GenomeNet

Database: RefSeq
Entry: NC_011739
LinkDB: NC_011739
Original site: NC_011739 
LOCUS       NC_011739              33809 bp    DNA     circular CON 13-DEC-2020
DEFINITION  Escherichia coli UMN026 plasmid p2ESCUM, complete sequence.
ACCESSION   NC_011739
VERSION     NC_011739.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMEA3138233
            Assembly: GCF_000026325.1
KEYWORDS    RefSeq.
SOURCE      Escherichia coli UMN026
  ORGANISM  Escherichia coli UMN026
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 33809)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-DEC-2008) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            CU928149.1.
            Annotation results relative to BLAST similarities, COG
            assignations, enzymatic function prediction (PRIAM software), TMHMM
            and SignalP predictions, and synteny conservation (Syntonizer
            software) are available in the MaGe annotation system
            http://www.genoscope.cns.fr/agc/mage.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 12/13/2020 20:15:59
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 5.0
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 5,174
            CDSs (total)                      :: 5,056
            Genes (coding)                    :: 4,936
            CDSs (with protein)               :: 4,936
            Genes (RNA)                       :: 118
            rRNAs                             :: 8, 7, 7 (5S, 16S, 23S)
            complete rRNAs                    :: 8, 7, 7 (5S, 16S, 23S)
            tRNAs                             :: 87
            ncRNAs                            :: 9
            Pseudo Genes (total)              :: 120
            CDSs (without protein)            :: 120
            Pseudo Genes (ambiguous residues) :: 0 of 120
            Pseudo Genes (frameshifted)       :: 46 of 120
            Pseudo Genes (incomplete)         :: 75 of 120
            Pseudo Genes (internal stop)      :: 26 of 120
            Pseudo Genes (multiple problems)  :: 23 of 120
            CRISPR Arrays                     :: 2
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..33809
                     /organism="Escherichia coli UMN026"
                     /mol_type="genomic DNA"
                     /strain="UMN026"
                     /db_xref="taxon:585056"
                     /plasmid="p2ESCUM"
     gene            355..1251
                     /locus_tag="ECUMN_RS00745"
                     /old_locus_tag="ECUMN_p20001"
                     /old_locus_tag="p2ECUMN_0001"
     CDS             355..1251
                     /locus_tag="ECUMN_RS00745"
                     /old_locus_tag="ECUMN_p20001"
                     /old_locus_tag="p2ECUMN_0001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_032488386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein"
                     /protein_id="WP_001122745.1"
                     /translation="MPIRKISEKTKIRHRNEINKTLAQLPLSAKRVLCLALVSVDTKK
                     PLEPGMIFKITADTYTSITKVKPSVAYRQLKEGAELLNTSKLSLSSDDILALSTELGL
                     PDAMRKSLERLDMGITDYCAYSPNEGYVVLKFTHTIHPYISNLIGGENKFTTQLLTSA
                     MRLSGQYSWALYQLIRKNYSKFRTKNYFSIHLNELKDELIAYTIEDDEVVYKYPEFPI
                     FKREVINKAIKEIKEKTEIEFLSCLIESKEGRKVSVLRFEFLVSEDKFTGIDNETHEF
                     MNDDDAAFLTEFDKVVPPKKNK"
     gene            1260..1703
                     /locus_tag="ECUMN_RS00750"
                     /old_locus_tag="ECUMN_p20002"
                     /old_locus_tag="p2ECUMN_0002"
     CDS             1260..1703
                     /locus_tag="ECUMN_RS00750"
                     /old_locus_tag="ECUMN_p20002"
                     /old_locus_tag="p2ECUMN_0002"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001074376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001074389.1"
                     /translation="MAKIYQFPQGEERGKFRKEIARERKKRFAVNTGSIFVKWLGWGW
                     FYLRLLAASVLHFVSVFVLAILGAFKWAVFWLGGILCVITWYHLDHQLWTPQNLTIPV
                     ITATWILGLLAEPLMELLNKTMPWHKLLVPEPADESTENSSEISQ"
     gene            1800..2186
                     /locus_tag="ECUMN_RS00755"
                     /old_locus_tag="ECUMN_p20003"
                     /old_locus_tag="p2ECUMN_0003"
     CDS             1800..2186
                     /locus_tag="ECUMN_RS00755"
                     /old_locus_tag="ECUMN_p20003"
                     /old_locus_tag="p2ECUMN_0003"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000202950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_023156601.1"
                     /translation="MTYSRFLLENFMKYQVKEFVNEKYSKAINILKDNLKENYHIFYG
                     VRLSEILFPASEYGTDAFFKEFESINSITLPLIIFEMNERKPVAIIGFEQIAGAVFVE
                     QLDIKVLVIDDLSELLTNETLASLYN"
     gene            complement(2935..3216)
                     /locus_tag="ECUMN_RS00760"
                     /old_locus_tag="ECUMN_p20005"
                     /old_locus_tag="p2ECUMN_0005"
     CDS             complement(2935..3216)
                     /locus_tag="ECUMN_RS00760"
                     /old_locus_tag="ECUMN_p20005"
                     /old_locus_tag="p2ECUMN_0005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001556765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001290347.1"
                     /translation="MSEIYCIAIAVIIVGYVYLMISVITAPQKLFPILQLITLIGISS
                     LFSFMSFKSESMWTGEPELLVAIMFGTFSATLIFYMFKILIRAFDSLTK"
     gene            complement(3378..3662)
                     /locus_tag="ECUMN_RS00765"
                     /old_locus_tag="ECUMN_p20006"
                     /old_locus_tag="p2ECUMN_0006"
     CDS             complement(3378..3662)
                     /locus_tag="ECUMN_RS00765"
                     /old_locus_tag="ECUMN_p20006"
                     /old_locus_tag="p2ECUMN_0006"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000905710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000905710.1"
                     /translation="MLIKIIKSVFNFYMLCVQPLLGLFLMGYSIWSFSGDGICTADKV
                     IACDISIYLEPAFYLLIGTVVLFVWYIAWQTERSKEEDFKSSIKPEDFVK"
     gene            complement(3699..4001)
                     /locus_tag="ECUMN_RS00770"
                     /old_locus_tag="ECUMN_p20007"
                     /old_locus_tag="p2ECUMN_0007"
     CDS             complement(3699..4001)
                     /locus_tag="ECUMN_RS00770"
                     /old_locus_tag="ECUMN_p20007"
                     /old_locus_tag="p2ECUMN_0007"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001096506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001096507.1"
                     /translation="MAKLPKKIDQEIKPLDLRQFVSSAAQKPASASAVTRINLTMTDD
                     DLDTAQVFQNKYGASRAEVIRAALAALRLVSAEERRRLFDDIRKNSPKAGRPTVNK"
     gene            complement(4095..4754)
                     /locus_tag="ECUMN_RS00775"
                     /old_locus_tag="ECUMN_p20008"
                     /old_locus_tag="p2ECUMN_0008"
     CDS             complement(4095..4754)
                     /locus_tag="ECUMN_RS00775"
                     /old_locus_tag="ECUMN_p20008"
                     /old_locus_tag="p2ECUMN_0008"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000516228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-arginine deiminase"
                     /protein_id="WP_000516226.1"
                     /translation="MGKIITVAGHKGGIGKSTVLCSLCVCVIIKGKTACFLETDSQGS
                     IKDFIEERKTNDRLSEIPYFECYTDIPAMARKLAARFDYVFVDTPGMKSPAFVKALSC
                     ADILFTFIEPGAGIEINTLGRLVFDIKTAQAGVNPSMKAWIVLNKCSTNPSDSEASEL
                     RRQLNDDPDWLPVPRQRIYMRTVHKKAYNSGMGVHEYDDKRGNKARGEIELLLKETDV
                     L"
     gene            complement(4869..5684)
                     /locus_tag="ECUMN_RS00780"
                     /old_locus_tag="ECUMN_p20009"
                     /old_locus_tag="p2ECUMN_0009"
     CDS             complement(4869..5684)
                     /locus_tag="ECUMN_RS00780"
                     /old_locus_tag="ECUMN_p20009"
                     /old_locus_tag="p2ECUMN_0009"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000018884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_024186250.1"
                     /translation="MSHLPASIFQISRSDAWNLTLSPDAARNMRDLAAQIGAGMPKYL
                     IAPEVSLLLSYIDDLSIRMYFETLWNTGARLNEALALKPADFMLTPTRQYPQPVVILK
                     TLKQRIKEAERRPGRPTTRHPPLHPDPRYRKPPEPAVRLVPVLDAGYALRMREYLATW
                     KKRIKHQPVWDITSRQTPLNWINTAVARAGRDGVTFSVPVTPHTFRHSYAMHLTMSGV
                     PPRVLQSLLGHRYARSTEIYTRVFSLDVLTGSGLSFTCDPQLAKQLLGYPDAP"
     gene            complement(6240..6896)
                     /locus_tag="ECUMN_RS00785"
                     /old_locus_tag="ECUMN_p20010"
                     /old_locus_tag="p2ECUMN_0010"
     CDS             complement(6240..6896)
                     /locus_tag="ECUMN_RS00785"
                     /old_locus_tag="ECUMN_p20010"
                     /old_locus_tag="p2ECUMN_0010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001478769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001478769.1"
                     /translation="MMIKSKKVVVIFVALSSFLLAGCDSPKDANKQNFEKAINTRLEK
                     ECITISPLGMFDSKPYPVQVAVAQANRYTSQERADEINSRQFSALDVLVKADLLTVKD
                     TLVDDVIGFTKTGKKVPGREYALTDEGKKYLKSPERPDFCVGHYKVDEIVDFTEPGDA
                     MGMKITQVNYTFSPTSIAEWAKRDDVRAAFLGLESDLKEKQTKRITLVLKNDGWSAER
                     "
     gene            complement(7000..7464)
                     /locus_tag="ECUMN_RS00790"
                     /old_locus_tag="ECUMN_p20011"
                     /old_locus_tag="p2ECUMN_0011"
     CDS             complement(7000..7464)
                     /locus_tag="ECUMN_RS00790"
                     /old_locus_tag="ECUMN_p20011"
                     /old_locus_tag="p2ECUMN_0011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001293133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="H-NS histone family protein"
                     /protein_id="WP_001293140.1"
                     /translation="MSELTKEDEYGIISRTMMNIRSLRVFAREVDFEQLLEMQEKLNV
                     VVEERREDAEREAAERQELEAKRQQAIEYIISLGLDPESLLAPVTADTVKTRRKAKGG
                     VRKAKYRFKDENGEIREWSGNGKRPLALQKLLDEGHFMEDFLIDKLQPGQVE"
     gene            complement(7482..7688)
                     /gene="hha"
                     /locus_tag="ECUMN_RS00795"
                     /old_locus_tag="ECUMN_p20012"
                     /old_locus_tag="p2ECUMN_0012"
     CDS             complement(7482..7688)
                     /gene="hha"
                     /locus_tag="ECUMN_RS00795"
                     /old_locus_tag="ECUMN_p20012"
                     /old_locus_tag="p2ECUMN_0012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000850858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin expression modulator Hha"
                     /protein_id="WP_000850859.1"
                     /translation="MKTKQEWLFQLRKCTSRDTLEKVIEINRYKLPLSESEAFYSAAD
                     HRRAELVMNKLYDKVPSGVWKYVH"
     gene            complement(7685..9838)
                     /locus_tag="ECUMN_RS00800"
                     /old_locus_tag="ECUMN_p20013"
                     /old_locus_tag="p2ECUMN_0013"
     CDS             complement(7685..9838)
                     /locus_tag="ECUMN_RS00800"
                     /old_locus_tag="ECUMN_p20013"
                     /old_locus_tag="p2ECUMN_0013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016247728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IA DNA topoisomerase"
                     /protein_id="WP_001235749.1"
                     /translation="MRLFIAEKPAVANDIVKALGGNFTRHDGWFESDNAIVTNCFGHI
                     IESQPPENYNPEYKAWKVETLPLRLYPVKYQPVESAAKQVKTILELIRRGDVTEIVHA
                     GDPDDEGQLLVDEVLEYAGNTKPVKRVLINDNTLPAVKKALANLKDNRDFKGLYLKAL
                     ARSVADAVYGFSMTRAYTIPAKARGYQGVLSVGRVQTPVLGLIVNRTRANQNHKSSFY
                     YTMTGVFQRGADVIRANWKPGEFAPLTDRKLLDKAWADGTAASLAGKPATVEAAATDD
                     KKTAAPLPFNLVRLQQYMNKKFKMTAQKTLDITQQLREKYKAITYNRSDCSYLSDEQF
                     SEAPQVIDALKSVFPQSLDIDSSRKSKAFNSAKVTAHTAIIPTASVPDVNALSTDERN
                     VYLAIAQHYLVQFMPEKAYQEVSVAIQCGDESFYARARKTTDSGFEAFLGAETTDEGE
                     SEDNDDSAFELLCKIRTGETLTTKEVIVNEKKTTPPPLFTEASLLAALVRVADFVTDP
                     TIKKLLKDKDKDKKDEHGGIGTPATRAAILETLKKRNYITLEKGKLIPTDTGYALIDA
                     LPGIAVNPDMTALWAEKQTAIENGDLTVEEFINELYDELTGMISDVDLGEMKIEPVAP
                     AGQSQRLSSPCPTCGKQIIIRQKGYFCTGCEFKIWSEFSGKKITQAQAEKLVKSGKTD
                     LIKGFKKKSGGTYDTVLVLEDKKTGKLGFPARAKK"
     gene            complement(9850..10437)
                     /locus_tag="ECUMN_RS00805"
                     /old_locus_tag="ECUMN_p20014"
                     /old_locus_tag="p2ECUMN_0014"
     CDS             complement(9850..10437)
                     /locus_tag="ECUMN_RS00805"
                     /old_locus_tag="ECUMN_p20014"
                     /old_locus_tag="p2ECUMN_0014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000280693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000275458.1"
                     /translation="MYIHIVPKLYHLMANKCSLKSISIPELDFIIDSESLSVGRPWPN
                     KCLWVGMRKGRKSVNGLVLQTDKKLRWFTTIYTWDIEDMGLIYHQVNTYIEDDNFDMV
                     SQEILLNGSFDKWSNRVHSAYENKPPARIQPKMESLLNKPGENSHDVWEEFEWGDFLL
                     SREESLLLHTIQSERLSTDCSLFKRQPSIESALVI"
     gene            complement(10464..10784)
                     /locus_tag="ECUMN_RS00810"
                     /old_locus_tag="ECUMN_p20015"
                     /old_locus_tag="p2ECUMN_0015"
     CDS             complement(10464..10784)
                     /locus_tag="ECUMN_RS00810"
                     /old_locus_tag="ECUMN_p20015"
                     /old_locus_tag="p2ECUMN_0015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001579350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001020837.1"
                     /translation="MNIHLFSEVLFCVWVIALIVILFIVVKYYRRVHYRLNSLSETIK
                     RTQGGVNKRISENRELLELIKNQHPEILDEYPWVSGWLDSQEKFLVALADKSGIDINK
                     SGLI"
     gene            complement(10844..11248)
                     /locus_tag="ECUMN_RS00815"
                     /old_locus_tag="ECUMN_p20016"
                     /old_locus_tag="p2ECUMN_0016"
     CDS             complement(10844..11248)
                     /locus_tag="ECUMN_RS00815"
                     /old_locus_tag="ECUMN_p20016"
                     /old_locus_tag="p2ECUMN_0016"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001576899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001218544.1"
                     /translation="MALSPKEKKELQQRFEKQLLPDLDMSFELNGEVYKFNFDKNESG
                     DYIDSFTQAVWGGYQDAEEWEKYGKHQETELPEYPEPVEGWCDCDKCKSMIFHKEKNI
                     YVCLSCHKQTEPFLPIDWNSNDYDWLPYEDEY"
     gene            complement(11264..11779)
                     /locus_tag="ECUMN_RS00820"
                     /old_locus_tag="ECUMN_p20017"
                     /old_locus_tag="p2ECUMN_0017"
     CDS             complement(11264..11779)
                     /locus_tag="ECUMN_RS00820"
                     /old_locus_tag="ECUMN_p20017"
                     /old_locus_tag="p2ECUMN_0017"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000698399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thermonuclease family protein"
                     /protein_id="WP_001218000.1"
                     /translation="MRIFLSVILFLFTAFQSANAGGIPGALAGILSTLNQEIQGKVIR
                     VLDGDTIEVLQDKKPVRIRLANIDAPEKKQAFGRWSANQLKALLAAQPVTVTYTQTDR
                     YGRIIGHVFTTNGTDASRFMVQSGAAWVYERYNVDESLPALQREAQEQKRGLWVDANP
                     VPPWEWRYKHN"
     gene            complement(11776..12210)
                     /locus_tag="ECUMN_RS25970"
                     /old_locus_tag="ECUMN_p20018"
     CDS             complement(11776..12210)
                     /locus_tag="ECUMN_RS25970"
                     /old_locus_tag="ECUMN_p20018"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001576897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000981209.1"
                     /translation="MMNKFSYVNRMLRQVFVFSFITAPSIALFVVFMFFSFNNSIAGS
                     FLKEARGLITDTPSDKVNVCLFEKGVPQDMELTNSTTEHVLKNKCITTLVDAADWQES
                     VDGSIRYFYWSSVVIGFVVWLTFNFRALEELFYRRKRKGDVE"
     gene            complement(12292..12549)
                     /locus_tag="ECUMN_RS00830"
                     /old_locus_tag="ECUMN_p20019"
                     /old_locus_tag="p2ECUMN_0019"
     CDS             complement(12292..12549)
                     /locus_tag="ECUMN_RS00830"
                     /old_locus_tag="ECUMN_p20019"
                     /old_locus_tag="p2ECUMN_0019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000726017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000726017.1"
                     /translation="MKKKEKIDFLNAIKAGHSGFIAGNPAHALDDKTMNAIIHNYEAT
                     IAPGKAGNCKETPLTKYCSRTMPERISVEEINEVKIYPELF"
     gene            complement(12555..12857)
                     /locus_tag="ECUMN_RS00835"
                     /old_locus_tag="ECUMN_p20020"
                     /old_locus_tag="p2ECUMN_0020"
     CDS             complement(12555..12857)
                     /locus_tag="ECUMN_RS00835"
                     /old_locus_tag="ECUMN_p20020"
                     /old_locus_tag="p2ECUMN_0020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000717624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IncN plasmid KikA protein"
                     /protein_id="WP_000820911.1"
                     /translation="MKRICKGLIVIFTVSWLTAPAYASDPCASVLCLYGKAVGQGGGS
                     ECRSAEKDFFNILKKKKGNIRWSKTFDARKAFLNQCSTADPAAISKIMSKFGKIKG"
     gene            complement(12854..13267)
                     /locus_tag="ECUMN_RS00840"
                     /old_locus_tag="ECUMN_p20021"
                     /old_locus_tag="p2ECUMN_0021"
     CDS             complement(12854..13267)
                     /locus_tag="ECUMN_RS00840"
                     /old_locus_tag="ECUMN_p20021"
                     /old_locus_tag="p2ECUMN_0021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000722603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000722607.1"
                     /translation="MKKILMISILLLTACSSPPEPPQVEWEKRPEVMNTQIMNWTPTS
                     NVIKSDNINSLWSKVLPDFKPENRLYDDSVFYAVAHSEKIVVRTSSFDSYWSAKDWLR
                     KNGATGVIEYQPLKRWLNNDYVEISLSRINVQRLP"
     gene            complement(13264..15099)
                     /locus_tag="ECUMN_RS00845"
                     /old_locus_tag="ECUMN_p20022"
                     /old_locus_tag="p2ECUMN_0022"
     CDS             complement(13264..15099)
                     /locus_tag="ECUMN_RS00845"
                     /old_locus_tag="ECUMN_p20022"
                     /old_locus_tag="p2ECUMN_0022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000053816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretory system conjugative DNA
                     transfer family protein"
                     /protein_id="WP_000053829.1"
                     /translation="MSLKLPDKGQWVFIGLVMCLVTYYAGSVAVYFLNGKTPLYIWKN
                     FDSMLLWKIITESNIRTDIRLTAIPSLLSGMVSSLIVPVFVIWQLNKMDVALYGDAKF
                     ASDNDLKKSKLLKWETENDTDILVGAYKGKYLWYTAPDFVSLGAGTRAGKGAAIGIPN
                     LLVRKHSLIALDPKQELWKITSKVREILLGNKVYLLDPFNSKTHQFNPLFYIDLKAES
                     GAKDLLKLIEILFPSYGMTGAEAHFNNLAGQYWTGLAKLLHFFINYEPSWLNEFGLKP
                     VFSIGSVVDLYSNIDRELILSKREELEGTNGLDENALYHLRDALTKIREYHETEDEQR
                     SSIDGSFRKKMSLFYLPTVRKCTDGNDFDLRQLRREDITVYVGVNAEDISLAYDFLNL
                     FFNFVVEVTLRENPDFDPTLKHDCLMFLDEFPSIGYMPIIKKGSGYIAGFKLKLLTIY
                     QNISQLNEIYGIEGAKTLMSAHPCRIIYAVSEEDDAAKISEKLGYITTTSKSTSKSRG
                     RSASQGESESEARRALVLPQELGTLDFKEEFIILKGENPVKAEKALYYLDPYFMDRLM
                     KVSPKLASLTMELNKTKKIFGVKGLKYPSKEKMLSVGELESEVLL"
     gene            complement(15102..16133)
                     /gene="virB11"
                     /locus_tag="ECUMN_RS00850"
                     /old_locus_tag="ECUMN_p20023"
                     /old_locus_tag="p2ECUMN_0023"
     CDS             complement(15102..16133)
                     /gene="virB11"
                     /locus_tag="ECUMN_RS00850"
                     /old_locus_tag="ECUMN_p20023"
                     /old_locus_tag="p2ECUMN_0023"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001058463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type DNA transfer ATPase VirB11"
                     /protein_id="WP_001058469.1"
                     /translation="MNNENRHLIYDVVNDYFYHWLNEIDGVTEIAVNRPGEIFIKVRG
                     KWQWYEQKMSYSDCLSFASTLADFHDGGSVTPEYPLRSATLPGGERVQVVIPPATEKD
                     TVSITIRKPSGIFISHDKFIKQGFYSRVSGLSGDSVMEDNISALITSGYFERVIPESL
                     SQGKTIVFCGGTGSGKTTFANACLEYIPHHLRCISIEDTDEAKFRFHKNHVKLYYPAE
                     GESKIITSASLLRSCFRMNPDRILMTEIRGAEAWDFLKASSSGHAGNITTVHESSPEY
                     AVLGIVQRCYMNPECQNLPFNVILRRVLSNIDIIMSIKYLDDEDFRFASGIYYRQLHF
                     DDYFRKLKE"
     gene            complement(16135..17340)
                     /locus_tag="ECUMN_RS00855"
                     /old_locus_tag="ECUMN_p20024"
                     /old_locus_tag="p2ECUMN_0024"
     CDS             complement(16135..17340)
                     /locus_tag="ECUMN_RS00855"
                     /old_locus_tag="ECUMN_p20024"
                     /old_locus_tag="p2ECUMN_0024"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001378527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TrbI/VirB10 family protein"
                     /protein_id="WP_000139137.1"
                     /translation="MTEQENKIPTATEIEQQLRERRQKELEQAGKSPEEEPGKPALQL
                     GIEKLKKSRKGMIILVVGFLLLAAGVSVYYIPSIIRSVSSGDEKPASQPLATGAAKRQ
                     TGLSEDIDPFNTAQKKTEKPEEEKVISSEKTEPPENKQQSFSRALDVSLDGSQAGNSS
                     SSAGTSVSHTAASEPESDKKDEAKATAQATESAPLAKITKLPYDPNLFIPEGTSIPCS
                     LDRRFVSDLAGKLECTVNSDIYSASGNVKLIERGTAAKLMYKAGSLNHGQGRVFVMAY
                     KLRTRSKPFIDIPLVDSQAAGALGEAGASGWIDTHFSERFLGAMMVGMIPDLSQAASG
                     IAQNNRDSQTDYTANSRQAFADIAREAFSNSVNIPPTLYKNQGEIITLIVGQDLDFSG
                     IYKLKMKGG"
     gene            complement(17337..18266)
                     /locus_tag="ECUMN_RS00860"
                     /old_locus_tag="ECUMN_p20025"
                     /old_locus_tag="p2ECUMN_0025"
     CDS             complement(17337..18266)
                     /locus_tag="ECUMN_RS00860"
                     /old_locus_tag="ECUMN_p20025"
                     /old_locus_tag="p2ECUMN_0025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000783379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TrbG/VirB9 family P-type conjugative transfer
                     protein"
                     /protein_id="WP_000783376.1"
                     /translation="MKMNKGALIMALLMAAHVCHAAVLPSGSRFDPRNQIVSYNPNNT
                     TIINSAVGYTTTLVFDEDETVISARTGFPQGWAVNKEDNLVYLEVRPVKQTVQKNNTD
                     ENGNTSSESVSVALDPENELERWRTNLFVRTTKRNYSMELNARTFRQPEKIAFVVNYQ
                     YPQERRKEQAEIEKKRTETLARRLEEQAINRSLENAKSPRNWQYWKRVAEGSQDISPD
                     YAYDDGRYTWFGFSPLKKIPSVFVMNGMQETLTNPVIKQSGSFTAVGVPVDKRFVLRL
                     GEQVVGIENQGFGKVRLPAGDTVSPDVKKEVIQ"
     gene            complement(18271..18984)
                     /locus_tag="ECUMN_RS00865"
                     /old_locus_tag="ECUMN_p20026"
                     /old_locus_tag="p2ECUMN_0026"
     CDS             complement(18271..18984)
                     /locus_tag="ECUMN_RS00865"
                     /old_locus_tag="ECUMN_p20026"
                     /old_locus_tag="p2ECUMN_0026"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016247737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein"
                     /protein_id="WP_000394613.1"
                     /translation="MEFKLPGFKNKKDVTDSSVSFEEKNIALQERMNRIYKFGGIGGM
                     LIGGLSLLALNAALPLKTTVVDAYLIDKVTGVAERLTSVKKENLSENEAIARYFITQY
                     IKHREGYNFFSLQHDYDYVMAYSAENVAADYNALFNSEQAPKLVYNKAEKTAMVQDNP
                     SVIISPSSRTDDKDIGAYIRFRLTIRDVATGQTRQEFWNVRLTYRIEPQVEMVSGERN
                     NNPLKFVVTSYVRDKEARG"
     gene            complement(19229..20362)
                     /locus_tag="ECUMN_RS00870"
                     /old_locus_tag="ECUMN_p20027"
                     /old_locus_tag="p2ECUMN_0027"
     CDS             complement(19229..20362)
                     /locus_tag="ECUMN_RS00870"
                     /old_locus_tag="ECUMN_p20027"
                     /old_locus_tag="p2ECUMN_0027"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000513453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein"
                     /protein_id="WP_000513454.1"
                     /translation="MGIVTGIPDGTDLSGNVTSPANAGGVPGFDSDFFQTTHEVIFNI
                     LNKSISGKLSEYSDVAYTLGKYGVSLYVLWYAFTVLARKQQTPVPDFIWNICRFYIIL
                     LFVKNTGGILTSATDAIDGLKNTLAGGDPWVWMDQLWVKVIQVATLIFDKDTSTVPVA
                     GGIGALLTYVGGVLALLLCSIVFAAAELTLLLLSVTAPIFIMCLMFGFLRQMFNSWLQ
                     LNFSSLLVFLFAALALRAGTWQLNMALSTSIATASENNLLQTGVTSLAAGIFMAWIIW
                     QAKSYASQIAGVGVEGAMQGAAAMGIGAGVFGASRMARGALGMGRNAGIGAWKGLRRQ
                     EGGFGESPGITGKTANLAGQGVNIGAKKLRQAAIERAKKMYGG"
     gene            complement(20372..20599)
                     /locus_tag="ECUMN_RS00875"
                     /old_locus_tag="ECUMN_p20028"
                     /old_locus_tag="p2ECUMN_0028"
     CDS             complement(20372..20599)
                     /locus_tag="ECUMN_RS00875"
                     /old_locus_tag="ECUMN_p20028"
                     /old_locus_tag="p2ECUMN_0028"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000835348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EexN family lipoprotein"
                     /protein_id="WP_000835348.1"
                     /translation="MKSIATAGLVIISVFSLSGCFEETKSVDWWLAHPKETYKKFEEC
                     QKSGSDSDNCKNVKRAHLSFERRKAVGLPIN"
     gene            complement(20600..21358)
                     /locus_tag="ECUMN_RS00880"
                     /old_locus_tag="ECUMN_p20029"
                     /old_locus_tag="p2ECUMN_0029"
     CDS             complement(20600..21358)
                     /locus_tag="ECUMN_RS00880"
                     /old_locus_tag="ECUMN_p20029"
                     /old_locus_tag="p2ECUMN_0029"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000744203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein"
                     /protein_id="WP_000744204.1"
                     /translation="MKKQIMAAFVASLIVISGAQAGIPVAIDANPEWAIEAGRWTERL
                     KQWAETVKHYESQINAYKQELLSKTGIRDVQGLVQSAQSVSKELMQIYDQGNAFIDDY
                     IKNPEGALSEQAKSLLSDYKVTDTCQNLGYSGDLVRGCEATFLSQLASVEYGNKLESK
                     LRQDNQTMKDLIDQVKNAKDTKATQDATNAVALEQLKFEKLKFQYQMYRDKQRDLAEY
                     KEKMAQASFRKQQREAVPPSYRKAYMAMKSYEDD"
     gene            complement(21369..24122)
                     /locus_tag="ECUMN_RS00885"
                     /old_locus_tag="ECUMN_p20030"
                     /old_locus_tag="p2ECUMN_0030"
     CDS             complement(21369..24122)
                     /locus_tag="ECUMN_RS00885"
                     /old_locus_tag="ECUMN_p20030"
                     /old_locus_tag="p2ECUMN_0030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016247738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VirB3 family type IV secretion system protein"
                     /protein_id="WP_012599839.1"
                     /translation="MSTLFKGLTRPALIRGLGVPLFPFLGMCIICVLLGVWIHEAMYA
                     LILPGWYAIRRVTQFDERFFDLLYLRTLVKGHPLSNKRFSAVHYAGSQYDEVDISKVD
                     NFMKLKDQSSVEELIPYSSHITDNIIVTKNRDLLATWQIDGAYFECVDSEDLSILTDQ
                     LNTLIRSFEGKSVTLYPHRIRCKKGVRPVFNSKIPFVNRVMNDYYESFPQSEFFENKL
                     FLTICFKPFTTEDKVTHFFSRSKKQKDIFKEPVNEMNEICDRLNTYLSRFHSRRLGLY
                     EDHGVVYSDQLSLFQYLLSGRWQKVRVSSSPFYTYLGGKDLFFGNDAGQITASDHARY
                     FRCIEIKDYFQETDAGILDALMYLPVEYVVTSSFTAMDKQSAIKALDDQIDKLEMTDD
                     AAKSLLADLKVGLDMVSSGYISFGKSHQTLVVFADSPERLVKDTNIVTSTLEDLGLIV
                     TYSTLSLGAAYFAQLPGNYTLRPRLSTLSSLNFAEMESFHNFFSGKEKGNTWGEKLIT
                     LRGSGNDIYHLNYHMTTEHQNFFGKNPTLGHTEILGTSNVGKTVLLMTKAFAAQQFGT
                     PESFPANRKLKKLTTVFFDKDRAGEVGIRAMGGSYYRVKEGEPTGWNPAALPPTKRNI
                     AFMKDLVRLLCTLNSEPLDDYQNSLISDAVERLMQRSDRSYPVSKLRPLIQEPDDTET
                     KRHGLKARLKPWTQGEEFGWVFDNREDTFDVDNLDVFGIDGTEFLDNKVLASAASFYL
                     IYRVTMLADGRRLLIYMDEFWQWINNEAFRDFVYNKLKTGRKLDMVLVVATQSPDELI
                     KSPIAAAVREQCATHIYLANPKAKRSEYVDGLQVRELYFDKIKAIDPLSRQFLVVKNP
                     QRKGESDDFAAFARLELGKAAYYLPVLSASKPQLELFDEIWKEGMKPEEWLDTYLEQA
                     NLI"
     gene            complement(24144..24440)
                     /locus_tag="ECUMN_RS00890"
                     /old_locus_tag="ECUMN_p20031"
                     /old_locus_tag="p2ECUMN_0031"
     CDS             complement(24144..24440)
                     /locus_tag="ECUMN_RS00890"
                     /old_locus_tag="ECUMN_p20031"
                     /old_locus_tag="p2ECUMN_0031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001556767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TrbC/VirB2 family protein"
                     /protein_id="WP_000040717.1"
                     /translation="MSKLNLNKRYLTLSLFMAALMLCVAEPAFADDVSTKTTGFLQKI
                     IDFLTDVRKPAITIMALVIGYIALFSRQHTAWIVPLVIGIIIFIVAPYVPNWLS"
     gene            complement(24418..25065)
                     /locus_tag="ECUMN_RS00895"
                     /old_locus_tag="ECUMN_p20032"
                     /old_locus_tag="p2ECUMN_0032"
     CDS             complement(24418..25065)
                     /locus_tag="ECUMN_RS00895"
                     /old_locus_tag="ECUMN_p20032"
                     /old_locus_tag="p2ECUMN_0032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000953524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase domain-containing
                     protein"
                     /protein_id="WP_000953528.1"
                     /translation="MLSTSTFLALAMQCAASVHPDTTHEVARVESGFNPYAIAEIIPK
                     VKRKPGDKGVVSYFPESKEAALKIVKNIELRNHRYSVGLMQITSTNFAKFGTTAEKMF
                     DPCENLKVSEKILVDCYKRGGDLVRGLSCYYSGNPETGVKPEPEFNNTSYVQRIGFSP
                     PDNKKSFIVPSVKEMIKKENKTTITPEEIIIYPQYAIRGTVSNEKETKDVEIKSE"
     gene            complement(25283..25789)
                     /locus_tag="ECUMN_RS00900"
     CDS             complement(25283..25789)
                     /locus_tag="ECUMN_RS00900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000455437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000872473.1"
                     /translation="MKWYVLQFTTTRFAAVFAHLERLSFSYFCPMETARYRRPDKIVS
                     YRERCFPLFPGYLFVQADFEEVHFTIITAIPYVQRFISFGGEPLPVSEDVIEVLLRRQ
                     SQSAQTNLLRKSIPHEFAEILLMENPQQRSMAFIHYITERSLTHKMKRKKNDCYPEKK
                     RNETQAPT"
     gene            complement(26122..27288)
                     /locus_tag="ECUMN_RS00905"
                     /old_locus_tag="ECUMN_p20035"
                     /old_locus_tag="p2ECUMN_0035"
     CDS             complement(26122..27288)
                     /locus_tag="ECUMN_RS00905"
                     /old_locus_tag="ECUMN_p20035"
                     /old_locus_tag="p2ECUMN_0035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001694629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="relaxase/mobilization nuclease domain-containing
                     protein"
                     /protein_id="WP_000539534.1"
                     /translation="MGVYVDKEYRVKRKSSENGRKSAFAHKVKNGGKNYSRNVQERIN
                     RKGASKEVVVKISGGAITRQGVRNSIDYMSRESELPVMSESGQVWTGDEIQEAKEHMI
                     DRANDPQHVINDKGKENKKITQNIVFSPPVSAKVKPEDLLESVRKTMQKKYPNHRFVL
                     GYHCDKKEHPHVHVVFRIRDNDGKRADIRKKDLREIRTGFCEELKLKGYDVKATHKQQ
                     HGLNQSVKDAHNTAPKRQKGVYEVVDIGYDHYQNDKTKSKQHFIKLKTLNKGVEKTYW
                     GADFGDLCSRESVKAGDLVRLKKLGQKEVKIPALDKNGVQHGWKTVHRNEWQLENLGV
                     KGIDRTPSASKELVLNSPDMLLKQQQRMAQFTQQKASTLQSEQKLKTGIKFLGL"
     gene            complement(27291..27836)
                     /locus_tag="ECUMN_RS00910"
                     /old_locus_tag="ECUMN_p20036"
                     /old_locus_tag="p2ECUMN_0036"
     CDS             complement(27291..27836)
                     /locus_tag="ECUMN_RS00910"
                     /old_locus_tag="ECUMN_p20036"
                     /old_locus_tag="p2ECUMN_0036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000757693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000815825.1"
                     /translation="MKQVNFRLEEQQHDELLDCLKILYPDEPALTVAKGMKLLASALL
                     KSKAGSKDINTFFDNKDFIKTTMYLTGKQRADIERAANRHGWTLSRECRYRIQTTLEN
                     ELDFFDQELLMMNRCRNSIDKIGRNFHYIIVNDQTRVLDKDGFYQDAERLTTEIFNLK
                     NQFENYIMLCKGRTVSNKVEM"
     gene            complement(28152..28424)
                     /locus_tag="ECUMN_RS00915"
                     /old_locus_tag="ECUMN_p20038"
                     /old_locus_tag="p2ECUMN_0038"
     CDS             complement(28152..28424)
                     /locus_tag="ECUMN_RS00915"
                     /old_locus_tag="ECUMN_p20038"
                     /old_locus_tag="p2ECUMN_0038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001547192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001363158.1"
                     /translation="MTKHEFVSFVSGELRQGAVRFSLAFNSKGEIVLYWTNKAGIRVW
                     RILSGNRGKKPSKANLERMSNFRRWLFDARQGMEGYTQQPEQSNLS"
     gene            complement(28437..28586)
                     /locus_tag="ECUMN_RS25915"
                     /old_locus_tag="ECUMN_p20039"
     CDS             complement(28437..28586)
                     /locus_tag="ECUMN_RS25915"
                     /old_locus_tag="ECUMN_p20039"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000003880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000003876.1"
                     /translation="MSERILSAIHDVEKGGRPVFPLMPFHVFPEYMALLRKALEKKTQ
                     KRTDK"
     gene            complement(28655..28966)
                     /locus_tag="ECUMN_RS00920"
                     /old_locus_tag="ECUMN_p20040"
                     /old_locus_tag="p2ECUMN_0040"
     CDS             complement(28655..28966)
                     /locus_tag="ECUMN_RS00920"
                     /old_locus_tag="ECUMN_p20040"
                     /old_locus_tag="p2ECUMN_0040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000627400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000627399.1"
                     /translation="MITESDMLTEAKKMAVEMMFWPACPVDDDYCFDAIMYTSVIDRK
                     FEDEHGVYLHQVYKELCSTPELKKFLKKKAIKLIAFKHDIDLDSANKILMKNMLRRIE
                     N"
     gene            complement(28963..29379)
                     /locus_tag="ECUMN_RS00925"
                     /old_locus_tag="ECUMN_p20041"
                     /old_locus_tag="p2ECUMN_0041"
     CDS             complement(28963..29379)
                     /locus_tag="ECUMN_RS00925"
                     /old_locus_tag="ECUMN_p20041"
                     /old_locus_tag="p2ECUMN_0041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001407775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail-associated lysozyme"
                     /protein_id="WP_012599847.1"
                     /translation="MQGHPCIFLKGVDFMKCVYVVGKGLIVAGNKITIDGKEHVSVEN
                     SENIVVTDDCIKIGNKTVVFKGRSIKVEIHGNVNKIVTENADVSIHGNAGDVETVSGD
                     VDCHQVNGDITTVSGDVTCGDVSGDVTTVSGDINRK"
     gene            complement(29389..29688)
                     /locus_tag="ECUMN_RS00930"
                     /old_locus_tag="ECUMN_p20042"
                     /old_locus_tag="p2ECUMN_0042"
     CDS             complement(29389..29688)
                     /locus_tag="ECUMN_RS00930"
                     /old_locus_tag="ECUMN_p20042"
                     /old_locus_tag="p2ECUMN_0042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000673428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000650311.1"
                     /translation="MKCSSVFTSTTNHVFTFERVTLCTIILMHKDTGQQYVVIFTDNN
                     KIRDYKTGIVPQFGELKQSDVDLVLFYRDEYEKYFDSLKDGDECLSFKDFIECLR"
     gene            complement(30142..30369)
                     /locus_tag="ECUMN_RS00935"
                     /old_locus_tag="ECUMN_p20045"
                     /old_locus_tag="p2ECUMN_0045"
     CDS             complement(30142..30369)
                     /locus_tag="ECUMN_RS00935"
                     /old_locus_tag="ECUMN_p20045"
                     /old_locus_tag="p2ECUMN_0045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000801440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000801440.1"
                     /translation="MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQ
                     NSQSLSLVEFEFLLLLAGEHPEYVLCKRESK"
     gene            complement(30356..30607)
                     /locus_tag="ECUMN_RS00940"
                     /old_locus_tag="ECUMN_p20046"
                     /old_locus_tag="p2ECUMN_0046"
     CDS             complement(30356..30607)
                     /locus_tag="ECUMN_RS00940"
                     /old_locus_tag="ECUMN_p20046"
                     /old_locus_tag="p2ECUMN_0046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001565860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001230707.1"
                     /translation="MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYD
                     AVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLNETR"
     gene            complement(30604..31146)
                     /locus_tag="ECUMN_RS00945"
                     /old_locus_tag="ECUMN_p20047"
                     /old_locus_tag="p2ECUMN_0047"
     CDS             complement(30604..31146)
                     /locus_tag="ECUMN_RS00945"
                     /old_locus_tag="ECUMN_p20047"
                     /old_locus_tag="p2ECUMN_0047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001401654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001083906.1"
                     /translation="MNSFFEQYHPVFEVVCRILGNGWRVNKLDDCSSRIKLTSPQFKN
                     YSVHIRMEKDRFSVVGSVDSRSWRSPHHVCTLSRKRNPVDIAADIERKILVNASQEVL
                     QAIEYEKHQVEKKDEILILKGMLSQLVQLESWYGALTGFKAENGLNGKVTEQGDSYDL
                     QIRGLSIDQLVKITGYLKQL"
     gene            complement(31251..31766)
                     /locus_tag="ECUMN_RS00950"
     CDS             complement(31251..31766)
                     /locus_tag="ECUMN_RS00950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001025391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="J domain-containing protein"
                     /protein_id="WP_001025395.1"
                     /translation="MNIQEALNVFGLSGELTEKDIKAAYRKAALKYHPDRNPLGAELM
                     KAVNAAFDVLMANIDKINQFQSTDEHARYNYGDDLEKVLNVLSGLSGLVFEVIGNWVW
                     ISGETITHKETLKEIGCKWAAKKKQWFYRPDEHKSYWNREEHTIEEIRAKYGTTGQRR
                     ATGWQRVETRA"
     gene            complement(32406..32756)
                     /locus_tag="ECUMN_RS00955"
                     /old_locus_tag="ECUMN_p20049"
                     /old_locus_tag="p2ECUMN_0049"
     CDS             complement(32406..32756)
                     /locus_tag="ECUMN_RS00955"
                     /old_locus_tag="ECUMN_p20049"
                     /old_locus_tag="p2ECUMN_0049"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000127484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module antitoxin"
                     /protein_id="WP_000127482.1"
                     /translation="MTATKNVKSQKNDYPASVDHNAAMIEELRADPDYANAYLANALE
                     EINEPGGLGGFLVALRQVIEARGGISEAARKSGLARQSIYRALSPNGNPTITTLAQLT
                     SVAGLQFTLSKSSH"
     gene            complement(32753..33088)
                     /locus_tag="ECUMN_RS00960"
                     /old_locus_tag="ECUMN_p20050"
                     /old_locus_tag="p2ECUMN_0050"
     CDS             complement(32753..33088)
                     /locus_tag="ECUMN_RS00960"
                     /old_locus_tag="ECUMN_p20050"
                     /old_locus_tag="p2ECUMN_0050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004026069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RelE/ParE family
                     toxin"
                     /protein_id="WP_001147119.1"
                     /translation="MPYTAKRYQTENGEVPYTDWMKKLRRKDQTAALKVDSRIARAMG
                     GNFGDHKFERDGVWELRVDYGPGYRVYYSIEDGEIILLLIGGNKKTQTADLDKAVSYL
                     QDFKKRSKK"
CONTIG      join(CU928149.1:1..33809)
//
DBGET integrated database retrieval system