEEHDPNREAVRDMPYGSLRSLVRVLVAEHLREKERPPVS
                     GLCGKERDMACLSPNADARPTPGERSERALRALLLDWLSWYRDGRNPNLIHIRLTVRT
                     RSRRGDRYQLAADHCVQYADSELTHGSITRTREILQWALDLDPTNVKVLLACARLDAQ
                     RGAHERARSLFRAAESALRKRGTAVERIDDAQSASHRVGVSLYTSWATMEMNLSRPVE
                     ANAVLERGNERFPRNHALYQTWALVQEKRGQPDAARQLLEQSVRLRPNAPAYVAWALL
                     EEREGHLDTARELFEAALQVDPSHSATYNAYGRLEARAGDLEKARRVFLRGLHVQQAP
                     CIYHGFALVELRYGNGIRRAEEILLEGIAQKSDRSMFLWHTLGALAFQQKKYEKAREI
                     FAQALQIYPSNSRLLLGAALSYAAEATALDAERPRQLFRRALQEDSFHGHAWQCWGVF
                     ESRLGNVDAARLLFERGVERCPFHVPLWQAYALLESTAGNIRKARILFERGMQLESDH
                     VHLLNAYACMEARVGNYQKAQCLLERALRIDPGHGATWNARALLELRRGNQHGAREVL
                     EEGLGKDANHAPLYRTYARLELALGNVERARLLIEQGLVRDASDSGLIQLRTDLQKPS
                     AVFTAGAFERWADLSPRESAGSMSVLARLQAELSEASISTTDFDLFAIQSVDDALQEG
                     HSSIDAR"
     gene            complement(<1288223..>1289809)
                     /locus_tag="CYME_CMT511C"
                     /db_xref="GeneID:16997705"
     mRNA            complement(<1288223..>1289809)
                     /locus_tag="CYME_CMT511C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539414.1"
                     /db_xref="GeneID:16997705"
     CDS             complement(1288223..1289809)
                     /locus_tag="CYME_CMT511C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539471.1"
                     /db_xref="GeneID:16997705"
                     /translation="MQQMSHVLLSVCGRRHRRTPGGRSALLQFRLGARTAQVLCKQTH
                     VHERCFGSSIGATYHPGVAPESSTPVPSELMGNFQGLEVTFLGTGAAAPSPRRNVLSV
                     AVRIGLAEQRKSAALWLFDVGEATQHQLMRSHLHMGRIERIFLTHLHGDHCFGLAGLL
                     CGLGANSIPDDQSETAGDSGDAPGDRRGRLPLVDVYGPPGLRLLVRSALGVGRAHPRL
                     RLRLHEIVPPAPDVLRDWYEWSRQFMNVEDNRLSRAALRTWAETLAPTMDCSLPMLPC
                     EQAGTDFHFPSLADVQSMPEDPRIHGSIALKLVDDERGSVYVAPLRHSVPCFGYVIVE
                     KQRLPRIDLVALRQKYQLETHPILKELKLGRSVPHPHDASKWIEPSEVLQPAAGPRKL
                     VILGDTYDSTLILPAAHQCQLLVHEATLGDELAHRARSVQHSTARMAGAFAKRANLTG
                     ALALTHISARYDDQDGRSSRQLLAEARQGAKDGQFSIFIAEDLQRVQVPGTTAQCDPA
                     LMRYSTRSADSDSAVMLDAL"
     gene            <1290539..>1291933
                     /locus_tag="CYME_CMT512C"
                     /db_xref="GeneID:16997706"
     mRNA            <1290539..>1291933
                     /locus_tag="CYME_CMT512C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539415.1"
                     /db_xref="GeneID:16997706"
     CDS             1290539..1291933
                     /locus_tag="CYME_CMT512C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539472.1"
                     /db_xref="GeneID:16997706"
                     /translation="MQTRSARVRKSRSPREMIEKDDDFLDRQAQPRTRTLPFAALLTR
                     FRRRRLGHASALRRLTLNLLVLLGLWTALRQMVCLVTPVMNWLGQRSACLSARERHWL
                     GLDGESLDPLSPYVVAPSARSLYHASCSDDVIVVVRTSKKTYPKRAPTIIRTWLRDFP
                     RERVFFVSPDALPDYGAQVLVLDVLRTDIYYGHTYSPDAVGTPVFLRLMKKFGANYVL
                     IVDDDTYVFGENFCKTLHELESSRRSEFLYSGFSFCMDAPYGAYMNKRCITPPEAKRP
                     LPTHRPCTVGFAYGGGGVVMNEALVRALASVADECWNETYCIRGGSLRTWWCMYYHPE
                     IFKGKEQHMDMHWSFMPNRPSYYLQTMGARGLVQGVPFNSSFRPASFHHVEGAEAYWL
                     YSLRLAPDPRQLNVPSDWRGQVTMAHIFGHPPPWAGDCEGSFFRKAQKEAEERMERFR
                     GKLKQVHQEARPHP"
     gene            complement(<1292301..>1294601)
                     /locus_tag="CYME_CMT513C"
                     /db_xref="GeneID:16997751"
     mRNA            complement(<1292301..>1294601)
                     /locus_tag="CYME_CMT513C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539416.1"
                     /db_xref="GeneID:16997751"
     CDS             complement(1292301..1294601)
                     /locus_tag="CYME_CMT513C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539473.1"
                     /db_xref="GeneID:16997751"
                     /translation="MTTARHEHGLGPPRRPATWTEVNPVSKRLRRPVQKSVEDTGSVL
                     AALQRYEEQLSSHYVTLRAEAVDKLSVLFRSLARRGTRIGSVPYSWLRLFERLTILAT
                     EPTRTHLRKQAGELVLNMLQCSGSDLDLSPVLPNVVLRLASAAALPDLCCRLESFQLL
                     CRILNTAPSRLRPTLVELLCEQTTFVALVQAWIHLNGGSPDFVQDEEATTRTCVAMQH
                     RSHLQQAESLESSLDALELLISLAHRFGERYTGCRIETTPELPVLLDEFAYMEQRHES
                     SGYLVAKGDASMDEDPDRDVIETKPFRTCALRLEQLSPVAPLVLLFVDQESMNSSTVQ
                     AASTAQLLQNFYSEAFRILVSFVLEDRTCDGRLYDLLCRCVDGSQRLRQHAPSAYDAA
                     NPGPSRFSHWAHNIWKHHLEPHWRSKPRDSQADRAFARLSVILADVLCCPAMILPELV
                     SAAVEAGAASHLLHMSCHPTLTETAWRTHWRQRCGSAMESLTNGSWVPASSDWSIFER
                     FADYECLLATIKFAYRCILGAHAADNGKREQRLAAECLRQVRLVLCKQNTLMISHDHC
                     KSLMTALAPFIAVPSRNVLVLTELAPVLRQQLEALLERLLVLSAGSVPVRLERALARC
                     QMHRKALETGCWRSVHALSNSMTLETRFLLLIALMRNVSQPEVRRDPIDCIEGVDACR
                     VTDALAPTLREVYTHLRRTWTALSCAGPWLVLAWAKLIRHQVARNRVQESLVRFMERE
                     GAPTSSVAREKDASSNHGAVSSAAGR"
     gene            <1296425..>1297201
                     /locus_tag="CYME_CMT514C"
                     /db_xref="GeneID:16997752"
     mRNA            <1296425..>1297201
                     /locus_tag="CYME_CMT514C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539417.1"
                     /db_xref="GeneID:16997752"
     CDS             1296425..1297201
                     /locus_tag="CYME_CMT514C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539474.1"
                     /db_xref="GeneID:16997752"
                     /translation="MFRSQSFRGAALWYSRKRVYKSRILKSDRGLSCIPSIRCVGPRR
                     YDQSIPVHRWRLTALCPELIRIVFWRGASRPGKLVGLPRSNTLRDPVWCPASLSLWWS
                     LPVDESLFGGPDTGCRRVATVRQVLLPIPRRLSFSRIFMFFLRWFLRALPNMVESHWI
                     WSLSSIPVFLRMQMRWLDYCTETRFGYASIYKCSSAFSSLSLSRTRAWTETPLRSVTC
                     TSRKVRDKFRAGEGRERQVEERHHGHDRFVHSPVCLRRGF"
     gene            <1298368..>1299816
                     /locus_tag="CYME_CMT515C"
                     /db_xref="GeneID:16997753"
     mRNA            <1298368..>1299816
                     /locus_tag="CYME_CMT515C"
                     /product="chromatin assembly factor 1 55 kDa subunit"
                     /transcript_id="XM_005539418.1"
                     /db_xref="GeneID:16997753"
     CDS             1298368..1299816
                     /locus_tag="CYME_CMT515C"
                     /codon_start=1
                     /product="chromatin assembly factor 1 55 kDa subunit"
                     /protein_id="XP_005539475.1"
                     /db_xref="GeneID:16997753"
                     /translation="MEQENAEERLINEEYKIWKKNTPFLYDLVLTKALEWPSLTVEWL
                     PERRLAEGHSSVLANLLLGTHTSDAEQNYLMVAEVRLPYYEGASENAPAPGAPGAGAG
                     KEAEASGCEDTLLSRIEIRQKINHDGEVNRARYWPKNPFIVATKSPSSAVYLYDLSKH
                     PSKPPTDSRIEAQAILTGHQREGFGLAWSPDDRGNLLSCADDMLICQYDVRAVLAGEV
                     ASGNGTAPTRSSSERVSNWGGPPQYGPLRVYTGHKAVVEDVAWCMHNAHMFVSAGDDR
                     QIMLWDTRETSSSRAAATFEAHKAEVNCVAFSPFNANLLASGSSDSTVALWDIRYLKM
                     KIHSFEAHSDAVQQLVWSPTEETILASAAADRRLMIWDLSRIGQEQSPEDAEDGPPEL
                     LFVHGGHTAKISDFGWSQNDPWLIASVAEDNILQVWQVGEHIYADEDEEDEDGAEIES
                     ESDPVGARDTPAHGAERSDLAPDDDVDAALLE"
     misc_feature    complement(1299326..1300707)
                     /note="possible transcribed region"
     misc_feature    1300817..1303149
                     /note="possible transcribed region"
     gene            complement(<1301914..>1303359)
                     /locus_tag="CYME_CMT518C"
                     /db_xref="GeneID:16997785"
     mRNA            complement(<1301914..>1303359)
                     /locus_tag="CYME_CMT518C"
                     /product="similar to tetrapyrrole methylase"
                     /transcript_id="XM_005539419.1"
                     /db_xref="GeneID:16997785"
     CDS             complement(1301914..1303359)
                     /locus_tag="CYME_CMT518C"
                     /codon_start=1
                     /product="similar to tetrapyrrole methylase"
                     /protein_id="XP_005539476.1"
                     /db_xref="GeneID:16997785"
                     /translation="MRVLSPPRPARGCVLPGSADYFGERRSRQASWRAGCLFIRGVSG
                     SLALFLRTLPSLNRATARGPAVEPGTWRVKRCLTTCAADLEVNGTSGSAESVPGSNQV
                     DKFLQLPAVERGRLYVVATPIGNLGDLSFRALAILRQADWIAAEDTRHTGKLLSHYGI
                     SMRKQVAHHEHNWREQVPFLLSELQERRAAVALVCDAGTPLVADPGTQLVREAIQRNI
                     PVVSVPGPCAALAALTISGFLSTPNSGPVSAEDWAALLGNSFSFYGFLPHRSSGHSRW
                     RQKRTQLMETIIREAWYRPVILYEAPHRLRETVHDLALAARSVHVTAAEATTVQPPDA
                     SLQICIARELTKVHEEVYRGLLREAAAYLEQREPRGEYCLVLGPPSRPEDPPHALHFC
                     TEDQDVVPVVEASAAAPHSIDARMERVHVVTFITALLQEGLPASAVARCVARSIPNIQ
                     RKQAYALVLQIQEQFGNCISKHRSPGKEDSS"
     misc_feature    1303410..1304621
                     /note="possible transcribed region"
     gene            <1304915..>1306762
                     /locus_tag="CYME_CMT520C"
                     /db_xref="GeneID:16997787"
     mRNA            <1304915..>1306762
                     /locus_tag="CYME_CMT520C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539420.1"
                     /db_xref="GeneID:16997787"
     CDS             1304915..1306762
                     /locus_tag="CYME_CMT520C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539477.1"
                     /db_xref="GeneID:16997787"
                     /translation="MVNAPFCFVTLPYSVDRRLQGSTWKQQQDRISSKTKSARKRQLA
                     ETPQTLKAQQRTEDKRSGSMRPWPVLRFIKDATFFFNPFRDPNARPNPTERLVQQQAM
                     PRADPERAPGGLVLVAGATGLLGRRVVAQLLAAGYSVRALVRSEKRAEQALGNLKYPK
                     SKLGERAAPGTLQLLFGDLYNVPPEGVQDVTAVICCTGVKIGPQDDTPDRDKYGQGIK
                     FYEPVVLEDTPENVEYRGVQNLVSCARDVLVSGQKIVLMDFEDAETAARQWGPVDDVV
                     MGGVSASKLSFPERGIGRFSGLVRTDNFGGFASVRTLPFQMPLNLQGYDGIELLVRGD
                     GKRYKFIIRCDDRWDGIAYSCSFDTEDHRSTKACQRIRLPFERFVAVFRGSTRPNERP
                     LDRSNIQAFQIMLSKFEYDGALNPGFKAGDFCLEFRYIGAYRDVLGAEADRVRGHGAQ
                     VVAGGTATQRPRFIHISSAGVTRVLRPDEFPDLSKEPPAVRMNAQLGRVLEWKLAGED
                     LVRSSGIPYTIIRPCALTLEEASGLSALRLEQGDWLRGQVSRDDVAALAVACLDEPAM
                     EGKTVEVATSAATERPTMHSLRERALQLERDQDAIQRKFAPFPYVPQGS"
     misc_feature    1307760..1308548
                     /note="possible transcribed region"
     gene            complement(<1308650..>1310695)
                     /locus_tag="CYME_CMT522C"
                     /db_xref="GeneID:16997789"
     mRNA            complement(<1308650..>1310695)
                     /locus_tag="CYME_CMT522C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539421.1"
                     /db_xref="GeneID:16997789"
     CDS             complement(1308650..1310695)
                     /locus_tag="CYME_CMT522C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539478.1"
                     /db_xref="GeneID:16997789"
                     /translation="MRSTRVNKGWLGCGDLSEPVEYAAPGMGRGRPQQVMAAFVGSIP
                     AYRCSSLTVQNRRFYGKQVATKRPYRGYVVRERQLVSFPTQPHCQEHPGSIPNSNRRR
                     TSGDSRQKPVGNAFYQAARTTEASPRYRTEPLTSRMSIQRGRPSFRGIPDGIHLQALF
                     IVLCVFGLFTLSSWAPNRRFSMMGILACIACVLVLLLSSSRRLSTASPDDLASDEDDV
                     DDASKRIKATLRSRHHHHRLRRLNLEDLALVLGWSGGSDLVLRGLPPADRLRQRSRRR
                     GAQASARDAYAGAGWFSDTDSTDIAQASSRPRSDAARRPLRRLQSGSEEQVLPFPESD
                     SYSSLFKNHRREWQADSTLEEDVDGYVQGGTAAGTASHGEDDTFGLGAWTILDGMDGN
                     EPDLGEDLRPARSPAIFSRHDATEQTERDFTLDAQGGTGVLQSNIVHVGRAAPESVTA
                     AVADSSSSIAIVPVEVLSPDDDDDDDDDDDDIMERVRYERSKRRRPARRRLGVEGVVR
                     VGGGGGFPENRFDFDASTKDEVRFSAGARTARATSRRAATWDPNSVQSESTVAAEDVY
                     FMNRAQRSSTSARGRQTLLRSVFLPLWQISRMVYRDLQTKYGTTSTISQPSQPQPRRT
                     ASSGAVASGGGGDVPAEGSNAFYAEGFEAPSGPDVFQDAARWVSRSAPGLWRTLFGP"
     gene            <1311252..>1313912
                     /locus_tag="CYME_CMT523C"
                     /db_xref="GeneID:16997812"
     mRNA            <1311252..>1313912
                     /locus_tag="CYME_CMT523C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539422.1"
                     /db_xref="GeneID:16997812"
     CDS             1311252..1313912
                     /locus_tag="CYME_CMT523C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539479.1"
                     /db_xref="GeneID:16997812"
                     /translation="MDLRRGLCAAKQGLGARVIETGAEDVLVFAYGTTPREPAADSVA
                     ARAAPGTLSGRWGTLDDASPSETDSESLSTSSGSMSSSSSAYTSESDWDGLGTNGEAA
                     APCAGVLSTRTSPPVSEPVQRRMNRQKTRLASFLEPAVGHAGEVVRRLSPSSARQHST
                     LGLFWQGASPRTYRGPSQHVPAVSSTPRSGKAFEDVYRTETRTRTSPDTEASPDALGS
                     SAQEALHTNRQLVPAARRERVRPPPIDTAFALPQAHGHANKWSSLVALRHLTLNGQPG
                     SPPNSMTLLQADAMHRSLLDSDASESEPDSAVCSGRTGSTQCAGLSSETPLASIPLNG
                     AVRFGPGEVLIPVRCAFASASAAGEPGMQPLLAVAHGYPRFPMFQHAAGACPVSSSSS
                     SATTSMSPRGAMSPPSDRREAFWQRSAHRRGAWAGSLSSLSPGPVLNQSWSSIYRSNQ
                     RYDGGRLGLSSASSATPRTACATGTQPLLSPSSALRSHRRLHRRLDELLDGILRHDRA
                     LAEDDWWRELSGLVADGLVSAANIFYRLSAHHALRERTQRSETAAYGALHITLHLILN
                     GPLEALAEAVANGQVDFWQALHGHWHAQLPDLKSLSEAETARHWRMIFLVEVVEYLTR
                     KLRFHESYPPFEANYALGRFFRRVELESTDSFRVVENQETQRQLFSLDTVTEMVSILH
                     CLLDAELGLARNAGRFLASRSETASSTSGTVTEADPVLQLYREQTHLGGLLALLAQDA
                     TNLYQMVVYMMSRMHARLGKRSVSTQRSHCGTSGNATTATPTATTACSSLSGSGCTAS
                     EAADLRELAVVLQEMSGYLRKFFERLLEADLIEQVPYIPPQLLIPAPDACMVPSRFPF
                     LVIARFTNFADLHRAIASGARSEAAARSRP"
     gene            complement(<1316708..>1318195)
                     /locus_tag="CYME_CMT524C"
                     /db_xref="GeneID:16997813"
     mRNA            complement(<1316708..>1318195)
                     /locus_tag="CYME_CMT524C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539423.1"
                     /db_xref="GeneID:16997813"
     CDS             complement(1316708..1318195)
                     /locus_tag="CYME_CMT524C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539480.1"
                     /db_xref="GeneID:16997813"
                     /translation="MTSEALETKRYGKRPVECLVLACTRAGKPFFFWSTRQWPDWQQR
                     RLVVSLGASAAALVARLEHKLRPSYGKRSNRYLVEGERRVWCLDLSIDDCVLLAGVRS
                     PGGPASAPQCQLREPSVYRCLCLALQSWLRRVLLSQLPTSVFATLHVRPAFDMHPYID
                     SDSIGSVLEMVLHHPLVCIRDLLPLSGPLLYPSQRSSLMDSMQRLIKLVEERARPVRV
                     SACLLVDVVANGMMVARISMNVGAPLYLIMLGLVRVLHAESCVRLQTPDYEPLYLVAG
                     GSGRYRLIYALCRAVAPQVLDEEPIRSLQASVLQTAAVQHAQAHDRLLVNLIDSLTPA
                     DLERDIGTAALAAWLPERHTKAPPFALAAIFQTSRRFVSVHIDDESHWWILAAYRLYE
                     QRQRSSNVRHAPFSLKAPTRRLSCFPNRSCYGEQCIVFVIFELSETGSGLVQITDQVP
                     AIVQMIADRWTGHLLQLSLHHPILRSLDQEPEWYLWSGLCRLYAR"
     misc_feature    1317741..1319225
                     /note="possible transcribed region"
     gene            complement(<1318619..>1320331)
                     /locus_tag="CYME_CMT526C"
                     /db_xref="GeneID:16997815"
     mRNA            complement(<1318619..>1320331)
                     /locus_tag="CYME_CMT526C"
                     /product="probable ammonium transporter"
                     /transcript_id="XM_005539424.1"
                     /db_xref="GeneID:16997815"
     CDS             complement(1318619..1320331)
                     /locus_tag="CYME_CMT526C"
                     /codon_start=1
                     /product="probable ammonium transporter"
                     /protein_id="XP_005539481.1"
                     /db_xref="GeneID:16997815"
                     /translation="MHYLADRFGLNADAPKLSAANQSLYFALANIVDGVNSAFLLLTA
                     ALVFCMQAGFAMLTVGSVRNKNAKNALVLNLCDACVGGVAYYVLGFGFAFAPINQALL
                     TYDNFVTELPLSPIYKTKSNGFIAFQHFALAHMQSPLTKDAFTYLSGLSVPSGTNNGA
                     TLFLWWFQFTFCLTAASIVAGAICERVRVFAYIGFVSLMMGFVYPVISHAMWDVNGWL
                     NVFYNKVTDPTTGHITGSFGIYGSAGSIDFAGSGVVHITGGAGAFVGALIIGPRIGRF
                     DENGKIRPIPGHNISLIVLGGLLLWFGWFGFNPGSQLGVLSYADGGKVGSAVRGGFNL
                     NGVPTVYSTAGQVALAAVNTLVLPAAAGITTLMITRFFYHCFDCASMVNGFILGTVAI
                     TSPCSTIPTYSALCCGIIGGFIWVFGDKLVQRLRIDDPLGAIAVHGFGGTWGIIIPGF
                     FAKPDYVAMVYAPANGSGGVFYGYGKQLAAQLTEILYIWSFVCTVIGGYFLILKFLGL
                     LRVSPEEEILGNDTSHHGGPAYPEDDVGLEEDLATLRSYQKSQKVDQKESGSDSPAEE
                     PVAV"
     gene            <1320678..>1321493
                     /locus_tag="CYME_CMT527C"
                     /db_xref="GeneID:16997816"
     mRNA            <1320678..>1321493
                     /locus_tag="CYME_CMT527C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539425.1"
                     /db_xref="GeneID:16997816"
     CDS             1320678..1321493
                     /locus_tag="CYME_CMT527C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539482.1"
                     /db_xref="GeneID:16997816"
                     /translation="MANERKPLQPVPRPSVNGAPATATFLVLGLIGTLSIYLLGLRHW
                     DTEVFLPPGLSSVVPAVFRLFLSVFAFRYPGEAIFAWLMLYYFQTVEKQMGTRKFLPF
                     AVFVTLVQQVLQYTYGHWVRSLPLTKSGLYGVAFAALAIKVHLEPTVKHRLVGCTLSQ
                     KQMSLLMAAFLVLNDFLFDLLFNHKPDVYLFGRSKFSVSGLMAAVFGYTAGLLYLLPA
                     LGPVERWLVLPSSRNPLVVWLTLIAHQELETVPYHLQSEHMRLLEAAYNPVNW"
     gene            complement(<1322346..>1324292)
                     /locus_tag="CYME_CMT528C"
                     /db_xref="GeneID:16998084"
     mRNA            complement(<1322346..>1324292)
                     /locus_tag="CYME_CMT528C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539426.1"
                     /db_xref="GeneID:16998084"
     CDS             complement(1322346..1324292)
                     /locus_tag="CYME_CMT528C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539483.1"
                     /db_xref="GeneID:16998084"
                     /translation="MDAKAARVLPASCRVTDAADIRGLNGPIAGDDGRTRCGTLGGDA
                     SSERNPESLETRGVLLRSSEPEAFPSFQSSGETLNEKSHLRRSVSLSCLEGLPRRLCW
                     RELAVLLSSAPDINGQLRERRSGSNEFLFKRTRSEATMHATFLLDMPVHVSETFSHVL
                     LDEVAQEFGRVAVLQPAWTAGAHMMRSDALATAAVCAPSMTGRGSLPGPARVLPAHHW
                     APPQRPKMVPDGHLKRSNSIDSLRGCQHEASQAQSARREALRRFRHLLMLQKLEQHED
                     SPLSTPRETTENIPDAAVEDDEIVRHGAALSVAPDDRAEPSPAVSLRVESASPAEPAI
                     VRPQCAGRATEALAQSVDRSAASLRRERHVMGLSARDVPSAASHAKTGSSSAALVVPW
                     RKRWALLWYDQASRPTVTVRTIVRSMVYCLYESLCFWGHRDLGRTLKLALETCLDELL
                     PPGKLSCRRKVLEYLVPCGCGSYVLWYLQRRRIVAGKPALYQLPRFHWTHLRTWRSAA
                     FTVTYRMLRLAVIYRFFLKFGTPLYRLATLLALVLSFFRAEILSDLFRIRQWPRYISF
                     VQGTRTVIRSVVYAAAFSIPLERFGSAFAISRRRANIRKAIFFGTVMLSSRVRHFVRQ
                     MRRVFESKSLRGARLLATHGVSWT"
     gene            <1325293..>1327602
                     /locus_tag="CYME_CMT529C"
                     /db_xref="GeneID:16998085"
     mRNA            <1325293..>1327602
                     /locus_tag="CYME_CMT529C"
                     /product="similar to DNA repair protein Rad17-like
                     protein"
                     /transcript_id="XM_005539427.1"
                     /db_xref="GeneID:16998085"
     CDS             1325293..1327602
                     /locus_tag="CYME_CMT529C"
                     /codon_start=1
                     /product="similar to DNA repair protein Rad17-like
                     protein"
                     /protein_id="XP_005539484.1"
                     /db_xref="GeneID:16998085"
                     /translation="MNCRRQLTIRALHGDVKAETSDKRRWKRRLRRDECSMPPTASGW
                     TRGSRLDAAGVAGVGGAQPSDQDAACLLWCERFRPTCVEELAVAPKKRVEIETWLCHA
                     WETCSNSQFEAAPCAPQVALIWGPSGAGASATLDVLATQRFRATVVRWTCTDRYFDTE
                     LGSASVLESFLEFLLMVSNTPADEWRGNASFTQRSSVTHLRQQNQPGAERLGANASAG
                     HHHDRYLAVVEDFPVGIQERDHAVYSSFQSRLLALLAGLRLPLAWILPSDPHWRARQI
                     RFLFGGQAKLPDQLPPWVRHIEFLPVTERRIQTVLLQIAARLADARDADRFGRSSALE
                     QITAELARRCAGDIRRAIQWMQFCFVGQAMEPIAAPGTKPTKRGRFLENWKCLSELMQ
                     HFEGNARIGLSHMIARILYDKHQAEEWQIDDEYCIDDIGRSCNADGDIGNITLPTTAT
                     ECSMFLSALHENFVEHFVRIEDVALALADFSYADMMQRNKLDVEAVIALQVAVCGVRC
                     ANRCHAPARFRPIRLQPRRYGTHAIRPSSTLYDENVNDYRDATGLGRRAWEPAAFTMR
                     SKATQLPCWTSPANDTLESAESTALFLDPIEDADSRPSRASENTGQPLRNDCTRSATL
                     LETTHVSTICAPWSSNRRRRYSVRVINDNALPMHSVSANASRISAEAGRAPGPWSDHE
                     PAAAFAVGLASDEFGLSGEAHLPSSRRQRTSTSGTSPSPAYESSVGEDTVRRARVSEA
                     LSPDIEPRDQVLHCLLDMYEKRTDHLCAS"
     gene            complement(<1328493..>1329176)
                     /locus_tag="CYME_CMT530C"
                     /db_xref="GeneID:16998086"
     mRNA            complement(<1328493..>1329176)
                     /locus_tag="CYME_CMT530C"
                     /product="similar to phenylamine binding protein, sterol
                     isomerase"
                     /transcript_id="XM_005539428.1"
                     /db_xref="GeneID:16998086"
     CDS             complement(1328493..1329176)
                     /locus_tag="CYME_CMT530C"
                     /codon_start=1
                     /product="similar to phenylamine binding protein, sterol
                     isomerase"
                     /protein_id="XP_005539485.1"
                     /db_xref="GeneID:16998086"
                     /translation="MANVAMNKSSSSGSAPRVLKADDPLTPGEKAVIVWYLLDAITHL
                     GLELPWLILTLTVTVERSNHFMALPWKEYAKADPRWGRLHDCTAALEVPTALLWGPLA
                     LVLAYGTYRRRPWRHFWQVICATGEIYGNWMTFGPEWLTGSRELNPANSWVHKWVYLF
                     FANVLWIVIPLILLIESFGVLLDACDRSKSHRRTDMVPGRTEMLVIWSMLALYAVVVI
                     GFGFVKHLV"
     misc_feature    1329954..1331278
                     /note="possible transcribed region"
     gene            complement(<1333504..>1334208)
                     /locus_tag="CYME_CMT532C"
                     /db_xref="GeneID:16997771"
     mRNA            complement(<1333504..>1334208)
                     /locus_tag="CYME_CMT532C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539429.1"
                     /db_xref="GeneID:16997771"
     CDS             complement(1333504..1334208)
                     /locus_tag="CYME_CMT532C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539486.1"
                     /db_xref="GeneID:16997771"
                     /translation="MGCRSVPSFEALSGEPWTSRARFRRWLRTKLPRRRQAVTTEPRT
                     GGGVILFHPDYEFRQCRCAVFHLNILGVLIALGQGVYRLARALAMQAWRQPHDSLFAD
                     TGPHWFPADNCVCGHRFADHMPLHAAVDERIAFLETEYKLWDFYRIDVRHLTPPETIP
                     RLALVPPDVVTMASAVHWKRHFLHRCLPLGKDTQVEKLLLLHGTEVSGGKLRTRFVHT
                     SRRLPHTLGGAPLSRI"
     gene            <1336750..>1339122
                     /locus_tag="CYME_CMT533C"
                     /db_xref="GeneID:16997772"
     mRNA            <1336750..>1339122
                     /locus_tag="CYME_CMT533C"
                     /product="probable tyrosine aminotransferase"
                     /transcript_id="XM_005539430.1"
                     /db_xref="GeneID:16997772"
     CDS             1336750..1339122
                     /locus_tag="CYME_CMT533C"
                     /codon_start=1
                     /product="probable tyrosine aminotransferase"
                     /protein_id="XP_005539487.1"
                     /db_xref="GeneID:16997772"
                     /translation="MRRCQPVGAAFASAPSRSEALSTSSFVAYWARSGAPEPANRRRL
                     LRIRCMPDAAPFVVLRTKHWRLRHCSGRSRIEALNADVTELHQLKTPTTCSPEMPEYP
                     VDWSAADEDDAHGHLHGSRTAAQRGTKQCVGAGLETTHPASCQQRIRAQDAPCATTSP
                     RAAALVMRMIRTHLAAMLAILGIAQQRKQQHERQSIRDCVSRMSTAYAKYQAASILGF
                     AQRPPVLTTSGEHRPCCLGSCSDSILGSDAVADSTNDSLPQWLRAWRGGRSWRANLHV
                     PTTAANLQDTGKQSGLSRELVVISERLLERGLATGRSTALEIESKRRAISSLLQRYTE
                     TTDSPQGSETSTGCVPSFRMEAGITRSEQDAFDERTSRSGTARRRDDWYVPASARATR
                     TRNPIRELVQGWKRSPNPSRELIDLSIGDPTAYRNLEPPSHLLEYFEGVLRSGRYHGY
                     THSTGMEDARSAVAEHFNRRLGRKALSSRDIFLTSGVSGALELALSGLLNEGDNILVP
                     CPGFPLLRTIAENLGAFVREYPLLPEQGWKIHLSRLEALVDHRTRALVVNNPSNPCGS
                     VWDAAHITEILAVAARLRLPILSDEVYADMVFPSVSFHSFAALSREVPIVTVGGLSKQ
                     FIVPGWRLGWVVLHDPVGALDRCGYRDGLQRLTTRMLLPNALAQAVVPYALGEEALRK
                     AFLDDLMLHLASNASLFTEKLRAVPGLRCIMPQGAMYMMIQVDCSRFSSIANTMEFCQ
                     QLYDAESVLALPGECFGAEGFIRVVTFPPQRIIIEACERIKRFCTSRCEK"
     gene            complement(<1342365..>1343297)
                     /locus_tag="CYME_CMT534C"
                     /db_xref="GeneID:16997773"
     mRNA            complement(<1342365..>1343297)
                     /locus_tag="CYME_CMT534C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539431.1"
                     /db_xref="GeneID:16997773"
     CDS             complement(1342365..1343297)
                     /locus_tag="CYME_CMT534C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539488.1"
                     /db_xref="GeneID:16997773"
                     /translation="MKPTNKAQDDDAVFALSTEVNHKLDLHQSSAEALRLAGVYTRQS
                     CVLDLYHGYRSDDEDTEPDEEDGRLQTVREYHENGMLKLMRTFVRRLRRDATDPTAES
                     SYYDRVVEEKHYDPSGICRVDMHFALGQPYLYRKHYYPNNRLKSEKVFFVEDEETMRA
                     RKVGHWRTYYENGNIQSEIIYNKDGVRCGFCKRYAIDGAIEWVKDYTREQEERLQAFN
                     AKRGNLDLTVTDAARVLGLEGDWCSHVVNRTFRSKCAPLHPDWRRTAGDKAGETWEEE
                     QRTEAFIRLSRAREVLLKFLETHPRECSCERGGA"
     misc_feature    1343547..1344414
                     /note="possible transcribed region"
     gene            complement(<1345837..>1348320)
                     /locus_tag="CYME_CMT536C"
                     /db_xref="GeneID:16997733"
     mRNA            complement(<1345837..>1348320)
                     /locus_tag="CYME_CMT536C"
                     /product="similar to zinc transporter"
                     /transcript_id="XM_005539432.1"
                     /db_xref="GeneID:16997733"
     CDS             complement(1345837..1348320)
                     /locus_tag="CYME_CMT536C"
                     /codon_start=1
                     /product="similar to zinc transporter"
                     /protein_id="XP_005539489.1"
                     /db_xref="GeneID:16997733"
                     /translation="MDVQLFKLGLLFQVGRIAEACGLSALVHPADSGAVGLLFAALGL
                     VGLVGACGLAPLLVLVKRIRPQSLWVNRTGIENGAAVVMDLGEDADFGVHDLQQQQQQ
                     QHRRLLLLLQRREGAQRAAPRRFTRLLDLSNVLRFRLLYIIGVTLAASKLALCGSAVE
                     GTQLVLLCDQTGLALLRALTLCWRYRQRSILLHDAIAALVSAVVLMALMLWECFREPC
                     DYIASKATGNSTLWGDVTDKALLGIGLLYIALAHFLEQRHEQDMAGEPGEYALLLRRR
                     ERAHRRLIATTAALVLYGLFHFLFAMLPTRRVPKDYLVDHLQSRSIAQFSVFFFRLGV
                     LITADWCLAWFTRSAPGEPLEQLQTMTPVLFAALVFMLLFLFNLGLPETEASACCYEL
                     HLYWLTVPSASILSWLVQRLRQKSDATPQRLTSIAGEERNHQLPEPGENASQLSGMRT
                     IAAHRCALDPWMPNQCLDKGRDVFDSEFFREYDVETSFDAPGSRWRHHWYRFLAHVRH
                     HREARKMLFALLLNLSYASIEFVCGSWSHSLSLVSDAAHMLLDASALLLALLASYGAA
                     LPPSRRFPFGLQRMQVLAGYTNALVLSLVALNIGLEALWRLVEPLPLQVEPLLPVACI
                     GLAVNILGLWLLHDHHDHHHHHLRESCSAGAQNMGAAYLHLLADTLGSIGVIITSILV
                     RYQGLAWSDPVCSMLIASLILVTTMPCVRQCYELLAGVYAERQQRKLTAELFQHPLLS
                     DGHTVMRSLRICFVTWDRALVTLRLETDACCRPETIRSWCQHVVLERVGPRTEVFVEI
                     QRPDCGRWMHRSQAGDRTSQVRGILAVAP"
     gene            <1348874..>1350610
                     /locus_tag="CYME_CMT537C"
                     /db_xref="GeneID:16997734"
     mRNA            <1348874..>1350610
                     /locus_tag="CYME_CMT537C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539433.1"
                     /db_xref="GeneID:16997734"
     CDS             1348874..1350610
                     /locus_tag="CYME_CMT537C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539490.1"
                     /db_xref="GeneID:16997734"
                     /translation="MRQQQQRAPVSAPPRGTWAGARARKAWNDRTLVSAAFVTSSFSS
                     RRRRRRCQYYGQTEPLCLSLLRRIDCPHWEACAGCTLQDATAQARPPIFEQVATFFAE
                     TFGYQLPEPVVASSSHHWRTLAKLAVRCAPKTPHQNRVDKVRSWAPQLGLFRAGTHEV
                     VAIPECQVHHAALNKAFKCLECVLARSAVAIYDERRPRLESLRYVQLAVERRTGRVQL
                     VLVGYREPTSQPVAPSRRRTDASLLTPTWRMLCDQLWEEGKRFGSKQQLWHSIWVHMH
                     AGRGNAIFASAHEASQTETAQWQQVYGDAPFIIDEPLAGEPGPVMVLPPFAFQQANLT
                     AYRAMLPLIGFWCMQPLPSSVQRRCNVAAMTSQPQVGTVASRSMPVLRIAEFCAGVGS
                     IGLSVVRQMQQLPNAPAHIYLWASDIHPGGQVAFWETARRNGLLDERVRSALELRYQV
                     GSLTALAQRVHDPKVAASIVIADPPRAGLGPVFISEVLGKALTPSATDDAASSRLERF
                     IYVSCSMSSFMRDVRQLVSFAPNDRNRDASEPTVCWTLRHAQPYLFFPGADHLEMVAV
                     FDRQVRGRCRMS"
     gene            complement(<1350902..>1355005)
                     /locus_tag="CYME_CMT538C"
                     /db_xref="GeneID:16997735"
     mRNA            complement(<1350902..>1355005)
                     /locus_tag="CYME_CMT538C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539434.1"
                     /db_xref="GeneID:16997735"
     CDS             complement(1350902..1355005)
                     /locus_tag="CYME_CMT538C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539491.1"
                     /db_xref="GeneID:16997735"
                     /translation="MTELEQATEFSDGVPMSPPSSGCPGVELESLVHAPPDEACTQTS
                     GLTRKAATRVSVSARRTLPSVARAPWSNINCQQHDARGTLEPTTETIAERISIEKKRG
                     ARQVQVPAECVTVDACADTDANRIVSDAVRGNPQRPPSTFARESALERVLESVEAAQA
                     PTGDEAGEVVVRDGSPDVEKDQQETAAVRSDEGVQYADTPLAVNTPELTELSNASVGN
                     VENNRLRSASEIQGSSKTAAHERKAPMLESDVTDPAGNTANEYSQLSPSHAVPPACAL
                     GRTAGTGAAGIPEMSSASALTPAQTGESAATGASAACELPSTPPAADSEPSSNTCGAP
                     GSTESAHTETNSTTVTNMNAAPEQSAWRPALDTTPSSLVQQNVRFVEKPGSNGDLADP
                     VILVVSIPQNQETIKYRAKDRVAIWNREELRKISGNAAPLAKNLRKYLAKYTNCEVYC
                     GQDLDEQGRLRSFDARSGSGGLGEHVPIWNRVKKLKISGNASPLAKNLKAYLLRHPDC
                     EVYTGQDLNLGHGTGSTAVPNRAALAGMATIQQLGDKLGPAAGASGPNAASAPERGAP
                     SSGTVIQNENTDARALLLDDEASRLLLPDLAAIPQVADGLVAGITGDTAMFSNGVEYR
                     CIAAHGVSCSCGQCLEAEVELYKHLDITCSCSDCASVTDVEHALSRSDAAADVSSAES
                     DVSSSSEAEGVLFGSIEEYRPVSAETIGPTATLPAYAGDQRITITSIKTTHGLVLLIP
                     HQALRQETEATPEAFVEAVSTADLRVDVTPQAPSLGASASSAAHRRYLVVPGRHIGAA
                     LAAAAPTPGEHPGTDPVLSTAQVADQRAASSEAVTDPAANMVSVDTIIEAVGRHLAAT
                     VRDPAATPLQSAEERSAPGRDSTKISDDDTRDVSVTGVSDEHVPHVAPSTVQDALSAP
                     IGTMPASGTVSARTEPTGALERTPIPVQAGGDTAQPPDAGSVREHLDHAAVAVATAVA
                     TCEHALPSPPPRAAATWRAAQVRHGAGAATPKSLTDDDDDDRNCGADHIENASPVYRE
                     ARRRHPKRHRRESVRSEPPMLSATALTEATERVRSGRRTSCRRQQRRKRSRNLGQLAF
                     AYRHLQRMRQIDAYERELLRLSSSDESSGLWSPFRPESDDLGDGDIVIDPKWWQWTGD
                     PLEHDLGPFGNGILGDIPWMITFGDTDDGRDRHHREDEDEEDVDTGEDGILCADPCFN
                     AQGRRRRSPRRLGDKSGGRSMHTSTTEAEAAIQIEIEAKEDEEDAQGKAAAVLSRRHV
                     DRRDIHRIGCRGGRYRRGHFAAEHELLRPGREGRRSSDLMHPQRTRGAAAAAYTSGQA
                     ALSSPTRAHRKAVSAGVHTDDSMFDEMSSSSSSSSSILVRTSATVSL"
     gene            complement(<1357068..>1357634)
                     /locus_tag="CYME_CMT539C"
                     /db_xref="GeneID:16997736"
     mRNA            complement(<1357068..>1357634)
                     /locus_tag="CYME_CMT539C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539435.1"
                     /db_xref="GeneID:16997736"
     CDS             complement(1357068..1357634)
                     /locus_tag="CYME_CMT539C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539492.1"
                     /db_xref="GeneID:16997736"
                     /translation="MRFLPMIERSNARIARTRSLCVSTVPLASRQADSSAIFRALPLR
                     SLFGEKRICSFLCRSWSHQASTIPDVHHQKFPLDLFVFEWTHFVMTIDEDLPLARRAC
                     GTNTTCAPLCPCVLEASAIRPVERSLRFKIENMCSMELNHRGYRAMKSGSTFRQNRQK
                     LERNGTGQMPCCFMEAWRETSGKKPSMI"
     gene            complement(<1359381..>1360451)
                     /locus_tag="CYME_CMT540C"
                     /db_xref="GeneID:16997737"
     mRNA            complement(<1359381..>1360451)
                     /locus_tag="CYME_CMT540C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539436.1"
                     /db_xref="GeneID:16997737"
     CDS             complement(1359381..1360451)
                     /locus_tag="CYME_CMT540C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539493.1"
                     /db_xref="GeneID:16997737"
                     /translation="MEDVARRLTFSKERGRCRQVDGTSRTPGLFDSRAGEASSPKEAE
                     GSRSDEQVVVPGSFALRQSRSVATPAAAAAAAASKQAYGTPWLARGGGARTRAASSTS
                     RDVLCLSTEGNTKAAADMSRVSATDPEAWTPPLERMLEGIQSGLHMSLVDETPSYFEW
                     KQPCDPSEAGIGFQNGRNGSRANSSSRSESSFVNRAQSDDLSPVTSRIRQPQVRLPRG
                     SVPKIRNGTSSGALIQSQSLGDDQHRRRGTRFSNIALDTKIATRCASPSRVDTAYPKS
                     QAARRSTEASEELQRLRAEITRLRSESDAWRRACVANAQANTRLRQRLRHFREQLDAV
                     LRELRSHEQAPPQHAISSCDDE"
     gene            <1362199..>1363596
                     /locus_tag="CYME_CMT541C"
                     /db_xref="GeneID:16997667"
     mRNA            <1362199..>1363596
                     /locus_tag="CYME_CMT541C"
                     /product="similar to mitochondrial carrier protein
                     precursor"
                     /transcript_id="XM_005539437.1"
                     /db_xref="GeneID:16997667"
     CDS             1362199..1363596
                     /locus_tag="CYME_CMT541C"
                     /codon_start=1
                     /product="similar to mitochondrial carrier protein
                     precursor"
                     /protein_id="XP_005539494.1"
                     /db_xref="GeneID:16997667"
                     /translation="MLIFLTPVECIYERPAPTYRNKAFTTPEVRVPHRERLHRVRRRA
                     LTPVRVPGVVAIASDANEGSTPSDEPWWRERARLVVSRQSQATGDAPTSRRRFLQALV
                     LALVGFVAGSLGKSASSGKAGTQAQAVTLAPTPINPYARRRQKKQYEKYLEIQKALIE
                     RNRLRRKYSRKPPIDTDALPYSLSALSAFVASAISTFIVHPIDTIKTRLQMRGASCPL
                     PPNQLYRGVVSNVWKEAPNAAIYLGVYEAFKDIFLRTPVLGSYPMLCFLLAGGLGDAI
                     GSVVRVPAEILNKRLQLGLSATLSDAWREVFCDPNNREVVKVTWMAVLARDVPYGALQ
                     IAFYEQLKILVLVHHAMGAQSAKGLFLDALLGAIAGCAAAFLTTPADVIVTRLASQYP
                     QSYIDTRRFMGVLGTARRIVEMDGWRGFFSGSLQRAAYYAPLIGLFFFLYETCRYVAL
                     HPETVSQLVTSYLPL"
     gene            <1364006..>1364656
                     /locus_tag="CYME_CMT542C"
                     /db_xref="GeneID:16997668"
     mRNA            <1364006..>1364656
                     /locus_tag="CYME_CMT542C"
                     /product="similar to phosphoserine phosphatase"
                     /transcript_id="XM_005539438.1"
                     /db_xref="GeneID:16997668"
     CDS             1364006..1364656
                     /locus_tag="CYME_CMT542C"
                     /codon_start=1
                     /product="similar to phosphoserine phosphatase"
                     /protein_id="XP_005539495.1"
                     /db_xref="GeneID:16997668"
                     /translation="MVVFDLSWTLVQADSFELLCQAAAVDADAVAEVRRCHSLGSDDD
                     LRACAALLRGRSSTGLAERLHALIEYTDGAASVCRVLKKLGYRTTVLSPGRSFLRELV
                     KADLGIDFVAANRHEMDSNEHFTGAILELLVNGERKAELLTMLAMREQLSPQQIIAVG
                     DGPVSAKMLDSAGPSIAFGAPAARDGTNIGGKIQSKSLTCIWFLMGIHERDLRSFS"
     gene            <1365008..>1366372
                     /locus_tag="CYME_CMT543C"
                     /db_xref="GeneID:16997669"
     mRNA            <1365008..>1366372
                     /locus_tag="CYME_CMT543C"
                     /product="similar to rRNA methylase"
                     /transcript_id="XM_005539439.1"
                     /db_xref="GeneID:16997669"
     CDS             1365008..1366372
                     /locus_tag="CYME_CMT543C"
                     /codon_start=1
                     /product="similar to rRNA methylase"
                     /protein_id="XP_005539496.1"
                     /db_xref="GeneID:16997669"
                     /translation="MRCLCWTNALDPLYRLAGRQALRLRGHQSWWRYQHCMLHQRAQA
                     CTGAERSAQWSLIRSAQNAKLKLLRQILRKGSLVLDSPSASSSLGSSAPDRRFLQLVK
                     ERESENSYTAALAERCLRPQLFVVEGARLLQDALDVHWAPEFIICSADAVQGLWRRHP
                     QLMGKISTDGLLQQRTFVCETELPTETVHSQGIVGVFQRKWLPWDQQRTLVLFLDGVQ
                     DPGNLGTILRSACAAGCRTLLLSDQCVDAWSSKVVRAGMGAHFRQCIVDKVSLEHLEC
                     LLDLLVMVPGTDAPCCASREAHSAAEVKEAGLKPPASDRGHNLSRIHHHGQRYRFVIA
                     HPKKVPGLAHFSYDDDAIWLRASNLDAKKTRATGTAGKIPPHRDIRTPTLDILVIGNE
                     AHGPSAAIFDFAQSVTGSCTVAIPLDSGVESLNAAAAASILLFEARRQRQKFEESTGA
                     AETL"
     gene            <1367124..>1367483
                     /locus_tag="CYME_CMT544C"
                     /db_xref="GeneID:16997670"
     mRNA            <1367124..>1367483
                     /locus_tag="CYME_CMT544C"
                     /product="mitochondrial ribosomal protein S16, precursor"
                     /transcript_id="XM_005539440.1"
                     /db_xref="GeneID:16997670"
     CDS             1367124..1367483
                     /locus_tag="CYME_CMT544C"
                     /codon_start=1
                     /product="mitochondrial ribosomal protein S16, precursor"
                     /protein_id="XP_005539497.1"
                     /db_xref="GeneID:16997670"
                     /translation="MSPVRIRLARHGRRHAAVFRIVVADSRAPRDGRFLEHVGTYNPR
                     VIRGAKLVQFDVKRTQYWLSVGAQPSERVAKLLGLAGVLPPAPVRGRTAAPSAAAPQN
                     LGAVRGLESLVPTFAVS"
     gene            complement(<1368469..>1368762)
                     /locus_tag="CYME_CMT545C"
                     /db_xref="GeneID:16997679"
     mRNA            complement(<1368469..>1368762)
                     /locus_tag="CYME_CMT545C"
                     /product="similar to U6 snRNA-associated Sm-like protein"
                     /transcript_id="XM_005539441.1"
                     /db_xref="GeneID:16997679"
     CDS             complement(1368469..1368762)
                     /locus_tag="CYME_CMT545C"
                     /codon_start=1
                     /product="similar to U6 snRNA-associated Sm-like protein"
                     /protein_id="XP_005539498.1"
                     /db_xref="GeneID:16997679"
                     /translation="MLPVGLVRGAVGQQVTVELKNGKHCTGVLTGVDPWMNLNLESAR
                     VTGASRAATTDSVEQAASYAALHIRGTMIKLVQLPSKSWEYAQDERKPRQLRE"
     gene            <1369268..>1370917
                     /locus_tag="CYME_CMT546C"
                     /db_xref="GeneID:16997680"
     mRNA            <1369268..>1370917
                     /locus_tag="CYME_CMT546C"
                     /product="unknown zinc finger protein"
                     /transcript_id="XM_005539442.1"
                     /db_xref="GeneID:16997680"
     CDS             1369268..1370917
                     /locus_tag="CYME_CMT546C"
                     /codon_start=1
                     /product="unknown zinc finger protein"
                     /protein_id="XP_005539499.1"
                     /db_xref="GeneID:16997680"
                     /translation="MQLDNGSIATSLVHVATPAAEHVYCVACQWSPADGVAASDANNG
                     HSAPSKALSPEALLEKRRQHYRSDWHRVNLKRRTAQLPPLSEAEFTERCRNWESGGET
                     VQMDFGGLEDENTSSSEEPWSSYSVKVPVGSALPEDALFSAARFARSSAVNGERQPSS
                     RRVACIWCLKEFSSEKALQQHERTARHREKLRELGIPESDEQHQHQKQQQQQQQLISG
                     ASKETSLETADLDAWLAERMQEARPLDIHECLFCNHKVAVDENVSEQERSGALLANLR
                     HMAKEHSFFVPYIEYCYDLAGLVRYLGVKVGLGYCCVFGGRVVPLSQDTTDSAEQLFE
                     RRAEVFSSLQACRNHMRDAGHCRLPDFDQEEVWDEYQEFYSFTPVRADALLSSAADAS
                     EALSPGTPHEAAGEAESVALAPWEKWVSVAEAPRSTHPPDEEVVGLQLGASGRTIAHR
                     SLWRYYRQRVHDHHRTQLPVCIARQERQQMVLAYQELAHTAAIGFTGPAASQPYPSIP
                     PRRVLERWRRDQLALAERNAATRRGRAARSSIAVLNSGYRG"
     gene            <1375765..>1380483
                     /locus_tag="CYME_CMT547C"
                     /db_xref="GeneID:16997681"
     mRNA            <1375765..>1380483
                     /locus_tag="CYME_CMT547C"
                     /product="starch associated protein R1"
                     /transcript_id="XM_005539443.1"
                     /db_xref="GeneID:16997681"
     CDS             1375765..1380483
                     /locus_tag="CYME_CMT547C"
                     /codon_start=1
                     /product="starch associated protein R1"
                     /protein_id="XP_005539500.1"
                     /db_xref="GeneID:16997681"
                     /translation="MSDQPSVSVKVPLYEKIYQLDGFIGDEERNALQLPEGVDEAGLF
                     VTVYVSRESTYPGDAPAGGATPHENTGDPSVAREDIVDWRKARIVCRFLLVLLSREEV
                     RHLDQLGASVPKSLKERIAERNRFEWSRILQNRPTYLHWGVARDHPDEWTLPEAKTFP
                     PGTIRFDKIAVRTEFPAEHPRIRINVPFFESGNELRTIRGIKAVVYRAKDHKYFKDGR
                     RDIFVPVWDSVRTWVIDGAGIEENVAELSLTESAFRTALGVSRSDSYMSLSRETSPGP
                     DASGSGRSAVRRSISLSSVRKLKSSASLDRLVKAGAPQDRSLKAVRRIHTAATVLFEE
                     LFGGVGRGGSGHLDVVVEEMEPQSEYHIHMATDISGLALHWGVSRKKPGQWVLPRRDW
                     WPAGVTSQVDHKAVRSEFEADQDNPGVWRLDMCFRRESEDDIANGESWLPSALVFVLY
                     QAEYNFWSNYHNDNFVVPVAPPAPSVLEDVYASYLHTLQEQEKMLGDRAQGEEPETLP
                     VGTILGLERRSLDDDGETVICFSVEEDGFALRVHADLSPLVIHWGIARHRVTEFLQPD
                     ESLAVETKGRTYRFENKAMRTEFVPDEHHQGTYYAEIHLKKEHAPRAVTFVLFNPELN
                     RWYRAEGGGNFVLRMDLESFSQLPGSVGKHEDVAQKIIEVEVEYGSWTLMHRYNLAND
                     ILRNSMSALDADLLQIVFVWLRYSFLRQLDWQRSYNTQPRLLAHAQEQLTTTLAQVFV
                     SRPDLRLWVRLCLSMLGRGGGNGQRIRDDILRIMHKHHIPETPGHFMEQWHQKLHNNT
                     TPDDVAICESYLAFLRSNGDKNVFYETLQKHGVTKERLASYERPIFAEVQTYPCDTNS
                     LIHDFEEYLHVLKSVHSGTDLAVVLDYARWTLDQELISKVEHIQSVRAELMASPQGAL
                     EFSFLIAEARKMLQSTLEHVEDPTRVRDMLFLDLALDELARLAVESQGLADYVAETDV
                     QKACNLLVVLAQHVGWSMLSSAFLETSYDLAALVYGIQSDVQLQEPDFGLRLYATMER
                     LMDCVGHDVVERLHHDVQPKAVYIGVGCNIDQKVVTLFSEELIRGQAAFALAQVLRPL
                     MRNIRKQANLGNWQVISPGSCTGQGAVFDELLSIQYKTFAEPTVAFVRRISGEEEIPT
                     GMVGLITTDTLDILSHCAVRARNEHVVLACCFSEELFDQLTERFRGAWVAVRSLTDGS
                     LDFQPIQEGAGRTTAADTTDGASEHAQRRAVSMRSDIEKKPVKSVLGIAQFNTQRGGS
                     KSNSLAKLIRVIPDWIHIPPCALLPFGVCEQVLAEAQNSDVGERFQQLMAELDGKGPT
                     DDCSALLARLRHCVRQLAPSDTFMKELQQVLQHEGFHSIDNLDMRRAWECILDVWASK
                     FNDRAFLALRKAGAVGKTSLSSLYMAVLVQEVVPADYAFVLHTKNPFTGEPSEIYGEL
                     VHGLGEVLVGNYPGRALGFTYSKSTGQVRVCNYPSKTKALIPRGGLIFRSDSNGEDLE
                     DFAGAGLFDSILMQPAEEVVVRYRELKILQDKAYLERILSKIGKCGIEIESNCGNKPQ
                     DIEGCICGEDVYVVQSRDQV"
     gene            complement(<1385476..>1388313)
                     /locus_tag="CYME_CMT548C"
                     /db_xref="GeneID:16997682"
     mRNA            complement(<1385476..>1388313)
                     /locus_tag="CYME_CMT548C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539444.1"
                     /db_xref="GeneID:16997682"
     CDS             complement(1385476..1388313)
                     /locus_tag="CYME_CMT548C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539501.1"
                     /db_xref="GeneID:16997682"
                     /translation="MTDEECRICREPGELHRPLRSPCKCAGSVRYVHEDCLHVWLRTT
                     GYSHCELCGTAYRFEPVYRADAPTTLRLADLFWGLSDLVASGYARLARASLVAAAWLL
                     VVPYATWIIWYAGFSKSWTDLEQIKNVGNLSTIVTRLSLGLVLCILIFLACLGLNAIQ
                     EHGREESRRTLQSLTNRRVGQTGYARRVPHPLHRRRSLWARQGIAVPAAGTQFPLTEE
                     RSLGSMAGIEDDAGGSEESDDSWPSSMTSTPAGEGRTAPSAAPSPQETQWTTEPNAPG
                     LFSFLEHDSGEDLTLSEVLGLKGPLVNLLTNVIIVVISNAVVIDVFAVSPLLLGRFVL
                     SLVFRLKGPVLKCLTLPLVHWVRLIADDDVPRSLLDTGAAVSASSRNVPSIYSICIGY
                     VVFLGLILSCIRLLERVHVRGGTARWQRFRNTLWILTFVQVTARAILVMMLEFIMLPL
                     VFGMAVDLFAFPSGLGTVEVRFRSILETDTRNVLIHWTIGILYISGLSVLIGILREVL
                     HPRLLRFLRDPNDPDFDPLREIVTRPLRFHLRRLGFSTALYVPVIGLTVYAPTQMVLW
                     FSPNVFPLRLVSGLGSGWDIALCATVIGLFLSGLTRLAPLRSITQEVVAFWTHHSSRL
                     LGLQHLVMRPTPQRTESPTPADVTSVPEPQVPAFSSRGSLLPVRIVLFAVLWFVFMSC
                     SIALVLAIPLVIGRAVSTYLHVLAGDTLAEINDLMLYVLSLTCIGIIATAARTVYQTY
                     QRGDLLALSVSVAEHMTQFLAIAGASVIWLVLLPYLLGCIMERNFALLATVPSSDVSF
                     ARWVQTWLRGFLPQRVLWPALFRPRGTSPSEHPALADCILPERLIFRRGAAPVLVFTN
                     LLRICIFTACIAMLPLLFQALPGHESTQSGIFVLLHIAYIMLQLGVLAVFGRDRFCDL
                     YRFLIEQIRNKRYLVAMRLLDYSERYHFHEG"
     gene            complement(<1391078..>1391788)
                     /locus_tag="CYME_CMT549C"
                     /db_xref="GeneID:16997654"
     mRNA            complement(<1391078..>1391788)
                     /locus_tag="CYME_CMT549C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539445.1"
                     /db_xref="GeneID:16997654"
     CDS             complement(1391078..1391788)
                     /locus_tag="CYME_CMT549C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539502.1"
                     /db_xref="GeneID:16997654"
                     /translation="MGRRRRDLPSKESRRANRAGPAARQFNRLLAPLGMRLLPVPGDG
                     NCFFRACAVQFQILGRNHAPRDICDHMKLRQRVCDYLCENRKVYAPYLEAEALGTGCN
                     AVVDFDGYVKKMRVDGVWAGHLEVHALSAMLESEMIIYLLDAPSYRIRHSDGPVQRVL
                     RLAYYENQHYDAVLPTDIQHPGASTDMATSHVPSSSRIRDARSRKSRRGSARSPGMRS
                     LPSMPSSSHETDLRLVEL"
     gene            complement(<1392672..>1393769)
                     /locus_tag="CYME_CMT550C"
                     /db_xref="GeneID:16997655"
     mRNA            complement(<1392672..>1393769)
                     /locus_tag="CYME_CMT550C"
                     /product="unknown homeobox protein"
                     /transcript_id="XM_005539446.1"
                     /db_xref="GeneID:16997655"
     CDS             complement(1392672..1393769)
                     /locus_tag="CYME_CMT550C"
                     /codon_start=1
                     /product="unknown homeobox protein"
                     /protein_id="XP_005539503.1"
                     /db_xref="GeneID:16997655"
                     /translation="MSSDGNRGLPETRTVVVGSPGLQIGAFTTQDMNLDYQNRLRETR
                     LPGRFDQSFKGLEMIATAAVAVAQTPQSMEIAEPACQWDKPDPVSPRDTHGAIGGRGA
                     DTAHDEYRHFEPERKSSRQSRPKPFTSTKKGARIFTPEQQQVLKAVYAENQYPSRDDI
                     QRLARAFQQPEAKLTTWFNNRRARVRRSQRNQRVSPSTRRYGSEQSATALSSQSMERC
                     ASECVTSATGHQTVPLARKSSRRESIFDTESTALAAHAPWVHSPSQSLMNPSGRLDAL
                     NAPSLSVCGDGSCKRQMVSQFEAGESCRTPAVSRERRTLTSMDYLECATLRGIEKFEN
                     GSGRALKSDEDFSPTTLATADTPGKWPTCRR"
     gene            complement(<1394675..>1395241)
                     /locus_tag="CYME_CMT551C"
                     /db_xref="GeneID:16997656"
     mRNA            complement(<1394675..>1395241)
                     /locus_tag="CYME_CMT551C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539447.1"
                     /db_xref="GeneID:16997656"
     CDS             complement(1394675..1395241)
                     /locus_tag="CYME_CMT551C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539504.1"
                     /db_xref="GeneID:16997656"
                     /translation="MSTTAMALPVPFLQARRNQSAHFSVFALLFAETISYFQNRVDSI
                     AELEERLLDLGQQIGRRVLELVWLREKFTRREIDVLGALRFTTTTVWRFLFGKFADSL
                     ERVKDKENEYIIVDNTMLFARFISVPTELEGLNCNALIAGIVQGVLTASGFPCRVDAH
                     QAPPADASEYVSRSLFSIRFLPESNHTF"
     gene            <1395511..>1395792
                     /locus_tag="CYME_CMT552C"
                     /db_xref="GeneID:16997657"
     mRNA            <1395511..>1395792
                     /locus_tag="CYME_CMT552C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539448.1"
                     /db_xref="GeneID:16997657"
     CDS             1395511..1395792
                     /locus_tag="CYME_CMT552C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539505.1"
                     /db_xref="GeneID:16997657"
                     /translation="MVLSTEEASKQVSTPYPPIDPNPSFTRVLLNFKPKEYAVVVASA
                     AGSAFFGYLAGHPVRVPSTYCATAIGTLGGFCYSFRASLGRLLGFEPNN"
     gene            complement(<1396018..>1398948)
                     /locus_tag="CYME_CMT553C"
                     /db_xref="GeneID:16997641"
     mRNA            complement(<1396018..>1398948)
                     /locus_tag="CYME_CMT553C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539449.1"
                     /db_xref="GeneID:16997641"
     CDS             complement(1396018..1398948)
                     /locus_tag="CYME_CMT553C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539506.1"
                     /db_xref="GeneID:16997641"
                     /translation="MNSELDQRDAAFSRDEFSLLLAEPALKSLEQCCTDSELREWLSL
                     LVTHYRTTECPEPRFLDDTLETLRRCIANAVEENREAQLPEGDIYDSAGETAGPLALE
                     LLLSSLDLIAKSVLKNAALEMPRDHGTSEASDRSAASKAAGKHASAVRSTASTALRLL
                     SGFFSADDSSVGPATSDAPSESALHVLLHKLPCLLQLVADAYRANPVLYRRCKSFVNS
                     FLAEHLTAYSCALCIASADISEGNVLPTSASLGFLESIIKLSTGSDTVPPAVLCACIS
                     KLTTAIALEQAQQGQASSRNAGASQSILTDPSLSTLPRAGLALSEVASGKASNAPMAN
                     SKALAAEHRQSALQSREQRRVLAVFLAGVSAENLKRLQNLHGHALTVLQLWIDHIKPS
                     DLAADEMLSAFSMLMDATIRYYREPVCPLLLLQAVQSFVHRCSSERAKYPLTFLDRIR
                     AAIETVIGIAGEDWQPLGARDPQQTQHERSVRLAFSSLGLEFLTAYAIPLVEAVFRED
                     KTMRRKLISAISDVALRILKAPSPEDPENTPPAIVRELTAALDPRLHSLGRGLDAMAY
                     DCDIQIYADVAAGWRPCFEGDLQVAYKTRAALLIYKLLEPSMLDDFENEVTESSESGG
                     RSQWRVKDLQERLVSAFEDIAFFRFKNRMMLLLLGQSLGAIFRHSDSLQIALIGESST
                     RNQSQSVTTAALFQARDVSADEARSLRRIAFILFHSRVGEFTSQSRSLLRRIESDWRK
                     NDAKVSAACFLLLRVMLLRFPPEHLLGSRATLLSETLRILRGATGEPIAALGAIKFVD
                     QLLLLNMPEFSYALPMFLAIEPYADGFAPEPLLSRGIFAENEPFRKPAQSIGTLLPPY
                     AVGQSAKRQGKPILVELAAGVEDFGDALPPEAGRPIRIDPQRFQRSRQNHLSVSAKET
                     PQSSRSVSPTEALRALRSYARALCERSSNKSLAYAVPCMMEIEHWIESEFLTIHELWK
                     EILA"
     misc_feature    complement(1400231..1402012)
                     /note="possible transcribed region"
     misc_feature    1401371..1405484
                     /note="pseudo-gene of triacylglycerol lipase"
     misc_feature    complement(1406896..1407805)
                     /note="repetitive element"
     misc_feature    1407811..1408945
                     /note="repetitive element"
     gene            complement(<1408975..>1410636)
                     /locus_tag="CYME_CMT558C"
                     /db_xref="GeneID:16997644"
     mRNA            complement(<1408975..>1410636)
                     /locus_tag="CYME_CMT558C"
                     /product="chaperonin containing TCP1, subunit 7"
                     /transcript_id="XM_005539450.1"
                     /db_xref="GeneID:16997644"
     CDS             complement(1408975..1410636)
                     /locus_tag="CYME_CMT558C"
                     /codon_start=1
                     /product="chaperonin containing TCP1, subunit 7"
                     /protein_id="XP_005539507.1"
                     /db_xref="GeneID:16997644"
                     /translation="MAQVSGYPPIIILKDDVDASQGIGQIISNINACEQVVEVLHSTL
                     GPRGMDKLIQGSDGKVTISNDGATILRVLEVVHPAARLLADIAKSQDEEVGDGTTSVV
                     LLAGELLRQAKGFLEDGVHPRVIIYAYREAHRMISERLKQIAVDVSGQLKVLRADPER
                     VSTEEREAARALLQRCAGTALNSKLIAQYREFFAGIAVDAVLALDDDLDLDMIGVKKV
                     NGGSVTDSCLVAGVGFKKTFSYAGFEQQPKKIHQPKILLLNLELELKSEKENAEVRVQ
                     SAAAYQQIVDAEWNIIYEKLEKIVATGARVVLSRLAIGDLATQYFADRGVFCAGRVPD
                     ADLQRVARAVGARVQTTVHDMRVEEALGTCEWFEERQVGAERFNFFTGCKEARSATIL
                     LRGGSEQFLDETERSLHDAIMIVRRTLKYPELVAGGGAVEMELSKFLRERSRHIQGKA
                     QLLLAAYGKALETIPRTLCENAGFDATDLLNKLRAKHATSDENLWFGANLETGEPQDC
                     WQNYVWEPVLIRANAFASATEAACTILSIDETLKTETSDKNDAIR"
     gene            <1411644..>1412678
                     /locus_tag="CYME_CMT559C"
                     /db_xref="GeneID:16997645"
     mRNA            <1411644..>1412678
                     /locus_tag="CYME_CMT559C"
                     /product="similar to SWI/SNF related, matrix associated,
                     actin dependent regulator of chromatin, subfamily b"
                     /transcript_id="XM_005539451.1"
                     /db_xref="GeneID:16997645"
     CDS             1411644..1412678
                     /locus_tag="CYME_CMT559C"
                     /codon_start=1
                     /product="similar to SWI/SNF related, matrix associated,
                     actin dependent regulator of chromatin, subfamily b"
                     /protein_id="XP_005539508.1"
                     /db_xref="GeneID:16997645"
                     /translation="MVQSVNLDTGQAEEFELKQGQCGAAQEPLIPIRIDVQWNDARVV
                     DAFLWNQYEERLTPETFAPHLLRDLQQPMELANGVASAIREQIEQYSPFEHELFADRS
                     ELRLLFTLDVRIGNIQLQDTFEWDALSFESDPEQFSRMLCRELGLGTEFSTAIAHAIR
                     EQLQDVWAGVAYSQKSILESVHPRITIRDGEDWELPGPAVRVLSKEELEEVERREDRS
                     ARAMRRSQRKSGLSWGLAPAPTLRERSVDSTVFFGPRQAVAEERPKRRRNQNPVDSEG
                     RPVVACSHCGRHPSKTPLMRVGPRGLKNEICNSCGLYYRKYGELPTHYKGYPIGPGYP
                     PPPGSQEHDA"
     gene            complement(<1413951..>1415390)
                     /locus_tag="CYME_CMT560C"
                     /db_xref="GeneID:16997729"
     mRNA            complement(<1413951..>1415390)
                     /locus_tag="CYME_CMT560C"
                     /product="probable delta(24)-sterol C-methyltransferase"
                     /transcript_id="XM_005539452.1"
                     /db_xref="GeneID:16997729"
     CDS             complement(1413951..1415390)
                     /locus_tag="CYME_CMT560C"
                     /codon_start=1
                     /product="probable delta(24)-sterol C-methyltransferase"
                     /protein_id="XP_005539509.1"
                     /db_xref="GeneID:16997729"
                     /translation="MHQLAFAHAWAVPKSHAPGKRGGLLRFTDDRLSRFATHRLRCWN
                     HRRITRLAGYAQRRSSCVSAVEYGAPLLQTELVAQSVLSTANRASVRVPATERTINER
                     LSWNTLSTWTQNARERLRVHPGRALSIAAITILAIATLYRFIMARRRTEYLLKRKALG
                     LDTTPAAAGPQWRLPGDETKATESAGLAQRIATFYDLQSELWEQVWGEHMHHGFYNVD
                     GTRDGKDDRQAQIDMMDRLLHYSGVDASIRSAIGAGHRRLRVLDVGCGIGGASRYIAL
                     RYGADVHVTGVTLSPVQASRAQVLTRQLRLEDRVETVVADALALPFPDNAFDVIWSME
                     SAEHMPNKFRFMEECARVLRPGGILAMTAWCHRRCPPPFTDADRRIYRKVCAYYCIPF
                     LCTLDEFENYAWQCGLVDIETADWTRATLPFWPAVARSALQRKALLGLVEGGWPVIRS
                     ALAIRWMIRGFRRNLFVIGALRAVKPAPR"
     gene            <1417469..>1420024
                     /locus_tag="CYME_CMT561C"
                     /db_xref="GeneID:16997730"
     mRNA            <1417469..>1420024
                     /locus_tag="CYME_CMT561C"
                     /product="aconitate hydratase"
                     /transcript_id="XM_005539453.1"
                     /db_xref="GeneID:16997730"
     CDS             1417469..1420024
                     /locus_tag="CYME_CMT561C"
                     /codon_start=1
                     /product="aconitate hydratase"
                     /protein_id="XP_005539510.1"
                     /db_xref="GeneID:16997730"
                     /translation="MPLAALGQRAALFATSATTTRSLLGRLRESGPQDHRFVSTSTRL
                     VHQSSQTFGARRATLQQLALFKAVGTGGSYGVPGGKQTLKRQLHASTPMAKVPLSRYE
                     PDTSLEEVYERIRQNVAVVRKRLDRPLTLAEKILYGHLSNPETAELVRGKSYLHLHPD
                     RVAMQDATAQMATLQFMSAGISRTQAPTTIHCDHLITAQSGAKEDLERAVQQNREVYD
                     FLSTAAAKYGMGFWKPGSGIIHQIILENYAFPGGLMIGTDSHTPNAGGLGMAAIGVGG
                     ADAVDVMVGLPWELKAPRVIGVRLTGKLHDWTAPKDVILKVAGILTVKGGTGSIIEYF
                     GPGVDSISCTGMGTICNMGAEIGATTSIFPYSKRMEAYLKATRRDAIAELANKYVDLL
                     RADENAVYDRLIEINLSELEPHVNGPFTPDLAHPLSKLKDAVKQNDWPAEIRVSLIGS
                     CTNSSYEDMMRAASVCKQAIDHGVKAKTIFHITPGSEQVRSTIERDGMIQLFEAIGGV
                     VLANACGPCIGQWNRQDVPKGVKNTIITSYNRNFAQRNDGNPLTHAFMASPEIVTAFA
                     LSGRLDFNPVTDVLTDQSGKPFKLQSPSGDELPARGFDPGRDTFQAPPGDGSSVAVRI
                     DPQSERLQQLEAFPAWNGKDIERAFILLKVKGKCTTDHISMAGPWLKYRGHLDNISNN
                     LFIGAINAENGKANLVKNQLNGEYGPVPATARAYKQAGIPWVVVGDENYGEGSSREHA
                     ALEPRYLGGVAIIAKSFARIHETNLKKQGMLPLTFQDPADYDKIDPSDRVSILGLTKF
                     RPDEPLTLRVEKADGSQLELKVNHSFNEAQIEWFRHGSALNKIRADLVAAGKA"
     gene            complement(<1420898..>1423450)
                     /locus_tag="CYME_CMT562C"
                     /db_xref="GeneID:16997731"
     mRNA            complement(<1420898..>1423450)
                     /locus_tag="CYME_CMT562C"
                     /product="probable telomerase regulation-associated
                     protein"
                     /transcript_id="XM_005539454.1"
                     /db_xref="GeneID:16997731"
     CDS             complement(1420898..1423450)
                     /locus_tag="CYME_CMT562C"
                     /codon_start=1
                     /product="probable telomerase regulation-associated
                     protein"
                     /protein_id="XP_005539511.1"
                     /db_xref="GeneID:16997731"
                     /translation="MQTLLKLIGKESRDLPYRVTRTIPLDDPAQVWTVHDAVSTRDEN
                     APPVTLFRFERRRHHGSRADVCEHLARAGVQRLRTVRHPDILRFVDSSELSAGAAQSE
                     SLQLVTEAVVPLQFVLRSDPISLTAETIVWGLFCIARALHFIHTEMKSVHGRLSPATV
                     FVTAGGDWKLGGLEVLTESAQWQRLSEARHFQFANYWPPELHTPVPPATAIPTHALDA
                     WAFGCLMYELFSGGQYQTVDDLRRIQVIPEKLRSVYSLFLAADSAKRAALQSFLTQEH
                     ILQMPFVRLNLALDRLQLSEHWEKRSTMESLLESLDKLPPSFCVYKAAPLLQQAIDLG
                     VADPAAIRVVLRIHRRFENRQGPETRAFMEAVARWLRASPIDVRNEVAQALDWLVERA
                     DTSQLNEILFPAMVANLPRQITIQTGTASTTSQSTSDPRAGSPSAMEQVVPLALRDMV
                     LKTIARIAPRLSERNRNHVLMNHFAKLQLDPEPAIRTNTTICLGKIATLLSATTQKKV
                     LVAAFTRAMRDSFPPARAAGIAALEATADLYARDDMVSRILPALCQGLGDKVADVREQ
                     AFRVTDAYLRRLRTMHEQEKEREDRERVAEIQPGTSTASALGARAAASKSDRAGSWHF
                     ASLAASLVDVFDATKQEHAAGTSLNRASQANHAEADRRSAVAGAALKPSALNAEDNAL
                     LSITRETQASSATPMSARDRGTRPEAPPNAARLSAEQFAAPIASPSADTHRPAALSST
                     AVHASMSSLSRSTRAPSASLWEAALAEECMRTAEAARCRDAPAAMRTRSNAGAPAAAA
                     AAGGAAVQQPQGPATEPLASVPDANDWALVLNSADARRRRAVKLGAMRRSTS"
     gene            <1426243..>1427127
                     /locus_tag="CYME_CMT563C"
                     /db_xref="GeneID:16997732"
     mRNA            <1426243..>1427127
                     /locus_tag="CYME_CMT563C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539455.1"
                     /db_xref="GeneID:16997732"
     CDS             1426243..1427127
                     /locus_tag="CYME_CMT563C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539512.1"
                     /db_xref="GeneID:16997732"
                     /translation="MYGETAAPTFTSLQAGVFSQKQKRSILLDNKLIHQAMKLMRWFR
                     SADLRYEIGERLVTRHPSTQRVPVALSHADRRRAPSLCALTSASTSASSVHSSLLRYV
                     QRDLEGRPLGRVLSNTGAIRGFSATSAGDATLETAPLDELRRGLGAPDLQLEDSLDTG
                     DGRPAKRDASFTVRLLQYLVQRYRGRVHPNPLAVAQSATVRDLLYLFAKLDRDLAVRE
                     GRDTAAWRAWRLQRFFGVSSMDEIPPNVTIDARLLPDAPSPGSVPYNRRKIRERLRRV
                     LESARASTSPQNEHEPGA"
     gene            complement(<1427767..>1429278)
                     /locus_tag="CYME_CMT564C"
                     /db_xref="GeneID:16997712"
     mRNA            complement(<1427767..>1429278)
                     /locus_tag="CYME_CMT564C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539456.1"
                     /db_xref="GeneID:16997712"
     CDS             complement(1427767..1429278)
                     /locus_tag="CYME_CMT564C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539513.1"
                     /db_xref="GeneID:16997712"
                     /translation="MLTPEDSAVLRRLANMTNDECVPEKHLDSEDRIVQRQLEFSLLT
                     PERREREHKNLKETRGTRAPGNQCTLSNTRTEIESSSNARNHGKRHTSRTGRAVLREL
                     QNQPSELAPAGKPATPGGTACFATPSRPGTKSRKASARNQQSRRRPVRAPGQGTTKEA
                     VVVADKSRWSRARTLEEQGSPGDFRSLIEESPRHILRRPFEPSHPHWEILRLREALEK
                     EKERAQAQEAYAASERAERCATEMAYHRLFQECNSLRQNVNHLEQALQILQVDLQEGL
                     NDLVRCPESYRTTIEHRLREMMDTVQVAIYALRNQTAYVRQPLAASQGMRSSRTRNDV
                     TSPDHAPLVSSPHDSEPWHVWWPAQQLSPPRAAAHLDPREESSPDASKLRSSGSPCAA
                     QVSRQAVKADERSVLSTAQAHVHMEPVDPCTSRVPSNRPHAAAGAKREGAPLVMPPPN
                     QVASPESSCDGMPAPELLLFGNVQSTAAPQTKESGSKSDTHNIHGLLVHLDAS"
     gene            complement(<1429878..>1431101)
                     /locus_tag="CYME_CMT565C"
                     /db_xref="GeneID:16997713"
     mRNA            complement(<1429878..>1431101)
                     /locus_tag="CYME_CMT565C"
                     /product="DNA recombination protein DMC1"
                     /transcript_id="XM_005539457.1"
                     /db_xref="GeneID:16997713"
     CDS             complement(1429878..1431101)
                     /locus_tag="CYME_CMT565C"
                     /codon_start=1
                     /product="DNA recombination protein DMC1"
                     /protein_id="XP_005539514.1"
                     /db_xref="GeneID:16997713"
                     /translation="MRACVYMCAYVYTCLHIHACSSTERSSCTHAPTCIMEEHPIILM
                     TRCIAIFIVRRTCWRCLATVRGQHQHRGMSRSSVVERARSKTTEVFHPIEELEQQGVL
                     ATDVKKLREAGIVTCLGVLQRPRRLLLDIKGLSEAKVDKIMAAARTAAGDVSYRSGTE
                     CLAVRQRVFHLRTGSDALDTLLGGGLESASITEVYGEYRCGKTQLCHTLAVTAQAADE
                     SHAGRVVYIDTEGNFRPERIRAIATRFSIDADDVLENIAHARAYTTDQQLELLREAAA
                     LMCESRFALVIVDSATALYRVDYSGRGELSARQQHLNQFMSTLGKLAEEFNVCALVTN
                     QVQACPDGAAAMFSSNPLKPIGGHIMAHASTTRLALRKGRGEQRIAKLVDSPCLPEGE
                     ATFEINAGGIADAAD"
     gene            complement(<1431975..>1436309)
                     /locus_tag="CYME_CMT566C"
                     /db_xref="GeneID:16997714"
     mRNA            complement(<1431975..>1436309)
                     /locus_tag="CYME_CMT566C"
                     /product="TATA-box binding protein-associated factor 2"
                     /transcript_id="XM_005539458.1"
                     /db_xref="GeneID:16997714"
     CDS             complement(1431975..1436309)
                     /locus_tag="CYME_CMT566C"
                     /codon_start=1
                     /product="TATA-box binding protein-associated factor 2"
                     /protein_id="XP_005539515.1"
                     /db_xref="GeneID:16997714"
                     /translation="MDGNRSSPTLRKTTGSRTPQERGAEELRARKHRSKASSAAAPTL
                     LRLPTSHGAGVLQPTHANNPGTDRKAQARAEHTRGDASQGGGLGPRLDRVQLRVDVDF
                     AERKLRGRALLYFQVPNALRQPGTTKYKGDASDTLELRINLRCCAIQAVTVNDRAVEY
                     RLQSPLDGTEVMQAIADRIYPPPTMEELEMMLSRQARHAAHGELLVFVPWSILGASRT
                     AEPLPPPGDPTAATNPVDVTGTSPNDLSKSSSEARSACKDPQAEPVSVAEADALVDRI
                     PRSETEPRSTTAPLGTKIDATWTKPTVSIGLRLQVEYTTLPESPAVHFCGHANGEPLD
                     VFDGSGAAEDALLFDQRLPEQQQLLLLQQQPLPILVEHMYVESHSGLASTWMPCLNPP
                     NAVLANSGVRCAYDLEITVPTGMIAVASGELKGSSLEESTEAGRASRTRFVFQVPEPV
                     LASDIAFSAGLFRVLPDRIRPQSVTYFCLPGFVRQLVNTVDFLPAAMEFLENYFGVPC
                     PCASLKFVFVDGFGMHLPSVYPGGGLVVLSSILLFSDRVVDDVFDSHRRMVTALASFW
                     MRRLLRPLHTADLWLFVGIEEYVGALCLRKLFGNTWFRLYLRDAMKSLVESPGSLRWS
                     PAEQPAAESHEPSRRFSMLLIAAIDRRAERKLIQVQSTSGASTGRKHHAARVDVGEGI
                     RSTLHSLLVMPPRHHAVGLKPFLKLLERRTGVELLAFVRQYVVSNSMPLFHCGYRYDP
                     KEHKIEVAVRQTNHRRQSGVVTEPLVFRGTLRLSIREPEEHYTIDLEIQESVHVFDVY
                     CRTRKVGLGVRGRAAAAAAAAAAAATSVDHPDIGGTSSADATTTTTTPAGERLPLTHD
                     PIMWIRVDPDMEWVRGVFWRQNERAWVRQLAGERDVSSQMDCCDALYLHATAIGVRGL
                     AEHGLLNEQVHYRVRSAAAASIARWGGSETRFLGLEILVDFYANRYLVGEDQVLPRSD
                     AKEDNHLANVDASDALVGSQADAATTAATAPGRLQEKRARLGREWLQRLPRPLDFSRN
                     LAEYFLQRAMLRALGGIRVAQTGEGAQRTPTDLFALLDHVLRFHNNEANMFDDAYFLR
                     DALLAFASASSTNEGLRTMEVARCIERFLNRDRLFPSHQRALTAGCIEAAAELVSIQR
                     QCVTSDRSSSEAVRIQNDFERLVWSTLLGPVRVELDRFDEAPTRSRFEQYLARVWWLH
                     RPFRAAVEGLVRTAGDRPEVVRSLLVIAAVAPEPLYPVLVLRAMCKFASRTTKLAILL
                     RSEHEMAAVAVRQVLRLFARYRHPVARQAAVEFFRTMWGFGEPAPLLTRDEYGRRLKM
                     RSLGMHAHDAVAGSRASLMPPERFEAPLIIRVPAVTSREATDEAPANSDRAGQRYHGS
                     AVTADAGSVPAGSGAPEPVVVVRLPPMETSGASSVLPNCDFEDQVYLNYARTKLFGEE
                     SSTNDQET"
     misc_feature    1436416..1437955
                     /note="possible transcribed region"
     gene            complement(<1437981..>1440728)
                     /locus_tag="CYME_CMT568C"
                     /db_xref="GeneID:16997716"
     mRNA            complement(<1437981..>1440728)
                     /locus_tag="CYME_CMT568C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539459.1"
                     /db_xref="GeneID:16997716"
     CDS             complement(1437981..1440728)
                     /locus_tag="CYME_CMT568C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539516.1"
                     /db_xref="GeneID:16997716"
                     /translation="MVSPGAGPMTAMTMCVTDAHRLDKSVKIDSKLTFYRRYDHVASA
                     VPEQRRIGARRCQKRHEFHIFSFEQKQGTVKLRATRVFFMNVQYEKNSVTPRKNLGTT
                     SETTDRALRAGLPPGDLTGTSASTHPGRAPVPSGSEVSDWTRTSAPGKPLQATTLGNT
                     TKRLTRKISAAFSSDVEAAVLKASKPKYTAPKEKYVLTLLASLQGCGDALFYLLENTQ
                     TGGTPEARGTDALTHTTTGGVPLEPGPESSSNNSNSNTPAPRKTAVAILSTKPQYGLN
                     KVSTFHVQRLPHHRQRNPPTGTWSSDGGERAEDVALAVERMLLCGDIVRKLWRHGQER
                     DWRIVCKVLMVAHRLMRDAAHYADSVAFRLWATYYERLQRPARIHDVDSDDACSHPGA
                     TRSQRTASDSPMLNLLERLAAHSSGVSPRGQRDWTRRLITRSSQAGAATASGSSVSSE
                     TNAEPLPAVAHHVMSLEAVARAFRDESRTRPEATACSLFVREYARYLWTRLESFRILY
                     LGERQESKILDELGDRFASLPPAAERTPCCVDEMGVVSSRLGEELSERVPFERALREV
                     IPVLLYELNAVTEVRLESVVEVATSPVPHAHVNESMASVNVHNEIMQEAARLIVHDAM
                     QLFATLNQMMESVLEQQLLLGSNHLALMRRSRALYRSFVDATNRLREWLASIHRCLLG
                     FDAASAHDKRHGRRALGNAAADAMLRGELEHAPLDLIARGWWANLSDEKPEEDHDGSG
                     DGDHRCRASDTGNVRTAERSETRRESSHAAAAEGRSRGTQQPRERTYSAQAPASGCSS
                     LFLSMGHEPLHTATGSVGVSLNEDSGNAMSKTPSLRDMMKAMETLLRAGAKAQEQSRA
                     LCERGPHMTQVIEDELRVLEQTYESCKSALEKLYQKKREEILTRPLQVLRVADARRPS
                     V"
     gene            1440727..1442820
                     /locus_tag="CYME_CMT569T"
                     /db_xref="GeneID:16997717"
     misc_RNA        1440727..1442820
                     /locus_tag="CYME_CMT569T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461717.1"
                     /db_xref="GeneID:16997717"
     gene            complement(<1445038..>1446625)
                     /locus_tag="CYME_CMT570C"
                     /db_xref="GeneID:16997718"
     mRNA            complement(join(<1445038..1445350,1445628..>1446625))
                     /locus_tag="CYME_CMT570C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539460.1"
                     /db_xref="GeneID:16997718"
     CDS             complement(join(1445038..1445350,1445628..1446625))
                     /locus_tag="CYME_CMT570C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539517.1"
                     /db_xref="GeneID:16997718"
                     /translation="MKEHSFSENNDLLPDLFAENAEELPADSALRRLIQGDETADEQA
                     ELLRQRGNQRYRLGCRLLDRGNDPGADLTLPGGEQSVATLRKRAHALFHQAMASYTEA
                     LALPGVSSTVRGALYLNRAEVHRRLGNYARGLHDAQQCIRSCGLEHPKAFYRASACAL
                     ALGKLPEARTFCEQGLERTKAPEHVLERRALQRLEERIAEEMVRAQRLLAEKDALLQQ
                     RVDQSQRLLDTLERQRIRLGMPLFAQQKKVSNWQPKPVPVARDEPNPDSESTVSIKFS
                     WPFMVVYPLVQQSDFFENVDDDAELQALFSDLLPVEGPPALTFDPEGRYRCDRVAFWY
                     ATQWTRTLVDVGDPALLRDLTRVQDNEFCGSLLPPEEQGTWKQVLLDDIGLDAARLPR
                     DTVCVRTLRDLVTQPDYIVPMFPVLFVAPRGATPAPFWLAASFS"
     gene            <1448233..>1450494
                     /locus_tag="CYME_CMT571C"
                     /db_xref="GeneID:16997719"
     mRNA            <1448233..>1450494
                     /locus_tag="CYME_CMT571C"
                     /product="probable adenylate kinase, chloroplast
                     precursor"
                     /transcript_id="XM_005539461.1"
                     /db_xref="GeneID:16997719"
     CDS             1448233..1450494
                     /locus_tag="CYME_CMT571C"
                     /codon_start=1
                     /product="probable adenylate kinase, chloroplast
                     precursor"
                     /protein_id="XP_005539518.1"
                     /db_xref="GeneID:16997719"
                     /translation="MKQFAFVEHAAFVYPALRHTPRPEKTWSASLACGAIPGNTGQVP
                     GSRLLPRWRHRGLGLTTGVHKRTAKYRSHRGTSSLHSAQENANSAKPLEPVSEHRPLR
                     IILAGPPASGKGTQAALLVERYGLVHISTGDMLRAAVEAGSELGLAAKKYMDAGELVP
                     DELVIGLMQQRMAAPDVQTSGWLLDGFPRTAAQIVAMDAAGIEPDLVISLDVPFEILK
                     ERVSGRRLDPETGRIYHLRFDPPPASDKALLDRLIQRSDDDVQKLAVRFENYRENVDA
                     LRQRYGAIMAEIDGRRSKEQVFENITRAVGMLRMRRSWQMKRSRPPRIILLGPPLSGV
                     EKYAARLCKDLGCIRISTEQVIRDAAAAEQTRTGLMIRQHLENNELVPDHLVAHVLGK
                     RLAAADVEQHGWLLDDVPRRIMKASSLLDAGIEPDLVLLLYLPHEDLEERMVQRLWDP
                     ETGRYFHEKYDPPSADDAALRARLIHRTDEDENLARWLLGTYYVVESELEAQYAGRIV
                     QIDGLAPDEEIYKQMTAAIEARGIPLLSDLTRATFEDLELGSAFMVLYRDPKPATIHE
                     VRWRGKGAWPDLFTRPLLAIGDLIALLVASSVLRLLYGGRLILDAIVWKTAAPFIIVW
                     IVGAPYIDAFTQNALRDRREALLSLFRAWRVCMPFAVFVRAQSMGFAPPLHFIVALLL
                     LTYVFLALWRLCYVIFLQGEYDSEGNRTLSLRDLGPWRRPVDRGAPYPGSVRSQTPPL
                     TDSSLFRETLGPT"
     misc_feature    1450290..1452692
                     /note="possible transcribed region"
     gene            complement(<1451932..>1453257)
                     /locus_tag="CYME_CMT573C"
                     /db_xref="GeneID:16997742"
     mRNA            complement(<1451932..>1453257)
                     /locus_tag="CYME_CMT573C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539462.1"
                     /db_xref="GeneID:16997742"
     CDS             complement(1451932..1453257)
                     /locus_tag="CYME_CMT573C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539519.1"
                     /db_xref="GeneID:16997742"
                     /translation="MISDGYRESSVVSPENGEQDFLDWGALHKARGLVAYYVSGHGWG
                     HLTRSLALACELLTHQFCVLLCTPVSPDAVHAQLLLLLGAYRTHAVEFPQSLRPEEQL
                     RVRAVKLDVGCIQSDALTIDAAATLTAYREINERRQTLIRVESAMLRRLQPQLILADA
                     VALAAAAAKAAALSDRFVFVTNFLFSAIYDQFLSEIPSLNTPQNRALVERMAMDESEA
                     PVWVQLSPGLVPPLRSFGGRCFSAGPVSRPWKSTRAETRRRLGISLSARVLLVCFGSF
                     DCKTLFGEQGCPLHSFLEQVDLIREPGSPWRMMLLTEYDAVSSSPRVRFVHPSAATYV
                     PDLIQAADVVLGKLGYGISAECLAAGTPLVYVRRPLFLEEEALRRDLQGLCVELTIEE
                     LRSGCWRRAVHQALESKGSTARARFGPEHPLASIRRLGALVQQWMRGSQ"
     gene            <1455053..>1456408
                     /locus_tag="CYME_CMT574C"
                     /db_xref="GeneID:16997743"
     mRNA            <1455053..>1456408
                     /locus_tag="CYME_CMT574C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539463.1"
                     /db_xref="GeneID:16997743"
     CDS             1455053..1456408
                     /locus_tag="CYME_CMT574C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539520.1"
                     /db_xref="GeneID:16997743"
                     /translation="MTAARPVKAFLSVSNCWYLSSRDHSSRRSTSGNSDLHRARSQQA
                     VRFPRTRCLPSRCVGRVRRHGLALETLLLQLQGLGPQKSPLGRQQLQVPNDRGTDLAP
                     TLAVASGDDGGCGGRISTPGRGWYYRWGAGGYASSSDERDNGDAEHQSFEQPGQEAAG
                     HASSGTGSDASDHEQLLRKMNRPVESVPRELFTLDLKTAQTYLVATASGLPRFLTDRF
                     PAWQAKMLADPNFFFKLVMEETVGMGLCLTGVVLARGDRLMKELDFVLIDTLVGAALS
                     FVLLWLLAPSATMQSLHQRHLSSSSNAGPVSALQHYFRTLPSCALAPASSATSYSWSQ
                     RAVAFLYKGSLFAIAGFMASVIGTSMGYALLALRKRLTGKEPENRMPPILIMSLGWAS
                     FMFVSANPRYQVVTAAELFIYEKASPAVAKASTAILRTVNSIAGGATWVLWARAFGLN
                     Q"
     gene            complement(<1458379..>1459725)
                     /locus_tag="CYME_CMT575C"
                     /db_xref="GeneID:16997744"
     mRNA            complement(<1458379..>1459725)
                     /locus_tag="CYME_CMT575C"
                     /product="similar to RNA 3'->5' exonuclease"
                     /transcript_id="XM_005539464.1"
                     /db_xref="GeneID:16997744"
     CDS             complement(1458379..1459725)
                     /locus_tag="CYME_CMT575C"
                     /codon_start=1
                     /product="similar to RNA 3'->5' exonuclease"
                     /protein_id="XP_005539521.1"
                     /db_xref="GeneID:16997744"
                     /translation="MTVSKSAKNSGKTVSEEDLGVKCLTGSSQQVEASADDLERPQVE
                     SGQPRGRRKKRLPTADDNWRALKQQLNTGQAPRQLHRSSATSSVSKQNSDAIGNLGDS
                     GTSNQSLGESVPAASPAQVKPSPERHRSSDRVATSVRTDGTKQPNDTEGSSLENVRAE
                     LHAPEKEPLRKAGPLGLYPQERAAPLGSIIALDGEFVGIGPGGSTDALARISVVDYDE
                     AVLYDRFVQVDTRVVDFRTPYSGIQPHHLQDPSCVPFAEAQRAVASLMKGRIIVGHEL
                     RKDLTVLQLSHPRRHIRDTAHYLRLRRLLPMRTFRTPSLRTLAAELLDQVIQKGTAHG
                     PGHDSVEDATTALRIYKLMADIWERDLVKMEKQQQQRAAARSTKKQKRRAARLRSAEK
                     AERQAKSSKGSNPDTEQRLRSSGSPSSESPKEKQLLENADDSTGTRSVPAFVDVAS"
     gene            <1460311..>1463688
                     /locus_tag="CYME_CMT576C"
                     /db_xref="GeneID:16997745"
     mRNA            <1460311..>1463688
                     /locus_tag="CYME_CMT576C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539465.1"
                     /db_xref="GeneID:16997745"
     CDS             1460311..1463688
                     /locus_tag="CYME_CMT576C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539522.1"
                     /db_xref="GeneID:16997745"
                     /translation="MTLSLECLGVHLPCESVEVALVAPAGPCHCWVSTNRETVQQWYR
                     ESAEGLDRSSTGSESPVGVQNKDRSVWRIVAEFRAPGRVAFLVHLGKHGLLAQTADCK
                     FLFVAGHWRSVKLPTWNERITAVTVVSGSLRSLADEPESRTSPTRFERTPQASTSSLH
                     LLLGTAQGTLYSCLVPQFKMTAIWSTTTACSGAEPICGLRYLHAARTGSPGHELLILS
                     TPTRLYYVMDPFSVSESARERLNLDRFMETAPCASADATMTAAGMVESIPQNKIGSLF
                     GDWNWLSRTGILHFQVNRSALAAGQLPVVWEKSWIDLSGIFSASKEPYAVFGAVDIEP
                     GCVLLGIQSASAADGAVFPAQGERAVVSDDNEPSLVTSLQECSITEHAPTPSRNAAPE
                     ECFVEERDSGVRVLPSSERGHTRGRDSASEACTSDELHPNTRAYSALALESVTSSVDQ
                     LDRSLSAETAEISPGDCMNITHVERSSVLPSVRDSNAAFESETFAFTQTPAADPQLPE
                     AVSADSSVSCAAFEHALPSTGTRTEQVSLDARSEAASTDVDPVLGFIALYSLVDGRLR
                     ARMAVRKEHGRPLALLPGGLLVTSRATYCCRVSGDVLKAVQEAFVERYRLAEALANCK
                     TTEQKDVVFLQYAEKLFSELGGIHEAATEADLQAQRIRKQQIAFYLARCRSLQVQDAL
                     KRMIEHCAVDAEMVLAYVEQRVLVEEDTLSTGALESLQKALQDYRSGADAETFLSQPC
                     VLRDQSATDAMYGRLYRLMKPGSTAQVQLREQILQRALVLPPIAERKHGSFSNNEHEA
                     IKLLQWAAVLLAEQGNEADLFALIQKHAPAVHEDRSFSGFLLWLVNRYGLWHVHIELL
                     LMLDKQVGSDAGYREDALDVAFEHAAEMALEASPLLERLLDRICGEDRALWRQALDRA
                     PASCRTAVWSRALLERRVVTLGEALDDRSTTRTTSPVDCPLPAQALSHLFRDMEHSLA
                     IEQAKIQDLISVLERLDRALEHQSAVRHATEAVWRRQSTNCTESTPGRETPQTAWFPG
                     HARSLLPDWMTRSLQADALYGAKAGASNAPAEMQARAALCRVRSRNRSLSSACVTGST
                     SEATQQPTDTSASVATREHDVTWFSPFWLESLNASYR"
     gene            complement(<1465097..>1466053)
                     /locus_tag="CYME_CMT577C"
                     /db_xref="GeneID:16997755"
     mRNA            complement(<1465097..>1466053)
                     /locus_tag="CYME_CMT577C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539466.1"
                     /db_xref="GeneID:16997755"
     CDS             complement(1465097..1466053)
                     /locus_tag="CYME_CMT577C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539523.1"
                     /db_xref="GeneID:16997755"
                     /translation="MQGENVDHAQPISTWSAEQELHLVVFTKPPIAGLTKQRLSREIG
                     STLATRISAALVENTLATAYDWLQGLDLQAGGTGAVHLYYTPVESEQAKAECVERWLD
                     DSVRHRYPAFRIAPQKASKVQSTGDQKQDPLGSRLIQAFTEVTSLVDESRDAHVVVIG
                     SDCPALDTAVLQQAFAALHAGHGAVIGPAQDGGYYLLGLAFAAAERTRWARVIYAAFG
                     PHLVFSQNDVCARTVEALRNDGVRTICLPVTLNDVDTAQDLVHLPASMRPREWFSSAN
                     ARLHKTSDLVETAPAPGSTTCDEEVDADKLDPSVQNVCSRQV"
     gene            <1466944..>1467780
                     /locus_tag="CYME_CMT578C"
                     /db_xref="GeneID:16997756"
     mRNA            <1466944..>1467780
                     /locus_tag="CYME_CMT578C"
                     /product="similar to methylated-DNA--protein-cysteine
                     methyltransferase"
                     /transcript_id="XM_005539467.1"
                     /db_xref="GeneID:16997756"
     CDS             1466944..1467780
                     /locus_tag="CYME_CMT578C"
                     /codon_start=1
                     /product="similar to methylated-DNA--protein-cysteine
                     methyltransferase"
                     /protein_id="XP_005539524.1"
                     /db_xref="GeneID:16997756"
                     /translation="MRSRHLSRTQTREQHCVSVSVSVSLCVCMCVNADSRTLAPESCV
                     LTRRVVLQNKGRRQHPHAAFAQMNTVGGSRYRGERLVPQCQRMARSTGTSFKEKRRRL
                     ASGSVLFSKCLRKSCCVCLDATLSDFEKAVYHVAASIEPGRVATYGTIAQVIKPTEGA
                     RAARAVGTALRKNPYWKEGCVPKVPCHRVVAADRTLGGYMGVKDPKSTQLERKRCIML
                     EEGVPLTRNKRGQWVVVENVAGGGGTSAGQPLLSPAELRAIAATFASASSLSPEGCST
                     PR"
     misc_feature    1470176..1472534
                     /note="pseudo-gene of NAD-specific glutamate
                     dehydrogenase"
     gene            complement(<1470248..>1472311)
                     /locus_tag="CYME_CMT579C"
                     /db_xref="GeneID:16997779"
     mRNA            complement(<1470248..>1472311)
                     /locus_tag="CYME_CMT579C"
                     /product="luminal binding protein BiP"
                     /transcript_id="XM_005539468.1"
                     /db_xref="GeneID:16997779"
     CDS             complement(1470248..1472311)
                     /locus_tag="CYME_CMT579C"
                     /codon_start=1
                     /product="luminal binding protein BiP"
                     /protein_id="XP_005539525.1"
                     /db_xref="GeneID:16997779"
                     /translation="MATRRFSYRRVSIWNWALVAVLVHVCCCLFGRAVLVGAKDASSG
                     GGKIEGPVIGIDLGTTYSCVGVFKNGKVEIIANEQGNRITPSYVAFTDKERLIGDAAK
                     NQLALNPERTIFDVKRLIGRRFDEETVQKDIKLLPYKVVNKDGKPYIRVEVRDGEVKT
                     FSPEEISAMILGKMKKIAEDYLGKPVKNAVVTVPAYFNDAQRQATKDAGTIAGLTVQR
                     IINEPTAAAIAYGLDKGGSEKNILVFDLGGGTFDVTLLTLDDGVFEVLATNGDTHLGG
                     EDFDQRVMDYLVKQFKKKNDGLDLRTDKRAMAKLRREVEKAKRALSYQTQVRIEIESI
                     MDGKDLIEELTRARFENLNMDLFRKTLKPVEIVLKDAKKEKKDIDEIVLVGGSTRIPK
                     IQELITEFFDGKQPSKGINPDEAVAYGAAVQGAILSGEGGETTKDILLLDVTPLSLGI
                     ETVGGVMTKIINRGTTIPTKKSQIFTTHVDRQSSVLIQVYEGERVATKDNHLLGKFEL
                     TGIPPAPRGVPQIEVTFEIDANGILQVSAEEKTAGKREKITIRNDKGRLKDEEIQRMV
                     REAEEYAEVDAKLKRKVDAKNNFENYIYQVRQMYEDKDKKTKLSTDDIDKLKDSVESA
                     QDWLDEHGEASDAAAIEERMKAFQDVVQPIILKTYESAKGTGKDSSADSSADDDRDSE
                     EHDEL"
     gene            complement(<1473962..>1475962)
                     /locus_tag="CYME_CMT581C"
                     /db_xref="GeneID:16997758"
     mRNA            complement(<1473962..>1475962)
                     /locus_tag="CYME_CMT581C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539469.1"
                     /db_xref="GeneID:16997758"
     CDS             complement(1473962..1475962)
                     /locus_tag="CYME_CMT581C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539526.1"
                     /db_xref="GeneID:16997758"
                     /translation="METESRGPRHDSGGSGAFPNGNARHGDERANRSQADVHAPKLSG
                     LRSDGASNTSEPYDTEQVSAVTEQLARVQVRESSSRRYYERKERGMLLQGKSSRKTGA
                     LQRPTPERATLERLRRKRVEVLARGAALRSALTFTDSWNVSAEHLKRQVRRFHELVAE
                     SSYPDWVAEYERRSRLARHLRNVASSRFRGCRVDVYGSTATGVLLKGGDLDVNFVAPM
                     APLEVLRAQYQDEEYSIDDFRRDVVGDLGRLLRRRRHEFVNVQIITQTRVPLVKFHDL
                     RSDIEVDVQVNNDFVVRNTALLRAYVRLDPRVRPLAIFIKRWAVARDLNEPFAGTLSS
                     YAYLMLLIQYLQIVNPPVLPCLQALRLERIPVSNGGSVQHIEKLVEHPQEPEVPDETL
                     VDDYFLDRTDIQMPVCNEMSVTLLLAGFFYFYGYQFNYDEMVVSVRCGRLISKKRRGW
                     DQSDRVQTDQNKADDVVDGIGDPYTHASDDETDHEDVAEELTVDDAEVGTCNGSERRQ
                     RRVASMSATESGTDSSHSGADEERTSPEQPLNHQTVERAVDLQSASVDPSGDHANAPL
                     QELTAPRPRAAVTSQAQRERLRLQRQRRQRERATHATQRHFFCIEDPFDMTHDLGRVC
                     SEDSVRLLRHEFRRAFAIIAQQLPLDSLLQSYVPSETPAEEP"
     gene            complement(<1478666..>1480741)
                     /locus_tag="CYME_CMT582C"
                     /db_xref="GeneID:16997780"
     mRNA            complement(<1478666..>1480741)
                     /locus_tag="CYME_CMT582C"
                     /product="succinate dehydrogenase flavoprotein subunit
                     precursor"
                     /transcript_id="XM_005539470.1"
                     /db_xref="GeneID:16997780"
     CDS             complement(1478666..1480741)
                     /locus_tag="CYME_CMT582C"
                     /codon_start=1
                     /product="succinate dehydrogenase flavoprotein subunit
                     precursor"
                     /protein_id="XP_005539527.1"
                     /db_xref="GeneID:16997780"
                     /translation="MTLVHSLRVFLSRRSFTKEAARRLPRHVTSIGAFPREERLLARS
                     KQRIIALVCGQQRRALGQLVRSARPAVDTESPARAKRRVATQATPSYAVVEHEYDAVV
                     LGAGGAGLRAVIGCAEAGLKTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMY
                     DTVKGSDWLGDQDAIHYMCREAPKVVIELEHYGVPFSRTEDGRIYQRAFGGQSLKFGK
                     GGQAYRCAAAADRTGHALLHTLYGQALKHNADFFVEYFGLDLIMDEEGVCRGLMALCL
                     EDGTIHRFRSHAVIICTGGYGRAYFSATSAHTCTGDGNAMAVRAGIPLQDMEFVQFHP
                     TGIYGAGCLITEGCRGEGGILRNGVGERFMERYAPSAKDLASRDVVSRAMTLEIMEGR
                     GCGPQKDHIQLFLNHIPPEILKERLPGIMETARIFAGVDVTKEPIPVLPTVHYNMGGI
                     PTNWRGEVLRPTASDPDAVVPGLLAAGEAACASVHGANRLGANSLLDIVVFGRACAHA
                     VAEQVRPGMPHKPLPANAGEDAIANLDRFLHANGSIKTADLRLRMQKIMQNHAAVFRA
                     KDTLEEGCKLIDECYSDLNEVRIADRSLIWNTDLIETLELQNLLQNAVATMHSAEQRK
                     ESRGAHARDDFPKRDDEHWMKHTLAWVHAQDALPANASPVRIGYRPVHDWSLDESEQT
                     PFPPAQRVY"
     gene            complement(<1482097..>1482507)
                     /locus_tag="CYME_CMT583C"
                     /db_xref="GeneID:16997781"
     mRNA            complement(<1482097..>1482507)
                     /locus_tag="CYME_CMT583C"
                     /product="RNA polymerase II subunit"
                     /transcript_id="XM_005539471.1"
                     /db_xref="GeneID:16997781"
     CDS             complement(1482097..1482507)
                     /locus_tag="CYME_CMT583C"
                     /codon_start=1
                     /product="RNA polymerase II subunit"
                     /protein_id="XP_005539528.1"
                     /db_xref="GeneID:16997781"
                     /translation="MDLGVDQEENAENLKFGELFGDNEHCQPLLICEVAELLRQKRAE
                     LPAELQSSLGPIFVKSEAYVERFNQFRSAEVAKVVRVRLERHPELHPFERAQLANLLP
                     ETPAEAKAIIPSLKGKLDDDVLGQLLRDLAALVE"
     gene            <1482969..>1484126
                     /locus_tag="CYME_CMT584C"
                     /db_xref="GeneID:16997782"
     mRNA            <1482969..>1484126
                     /locus_tag="CYME_CMT584C"
                     /product="dihydroorotase"
                     /transcript_id="XM_005539472.1"
                     /db_xref="GeneID:16997782"
     CDS             1482969..1484126
                     /locus_tag="CYME_CMT584C"
                     /codon_start=1
                     /product="dihydroorotase"
                     /protein_id="XP_005539529.1"
                     /db_xref="GeneID:16997782"
                     /translation="MAMKATLRVRMRRPDDWHVHFRDDAILRAVAPLTARQFGRALVM
                     PNLVPPVCTVAQARAYRERILATVRAADPANSFEPYLALYLTERTSVETVQQAKESGF
                     ILAFKWYPAGATTNAEQGVRSIERLNAVLAAMETLGVVLCVHGESTDPAVDVYDREEH
                     FIRHELEPVRKRFPRLRIVVEHVSTAFAAKWVLDNANGYTAATVTVQHLLCNRNDLLV
                     GGLKPHLYCLPVLKSEQDRLAIIEAIRQDNRGCFFLGTDSAPHPRFRKESACASAGCF
                     TAIAAMELYAEAFAKAGMLDRLERFAAENGARFYGLQPSTEYVQVLNWPEAVRTIPEY
                     VLVDSVAEREPQRTPETRTESMLTSTTLQPFQAGARLMWSMERLGISDADR"
     gene            complement(<1487260..>1487820)
                     /locus_tag="CYME_CMT585C"
                     /db_xref="GeneID:16997783"
     mRNA            complement(<1487260..>1487820)
                     /locus_tag="CYME_CMT585C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539473.1"
                     /db_xref="GeneID:16997783"
     CDS             complement(1487260..1487820)
                     /locus_tag="CYME_CMT585C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539530.1"
                     /db_xref="GeneID:16997783"
                     /translation="MLRPTRGVLAGPARFWRSWLERTQEKTQALREKDMFRTQMEHLS
                     ACERFGPDEYGALLRKLRDAAGFGSSLWNRLSNAQSDPFLKDVNEQEELIRLLTAEQK
                     ARLLQMRRAERRSLAQAIGKEEHLVETLVDRLTQAKFLHDWIRARLQEGLPLPQNAQQ
                     MELFMLNPNQRRGLPGVRPRIVRPRR"
     gene            <1489315..>1491129
                     /locus_tag="CYME_CMT586C"
                     /db_xref="GeneID:16997759"
     mRNA            <1489315..>1491129
                     /locus_tag="CYME_CMT586C"
                     /product="probable eukaryotic translation initiation
                     factor eIF-2A"
                     /transcript_id="XM_005539474.1"
                     /db_xref="GeneID:16997759"
     CDS             1489315..1491129
                     /locus_tag="CYME_CMT586C"
                     /codon_start=1
                     /product="probable eukaryotic translation initiation
                     factor eIF-2A"
                     /protein_id="XP_005539531.1"
                     /db_xref="GeneID:16997759"
                     /translation="MDSVPPVASELFIRSRESAQIVRLRRLASIEEDAARLQLSADAG
                     LDTATSLPGVPPGLASSTVAQFSLPDGNLLLWVDPDTRACTVFRVGAPGEPLEPVTRV
                     GGTAQDEFIQDAAFSPCGAFLVTWSRPHERLADGNLRIWRCATGEAVRAFPHRHHSAT
                     AFPYVQWTADERYALHAVANALDVYDGSKLEQPPLLRIAIPGLVQFAVAPEAVAAAVG
                     ALDLAYVATFVPESANGAPAVIQVWAIGSSSAIRSRHGEVDGLPASGKEARCAVPVAS
                     RRVYRAQHVEFYWSPKVYGSGSSPSLVIRTSHDYDVHGRSYYGESSAHFLYLGNKSEQ
                     SREPARDPASMPEGPIHDIGWSPTGREFVIVHGTTPARATLFHGTGTATFDFGTGPRN
                     RVSWSPHGRFLALAGFGSMSGNVQIWDRNKKKLIGQFQAECTTHWQWSPCSRFFLVGV
                     CYPRMKVDNGFRIFKYDGTLVYERKMPTTQLYQVEWRARVPEQFPDRPVSPQVLTSMR
                     KMAEQMTANTDASQKGNGSVASAVAGNQTRPSGAYIPPHLRRQVIENGVSMPPLKLHE
                     HEAPQSLVSGPFLTKSQRKNRKKKEREARQQQQDIPSV"
     misc_feature    1491744..1493196
                     /note="possible transcribed region"
     gene            complement(<1493256..>1494332)
                     /locus_tag="CYME_CMT588C"
                     /db_xref="GeneID:16997761"
     mRNA            complement(<1493256..>1494332)
                     /locus_tag="CYME_CMT588C"
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /transcript_id="XM_005539475.1"
                     /db_xref="GeneID:16997761"
     CDS             complement(1493256..1494332)
                     /locus_tag="CYME_CMT588C"
                     /codon_start=1
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="XP_005539532.1"
                     /db_xref="GeneID:16997761"
                     /translation="MVQVAPSLWTRLVQRVAPYAQLARWDKPTGVWLLYLPGAWSIAL
                     AAGLESTTSAGHGTEPPVQPTTSPVGSLRLQGAFLAGAFLLRGAGCTINDLWDRDIDK
                     QTIRTRQRPLASGRLHLGQGLGFAAAQTLAGFPILLWISTPAQQRAQRFGVHQIRDLL
                     HSTTFLTGVTALVPATLYPLAKRVTMWPQAVLGLTFNWGVLLGWSAATDGSMAWRVVL
                     PLYGAGWCWTLVYDTIYAHQDKYTDRRLGVGSTALRFGEVHAKTWLRGFAAGMVASLT
                     LVGVVSEQPWPFYAGVTLVGAQLFHQIQRVRLDDPADCMRHFRRMPLTGLVLLLGIAG
                     ANAWRQRVPVSTDTEAVVGTQSSG"
     misc_feature    1494230..1496140
                     /note="possible transcribed region"
     gene            complement(<1494694..>1497069)
                     /locus_tag="CYME_CMT590C"
                     /db_xref="GeneID:16997821"
     mRNA            complement(<1494694..>1497069)
                     /locus_tag="CYME_CMT590C"
                     /product="CDK tyrosine kinase WEE1"
                     /transcript_id="XM_005539476.1"
                     /db_xref="GeneID:16997821"
     CDS             complement(1494694..1497069)
                     /locus_tag="CYME_CMT590C"
                     /codon_start=1
                     /product="CDK tyrosine kinase WEE1"
                     /protein_id="XP_005539533.1"
                     /db_xref="GeneID:16997821"
                     /translation="MGRVGVRSKTQAQQGPPPTAVLKMRRASRLGTPRLPAALVTSSA
                     APGQQLDTDSIAEASVGRKRRLSRTEERPRLGALGSTTESAGPSRQRTIPEVLERKAG
                     LVVSTPKLELPRLDLISWGTTPHGARRLTPEAADIETPVNSAEFVATPFLGEGASRDA
                     AMGLDAGIYRTPTFTIATAVNANWMNSQAASAADEDSNASSTLAPEQGAGASQPPPSP
                     SPALKRLHLLNGSANGRWCPARESNFSAPRPPLQSQRHEYQTQAVATADMDAPESSTF
                     SSQMHTQTSVLSQDTLGMLLARRRAVQAARTSTDVVGRITFSQAGDDEAVANGNSAPG
                     GSLSELRPVTAGIPTLVRDHAMMITSQVPARSARRPTENPLWANTDARTQSQTEAGPG
                     NGLAAERIHRSLWGSRRAPATATAAELRDSFLAMGDVIQCTENGRHREAQPTSAPIIN
                     PFLVCTDEPETPSKAEMSSAQLRPNQLLPEVASSPSRFLQQFEEVQILGSGVKGQVLL
                     ARHRTDGCLYAVKRTTRPLLSRTDRLDALREVHALAAVGAHENIVRYHTAWFEEHDTR
                     LYLQLEYCAGGSMQLSGRTRLTTASKLPHYLRLVRLLGHVAAALAHCHAHGIAHMDVK
                     PENMLIGSVRKPHQQLQLRKQPTKQEVFKLADFGLACRLDGADFTGSEGDSRYLCQSV
                     LSEAPLGSLVPVDVFALGISIYELLTEQPLPTKGDEWQALRAGRLDRLDALTAAPGET
                     STDANLVLSFLIDWIRRCVQPSVQERPTAAEVALACETWLVEHASLSCDDP"
     gene            <1498888..>1499508
                     /locus_tag="CYME_CMT591C"
                     /db_xref="GeneID:16997822"
     mRNA            <1498888..>1499508
                     /locus_tag="CYME_CMT591C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539477.1"
                     /db_xref="GeneID:16997822"
     CDS             1498888..1499508
                     /locus_tag="CYME_CMT591C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539534.1"
                     /db_xref="GeneID:16997822"
                     /translation="MACSAYTRALTYVAGAAAQRPWRAARTHRGSWRTRRQPRAHPRT
                     STCFAQRTRYRSVRLQAPSPENNKSNRANSRPSTNQKASLTPSFLRDVTDSSFFADVP
                     YREFQQIGRLYRTVDEFLGRKENLLFWGSCALLFGAFSATSISTIVGALAEWDPIAGA
                     VIVFIMEWIATQYYRRPRPSNIIRILNAYQVGLTFGFILDALKLAG"
     gene            complement(<1500101..>1503769)
                     /locus_tag="CYME_CMT592C"
                     /db_xref="GeneID:16997823"
     mRNA            complement(<1500101..>1503769)
                     /locus_tag="CYME_CMT592C"
                     /product="similar to mitochondrial calcium-dependent
                     solute carrier"
                     /transcript_id="XM_005539478.1"
                     /db_xref="GeneID:16997823"
     CDS             complement(1500101..1503769)
                     /locus_tag="CYME_CMT592C"
                     /codon_start=1
                     /product="similar to mitochondrial calcium-dependent
                     solute carrier"
                     /protein_id="XP_005539535.1"
                     /db_xref="GeneID:16997823"
                     /translation="MGNGQSAETRKVSTDSSTVKENGRAIEKPEAALSEKRVSGEAAL
                     QQQQPQRPVPPAPPDRKHQGETVQSQVRSSTGGTELKRERRVTLPPGLDAGDIVLFNR
                     RCLAMAPLGALICAVAKAMSNSRWDHVGIVVRKEDGSLHLLEANLSGVTLRPLDERIR
                     RSRSNEIAFRRLSIIRTERFRTELLHFAEQVLETPYKNDLGAMLVSVIHPADMQERER
                     LHALLVSRRAQRMEVERELREAALTAFQRNSLLEQRRILLQSEEKIEEVLRRELAATK
                     GGFFEGSNDLSRVFCSELVAAAYQRLGLLSSFPPADSYVPKDFSTEQANPPGVHLLKN
                     ARLGNEEFIRRLPTQKQGWFASLLGSDSNQDRTTTEATGTNPADEAVPGTDANAAGAS
                     PVSDASGQPAYPRGESRELIRDALKRTPIFAALPDEYTRNHLVKSFRPVIVEAGDYVF
                     HQGDYGDAFYVVESGSLDRYIAKDGQEPIQVSTLGPRNSFGLTALFFNAAGRSSTIRA
                     RERSLLWRLDRATFERFALDFGETSVIENAAESRQLRALLKKHFLFSRLDRIGPKELE
                     SFFTVNFRPGETVFEQGEKGDNFYIVKSGVLERWISKPGHQPKLAGTLQPGDSFGELS
                     LMYNAPRGATVRARTDVELWAISAESFHRLHLGGGACYLERIFKEYASVKREKSQRTD
                     DGDPYEYFMTPEDFLRFARADAFKESPEDYRRLSNLLLRLVSNNNSGSLTAPQRKTSQ
                     QSAPLIDFWEFVRFDLLLNQPDAESQLIFRLCDRDNTGQVGMQEFQEMFLEYANGDRE
                     IEAMVEDGSPLLRQLFGKRGDRKLNFRDFTAASEGKLPAKFLADIHRLKAHMQQQAAR
                     APSSNALDDEILLSTSSLLAGTPQFSGIAPTHRGVLIGHVAGVAVAGVLARTLVAPLD
                     RLKVLMQTESIVVKVRPELLKDERIAPNPRSKRIYSSVWRGFRNMIAQDGILGMYRGN
                     GANALRILPATIIQSATIALAKEYIEAHRPENARRSLGFAAWDTVVIAGLGGIVAATI
                     TYPLDTARARLTVQHRGIAERYHGVLQCLREVRKQQGVPGLYRGLLSSTLGVFPYVGI
                     NFAVYETLRPIMPRRNDGSGRPTAGGLILSGFIASTLGQMAAYPFDTCRVRMQVDEGS
                     GGRFRQVFRTVLKEEGIRGLYRGLVPNILKAWPTVAVSFYAYEMLRKPLSQMLDSVYA
                     PASGLKPTAAAQGAFDSR"
     misc_feature    1503894..1505564
                     /note="possible transcribed region"
     gene            complement(<1506185..>1507114)
                     /locus_tag="CYME_CMT594C"
                     /db_xref="GeneID:16997825"
     mRNA            complement(<1506185..>1507114)
                     /locus_tag="CYME_CMT594C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539479.1"
                     /db_xref="GeneID:16997825"
     CDS             complement(1506185..1507114)
                     /locus_tag="CYME_CMT594C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539536.1"
                     /db_xref="GeneID:16997825"
                     /translation="MRGWTQRQRKALLLCLCALGLLLVLVIRSRRSSDDFRVEEIFIG
                     GQTRRPLYFFIAGIEGAGHGTLREVLKPCATTEVLDPNLHLDGGDDPKHRYAKFFSES
                     LELALQDQHLVSASRRTPCILDAVSTFPIGPEREPARRPDLEVLLDLHQRGVLDLRIL
                     VLWRDPLRCIQYTSSRSKSLDPLYLARVAEESLLYLSKQLEQMPSDIWDIINYDEFVQ
                     NPSRFESTIAALLPRDLYRRTSIMNEDQIKRLHANYERETLSFSEIGDRRCCLPEEIC
                     QDLDRLLSEFLEKREFLWAPMVEFLSHESRSFR"
     gene            complement(<1507525..>1508166)
                     /locus_tag="CYME_CMT595C"
                     /db_xref="GeneID:16997874"
     mRNA            complement(<1507525..>1508166)
                     /locus_tag="CYME_CMT595C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539480.1"
                     /db_xref="GeneID:16997874"
     CDS             complement(1507525..1508166)
                     /locus_tag="CYME_CMT595C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539537.1"
                     /db_xref="GeneID:16997874"
                     /translation="MFALPLSRTCCCVRVGRATPLRHLTKPRGYVAGNTFASTVHRES
                     LAHLPRARAQCRKHCSSAGLLYARAEEPKKASRPETGTAGALPPAARKLPPDVVEEVV
                     TEQRVRFAEQVGSRKMAIAFTCARCETRIRKRFSRQAYCHGIVIITCPGCQVRHLIAD
                     NIGWFKDVPRSPGRAGYHIDDFAQVERVSAEVFELEESFSRSEETTHEALPDD"
     gene            complement(1508955..1510741)
                     /locus_tag="CYME_CMT596T"
                     /db_xref="GeneID:16997875"
     misc_RNA        complement(1508955..1510741)
                     /locus_tag="CYME_CMT596T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461718.1"
                     /db_xref="GeneID:16997875"
     gene            <1511244..>1512596
                     /locus_tag="CYME_CMT597C"
                     /db_xref="GeneID:16997876"
     mRNA            <1511244..>1512596
                     /locus_tag="CYME_CMT597C"
                     /product="heat shock transcription factor"
                     /transcript_id="XM_005539481.1"
                     /db_xref="GeneID:16997876"
     CDS             1511244..1512596
                     /locus_tag="CYME_CMT597C"
                     /codon_start=1
                     /product="heat shock transcription factor"
                     /protein_id="XP_005539538.1"
                     /db_xref="GeneID:16997876"
                     /translation="MDLLAKAAETSTAGEDSESSPRKSTGDRPKRSEPTPFILKLYEL
                     VSDPSTDDLCTWTENGDSFVVLEPGRFTSEILPRYFKHHNFSSFVRQLNQYAFNKCSC
                     VRLEYRNPNFLRGRFDLLAQIERRPNRKPTPPSLPTVSPDTGPPTTAGSGAIKAQLPS
                     PSAAPSNQEAASSWPGPGFAAWRPPQANWQPSQGKSPDIFNPQAGACWPAAVYGPGGY
                     VGSSLGPVPARPDVFPGRDSNYEAFRLRRHFSPELASRISQWSRSEDAPASGRMESHR
                     ETAESPAWGACGARDTRQAEQATASTASQSTQSLRVARYPASTLVSVLRERLLAVGSE
                     YVHVDTALNLVAELEAQQERELLSICTETIHAVDRFRSCLWTLCARRASRAYESAVGE
                     PFTFAGRSTSTSNPTSGQTDSPMEQAQSSATTDAPAGSSSVLGSMDMGPQPDVPLPGK
                     "
     gene            complement(<1513349..>1514641)
                     /locus_tag="CYME_CMT598C"
                     /db_xref="GeneID:16997877"
     mRNA            complement(<1513349..>1514641)
                     /locus_tag="CYME_CMT598C"
                     /product="similar to heterogeneous nuclear
                     ribonucleoprotein"
                     /transcript_id="XM_005539482.1"
                     /db_xref="GeneID:16997877"
     CDS             complement(1513349..1514641)
                     /locus_tag="CYME_CMT598C"
                     /codon_start=1
                     /product="similar to heterogeneous nuclear
                     ribonucleoprotein"
                     /protein_id="XP_005539539.1"
                     /db_xref="GeneID:16997877"
                     /translation="MQALVGALRPTLAGPLDQHTDIRDLLPEQGGFFDWRKVLAGFSK
                     THPPADKRDSEPCPTGVASENRGAAHCPHSVSPVSVAPVVVRFHSLDEMVAWAFSAPP
                     RILSTEDHTTWNVSAMPNAGPGPTSSRRAQVFVGDLSGNVSERDLVDCFSNYGAVRSA
                     YIKRDPVTGKCVGFGFVEFQHSRDAERARLLAHRLRICSRRIRLGPAYHRRNGYEVVA
                     YEAPRDMTNERLHDFLAQRFDDDVFDPHGTFVVEPERLGPLWYGAERVVRIRFRQSWV
                     ADLIVQAGWIEWSPGVRSPVHAAQPYSICRNGVELQFGDGWMPPDALIRPHFDAFGAP
                     IQAVLTVPSRQVAYVIFEASWRGIHAALHSMRKVRTISTRQVWCHHCKVSTEFLLAYG
                     MALEDWRLRQNGRIPHDSHVIYIGCPATLPDLLVDRPC"
     misc_feature    1513518..1516099
                     /note="possible transcribed region"
     gene            complement(<1515848..>1517203)
                     /locus_tag="CYME_CMT600C"
                     /db_xref="GeneID:16997852"
     mRNA            complement(<1515848..>1517203)
                     /locus_tag="CYME_CMT600C"
                     /product="NAD-dependent deacetylase sirtuin 1"
                     /transcript_id="XM_005539483.1"
                     /db_xref="GeneID:16997852"
     CDS             complement(1515848..1517203)
                     /locus_tag="CYME_CMT600C"
                     /codon_start=1
                     /product="NAD-dependent deacetylase sirtuin 1"
                     /protein_id="XP_005539540.1"
                     /db_xref="GeneID:16997852"
                     /translation="METGESPSSESLEELSEGTEASSPSGSTIYSSALALLRGERHVR
                     VGASETELRKLLADEIGPERLKELVEETKLDEETILATVLASILERGYVRPKLPEINT
                     LSDVVSLLRNSENILVLCGAGISTSLGIPDFRSEGGIYERVQARYPFLDDPQMLFDLD
                     QFLVDPRPFYEFAAEIFPPEEALRKPSFCHRFIAQLERSGKLLRCYTQNIDGLERAAG
                     ISRTIFCHGSFDTLRCVKCNRSRAICEQDRHQIRRGNVIYCERCTGEEALHANDKRSS
                     LDDGLASDSEDSCGSDGFDPEPVMKPGIVFFGEPLPQEFFDSIEDDLRRADMLLVIGT
                     SLQVAPVADMPRSLDASVPQILVNREVVARARIQFDVELLGDCDFIVRLIAELLGWSD
                     KIGDTERCSLAGDPEQYFQLPSRYVFPGARLDPDGAGHRLQADDMSQNPESGATWNGF
                     Q"
     gene            <1520672..>1521418
                     /locus_tag="CYME_CMT601C"
                     /db_xref="GeneID:16997853"
     mRNA            <1520672..>1521418
                     /locus_tag="CYME_CMT601C"
                     /product="similar to transcription factor DP-1"
                     /transcript_id="XM_005539484.1"
                     /db_xref="GeneID:16997853"
     CDS             1520672..1521418
                     /locus_tag="CYME_CMT601C"
                     /codon_start=1
                     /product="similar to transcription factor DP-1"
                     /protein_id="XP_005539541.1"
                     /db_xref="GeneID:16997853"
                     /translation="MRSGRPREEKGLRHFAVRICHKVEQKGETTYNEVADELVAELLQ
                     GNNGVAPRDPASEEKNVRRRVYDALNVLCAIGVVHKDRRAVRWHGLPRASVREQSLLE
                     NELSRLSSSVRDKDGRIQRYRTIVRALERLVQRNMRGAAVASSGRPRSASLQGDSAVR
                     LPFLLIATDPDAAVDIDGDEPGSDRCSFTFNRPFQVYDADGVLLELDAMICNSGARQD
                     SASVPATTNCALGSNEASASATAAASEPPL"
     gene            complement(<1525781..>1527277)
                     /locus_tag="CYME_CMT602C"
                     /db_xref="GeneID:16997854"
     mRNA            complement(<1525781..>1527277)
                     /locus_tag="CYME_CMT602C"
                     /product="similar to lanthionine synthetase"
                     /transcript_id="XM_005539485.1"
                     /db_xref="GeneID:16997854"
     CDS             complement(1525781..1527277)
                     /locus_tag="CYME_CMT602C"
                     /codon_start=1
                     /product="similar to lanthionine synthetase"
                     /protein_id="XP_005539542.1"
                     /db_xref="GeneID:16997854"
                     /translation="MATPRRGTVRFRKGARFFENDLNPSQFSELAQVLDQGRYDSEVF
                     TTFALKTLDNLRCTARAIQTRYPPRFALRDPTLYTGGAGICIFFYHVWRNLKRISQEP
                     SMDESLRQAMQELAESALASAAEYASFSLQGLSQSHQRGTFRWDQVVAERGPSVFCGQ
                     AGVYLASVLVENARANTEACKAYMEQFIRMGQYAVPDTQHQAPSCADEVLYGSAGYLL
                     GWLYLQRELGPNAQWLGQDIAEDVVEYLMMRGSILADNCQPGANILLYQWHDNMYMGF
                     AHGLMGVTAALLEACAALPEKARPTQSDALLKNTLGFIFSHREPDGFYDTRVKLQERS
                     RFQELRSTDSKRLVQWCHGSPGALFLCAATQRRYPHFPNLSEEASLAARVTWQEGLLR
                     KGPGLCHGIGGNAYALLCCYQIARSSDPNAIEYLQRALAFADFQVSRSKAVPDAGMAS
                     AIDRVPWLLYVEGTRIPDNPYSLYEGIAGFGCLLVDLLLPREARMPPC"
     misc_feature    1527476..1528990
                     /note="possible transcribed region"
     gene            complement(<1528641..>1530998)
                     /locus_tag="CYME_CMT604C"
                     /db_xref="GeneID:16997843"
     mRNA            complement(<1528641..>1530998)
                     /locus_tag="CYME_CMT604C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539486.1"
                     /db_xref="GeneID:16997843"
     CDS             complement(1528641..1530998)
                     /locus_tag="CYME_CMT604C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539543.1"
                     /db_xref="GeneID:16997843"
                     /translation="MILESRTASFDATPEIVAHPRSRKPTTRELARLGGSVRAARRPT
                     SRMPRVRRPQERNRPEMLQQPAHGSVRKRLLSLALVPLMVIVLFMVQARMTAALPVKS
                     PNPVWHKQTFASRPSGHIALESTHLSRWSIQRQLAVVTGVSAQSAQNRGASRKVPREI
                     YGTITGKWMLPTTVSQSGANEPSAPSGNASLVVENTKHTITVPRRDVYQLGLHESSGF
                     ASLSLIQRLAPKLLDDSNSGTRGGQDAGASPRAAIDVVLGDILLRDGRYRSKGDVWMN
                     VLGLYSFPDGTLLLAGDTRVRPRGAIKQLYEAYLDLPQMKDERTPLDLATFERTIVEA
                     LQSPASEAAGGPRVSENGTLETLSRTKDALRSREACNSESVSLDAARLRLNAANTRAA
                     VLTNRERTKSANESAQSQWYNPAILCPIRAVLHVDKYSNEHNGRNHEQRPLNSAGLAE
                     AVLPQLSMIGDLDTSDACRGRARFQLRLSTANTMRILSAAQKYSLVSILFAIMQIAVI
                     LKQMESTNTQASAAKISMLSVGMQAIMDAYMCLMHLVFGVVVQALFNAFATASFFYFV
                     IFSVFEMRYLLMIWKARNWRVNNTGWDTVRRELSLLYSRFYAALLIGVLAIYHMQNHL
                     NIIIFGMYSYWLPQILRTAYLDARRSFLLPYALLSSSARLLAPLYFLGCPSNFLHLRP
                     RPRLCIGLVCWSLLQIVWMESQARWGGRWFIPRRLRPQKYEYSRPFAVHSQGDCVICM
                     QSLEDEETSAVMVTPCDHAFHSECLLKWMEIKLECPTCRRALPMP"
     gene            <1532083..>1533630
                     /locus_tag="CYME_CMT605C"
                     /db_xref="GeneID:16997844"
     mRNA            <1532083..>1533630
                     /locus_tag="CYME_CMT605C"
                     /product="box C/D snoRNP component Nop58"
                     /transcript_id="XM_005539487.1"
                     /db_xref="GeneID:16997844"
     CDS             1532083..1533630
                     /locus_tag="CYME_CMT605C"
                     /codon_start=1
                     /product="box C/D snoRNP component Nop58"
                     /protein_id="XP_005539544.1"
                     /db_xref="GeneID:16997844"
                     /translation="MLVLLETSTGFALFKLRHESRLRAATEEDLGAIFESDPERLGKF
                     LKLKAFQKFKDLSEALTAAAALSEGKLSKSLKKFLKRNVEQSDAVAVCEPKLAGIVKE
                     KLDLECVYDPGLNEVMRGLRARYSDLLRSELELETERPMVLGLAHSLSRYKLKFSPDK
                     IDTMIVQAIALLDDLDKEINTYAMRLREWFGWHFPELSKLVPDNALYAKLIAQMGTRR
                     GVSRIDWEQFGDQVHREAVESAARVSMGTEISDEDERNIEELALQVVSLSEYRAELFA
                     YLCNRMRAIAPNLTAMVGEIVGARLIAHAGSLLNLAKFPASTIQILGAEKALFRALKT
                     KHPTPKYGLIYHASLVGQAPPRIKGKISRVLAAKTALAVRLDALTERDENVEQITAVD
                     DESAARVALGMENRAKVERRLRQLESAASSRAPGRRQAQSYPATVHADSTRSRPSRYD
                     PPVEKRSYRVGDDALPSDGYSFRPAAANKAHTSADQADDKKRHRNGPSGTGSRESKRP
                     KEADERP"
     gene            complement(<1534958..>1535923)
                     /locus_tag="CYME_CMT606C"
                     /db_xref="GeneID:16997845"
     mRNA            complement(<1534958..>1535923)
                     /locus_tag="CYME_CMT606C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539488.1"
                     /db_xref="GeneID:16997845"
     CDS             complement(1534958..1535923)
                     /locus_tag="CYME_CMT606C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539545.1"
                     /db_xref="GeneID:16997845"
                     /translation="MTASGRLQHQRLVSRQATAFVYCAGSRHFFTKRWSVNCCQGRES
                     ELVHRYQVRKQQSASVTVPRFETVSAVPSGRCCRASRSASGESGPVPAVQPPKLGFVC
                     TFGTRITVDLFWIGLLSELALFPLGLGLGALFSFDVLQHTNWTDVEAVRDGVLYTVPF
                     SAIFFSLDILPIPAIKRLKRLTELTVRKVFGERSVLETLLFCMAAGFGEEALFRGAIQ
                     GLLDRYFGVLPVSVAVSALAFGAAHSANVAYFVLSSMAGAFFAIQFELAHHNLAAPSI
                     THSLYDWVTILAIKFFAQPPDAPAPNIDANTAQPDEFKAGTKDPP"
     misc_feature    1537808..1540017
                     /note="repetitive element"
     gene            <1539069..>1540097
                     /locus_tag="CYME_CMT608C"
                     /db_xref="GeneID:16997846"
     mRNA            <1539069..>1540097
                     /locus_tag="CYME_CMT608C"
                     /product="SEC14 protein"
                     /transcript_id="XM_005539489.1"
                     /db_xref="GeneID:16997846"
     CDS             1539069..1540097
                     /locus_tag="CYME_CMT608C"
                     /codon_start=1
                     /product="SEC14 protein"
                     /protein_id="XP_005539546.1"
                     /db_xref="GeneID:16997846"
                     /translation="MAFSGSSPERERSGSWIPNGSESFFGSEGSEAPEGAEGLGTVYT
                     PVLNAAQRAKLEALSELVRSAAELNLTPTEKAWMDEACLSRFLRARRYHVQKAFRQLH
                     ETIVWRRSFGVEQLMLDPELADVKRQSETGKLYVHGKDRFGRPAVFMKPRLQNTSERK
                     TAHEQMRQLVYTLERAVAEMMPPVEKICLVIDFPGYSLRNAPSIKVQRQTLKILQDYY
                     PERLGFAVCIDAPAIFWTFFEIVKPFIDRRTSAKIQFCSRKAKEGTKQNMRTLMNQLF
                     DPEALEIELGGRSAWRYSNEEYFRERVLPEYLRIKSYPERVEMIPCAEEDVNNTQDVF
                     YDSMSCLD"
     gene            complement(1544652..1546149)
                     /locus_tag="CYME_CMT609T"
                     /db_xref="GeneID:16997847"
     misc_RNA        complement(1544652..1546149)
                     /locus_tag="CYME_CMT609T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461719.1"
                     /db_xref="GeneID:16997847"
     gene            complement(<1547206..>1549113)
                     /locus_tag="CYME_CMT610C"
                     /db_xref="GeneID:16997884"
     mRNA            complement(<1547206..>1549113)
                     /locus_tag="CYME_CMT610C"
                     /product="methylenetetrahydrofolate reductase"
                     /transcript_id="XM_005539490.1"
                     /db_xref="GeneID:16997884"
     CDS             complement(1547206..1549113)
                     /locus_tag="CYME_CMT610C"
                     /codon_start=1
                     /product="methylenetetrahydrofolate reductase"
                     /protein_id="XP_005539547.1"
                     /db_xref="GeneID:16997884"
                     /translation="MNGTVEVECPKRPESRNSVAAFREPTVRELPQIKDKIAHCVEEG
                     KRFYSFEFFPPKTEQGLLGLYERIARLSRLEPLFVDVTWGAGGSTSDLTLELSGNIQK
                     FFGLDVAMHLTCTNMEEGMVDKALEEARKRGIRNIVSLRGDPPVGQEWRQCKDGFAHA
                     SDLVRHVRKVYGDYFCLIVAGYPEGHPAGLLDGKLTYEQELNYLKEKVDAGGDLIITQ
                     MFYDVDQFLRFVRDCRSIGIQVPILPGILPIQSYSGFKRMTGFCRTHVPEAVAETVER
                     LKDDEEAVKNFGIEYGTEMCRRILNSKLSLGLHFYTLNLEKATVSILENLGLVPKFES
                     VRALPWRPATIDGRRSEDVRPIFWANRPASYLLRTETWDDFPNGRWGDSRSPAYGELR
                     EHHLLGGGGLYTADQLERMREALGTPQNLHDVSAVFVKFLRGETKAPFPWASEPLANE
                     TNLIAAALERMNWQGFLTINSQPRVNGAPSTDVTVGWGGAGGYVYQKAYVEFFCSEER
                     MIQLLDAVRGNTPEFGSLSIYAINSRGDLRTNVRKPRTNAVTWGIFPDREVIQPTVVC
                     PESFKVWSKEAFALWKQNWSSIYDPENGTPEERRAYALIEHIRETFWLVNVVDNNFVT
                     GDIFKLFARIG"
     gene            <1552156..>1553199
                     /locus_tag="CYME_CMT611C"
                     /db_xref="GeneID:16997885"
     mRNA            <1552156..>1553199
                     /locus_tag="CYME_CMT611C"
                     /product="malate dehydrogenase, cytoplasmic"
                     /transcript_id="XM_005539491.1"
                     /db_xref="GeneID:16997885"
     CDS             1552156..1553199
                     /locus_tag="CYME_CMT611C"
                     /codon_start=1
                     /product="malate dehydrogenase, cytoplasmic"
                     /protein_id="XP_005539548.1"
                     /db_xref="GeneID:16997885"
                     /translation="MESLARLTPLYPDRALIVAVTGAAGQIAYSLLPLLASGTVFGPQ
                     QRIKLQLLDVPAAESVLKGVCCELEDGAYPLLDHPVLYTSVADEAFAGADIVVLLGSF
                     PRKPGMERKDLLAKNGTIFRDQGQALNRVAKADAHVIVVGNPANTNAWTLSQFCTKIP
                     KEHITALARLDHNRLKSLVARKLDSAVSDVHNVIIWGNHSATQYPDVTYAYTPQIVQG
                     KMRAALGGDSQLASEVIPLIQKRGAEVLALRKLSSAMSAAKAIGDHLRDWMFGTQTEN
                     EIVSMIVPSDGSYGIDKGLMFAFPVQCHRGGKYRIVSDLRIDDFSRKYIETTLAELRS
                     EREEAMRLVSKMC"
     misc_feature    complement(1553672..1555086)
                     /note="possible transcribed region"
     gene            <1555736..>1557037
                     /locus_tag="CYME_CMT613C"
                     /db_xref="GeneID:16997887"
     mRNA            <1555736..>1557037
                     /locus_tag="CYME_CMT613C"
                     /product="DnaJ homolog, subfamily A"
                     /transcript_id="XM_005539492.1"
                     /db_xref="GeneID:16997887"
     CDS             1555736..1557037
                     /locus_tag="CYME_CMT613C"
                     /codon_start=1
                     /product="DnaJ homolog, subfamily A"
                     /protein_id="XP_005539549.1"
                     /db_xref="GeneID:16997887"
                     /translation="MRRDLVLLVLILLVLVPFYSKGVTGRDLYEVLGVSRSADEAEIK
                     RAFRKLALQLHPDKNPDDRGAEQRFKEISTAYEILSDREKRHIYDNYGEAGLKAHEGA
                     SSAGGAEGHGFFEPFDLFEQFGSVFGGGFRGKPRGAHRESAASDLPPGPDLLLVLPVT
                     LTDLYNGAVREVVHRRRVRCPKWFQSCLTTCSACHGRGVQIITRQLGPGYVQQIQTIC
                     TVCGGKGRTVRTPCDACPHGEFEQQEKLLTIDIERGAEDGSRIPFEGEGDEGPGTSAG
                     NVYFILQSEPHPYFWREASAGRSLDLHMNLSITLREAMMGFERVVKHLDGHDVRISNG
                     SADILATGDTLRIPGEGMPSRVAPNEASGRVPYGELLVHVRVLMPSRSALGSELLQRI
                     ASLLPTEQAKYNSDVDRVWETRGRQSPASSNRTASRPHDEL"
     misc_feature    1559649..1561366
                     /note="possible transcribed region"
     gene            complement(<1560523..>1561695)
                     /locus_tag="CYME_CMT615C"
                     /db_xref="GeneID:16997901"
     mRNA            complement(<1560523..>1561695)
                     /locus_tag="CYME_CMT615C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539493.1"
                     /db_xref="GeneID:16997901"
     CDS             complement(1560523..1561695)
                     /locus_tag="CYME_CMT615C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539550.1"
                     /db_xref="GeneID:16997901"
                     /translation="MIRTFLIVSQSGLVLYSKAVLRPVEQPRLVGSLLTAVMEFVTRQ
                     TRRNISQVQFDDMLLTLVTAKRARITAALFQDLSDSCQLGRLVATKLLDDFLTMFEDV
                     LLSGLTTDGQGFSRSATYGRSYTSDDSLSAHAASPLTDGDAPGHPSQHMRNASEVSGG
                     SPIPRSAPELVHHVIDSELRAAAPSLGFTASPRGAVTMPSLVPGISGRKPPFSSRSLV
                     QNVTLLDRFRQFDGAFSDAIQKSALAVVAEFTRLRNVKRAILLRGNKVIASNATVDQV
                     ALLANVQFLIDDTEQILMVQGDEMRDLLFESESGLVLIRRLYVGESEDDETTDTSSIG
                     GLYSVASMDSTTQNSALILLIFAQPEIEASEWEKVEELAKLIEDVASLHANLRIAS"
     gene            complement(<1563347..>1565152)
                     /locus_tag="CYME_CMT616C"
                     /db_xref="GeneID:16997902"
     mRNA            complement(<1563347..>1565152)
                     /locus_tag="CYME_CMT616C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539494.1"
                     /db_xref="GeneID:16997902"
     CDS             complement(1563347..1565152)
                     /locus_tag="CYME_CMT616C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539551.1"
                     /db_xref="GeneID:16997902"
                     /translation="MATLPPVSSSARGLQGGDTRSDTSSKPENVPVWRAPGFGAITSA
                     RSTVAGAAAHSGGGPVRRNYANDAEREQKLLEFGIKPLPQFTFEEIKQTQRDVLRVIA
                     MVYDAPRGRTRADLELSLAEKLAAYHPGDPAYDLSKFQASEPKRLGNNYVQRQLVGAR
                     PFIMDGTFADMTGRGSGNRRTSTAAAAAAAAAAAQTGLLHFPAAVTGTDRQVDQASLR
                     LAQLVPNLQTPAGIAAARATAVEPGNIRSGVLHLPEPEGDILLGLHPSSHAAYRWCSR
                     CGTDVSTRFHNWYLHILKCDPIFYQNELSAFFSSRAGAGTPVLPPFGFPGGVKVSVPE
                     EQHALVSRSKYMAALNGLGPDRVPVFVNAAKYFKTCVDPNETLERVEAIARWLRNTTL
                     LKRVFESVQLVKRLPNAISDPGNRKILGFSSVSTETMAVTGPENPDKQLFYLESGRML
                     VSDNANQKEHRLGAGGTGAAVPGSKFSARVHLGSGAASQSAASALETSTRQDANAAAS
                     SGGPSDEDLRNEHPRGSIRDEQRFGRMMQHLGLARSIDEVIEVKKDFEREFGVTFDTR
                     SPIIRKRPRIRGISEPQQQQQQQQQQQRPLRLLRL"
     gene            <1568178..>1570895
                     /locus_tag="CYME_CMT617C"
                     /db_xref="GeneID:16997903"
     mRNA            <1568178..>1570895
                     /locus_tag="CYME_CMT617C"
                     /product="coatomer protein complex, subunit beta 2"
                     /transcript_id="XM_005539495.1"
                     /db_xref="GeneID:16997903"
     CDS             1568178..1570895
                     /locus_tag="CYME_CMT617C"
                     /codon_start=1
                     /product="coatomer protein complex, subunit beta 2"
                     /protein_id="XP_005539552.1"
                     /db_xref="GeneID:16997903"
                     /translation="MPLRLDPVKVAQVRSERVKGVELHSREPWVLVALYTGQVLIFDY
                     DRCVALKQFEVSDQPVRCARFVERKNWVIAAADDLYVRVYNYNTMEKVCEFEAHQDYV
                     RSIAVHPTRPLLLTASDDMAIKLWDWERNWNCTMVFEGHSHYVMQVVFNPKDPNTFAS
                     ASLDCTVKIWSLSSPVPNMSLEGHRKGVNSVDYYPGNDKPFLISGGDDERAIVWDMQT
                     RTPAQELVGHTANVSAVQFHPVRPLILTASEDGTVRVWNSNTYRLETMLSYGFERCWS
                     LACLRSSSVIAIGCDLGTIVVRIGKDEPVYSMDQSGKVVFAKNNEIFFVALRQAQLDQ
                     VADGARVSAPLKEMGTTEIYPQRISHSPNGRFIAVCGDGEYMIYTALAWRNKSFGTGD
                     ELVWDNGPGEYAVREGNARVHVFNRMQKERAVIRAPFPIKAIYGGPLLGLGGEDCICF
                     YDWASLQIVQRIDVAATNVLWSDTADLLAIITSDSFFVVRYNRSTVDAALEASQGVLG
                     ADGVDDAFSVLHEQADRIGTGRWSGECFVFCTHSGRLAFLVGTESTTIAHLDRQLYLM
                     GYLPTDNRVYLVDRDLQIISYALLASIVQFKSYIQKGMLREALDLLQSIPHAEHNRLA
                     QSLERAGYKQAALEVATDTDYRFELALTLNKLDLARSIAEQAPSETRWRQLSEAAMAN
                     NDLPLAEICMRNAHDASSLLLLQVARGDAAGLRDVASIALRAGESNTAFLAKLLLHDR
                     QGCLDILIQSQRFPEAALFARSFIPSKLAETVQLWKKWLRSKGEDRAAERLVDPALHP
                     ERFPGVPRSPLADHGLADARNGTNSVSDEKTEANKRTQVNLVSDLPDVSQLALDPGSP
                     VVSSTGTADAQRQSTDDELGRSPASAGPSSLEVARTRSVSHDSNWDVDF"
     gene            complement(1569992..1572611)
                     /locus_tag="CYME_CMT618T"
                     /db_xref="GeneID:16997904"
     misc_RNA        complement(1569992..1572611)
                     /locus_tag="CYME_CMT618T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461720.1"
                     /db_xref="GeneID:16997904"
     misc_feature    complement(1573486..1575209)
                     /note="possible transcribed region"
     gene            <1574030..>1577476
                     /locus_tag="CYME_CMT620C"
                     /db_xref="GeneID:16997906"
     mRNA            <1574030..>1577476
                     /locus_tag="CYME_CMT620C"
                     /product="hypothetical protein"
                     /transcript_id="XM_005539496.1"
                     /db_xref="GeneID:16997906"
     CDS             1574030..1577476
                     /locus_tag="CYME_CMT620C"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_005539553.1"
                     /db_xref="GeneID:16997906"
                     /translation="MSTLAEVKQALWELLSADADVRCRAASTILQGSLHLPDEDFAYT
                     CRRLVAGLVSSVQGAREGFSLALCACLRQLRAAEVEATGHRRQALILDALHRAYDLEG
                     VPTTSDPLQNVKHVGDAREIALARLFALGAVLGSWEPSHCESLPPLQLGGILEVLAHI
                     ADQDTKNFAEACGRLACEAVAKLCVDRSLFRAGSGARAAVLRYWKRRQRQGRPTLDAL
                     AVMLFCRNRYTLRASEADCPLWGQESPCRSPELLRRYVVPVIEDLSTEHSPVMPRAFD
                     LLLAEMDADVTPSDDGNAPARKRHRSGDSSKAAWIMLYEQVVAPHLFSSKHPAHVALA
                     LRLCMKALQIAASSPCVQAQDWRAMLAHDDWNEHLWNVSPLHRKHAHDLEPLLKALTD
                     ALVALLGRRCPLSTSLAEILWEKELQRARGEHQGSPAVVVLEAAARHLRATELARMVR
                     SSVDLTKLPLLVRGWNESLRRGAAAERTECSHKVLALLDSLAALIESGSSSRLERQHW
                     RGPLFSVAAFIATWSEYAANEPVPDWLGSMRSLLGCMQRKAQPESERALCVCTAHLES
                     LAALSEHRASRLALLTLALVLIVAVSAWSAPSPSPKKGAQRTPSEPSDLILHHCVPFL
                     DRCIEHLRTPGLDGDMFEIELTRLCLQLLRLDDSGVRSAVDVIFASMIASTQQTAAVL
                     RVVLGELPGLADQDDTSTDDLDDAEADLRSSSSESDAPSISADEATTDASDTSDASDV
                     ESSRPQVDLQADLELDMDEEEPAVLAAYDAQLVAALKPLVGERRRTSQLSASNAAERL
                     RENAFHHRVLDLVQIAIRYQTRAAGFAPVTLMDLLGALHHAADFIAETQGTDAALYTR
                     LVHGVLGRTQRAAAAASQVVEAAHERAFLESFQNLLEQVVALATARPHAVRFTEHDAV
                     ALHAGIRLALQAARSAQASTRMVELLSSALLQPILNHYLTTRGRVVSAEPQKRSSIAV
                     SSLVTFLGDLGRRMPAVFACPILEALHGMLANAQAMQQDGRHGLRSHALLECWAVVLP
                     LATSMPTVAFLSVERRLPILERWIEAIAAWNLGSAGQRKLLKLSQPFLRQLAKDLNTL
                     TSSAERDTYRCRIRCLVESKLQVLALGNAAGSKQRELLDQVLQTCCNSVAQVAGSVRA
                     IS"
     misc_feature    1577644..1579589
                     /note="possible transcribed region"
     gene            complement(<1577742..>1585106)
                     /locus_tag="CYME_CMT622C"
                     /db_xref="GeneID:16997908"
     mRNA            complement(<1577742..>1585106)
                     /locus_tag="CYME_CMT622C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539497.1"
                     /db_xref="GeneID:16997908"
     CDS             complement(1577742..1585106)
                     /locus_tag="CYME_CMT622C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539554.1"
                     /db_xref="GeneID:16997908"
                     /translation="MNLITKAARYVAGADRNPATSGVTEALDLIIHRLHCGRFPSERL
                     QCVEVLLRRVTAADDKVAELLEQADADACDEVSEALRVALSLREELVTKGVPLLGAIL
                     EQDRTESELIQSTLALLQLLLCAPTVSLAGSLEDSTQAASSERRSLVRRRSNTSCQSK
                     EAVAPLHRNEDIWRKWSADTASTIRTAVSMMLGAASPPVTASERAGLGLVPCLLDLLA
                     DGDYSVRLQVSDLLTHIARHALPPLQKAVLRCPRGVSRMMDLLRDPREVVRTYGLRLV
                     MELSRNSGEIQRILAFENIFELLFEMIDKARYEEVSVHVDEQSDEVQISRRYAPAENG
                     DADDNSETDDTDGFPASGRPQSESLARTSASDESLRQQQHVPMVLASTSDVMDLVTRD
                     CLIFMDILLDGDPAIATLFAEAGCIPKLCPLLFLADHPAKALRPVQVDNLILTIGLVD
                     HLSRAESTNKEPRTRALCLHYGVTESIARLICSARNADAVVVQGLLTLGRLSRDHVAT
                     LSFLHGLWVVVAEVDDSSQARTSRAPNGKEVHTLFLAFVLDMMTEHASQELRAAAFCF
                     LSMVWLESESGLCWFTWMLADKRQTCGAVDPASSNPHASEVLKDVESIDERTAHALQR
                     VVSELLGVAVGWPDEADPAAVLYACSLLASWMVRCCAQGSSVADQDPLLMPVSRYRVV
                     LGAGALTGECSAGEPLFMKLLRTLGRAVRENSPPLVRLALLLLLCCWLYVSDRARQKF
                     LSTPLNVPLLMDLVSSSGSRAEGMLFVHIRGLAALAIAECMELECAEAESLVISPRTL
                     VGIVRKRIGLMRFASYLDDVRASAYFAAAITGSPGLLLEQRFARGVLTTESRQGSGLV
                     EELGHMYIFPQELVSIMEPVYDCVQKRLLHEYVEQEVPPSDTEMQGSTLKSAEVGVSA
                     SPRNAKEFATPGSLSIDNRHFDDTTNKSSNEIRAMQMRIRELEDMVAQLDEYKRMIRK
                     QDEALLASKEEVEMLRRSLRESQDYADSLLRGSESRFREELRLVRDQLTEREDLVRRL
                     TEQVASLEQALQSRQRDVESISKACEALALENEQLRNAGAHVDDGSSVLPAQHVHSGV
                     FRDPAERTTADHFRSNEAHAYIDETSESSACDITDVRILERALAEERQKNERLMILLN
                     QFEDAERGEDSASELVRIENAHLRERLRALEDYIQSQNRTNTGADGAPSDAVIESAAE
                     DASGSGSASPRYPASEAPPLRSSSEDRFATVLRADTSFDPAIDAGSREQRIADLETQL
                     VSLQKMLERSEEDAYETQQILEEQVIRLEQERDTLRTELASLRSAAERVTTHDQHQRP
                     DVASTGTQTDVLAALQPSESELEAASRVSGERAAQVASMVVSGRVPSADQPPDALIDR
                     WVTGDSLRCEVAPANALAAGTTASGRLSIALDALHNLSNRFDGDLVHVLASLRSMEAR
                     VDTLCTRIWRCSAILPAHIPRGSDASVVLSGSAEAKMTLQRTTVGACTAPEVGTCVAP
                     LEALPELFAYALRKNQAIARERAAGYGAFRVEVLILEEILIKGLALGALKDAAVKLFG
                     YLKPGYAEAGPVSHAVGSWQRLEDAFAELRRSETQLAELETQYRSVCDERDRLRSECA
                     SLGHAVAAQQAAQTQLAELETQYRNVCDERDRLRSECASLGHAVAAQQAAQTQLAELE
                     TQYRNVCDERDSLLEHASRLESVQETCTNLKSELDAHVHEKALLNSRIRSLEEDLAQV
                     SHSFTVLREQHADCDGQTAELQRLEELVQLYQTRIEEYEEALTAATRDRRRLEDLEDS
                     MRTITRRCEELESERRELEISLEQAQADREKLAELEARNRELESKSETRDAELEELSA
                     QVLLLQETLASREDQVQHLQSQVQNLQNALGLEREEALAAEKQYEEISHELQSQLDRV
                     LAEHAETQLAHDECVAELHQTNQRLATAEEQQEALCARIHMIEAEHHRWRRALTDQIT
                     GVIDATASEVSACASTVHFWRDKQFAIIDRQLDMLTDQQATLQECELEFDNLQAQIRA
                     VILSAGATGTEQVADSEARRNERSPQPVPAVLAMHGEHDPDDNDGDDDHDDDDDHAES
                     AIRADKAFAGEQHTHQVQLVRDAYERQLAELESRHEASMREMMRVHEQVLQELEEEIE
                     HLRTIALASSHKRAFDEASAPETTQYRASPENDSSASYDVDGPAADPASVDALQRSLV
                     KERMASGDLRQENIRLQTCISALRARLAAWEHAQHPNASGTRASVLAGTPNDDDDDDD
                     DNGDDQVSSREALTDTNLPRLEPAHPSDDTRGSHSQHMETAAELPSSAAAQRDLIAQL
                     EKQIEELIARESRLASAVEMVHDENMLLRKQLAEQHHHDKRAQPQQPWRATHVNELDA
                     SGADSSQHAWLPSSAFATASAAVPATGAAVVKAQEQEQDATQVHVDPRAADMEAELWR
                     LREEHNELLICLAEMEMECNAYKERLRKLLQP"
     gene            <1585952..>1587457
                     /locus_tag="CYME_CMT623C"
                     /db_xref="GeneID:16997909"
     mRNA            <1585952..>1587457
                     /locus_tag="CYME_CMT623C"
                     /product="DnaJ homolog, subfamily B"
                     /transcript_id="XM_005539498.1"
                     /db_xref="GeneID:16997909"
     CDS             1585952..1587457
                     /locus_tag="CYME_CMT623C"
                     /codon_start=1
                     /product="DnaJ homolog, subfamily B"
                     /protein_id="XP_005539555.1"
                     /db_xref="GeneID:16997909"
                     /translation="MNKEDADACLKFAHEALRDADLVSALKWARKACRLHDSAEARSL
                     LETLEKSARRTGFVLNSADHDQAVVGAGEDDAAGAGQVPPVNTHDRRGQPSAPVEDAA
                     GAGASGKREADAHAKHQPRSNNYVNTGASHSNGHSQAASEEAASAASHTRTQKPQPAQ
                     TSRQRSSRSPSQRPSTSREDIAEILNARDLYRVLSVERNASDDDLRRAYRRLALRFHP
                     DKNSEPGADAAFKRIAHAFQTLSNPDRRRLYDQTGIDDEQSALRYQQAQAQAEHHADV
                     FFMTGSSSFHGARGARIYTPDAFDGFFFGPGEMSAEELFEAFFYGGFGAGMPMSYLAQ
                     RRAAFLSRARQQRQRGHPSAAGNAGHARRLGMFWHFMPFLIFLFLPYILSALAPLPSF
                     VLEPQGAFRWERRTTDTNLPYFVRDEAHKRQKEQHIELERRVEREWLQRYADSCRARR
                     REQAQLLGFARRAWTHRSRTAYENAAEAVPMHDCESFEHLRLRLANTSRSR"
     gene            complement(1586059..1588717)
                     /locus_tag="CYME_CMT624T"
                     /db_xref="GeneID:16997910"
     misc_RNA        complement(1586059..1588717)
                     /locus_tag="CYME_CMT624T"
                     /product="hypothetical transcript"
                     /transcript_id="XR_002461721.1"
                     /db_xref="GeneID:16997910"
     gene            <1588931..>1591897
                     /locus_tag="CYME_CMT625C"
                     /db_xref="GeneID:16997893"
     mRNA            <1588931..>1591897
                     /locus_tag="CYME_CMT625C"
                     /product="ppGpp synthetase/hydrolase Rel"
                     /transcript_id="XM_005539499.1"
                     /db_xref="GeneID:16997893"
     CDS             1588931..1591897
                     /locus_tag="CYME_CMT625C"
                     /codon_start=1
                     /product="ppGpp synthetase/hydrolase Rel"
                     /protein_id="XP_005539556.1"
                     /db_xref="GeneID:16997893"
                     /translation="MWALFERKVEWSALHSAHAFHLDKYTIDSLFRSDSLAKSGQLHL
                     GARHGYTSGTAVRQGELSWVSPVCSGLFVALSGRLVQRQCSGWNGFAAAPRRRRRGQR
                     CVLSVNQPKEEPSPQRAPPAHPAPTLHQPQPLPLQQQNQQQPQQATVNASPLSLSPSL
                     QQAEQHSAPKSSTTRVPAYSAPVEQTFPSPDTSTGEPLKSEKNGNTSATGKHACEADA
                     TLDAISAKVMREILGPLVAYLGPVPCFSIEQALSFVLKSRAAKGEHVSEASLERATGI
                     TSILAELQMDSDTIIAGILTELVESGVASLASIAEQFGNAVARLIEGEAKVSRLPEMA
                     ESPIADENVENLRQMFIAMASDFRIIVIKLAARLHTMRTLQTLPAERQRRIARETLDI
                     FAPLAHRLGIWSVKSHLENLAFLYLYPEEYRKIRSHIEGRMPSYKRILEESKARLEHA
                     LSSDPILRRTVSRIEVAARSKEIYSIWQKLQRGRAQRLDHIYDLVALRVTIDPREDLS
                     VVGTSGTNEMDRDEAEKTRLRDDENGLCYYVLGIVHQLWHPVPGRVKDYIAFPKPNGY
                     QSLHTTVVVDNGSDQAPLEVQIRTRAMDRTAEYGMAAHWYFKEHDQLTAAASNSWLTS
                     IQEWNLDIQSSHEFVELVRRELLGNRVFVFVNDTNTENATRILNLPRGSTVVDVAFAI
                     SADAGYRMIAAKVNGSMVPMNYVLQNADMIQIVRSKYSPGPSLEWVQYAKTRLAQHAL
                     RQFFARWQGETELPKHFTSAADPDLESGSSANDKNGEPGIDGNSSKAASNEERQFRWD
                     RSQRSEDAVNSFLSSMKPEDLLDDMCLQISPAQLVFEDGLEIASASMARCCLPLPSDK
                     IFGVIADGASQVEIHRQGCAVGQRALVQTSGARKLSVQWQSPARSGTTRAARLPACLK
                     VTCIDRNGLLSDVSRAVIEKGITILSTRSTSTQNTAYLEYCVAVINRTELDSLCAALR
                     DIPGVVTVEDGLAPHV"
     gene            complement(<1593005..>1593898)
                     /locus_tag="CYME_CMT626C"
                     /db_xref="GeneID:16997894"
     mRNA            complement(<1593005..>1593898)
                     /locus_tag="CYME_CMT626C"
                     /product="probable ribonuclease H"
                     /transcript_id="XM_005539500.1"
                     /db_xref="GeneID:16997894"
     CDS             complement(1593005..1593898)
                     /locus_tag="CYME_CMT626C"
                     /codon_start=1
                     /product="probable ribonuclease H"
                     /protein_id="XP_005539557.1"
                     /db_xref="GeneID:16997894"
                     /translation="MAYLVSLSRWCRACRFPKRAMRRSRGALSALGAAAHTYVTVRGF
                     SDDSEYRILRRDSRLTHLLTEKEKNRLHLLGELERAFYSSSREDAFRLAGVDEAGRGS
                     LAGPVVAAACVLPRDLWIENLNDSKKLSPFARDEIYDLLLDPRTGVDVGVGIVEADVI
                     DAVNILEATVIAMQKALQALRNGSPAVALIDGSLPATLKRENERNAHNASATEFFGIV
                     NGDASSLSIAAASIVAKVTRDRLMENLDKHYPGYEFADNKGYPTPRHLELLRELGPSP
                     IHRRSFAPVKQFFHPMGMNQE"
     gene            complement(<1595975..>1596568)
                     /locus_tag="CYME_CMT627C"
                     /db_xref="GeneID:16997895"
     mRNA            complement(<1595975..>1596568)
                     /locus_tag="CYME_CMT627C"
                     /product="40S ribosomal protein S5"
                     /transcript_id="XM_005539501.1"
                     /db_xref="GeneID:16997895"
     CDS             complement(1595975..1596568)
                     /locus_tag="CYME_CMT627C"
                     /codon_start=1
                     /product="40S ribosomal protein S5"
                     /protein_id="XP_005539558.1"
                     /db_xref="GeneID:16997895"
                     /translation="MEAQVPAREILLFNKWSLEDVEVSDIALADYIAVKQKYAVYLPH
                     TAGRYQTRRFKKAQCPIVERLVNALMKHGRNNGKKLMAVRIVKHCFEIMHVLTDQNPV
                     QILVDAVINSGPREDSTRIGSAGTVRRQAVDVSPLRRVNVALWLLTTGARESAFRNVK
                     TIAECLADELINAAKGSSNSFAIKKKDEIERVAKANR"
     gene            <1596989..>1598329
                     /locus_tag="CYME_CMT628C"
                     /db_xref="GeneID:16997896"
     mRNA            <1596989..>1598329
                     /locus_tag="CYME_CMT628C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539502.1"
                     /db_xref="GeneID:16997896"
     CDS             1596989..1598329
                     /locus_tag="CYME_CMT628C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539559.1"
                     /db_xref="GeneID:16997896"
                     /translation="MSMEGNADPALAARQYLEQCTDTSTAAVPRERPTKALPVPRRWR
                     TGESDEAERLLADELLLRSLSALPQNYDFEIAKTVERIRRDRIQSVALQLPEGLQVYA
                     CTLADILQRLCQTKGSHTCLKVVILAEVTYGACCVDDLAAQRCGCELLIHYGHSCLVP
                     IQHACVRTMYIFVRVSFETEHLIQCIMKEFEERSERIRLYLVSTIQFQGLLGTVAKAL
                     RERGRFSEIFIPQARPLSRGELLGCTAPMVSTEHEAQETVPSIGDSWAVLYIGDGRFH
                     LESVMIQNAHVEAFYRYDPYGKTLTREFYDHDSMVRERWEAIEAARRPNVRLWGVILG
                     TLGRQGNLNILRRILGMLREDCKQYVAILCNEVTPEKLRLLSGSGIDVWVQVACPRLS
                     IDWGRNLAPDGAPVLTPYEAMVALGRVPWRGRRYPMDYYAGSGGPWSNYYRDGS"
     gene            complement(<1599267..>1599836)
                     /locus_tag="CYME_CMT629C"
                     /db_xref="GeneID:16997959"
     mRNA            complement(<1599267..>1599836)
                     /locus_tag="CYME_CMT629C"
                     /product="glutaredoxin type 1"
                     /transcript_id="XM_005539503.1"
                     /db_xref="GeneID:16997959"
     CDS             complement(1599267..1599836)
                     /locus_tag="CYME_CMT629C"
                     /codon_start=1
                     /product="glutaredoxin type 1"
                     /protein_id="XP_005539560.1"
                     /db_xref="GeneID:16997959"
                     /translation="MGHICFNFAGVGVLVAAGRCNALRAGMQYHRALLHQWVRAPAVT
                     PYTRRALDTFVQRQTQGVGLGVTRFACRVQRVTMSSSSGLEQQLRELVASQPVVVFSK
                     SWCGFCAQVKSLMQELQAPAQIIELDELGNDGIEIQNLLYGWTGQRTVPNVFIGGKHI
                     GGCSETMEAYERGELVTLIKEAKRKSEVQ"
     gene            <1600264..>1600890
                     /locus_tag="CYME_CMT630C"
                     /db_xref="GeneID:16997960"
     mRNA            <1600264..>1600890
                     /locus_tag="CYME_CMT630C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539504.1"
                     /db_xref="GeneID:16997960"
     CDS             1600264..1600890
                     /locus_tag="CYME_CMT630C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539561.1"
                     /db_xref="GeneID:16997960"
                     /translation="MLVAFVSNILCLLFGYLYPVYATYKTLKRADPAETKQWLMYWVV
                     ISGFAVAELVGDVVLALLPFYNEIKAGFVLWLVLPQTRGATVIYNAYVEKYLAHHEQE
                     IERIALETRQRWRLGVGGNATGSGTGEAPPLVEVSALDSPVRSDDVDGRRYRALQQRR
                     ARERTGRRPSATSAQPAGVPYEAVALEAPLPPSDSSPIRASKRLGLVR"
     gene            complement(<1600907..>1602823)
                     /locus_tag="CYME_CMT631C"
                     /db_xref="GeneID:16997961"
     mRNA            complement(<1600907..>1602823)
                     /locus_tag="CYME_CMT631C"
                     /product="sphingosine-1-phosphate lyase"
                     /transcript_id="XM_005539505.1"
                     /db_xref="GeneID:16997961"
     CDS             complement(1600907..1602823)
                     /locus_tag="CYME_CMT631C"
                     /codon_start=1
                     /product="sphingosine-1-phosphate lyase"
                     /protein_id="XP_005539562.1"
                     /db_xref="GeneID:16997961"
                     /translation="MTEEFAVEARRVSCEDSGPEGSPSAAARSEQGTETPTSTNATGT
                     RLNWNTQAPAVTNNGWQIAASECSCSGSALGEACTPDAAPSHVGTGAAARSVMATASV
                     ENSVHSLSESQISWKTRLNDLLERLLPWIPERMASFLYRQATRWLPTLAQRLRSAYAK
                     SLEPMDAVVHPYRGIVPTFDRLPAEGRAPTQILADLDRMIECEAPKWEQGFVSGAVYS
                     GDRAHAEFLSNVYARTTHLNPLHADVWPSCIKFEAEIVRMTASMLHGGPQACGVVTSG
                     GTESILLACKTYRDWGRAERRITRPEIIIPSTAHAAFYKAAQYFNLRLRIAAVNPETF
                     RVKVEHVRKLVNRNTVLIVGSAPQFPHGVIDSIEDLAEIAQKRRVGFHVDACLGGFVL
                     PWLEMLQKLRPDAPHLRDLQVPCIDFRVPGVTSISVDTHKYGYAAKGTSVILYATPEW
                     RRYQFFTLTDWSGGLYYSPTFAGSRPGGLIAACWASMLRMGEDGYMHATDAIFRAAHA
                     LKTGIRARIPDLRILGAPLWVIALAAADPSTLNIYRVLDAMSDRGWSLNGLHRPPCIH
                     ICLTLRHCAPGVIERFLSDLSDCVKSNLELDRSNRTGKTEGMAPIYGLGGTMPARGVV
                     SDLLLSYMDLLYKV"
     misc_feature    complement(1603249..1606602)
                     /note="repetitive element"
     gene            <1607440..>1608279
                     /locus_tag="CYME_CMT633C"
                     /db_xref="GeneID:16997962"
     mRNA            <1607440..>1608279
                     /locus_tag="CYME_CMT633C"
                     /product="ribulose-5-phosphate 3-epimerase"
                     /transcript_id="XM_005539506.1"
                     /db_xref="GeneID:16997962"
     CDS             1607440..1608279
                     /locus_tag="CYME_CMT633C"
                     /codon_start=1
                     /product="ribulose-5-phosphate 3-epimerase"
                     /protein_id="XP_005539563.1"
                     /db_xref="GeneID:16997962"
                     /translation="MCAFIVTGSQCSRAQANVWTKETVACRRGPKPRSSTAKGRPLRM
                     GVERVPPPKPGQVVVAPSILSANFARLGEEVSAVDRFGADWIHVDVMDGHFVPPITIG
                     AGVVEALRPVTQRPLDVHLMVVNPDQHIPAFAKAGADIISVHCEGESTIHLHRTLQMI
                     RSLGCRAGVVLNPATPPMAIEYVLPIVDLVLVMSVNPGYGGQAFIDEVLPKITEIRKM
                     ADRLGKHDLWLEVDGGVKGSNAWRVVEAGANALVAGSAVFGAKDYKAAIDEIRAARRP
                     VAV"
     gene            <1610456..>1612567
                     /locus_tag="CYME_CMT634C"
                     /db_xref="GeneID:16997978"
     mRNA            <1610456..>1612567
                     /locus_tag="CYME_CMT634C"
                     /product="similar to rRNA methylase SpoU"
                     /transcript_id="XM_005539507.1"
                     /db_xref="GeneID:16997978"
     CDS             1610456..1612567
                     /locus_tag="CYME_CMT634C"
                     /codon_start=1
                     /product="similar to rRNA methylase SpoU"
                     /protein_id="XP_005539564.1"
                     /db_xref="GeneID:16997978"
                     /translation="MMRQNDGVGYRLGVWPWNRRPADSELLEPKCRSPRLLFGIGAVL
                     GKPGAYYAMQRIRGARRSHQALCSVYSRRFVASLSESWAEAHTTDAAAEALVQEGVLT
                     RGSREYRLFHGLSATRAEKVLYALRNRTDCVAVVLDGVHGVHNLAAVCRSCDAFGVQN
                     VHFIPPDRYALHSETGSESETGPYATSATAKAHYLGQFLKSAACDTAGGAHKWLSLKT
                     HGSVPELVSRLRALDYRIFVSSVYADRCISLYDLNFVDSRYQKCAFVFGNENSGVSEQ
                     LQEAADSLFTIPMYGFVESLNVSVSVATTLSYVTLQLRKQLGSDFPLPVARKREVPYF
                     WLHGGSFGELERTATRGQASNVRGLFKEGRSAFSVFGRRFEQELRKKGLFGLEPSGPN
                     AVLAPVTRQQYARRIQNYLIRRKGGVFGETDPLRRRRHHAETFIGLLAWMSICVRNVE
                     FAHASSLLPVYRAVFSKVDEVMETDASAAAALRVAAQPWSILDDTGAKHCVKLVWEVL
                     EAESATSGIDVAGLRTAVMKLNPRIVATRLLCDVLQIDMHTDLKATEWAAATFGPAAI
                     EEMQSLPQTEWYHIQTAVRLLHACDVRRLFYLSCDSESVSRTDRKTFLHHPRHSLYEC
                     YFWDVMRSAGADAPAAGDCDTQNVPVLSFNSYAPDSMELTALANSSGASAEAHEELRP
                     HLHLERAVQAIAFDFQRLRNV"
     gene            complement(<1613001..>1613975)
                     /locus_tag="CYME_CMT635C"
                     /db_xref="GeneID:16997979"
     mRNA            complement(<1613001..>1613975)
                     /locus_tag="CYME_CMT635C"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_005539508.1"
                     /db_xref="GeneID:16997979"
     CDS             complement(1613001..1613975)
                     /locus_tag="CYME_CMT635C"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_005539565.1"
                     /db_xref="GeneID:16997979"
                     /translation="MPTELSRTEKKSLIWLFKEHGLRVDGRSALRSRSVSVAVDVLPS
                     TAGSSRVFVGRTNDVLVGINLELRQYNLPAHAEDDAKRGSIAFSVEFCGVASPEFQGR
                     STEVLEAELVSFLDTAYAASPEFLADLFCREQRLASDPGTLRVCCWDVYVDVLVLGAS
                     GGNILDAVTYAVRAALATTVVPSVYWQDSESGGSWELDDRAEYCALLNASNAPLSASG
                     AFIPPLVRDSRTEHDQVTLVAPRWFIIDPCAEEETLAGCFLSVASDSAQHLRAIWKRG
                     SLPVEPDVVLDAAQQCIRDSAYACQEMDHFISELVATEESESVDDVPG"
     gene            <1616575..>1617561
                     /locus_tag="CYME_CMT636C"
                     /db_xref="GeneID:16997980"
     mRNA            <1616575..>1617561
                     /locus_tag="CYME_CMT636C"
                     /product="similar to membrane-bound
                     alpha-1,6-mannosyltransferase"
                     /transcript_id="XM_005539509.1"
                     /db_xref="GeneID:16997980"
     CDS             1616575..1617561
                     /locus_tag="CYME_CMT636C"
                     /codon_start=1
                     /product="similar to membrane-bound
                     alpha-1,6-mannosyltransferase"
                     /protein_id="XP_005539566.1"
                     /db_xref="GeneID:16997980"
                     /translation="MLPSTFGCVTRPPKVLALVLVLVFLVWTYFSASFLCSSGFWAFS
                     SRLSAGSSDKHVLSAGLCRSTLLDTVENISRSHVEQAQGSSYPYLFPPIIHQIWLGNR
                     PFPSSFSRSQESFRTKNPDMYYALWRDNDIACLIRRFYPVLAPVYAKITRVATTSDLA
                     RYLVLYVFGGFYSDTDTVCLQPIRKWPMLEGTQAMVGLEAEFSHVPNWQDMIVVRQIQ
                     VSVWTLASTPLHPLFGSAIHGIFVNCTRLSREKLEGMDVMEVAGPGYFTDTVFHYMHA
                     FGAGYANLSGLSRPTLFGDLLVQPLHVFRWEGRGPEEEACIQHLFGQSWRWR"
     misc_feature    complement(1618167..1620696)
                     /note="repetitive element"
CONTIG      join(AP006502.2:1..1621617)
//
DBGET integrated database retrieval system