GenomeNet

Database: RefSeq
Entry: NC_012864
LinkDB: NC_012864
Original site: NC_012864 
LOCUS       NC_012864            1245899 bp    DNA     linear   CON 28-AUG-2017
DEFINITION  Candida dubliniensis CD36 chromosome 5, complete sequence.
ACCESSION   NC_012864
VERSION     NC_012864.1
DBLINK      BioProject: PRJNA38659
            BioSample: SAMEA2272258
            Assembly: GCF_000026945.1
KEYWORDS    RefSeq; complete genome.
SOURCE      Candida dubliniensis CD36
  ORGANISM  Candida dubliniensis CD36
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Debaryomycetaceae;
            Candida/Lodderomyces clade; Candida.
REFERENCE   1
  AUTHORS   Jackson,A.P., Gamble,J.A., Yeomans,T., Moran,G.P., Saunders,D.,
            Harris,D., Aslett,M., Barrell,J.F., Butler,G., Citiulo,F.,
            Coleman,D.C., de Groot,P.W., Goodwin,T.J., Quail,M.A.,
            McQuillan,J., Munro,C.A., Pain,A., Poulter,R.T., Rajandream,M.A.,
            Renauld,H., Spiering,M.J., Tivey,A., Gow,N.A., Barrell,B.,
            Sullivan,D.J. and Berriman,M.
  TITLE     Comparative genomics of the fungal pathogens Candida dubliniensis
            and Candida albicans
  JOURNAL   Genome Res. 19 (12), 2231-2244 (2009)
   PUBMED   19745113
REFERENCE   2  (bases 1 to 1245899)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-AUG-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1245899)
  AUTHORS   Gamble,J.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-JAN-2009) Gamble J.A., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FM992692.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1245899
                     /organism="Candida dubliniensis CD36"
                     /mol_type="genomic DNA"
                     /strain="CD36"
                     /type_material="type material of Candida dubliniensis"
                     /db_xref="taxon:573826"
                     /chromosome="5"
     gene            complement(3640..5271)
                     /locus_tag="CD36_50010"
                     /pseudo
                     /db_xref="GeneID:8048064"
     misc_feature    complement(3640..5271)
                     /locus_tag="CD36_50010"
                     /inference="similar to AA sequence:UniProt:Q59KM5"
                     /note="appears to be incomplete ORF; apparent frameshift;
                     probable pseudogene;
                     Similar to C. albicans YRF1 (HPR5)"
                     /pseudo
                     /db_xref="GeneID:8048064"
     gene            complement(<6168..>6452)
                     /locus_tag="CD36_50020"
                     /db_xref="GeneID:8048065"
     mRNA            complement(<6168..>6452)
                     /locus_tag="CD36_50020"
                     /product="retrotransposon Tca4 polyprotein, putative"
                     /transcript_id="XM_002420265.1"
                     /db_xref="GeneID:8048065"
     CDS             complement(6168..6452)
                     /locus_tag="CD36_50020"
                     /inference="similar to AA sequence:UniProt:Q5AG24"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="retrotransposon Tca4 polyprotein, putative"
                     /protein_id="XP_002420310.1"
                     /db_xref="GeneID:8048065"
                     /db_xref="UniProtKB/TrEMBL:B9WGU6"
                     /translation="MSHMSESNSITYDDTFLSPLDNPNIHTIIHERREDIEHVINENR
                     PNTIFETHVEPPRTISSSGIIDHTNFRHRADPTWQVIPDAVNHLPLPAHF"
     mobile_element  complement(6191..7985)
                     /note="(subtelomeric)"
                     /mobile_element_type="retrotransposon:san A, partial Tcd4,
                     LTR"
     gene            complement(<6480..>7421)
                     /locus_tag="CD36_50040"
                     /db_xref="GeneID:8048066"
     mRNA            complement(<6480..>7421)
                     /locus_tag="CD36_50040"
                     /product="retrotransposon Tca4 gag-like protein, putative"
                     /transcript_id="XM_002420266.1"
                     /db_xref="GeneID:8048066"
     CDS             complement(6480..7421)
                     /locus_tag="CD36_50040"
                     /inference="similar to AA sequence:UniProt:Q5AG25"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="retrotransposon Tca4 gag-like protein, putative"
                     /protein_id="XP_002420311.1"
                     /db_xref="GeneID:8048066"
                     /db_xref="UniProtKB/TrEMBL:B9WGU7"
                     /translation="MAGFSDDDLRQMMGTLSILVADSKREIGQLHEKLEHNGETKYQS
                     LETYINSKYATTIKSFENLKYLDIDDPDLVNSWIICFNQVKRSHPQVFDAFMNAKSED
                     EIGIEKLQYTPYAGKQLNDMMRVFYMRISELLERKVDPNVSREVDNGETQFVPNLFKK
                     VYEMIIAKPDVSAAERIGQALFKLQTKSSELEVDSTYLLCQHLSTQEHQHDDLIYKFL
                     IGGVSPWYLHSQIYVSSYKLGTSDLFLEVYARHYELYKTDPNYKLPDIMTLLNEIRSN
                     RDYSKVVNAAKKGSTSQECFREEQQKVTPSLLDQLVD"
     gene            complement(12110..13701)
                     /locus_tag="CD36_50050"
                     /pseudo
                     /db_xref="GeneID:8048067"
     misc_feature    complement(12110..13701)
                     /locus_tag="CD36_50050"
                     /inference="similar to AA sequence:UniProt:Q59KM5"
                     /note="appears to be incomplete ORF; apparent frameshift;
                     probable pseudogene;
                     Similar to C. albicans YRF1 (HPR5)"
                     /pseudo
                     /db_xref="GeneID:8048067"
                     /db_xref="PSEUDO:CAX41386.1"
     gene            <15330..>17006
                     /locus_tag="CD36_50060"
                     /db_xref="GeneID:8048068"
     mRNA            <15330..>17006
                     /locus_tag="CD36_50060"
                     /product="non-ltr retrotransposon zorro 3 orf1-related
                     protein, putative"
                     /transcript_id="XM_002420267.1"
                     /db_xref="GeneID:8048068"
     CDS             15330..17006
                     /locus_tag="CD36_50060"
                     /inference="similar to AA sequence:UniProt:Q59KP9"
                     /note="transposable element;
                     Similar to C. albicans FGR13"
                     /codon_start=1
                     /transl_table=12
                     /product="non-ltr retrotransposon zorro 3 orf1-related
                     protein, putative"
                     /protein_id="XP_002420312.1"
                     /db_xref="GeneID:8048068"
                     /db_xref="GOA:B9WGU9"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:B9WGU9"
                     /translation="MNNNPSHNFHSQSQPGRLDTSSNSQMGYPVVPSSPNFVSSNLNS
                     QNKSSQQTISPVHDPASTPSQQSTQPEPNHAKVVDYAAFPKLIHAENAKHPKYRELKR
                     LESVQCPIDLYDLANRNNNINVPQTQLTADISHMYECATSEQVLNTIYFTLNQARDIY
                     QDKLTDLPDSFMDEIANYEKDPQLYLQDHESIPKWSDDYTLDNFYESRAMSEMLHACT
                     YFEVDNDHRLYLEAFDLTYIKKAEFEHLKQLLIGEIERLNFVIGDNSFQIQVDDKVEH
                     MYVASFRLPSISLRSCEQYFREFLDPKDEIVHARIPVFSHEVMSTNPANVNAFFILDK
                     VPPKRKVILQRNYSVRILTNLSHCVYCHSKSHTRLQCPEAGECNICGKLGHRAMNCES
                     RKRRSPEAVPMNGPVKILTKPSVETSQKVSGNGQSKEHNDSAPSDFVDTIFDSDGKEI
                     FHIDPNKSWTFHISQLRLKKTVPSNYLVAPSEPVAWKRYKDGSILVDVVAIVAHRKVG
                     RGFRLAARHAPTTTHPDGEIVEYIASALSRTAPDLVKTYVSAHGLPVTLK"
     mobile_element  15342..16707
                     /note="partial ORF1 (subtelomeric)"
                     /mobile_element_type="LINE:5A, Zorro4"
     mobile_element  16708..17137
                     /note="(subtelomeric)"
                     /mobile_element_type="retrotransposon:partial Tcd16, LTR"
     mobile_element  complement(17139..17517)
                     /note="partial ORF1 (subtelomeric)"
                     /mobile_element_type="LINE:5B, Zorro1-like"
     gene            <18869..>19669
                     /locus_tag="CD36_50070"
                     /db_xref="GeneID:8048069"
     mRNA            <18869..>19669
                     /locus_tag="CD36_50070"
                     /product="mitochondrial 54S ribosomal protein MRPL1"
                     /transcript_id="XM_002420268.1"
                     /db_xref="GeneID:8048069"
     CDS             18869..19669
                     /locus_tag="CD36_50070"
                     /inference="similar to AA sequence:UniProt:Q04599"
                     /inference="similar to AA sequence:UniProt:Q59LA1"
                     /note="Similar to S. cerevisiae MRPL1"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 54S ribosomal protein MRPL1"
                     /protein_id="XP_002420313.1"
                     /db_xref="GeneID:8048069"
                     /db_xref="GOA:B9WGV0"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR016095"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:B9WGV0"
                     /translation="MFKYVPTRSIPAYTSSIRTAVTLRSNLQKEKDQAKKRKLRQELK
                     FNALDNPIDHPLHMPIAKALNILRSLEVGKPADKTTISCNIYVRQEQGAAPIQTKVDI
                     PFPVQRKTKAVVFTTQQPVIEELKKAGIETFGGRDLLDKFLNQELTPDLFTHAFATQE
                     MEPHLKAVARILGPAGLQPTAKKGTVTDDINTILDVIRSFQIKQKDNHISFPVGNCTF
                     SDAQIMSNIKAISDKIYSKIDPNATKKTRLGYCYIGTANSPGLVIDFK"
     gene            complement(<19685..>21337)
                     /locus_tag="CD36_50080"
                     /db_xref="GeneID:8048070"
     mRNA            complement(<19685..>21337)
                     /locus_tag="CD36_50080"
                     /product="subunit of the GPI
                     (glycosylphosphatidylinositol):protein transamidase
                     complex, putative"
                     /transcript_id="XM_002420269.1"
                     /db_xref="GeneID:8048070"
     CDS             complement(19685..21337)
                     /locus_tag="CD36_50080"
                     /inference="similar to AA sequence:UniProt:P39012"
                     /inference="similar to AA sequence:UniProt:Q59LA5"
                     /note="Similar to S. cerevisiae GAA1;
                     In S. cerevisiae: removes the GPI-anchoring signal and
                     attaches GPI to proteins in the ER"
                     /codon_start=1
                     /transl_table=12
                     /product="subunit of the GPI
                     (glycosylphosphatidylinositol):protein transamidase
                     complex, putative"
                     /protein_id="XP_002420314.1"
                     /db_xref="GeneID:8048070"
                     /db_xref="GOA:B9WGV1"
                     /db_xref="InterPro:IPR007246"
                     /db_xref="UniProtKB/TrEMBL:B9WGV1"
                     /translation="MALAEVVIRKVKKLGLVPKAIGMLPRLSFLVAVLSCLWLITLPQ
                     EGNYRNVYISENALMPAQANSYFRESEWNIVRGYREEISKMEKQSVGERNKVVASWLR
                     DSGLQVSYHENGFANNTMYAIMHAPRGENTEAMALVVPWINSDGEYNEGAMSLAVALA
                     RYFTKMSIWSKNIVFVFPETGHKPLRSWVEAYHTSLDDTAGSIEAAIIMEYGKNGDFF
                     EYYDMFYEGLNGQLPNLDLLNTANVMTYHEQIPCAMQGISDRVINYGTRLRTLFRGIL
                     KLTLTGLTDEVHGCEAFSGWQIQAFTIKARGTEGKDVTQFGRIVDSTFRSVNNLLEKF
                     HQSFFFYLMLSPKHFVSIGTYLPSAVMLAVSYALSAISALVVGFDFQKVPLVLVVVTG
                     VEIACVVLAFVPVHQAILSGLGVAAFFPTQRVFSQQVAFSLIGIALLGVALLITALLI
                     VHFALAFSIGVLAIPLTFVPTLMRNRSRLTPVCLAVSNPFFVITVAGHVLGHPELFGR
                     LVSSWDDLQCWTWFIVVLGWFPAWVIITLSYCGYKPVKEKSE"
     gene            <21424..>22092
                     /locus_tag="CD36_50090"
                     /db_xref="GeneID:8048071"
     mRNA            <21424..>22092
                     /locus_tag="CD36_50090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420270.1"
                     /db_xref="GeneID:8048071"
     CDS             21424..22092
                     /locus_tag="CD36_50090"
                     /inference="similar to AA sequence:UniProt:Q59LA6"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420315.1"
                     /db_xref="GeneID:8048071"
                     /db_xref="UniProtKB/TrEMBL:B9WGV2"
                     /translation="MNKHLQRQLKGLPQQIITDGLHALQHNPARFTSFHDIPQLLDYI
                     YKPNKPAWWIRFMKCPYYNLKGKWPTIHLIDELGVDTSGYYNHQNLLSGSTPRPTLPL
                     IKSYANQKDTTTTMIKEVEKLYKFILSKRGLFGVTNHPMEVIYTPSKLGKIHTPAVLD
                     KELKNKVKLIKRVFNDVQPIEKPTLDKLQSIVVSQPHDSILQQYMARQFYLQNGKYIL
                     NSNY"
     gene            complement(<22075..>23652)
                     /locus_tag="CD36_50100"
                     /db_xref="GeneID:8048072"
     mRNA            complement(<22075..>23652)
                     /locus_tag="CD36_50100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420271.1"
                     /db_xref="GeneID:8048072"
     CDS             complement(22075..23652)
                     /locus_tag="CD36_50100"
                     /inference="similar to AA sequence:UniProt:Q59LA7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420316.1"
                     /db_xref="GeneID:8048072"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR024790"
                     /db_xref="InterPro:IPR024977"
                     /db_xref="UniProtKB/TrEMBL:B9WGV3"
                     /translation="MKHFMATTLYNGKLPSLVLADPSGLFTWCPHLNLIFIGMNRTSV
                     WCYRMNGERIYSINNKSAVRHIAFHGEYFCLSGSDNLIKIYNANNGQLVKVLPQEFDG
                     VEFVQWNGSEEKLNYLVVSDGKRLVVTFNQVLGVDMECELSISQQLSTDFFDQVYLSG
                     DKLVRVGFKIENRKLYTQQIVQVCQLVSLLEYSGEHIEKLKSLVAPYLQAMDRYMSNL
                     ESECGDLARYLSDLVVSNIIPECTKDYWLNQYGERGYKKMVKLAGVYEAAIKVTYQHL
                     VTTMERVISVVGELIGISKWEQGLLATKELEDLLVEAKSQLKFYYRFIWDMQSERQQT
                     QQFLVWTKSIIDMLNDQECEVCYSTAEVLCFINDALTKSVMMKYFDIELEVIHHPEKT
                     PMRNVCMDLTTIDEYHRSRLEVEVLRGVSLPEVYTNLKIVQWAEPILTYLQGTDLAIA
                     NMDAVISTIPDVYAYQHRERDLVALTKKSLLIIDSSSCIPIPLPETSFQPTNIILNKE
                     YGVLLDSTRQHYSIVRI"
     gene            <23827..>25035
                     /gene="CDC11"
                     /locus_tag="CD36_50110"
                     /db_xref="GeneID:8048073"
     mRNA            <23827..>25035
                     /gene="CDC11"
                     /locus_tag="CD36_50110"
                     /product="septin, putative"
                     /transcript_id="XM_002420272.1"
                     /db_xref="GeneID:8048073"
     CDS             23827..25035
                     /gene="CDC11"
                     /locus_tag="CD36_50110"
                     /inference="similar to AA sequence:UniProt:P32458"
                     /inference="similar to AA sequence:UniProt:Q8NJ85"
                     /note="In C. albicans: required for wild-type cell and
                     hyphal morphology and for agar-invasive growth; required
                     for full virulence and kidney tissue invasion in a mouse
                     model of systemic infection, but not for kidney
                     colonization or for immunogenicity"
                     /codon_start=1
                     /transl_table=12
                     /product="septin, putative"
                     /protein_id="XP_002420317.1"
                     /db_xref="GeneID:8048073"
                     /db_xref="GOA:B9WGV4"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WGV4"
                     /translation="MNYSTENVSSAALRKRKTLKKSINFSIMIIGESGSGRSTLINTL
                     CGGNSIVPTSSTATQDPFTKKLTLRHENVELEDNEGHKISLNIIDTPNFANSINCDDD
                     FKIIVDFIRHQFDEVLLEESRVKRNPRFKDGRIHVLIYMINPTGHGLSDIDVKFLQHV
                     NNLVNIIPIISKADSLTPKELKLNKELILEDLNNYGINFYKFNEYDYEQDYIDEEIIE
                     YNKYLNSLIPFAIIGANEYRSNPNGSEDEDDVLKLRILNKEFKPIDIDNAEINDFTIL
                     KNVLLVTHLNEFKDITHDSIYENYRTEALSGKQFQYVNKDSAKQEISESDYLMKEEQI
                     KLEEERLRKFEERVHQDLINKRKELLERENELKEIEKRLLAEGLKFDENGDVVKVHEE
                     ESSETEVKVI"
     gene            complement(<25032..>25967)
                     /locus_tag="CD36_50120"
                     /db_xref="GeneID:8048026"
     mRNA            complement(<25032..>25967)
                     /locus_tag="CD36_50120"
                     /product="coatomer subunit epsilon, putative"
                     /transcript_id="XM_002420273.1"
                     /db_xref="GeneID:8048026"
     CDS             complement(25032..25967)
                     /locus_tag="CD36_50120"
                     /inference="similar to AA sequence:UniProt:P40509"
                     /inference="similar to AA sequence:UniProt:Q59LB0"
                     /note="Similar to S. cerevisiae SEC28;
                     In S. cerevisiae: regulates retrograde Golgi-to-ER protein
                     traffic; epsilon-COP coatomer subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="coatomer subunit epsilon, putative"
                     /protein_id="XP_002420318.1"
                     /db_xref="GeneID:8048026"
                     /db_xref="GOA:B9WGV5"
                     /db_xref="InterPro:IPR006822"
                     /db_xref="UniProtKB/TrEMBL:B9WGV5"
                     /translation="MDAFSDSGELYTIRNQFYTNQHNKVKAYSLDEFSPENQLKVLEF
                     QIRSTIALEQDASKMIEDGKTKFPENEPLFQLLSAWNDLKDFGVDDSTYFEDVKQASF
                     ELQAVLTALYLVKFDKDIDQAILFLNNYIDNVNSLAKYNELEPFLVLVQLYLVKGNLS
                     GAAKVLESLNHFPESARDNIIYQVLESWILSVTGGSDNINNSYYFYDEILSSDFDQDI
                     QGKFKILNVLFALTLQLKHFPEAQELVAQIKSLGVVDANFIANQITFDQLQNDGAHAE
                     ELMTELKRLDASHELLKEQDLKTSIFDDIVTKYSI"
     gene            complement(<26054..>26671)
                     /locus_tag="CD36_50130"
                     /db_xref="GeneID:8048074"
     mRNA            complement(<26054..>26671)
                     /locus_tag="CD36_50130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420274.1"
                     /db_xref="GeneID:8048074"
     CDS             complement(26054..26671)
                     /locus_tag="CD36_50130"
                     /inference="similar to AA sequence:UniProt:Q59LB1"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420319.1"
                     /db_xref="GeneID:8048074"
                     /db_xref="InterPro:IPR012470"
                     /db_xref="UniProtKB/TrEMBL:B9WGV6"
                     /translation="MSDNILRDRLGPEKFAKALEFYDADQELTQEDRVQIRDDLKEVL
                     VGDNLASYGSGLIGFLMPTLYMRFFRKGSVNGKSFFQKPVLSGAIGLANMMVTHRVYS
                     QKLFNEKMNSGLPQRQLNVWKAMEQRSLGVYMFYYAKTAQDPKFKLEDPREYTEENRL
                     KVRFDPEKYREGHPQELSTWDRIRLSNGYDITEEKKTAWDDIRSK"
     gene            complement(<26751..>27353)
                     /locus_tag="CD36_50140"
                     /db_xref="GeneID:8048075"
     mRNA            complement(<26751..>27353)
                     /locus_tag="CD36_50140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420275.1"
                     /db_xref="GeneID:8048075"
     CDS             complement(26751..27353)
                     /locus_tag="CD36_50140"
                     /inference="similar to AA sequence:UniProt:Q59LB3"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420320.1"
                     /db_xref="GeneID:8048075"
                     /db_xref="InterPro:IPR012470"
                     /db_xref="UniProtKB/TrEMBL:B9WGV7"
                     /translation="MSGNPLQDILTPSQFQQCVRFYEADQKLDHGERVALATQLQTLA
                     MKTSLAGYTSGMLGFFAPTMYYRAVGRFPTPLFLVQRPFFSLVLGFGTLLVGNNVTAK
                     YLYEKNRKQSFADKNIGDVWQTMDFPYLNFFTLYYSRTSVFPNFIMRDPRTCSYQPLK
                     KENPHFTEATKLGHLDNTGKEHVLSVWDKVRLNHGGGVSK"
     gene            complement(<27493..>29613)
                     /locus_tag="CD36_50150"
                     /db_xref="GeneID:8048076"
     mRNA            complement(<27493..>29613)
                     /locus_tag="CD36_50150"
                     /product="threonyl-tRNA synthetase, cytoplasmic, putative"
                     /transcript_id="XM_002420276.1"
                     /db_xref="GeneID:8048076"
     CDS             complement(27493..29613)
                     /locus_tag="CD36_50150"
                     /EC_number="6.1.1.3"
                     /inference="similar to AA sequence:UniProt:P04801"
                     /inference="similar to AA sequence:UniProt:Q59LB4"
                     /note="Similar to S. cerevisiae THS1"
                     /codon_start=1
                     /transl_table=12
                     /product="threonyl-tRNA synthetase, cytoplasmic, putative"
                     /protein_id="XP_002420321.1"
                     /db_xref="GeneID:8048076"
                     /db_xref="GOA:B9WGV8"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="UniProtKB/TrEMBL:B9WGV8"
                     /translation="MSDVADKVKDLSFKDKKKKPANSLYLDPQPAFIEERIKLFEELK
                     AQYDEEISNKEKTPIKITLRDGTVKEGTAFETSPMDIANSIGKSFAERQVIAKVDGKL
                     WDMPRPLEGDVKLEFLDFEHPEGKAVFWHSSAHILGEACECHYGCHLSHGPPTEDGFF
                     YDMSINNGETFVTQGDFGNLEQVATKAIKEKQKFERLEMTKEQLLKMFHYNKYKVKFI
                     SDKIPDGTSTTVYRCGPLIDLCVGPHIPHSGRIKAFKVLKNSSSYFLGDASNDSLQRV
                     YGISFPDKKLMTEHLKFLAEAAERDHRKIGREQELFIFNEMSPGSAMWLPHGARIYNT
                     LVDTLRTEYRKRGYEEVITPNMYSTKLWETSGHWQNYKENMFSFEVEKETFGLKPMNC
                     PGHCILFKSRERSYRELPWRVADFGVIHRNEFSGALSGLTRVRRFQQDDAHIFCTTDQ
                     IGTEIAGVFDFLKKMYGIFGFEFKMELSTRPEKYVGDLETWNSAEKKLEQALNDFLGE
                     GKWELNPGDGAFYGPKIDIMISDALKRWFQCATIQLDFQLPQRFELEYKSDKGPNTRP
                     VMIHRAILGSVERMTAILTEHYKGKWPFWLSPRQVLIVPVGPKYYDYAQKLQKKLNDD
                     YFFYCDVDVSGNTLPKKIRTGQLYKYNFIFIVGEDEENSESVNVRNRDIPEEQGKNAM
                     VKFDDVVKQMVALRESKRSDNKLQ"
     gene            complement(<30040..>30438)
                     /locus_tag="CD36_50160"
                     /db_xref="GeneID:8048077"
     mRNA            complement(<30040..>30438)
                     /locus_tag="CD36_50160"
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /transcript_id="XM_002420277.1"
                     /db_xref="GeneID:8048077"
     CDS             complement(30040..30438)
                     /locus_tag="CD36_50160"
                     /inference="similar to AA sequence:UniProt:P35996"
                     /inference="similar to AA sequence:UniProt:Q59LB5"
                     /note="Similar to S. cerevisiae MRPL38;
                     In S. cerevisiae: appears as two protein spots (YmL34 and
                     YmL38) on two-dimensional SDS gels"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /protein_id="XP_002420322.1"
                     /db_xref="GeneID:8048077"
                     /db_xref="GOA:B9WGV9"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR005745"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:B9WGV9"
                     /translation="MIYLKSLLNVIDNSGAQVVECIKVLRHKPKSCAQIGDRITCVVK
                     QARPLQQELTGQTSTNRVKRRDICQAVVVRTRAPLKRKDGSVVRFDDNACVLINKNGE
                     PLGTRISSVVAKELKDLNYNKIVALAPKTF"
     gene            complement(<30589..>31281)
                     /locus_tag="CD36_50170"
                     /db_xref="GeneID:8048078"
     mRNA            complement(<30589..>31281)
                     /locus_tag="CD36_50170"
                     /product="uncharacterized integral membrane protein,
                     putative"
                     /transcript_id="XM_002420278.1"
                     /db_xref="GeneID:8048078"
     CDS             complement(30589..31281)
                     /locus_tag="CD36_50170"
                     /inference="similar to AA sequence:UniProt:P38842"
                     /inference="similar to AA sequence:UniProt:Q59LB6"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized integral membrane protein,
                     putative"
                     /protein_id="XP_002420323.1"
                     /db_xref="GeneID:8048078"
                     /db_xref="GOA:B9WGW0"
                     /db_xref="InterPro:IPR006838"
                     /db_xref="UniProtKB/TrEMBL:B9WGW0"
                     /translation="MSRRVVGNQVILGINAVSIAIGVYGASRIFSLELSDDLKGAGHY
                     QFLTNLSLIYSLGVFGLGFFAHLTRSESLYDLKNLLHPIGLALETIVAMVYWPLRLFC
                     LHLLTPDPENFKIPLKLDLSVHLMPVVSLLIDYLVFMPRWTIKSNTVLLLITALSTGY
                     WCLLKYLVDTENGGRYPYAFMDMEDDGLRALVFVAVGLVAFLQFHFMRSIYDFVVKKT
                     ENVDVEIDRKLD"
     gene            complement(<31433..>33064)
                     /locus_tag="CD36_50180"
                     /db_xref="GeneID:8048079"
     mRNA            complement(<31433..>33064)
                     /locus_tag="CD36_50180"
                     /product="importin subunit alpha, putative"
                     /transcript_id="XM_002420279.1"
                     /db_xref="GeneID:8048079"
     CDS             complement(31433..33064)
                     /locus_tag="CD36_50180"
                     /inference="similar to AA sequence:UniProt:Q02821"
                     /inference="similar to AA sequence:UniProt:Q59LB7"
                     /note="Similar to S. cerevisiae SRP1;
                     In S. cerevisiae: mediates import of nuclear proteins;
                     binds the nuclear localization signal of the substrate
                     during import; may also play a role in regulation of
                     protein degradation; karyopherin subunit alpha, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="importin subunit alpha, putative"
                     /protein_id="XP_002420324.1"
                     /db_xref="GeneID:8048079"
                     /db_xref="GOA:B9WGW1"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR002652"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024931"
                     /db_xref="UniProtKB/TrEMBL:B9WGW1"
                     /translation="MDSDATNRFVPEYRRTNFKNKGRFQSDELRRRRETHQVDLRKQK
                     REEVLAKRRNYANQGNESEDEEEYNPTANSDENQFYNKLKQDLPKMLEMIQAPDFDSQ
                     LAATVKFRQILSREHNPPIDLVIQSGVIPTLVEFMKEDHPDMLQLEAAWALTNIASGD
                     SAQTRVVVEANAVPLFVQLLYSQSLEVKEQAIWALGNVAGDSSDNRDYVLSCNAMEPV
                     LQLFNCTKMSLIRTATWTLSNLCRGKSPQPDWNIVSQAIPTLGKLIYSVDAETLVDAC
                     WAVSYLSDGTSEAIQAVIDARIPHRLVELLGHDSTLVQTPALRAIGNIVTGSDYQTQI
                     VINAGVLPALAPLLNSTKDTIRKEACWTISNITAGTTDQIQAVIDANLIPQVIRLLIH
                     GDYKTKKEACWAISNASSGGLTKPDQIRYLVSQGCIKPLCDLLSVADSKIIEVTLDSL
                     ENILKMGEMDKEARGASVNEYALFIEEAGGMEKIFECQNNPNEKIYQKAFSIIEKYFS
                     DDDGQIDDENIVPESYGNSFGFGMDANQQQQNFQF"
     gene            <33217..>33939
                     /locus_tag="CD36_50190"
                     /db_xref="GeneID:8048080"
     mRNA            <33217..>33939
                     /locus_tag="CD36_50190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420280.1"
                     /db_xref="GeneID:8048080"
     CDS             33217..33939
                     /locus_tag="CD36_50190"
                     /inference="similar to AA sequence:UniProt:Q59LB8"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420325.1"
                     /db_xref="GeneID:8048080"
                     /db_xref="UniProtKB/TrEMBL:B9WGW2"
                     /translation="MLSRTIYHRSFSILSRSKAKRSFTPSDSSVESDEILSENNPWSP
                     TLEDDPVYVQERNKFRKTKLPQQYRLAYSPLYEAPASKYVSMLKRLTLSVGVLGIYGA
                     KLFYESSQFDDLYAYATLAATFTPLALVQYKTKDYVTRIFRLYDKTKPQTLENLVSDE
                     KLILEKLNFTGGSTYNELLTITDNKDLKLSPPAKPYLPYSTWRDNTRDFYVMDNIGGI
                     RMDRIWGLIEKNSQVNNGRSNW"
     gene            <33980..>35152
                     /locus_tag="CD36_50200"
                     /db_xref="GeneID:8048081"
     mRNA            <33980..>35152
                     /locus_tag="CD36_50200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420281.1"
                     /db_xref="GeneID:8048081"
     CDS             33980..35152
                     /locus_tag="CD36_50200"
                     /inference="similar to AA sequence:UniProt:Q59LB9"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420326.1"
                     /db_xref="GeneID:8048081"
                     /db_xref="GOA:B9WGW3"
                     /db_xref="InterPro:IPR006016"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:B9WGW3"
                     /translation="MPHWFFWASIFLRRFFRFPIFFLSSFQPLMEAVKQLKKTPAAPS
                     RLLATGDLDDETLRNTQLNAELYHTSNDSVELYRQENNSSDLLGRLYYDDYDSDSMTS
                     PSITPMPLSPIISPSESSDQLSNKSRPPFLRMKSMERGISFDTSPHGHQKSYTVKAKH
                     PLFKFRRTNKTFLVGYNDDVESTKAIEWLFDEMIINGDTIVVLQVLDEKQHVAIDKSK
                     VQKNLAKIEQINHHFKKVCIIYEAAIGKAKRAIKSAIDEYRPSMMAIGTHHYDGKEHH
                     RSFTKSSLSKHILECSLVPIILVKPTYRYVEFLREEVDGPQYFENWIKNIDHIDNRVI
                     RKKVPLISPSISRNSSYTSLVNEDRGRGGGLSDQVLNESRSRSTSKNRVFARFFKK"
     gene            <35291..>38608
                     /locus_tag="CD36_50210"
                     /db_xref="GeneID:8048082"
     mRNA            <35291..>38608
                     /locus_tag="CD36_50210"
                     /product="histidine acid phosphatase, putative"
                     /transcript_id="XM_002420282.1"
                     /db_xref="GeneID:8048082"
     CDS             35291..38608
                     /locus_tag="CD36_50210"
                     /inference="similar to AA sequence:UniProt:Q06685"
                     /inference="similar to AA sequence:UniProt:Q5A4W6"
                     /note="Similar to S. cerevisiae VIP1;
                     In S. cerevisiae: generation of IP7 by Vip1p is important
                     for phosphate signaling; likely involved in cortical actin
                     cytoskeleton function, by analogy with S. pombe ortholog
                     asp1; inositol hexakisphosphate (IP6) and inositol
                     heptakisphosphate (IP7) kinase, putative; inositol
                     pyrophosphate synthase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="histidine acid phosphatase, putative"
                     /protein_id="XP_002420327.1"
                     /db_xref="GeneID:8048082"
                     /db_xref="GOA:B9WGW4"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013651"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:B9WGW4"
                     /translation="MTSNSESLPIPVPKKEDSKPTSLNIPKSISQPLSPLSAPIDQSN
                     GTPKPIPTPITEKAMASIAPMLEGFSPKTHAEDSVSRLNSISSSAGQVSDDDLVQPIT
                     AENLSNIKSYSNSFVDGSRISRTVSNTSNASRKSYADTFKLPKIGTIGVCAMDAKALS
                     KPCRRILNRLIETGEFETVIFGDKVILDEAIENWPTCDFLISFFSTGFPLDKAIDYVN
                     YRKPYMINDLVFQKALWDRRVVLAILNHANVPSPERLEISRDGGPHLDSQLLDRLKEI
                     GMSEEKLEKLTNQSEPDWEMVDEDTLRVGDKTLSKPFVEKPVDGEDHNVYIYYPRATG
                     GGGRRLFRKIGNKSSEFDANLSSPRTDGSFIYEKFMDTDNFEDVKAYTVGPNFCHAET
                     RKSPVVDGIVRRNTHGKEIRYVTELTDEEKTMAKNVSSAFKQTICGFDLLRVNGKSFV
                     IDVNGFSFVKDNNDYYDSCASILRGLFIDAKKSRDLLTRKIPKMLQTSQFEQKAQKWV
                     FKGMVTVIRHADRTPKQKFKYSFRSPVFISLLKGHREEVIIRAVPDLQVVLETVKIAE
                     SKGLEDLNKLKQLRIALEKKMDFPGTKIQLKPTLNGDNPEIVDKVQLILKWGGEPTHS
                     AKHQATDVGEQMRQNLQLLNREALDDVKVYTSSERRVIASAQYFSASLLSFDEPLVDD
                     FLIVRKDLLDDSNAAKDLMDKVKKKLKPLLREGAEAPPQFTWPPKMPQPFEVIKRVCE
                     LMNFYHQIMNYNFETKNVQEFQINWCCGEDPFLFKERWDKLFQEFISVEKTHPSKISE
                     LYDTMKYDALHNRQFLQKVFSYDPNDKVLLSRLTETCGSTVNSSGLVSEYPINILAMN
                     NFKLPESASTSTNNSSANLNSSSAAGSLGWVLSGAATTMKCESKDKTASPQTPFDHPT
                     FARLRELYRLSKVLFDFICPQEYGIKDEEKLDIGLLTSLPLAKQILSDIYDMKKNDQP
                     ALVNYFTKESHIYTLLNIIYGSQLPMKIARNALPELDYLSQIVFELYEAEDPSSPTGK
                     KHSIRLSLSPGCHTQDPLDVQLDDDHYIGCIPRINLTRHLDMDLVTQRLKSRFSRVSL
                     PKKFTPVNITGPLNSNK"
     gene            complement(<38663..>44776)
                     /gene="FAS1"
                     /locus_tag="CD36_50220"
                     /db_xref="GeneID:8048083"
     mRNA            complement(<38663..>44776)
                     /gene="FAS1"
                     /locus_tag="CD36_50220"
                     /product="fatty acid synthase subunit beta (ec 2.3.1.86)
                     [includes: 3-hydroxypalmitoyl-[acyl-carrier-protein]
                     dehydratase (ec 4.2.1.61); enoyl-[acyl-carrier-protein]
                     reductase [nadh] (ec 1.3.1.9); [acyl-carrier-protein]
                     acetyltransferase (ec 2.3.1.38); [acyl-carrier-protein]
                     malonyltransferase (ec 2.3.1.39); s-acyl fatty acid
                     synthase thioesterase (ec 3.1.2.14)]"
                     /transcript_id="XM_002420283.1"
                     /db_xref="GeneID:8048083"
     CDS             complement(38663..44776)
                     /gene="FAS1"
                     /locus_tag="CD36_50220"
                     /EC_number="1.3.1.9"
                     /EC_number="2.3.1.39"
                     /EC_number="2.3.1.86"
                     /EC_number="2.3.1.38"
                     /EC_number="3.1.2.14"
                     /EC_number="4.2.1.59"
                     /inference="similar to AA sequence:UniProt:P07149"
                     /inference="similar to AA sequence:UniProt:P34731"
                     /note="catalyzes the formation of long-chain fatty acids
                     from acetyl-CoA, malonyl-CoA and NADPH."
                     /codon_start=1
                     /transl_table=12
                     /product="fatty acid synthase subunit beta (ec 2.3.1.86)
                     [includes: 3-hydroxypalmitoyl-[acyl-carrier-protein]
                     dehydratase (ec 4.2.1.61); enoyl-[acyl-carrier-protein]
                     reductase [nadh] (ec 1.3.1.9); [acyl-carrier-protein]
                     acetyltransferase (ec 2.3.1.38); [acyl-carrier-protein]
                     malonyltransferase (ec 2.3.1.39); s-acyl fatty acid
                     synthase thioesterase (ec 3.1.2.14)]"
                     /protein_id="XP_002420328.1"
                     /db_xref="GeneID:8048083"
                     /db_xref="GOA:B9WGW5"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR003965"
                     /db_xref="InterPro:IPR013565"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR016452"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:B9WGW5"
                     /translation="MSTHRPFQLNHGSIEHTLLVPNDLFFNYSQLKDEFIKTLPEPTE
                     GFAGDDEPSSPAELYGKFIGFISNAQFPQIVELSLKDFESRFLDNNNDNIHSFAVKLL
                     DDETYPTTIAKVKENIVKNYYKAVKSINKVESNLLYHCKHDAKLAAIFGGQGNTDDYF
                     EELRELYTLYQGLIEDLLVCIAEKLNQLHPSFDKIYTQGLNILSWLKHPETTPDQDYL
                     LSVPVSCPVICVIQLCHYTITCKVLGLTPGEFRNSLRWSTGHSQGLVTAVTIAASDSW
                     DSFLKNSLTAVSLLLFIGSRCLSTYPRTSLPPTMLQDSLDNGEGRPSPMLSVRDLSIK
                     QVEKFIEQTNSHLPKEKHIAISLINGARNLVLSGPPESLYGFNLNLRNQKAPMGLDQS
                     RVPFSERKLKCSNRFLPIFAPFHSHLLADATELILDDVKEHGLVFEGLKIPVYDTFDG
                     SDFQGIKEPIIDRVVKLITELPVHWEEATNHKATHILDFGPGGVSGLGVLTHRNKEGT
                     GARIILAGTLDSNPIDDEYGFKHEIFQTSADKAIKWAPDWLKELRPTLVKNSEGKIYV
                     KTKFSQLLGRAPLMVAGMTPTTVNTDIVSAALNAGYHIELAGGGYFSPVMMTKAIDEI
                     VSRIKPGYGLGINLIYVNPFMLQWGIPLIKDLREKGYPIQSLTIGAGVPSIEVATEYI
                     EDLGLTHLGLKPGSVDAISQVIAIAKAHPTFPIVMQWTGGRGGGHHSFEDFHQPIIQM
                     YSKIRRCSNIILVAGSGFGSDEDTYPYLSGYWSEKFNYPPMPFDGVLFGSRVMTSKES
                     HTSLAAKKLIVECKGVPDQQWEQTYKKPTGGIITVRSEMGEPIHKIATRGVMFWKELD
                     DTIFNLPKNKLLEALNKKRDHIIKKLNNDFQKPWFGINANGVCDLQEMTYKEVANRLV
                     ELMYVKKSHRWIDVSLRNLYGDFLRRVEERFTSSTGTVSLLQNFNQLNEPEQFTVDFF
                     AKFPQAGKQLISEEDCDHFLMLAARPAQKPVPFVPVLDERFEFFFKKDSLWQSEDLES
                     VVDEDVQRTCILHGPVASQFTTKVDEPIGDILNSIHEGHIARLIKEEYSGDESKIPVV
                     EYFGGKKAASASSGCVNVAKGKEVVYEIDSQLPGKQEWLDLLAGTELNWLQAFISTDR
                     IVQGSKHVSNPLHNILTPVKHSKVTIDKETKKLTAFENIKGDLLPVVEIELIKPNTIQ
                     LSLIEHRTADSNPVALPFLYKYNPADGFAPILEIMEDRNERIKEFYWKLWFGSSVPYS
                     NDINVEKAILGDEITISSKTISEFTHAIGNKCDAFVDRPGKATLAPMDFAIVIGWKAI
                     IKAIFPKSVDGDLLKLVHLSNGYKMIPGAAPLKKGDVVSTKAEIKAVLNQPSGKLVEV
                     VGTIYRENKPVMEVTSQFLYRGEYNDYCNTFQKVTETPVQVAFKSPKDLAVLRSKEWF
                     HLEKDIEFDVLTFRCESTYKFKSANVYSSIKTTGQVLLELPTKEVIQVGSVDYEAGTS
                     YGNPVTDYLSRNGKTIEESVIFENAIPLSSGEELTSKAPGTNEPYAIVSGDYNPIHVS
                     RVFAAYAKLPGTITHGMYSSASIRALVEEWAANNVASRVRAFKCDFVGMVLPNDTLQT
                     TMEHVGMINGRKIIKVETRNVETELPVLIGEAEIEQPTTTYVFTGQGSQEQGMGMELY
                     NSSEVAREVWDKADRHFVNNYGFSILDIVQNNPNELTIHFGGAKGRAIRDNYIGMMFE
                     TIGEDGALKSEKIFKDIDETTTSYTFVSPTGLLSATQFTQPALTLMEKAAYEDIKSKG
                     LIPSDIMFAGHSLGEYSALSSLANVMPIESLVDVVFYRGMTMQVAVPRDELGRSNYGM
                     VAVNPSRVSATFDDSALRFVVDEVANKTKWLLEIVNYNVENQQYVAAGDLRALDTLTN
                     VLNVLKINKIDIVKLQEQMSIDKVKEHLYEIVDEVAAKSLAKPQPIELERGFAVIPLK
                     GISVPFHSSYLMSGVKPFQRFLCKKIPKSSVKPQDLIGKYIPNLTAKPFELTKEYFQS
                     VYELTKSEKIKNILDNWEQYE"
     gene            complement(<45886..>48051)
                     /locus_tag="CD36_50230"
                     /db_xref="GeneID:8048036"
     mRNA            complement(<45886..>48051)
                     /locus_tag="CD36_50230"
                     /product="bromodomain-containing transcription factor,
                     putative"
                     /transcript_id="XM_002420284.1"
                     /db_xref="GeneID:8048036"
     CDS             complement(45886..48051)
                     /locus_tag="CD36_50230"
                     /inference="similar to AA sequence:UniProt:Q07442"
                     /inference="similar to AA sequence:UniProt:Q5A4W8"
                     /note="Similar to S. cerevisiae BDF2;
                     In S. cerevisiae: protein involved in transcription
                     initiation at TATA-containing promoters; associates with
                     the basal transcription factor TFIID; contains two
                     bromodomains; corresponds to the C-terminal region of
                     mammalian TAF1; protein involved in transcription
                     initiation at TATA-containing promoters, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="bromodomain-containing transcription factor,
                     putative"
                     /protein_id="XP_002420329.1"
                     /db_xref="GeneID:8048036"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR027353"
                     /db_xref="UniProtKB/TrEMBL:B9WGW6"
                     /translation="MSETFPETNTPVQTPSTESFVNKMNADDKTIGNNVFSQDSDSNQ
                     QSSHQEPLSPPNPSPTPEKRQLDDEIDSNTEPESKKQKVEEESNVGQTALESGSPINE
                     DQEIATNNGISEDAAQEKPQEEAPQEKPQEDAPQEKPQDAPQETPQDVPQENPHESEE
                     PDIKEIDPPKPPVFTEPAPKPPQEPDMNNLPEHPLPPHQAKFVLNTIKAVKRNREAVP
                     FLHPVDTVKLNVPFYYNYIPRPMDLSTIERKINLKAYENVSQVVDDFNLMVKNCKKFN
                     GEAAGISKMAMNIQAQFEKLMVKVPPKELPVGTNAAEAASAATSPNTNKRKATTESSS
                     SHHHQHRDSVAAARPKRTIHPPKSKELPYETKPKNKKVAAELRFCNQTIKELMSKKHY
                     NYNFPFLAPVDTVALNIPNYNEIVKHPMDLGTIQSKLANNEYENADDFEKDVRLVFKN
                     CYLFNPEGTDVNMMGHRLEAVFDKKWASKPVPEPTPQNSDVSDRDYSSEEEDNVEISE
                     AMLSEIPAIQVMENQIIRMRKELDELKKEHLKRLREQQAARKKKKQQKGKRRASKAKH
                     AKDSHHHHQVQAPPEPPKLTPPQPVVTYEMKKQVSEMVPNLSDKKLNALIKIIQDDVQ
                     ISNDDEVELDMDQLEDRTVLKLYDFLFGDKALKNSAGKKKKPIANNNLDELAHLRSQL
                     ALFDEGVNGQQGSGNGFMNVVNQEESSEDEASSESSEEE"
     gene            complement(<49007..>51052)
                     /locus_tag="CD36_50240"
                     /db_xref="GeneID:8048084"
     mRNA            complement(<49007..>51052)
                     /locus_tag="CD36_50240"
                     /product="E3 ubiquitin-protein ligase, putative"
                     /transcript_id="XM_002420285.1"
                     /db_xref="GeneID:8048084"
     CDS             complement(49007..51052)
                     /locus_tag="CD36_50240"
                     /EC_number="6.3.2.-"
                     /inference="similar to AA sequence:UniProt:Q07457"
                     /inference="similar to AA sequence:UniProt:Q5A4X0"
                     /note="Similar to S. cerevisiae BRE1;
                     In S. cerevisiae: E3 ubiquitin ligase for Rad6p, required
                     for the ubiquitination of histone H2B, recruitment of
                     Rad6p to promoter chromatin and subsequent methylation of
                     histone H3 (on K4 and K79)"
                     /codon_start=1
                     /transl_table=12
                     /product="E3 ubiquitin-protein ligase, putative"
                     /protein_id="XP_002420330.1"
                     /db_xref="GeneID:8048084"
                     /db_xref="GOA:B9WGW7"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013956"
                     /db_xref="UniProtKB/TrEMBL:B9WGW7"
                     /translation="MGVDNEKKRSTSDSSASPRAKRSKPMQELSESGPLTQADVVYFQ
                     KEAIWRQMIQYKQQMMSMRSELIRLQRESDASKHIVCVLTGWYEQILALFDELNSEET
                     SDLLLAITKNDDERLELIRKKLSNLISSKVTFDSDKYEKVCGELALLSRQNEQILEEK
                     RSLCAKIDELESKIIELNKEYERAQSKTLRRLDSQRHIKTEEDEKSNTKEENPQPNGH
                     HKENDKNAQVDSEELDHLKCELDKLKTANQLLVQQVEELTKENQSLIQKSLNLDNKLH
                     NLEESDLEDNIYYKKIVKNNQSLQEQIGKLTKLNSSNVSRLNDLERQQNDLKSVIEGE
                     IIEENEKLKSQLHESENNLVRIRTTRDELLSKNNILTSQLQDQKTNESLVELNNVLSN
                     RVELLTEERLEAIVGTPGDAKLEDLSQQELIHKIGQLNNEIKEVELAFKQTREITLKK
                     LTSSIDQENLTKKLTIEKNKADQKYFSAMRVKDSLTNENKLLKIQIAKSQDLIKNLND
                     LEKKYLNKIDLLSNQLVDFRIIKENSLAENSKLHDELKTLTIAQGALQQEVERVNNKL
                     ESTLKENTDLQDSNKKRDLELVKLQKQLQSTENILQKYKTNNTNSLLQEDEQQLEALR
                     SIAKCSVCSKNWKDTAITVCGHVFCSKCTQERLAARLRRCPSCNRGFSANDLLSIHL"
     gene            <51821..>54424
                     /locus_tag="CD36_50250"
                     /db_xref="GeneID:8048303"
     mRNA            <51821..>54424
                     /locus_tag="CD36_50250"
                     /product="alpha-glucosidase II, catalytic subunit,
                     putative"
                     /transcript_id="XM_002420286.1"
                     /db_xref="GeneID:8048303"
     CDS             51821..54424
                     /locus_tag="CD36_50250"
                     /EC_number="3.2.1.84"
                     /inference="similar to AA sequence:UniProt:P38138"
                     /inference="similar to AA sequence:UniProt:Q5A4X3"
                     /note="Similar to S. cerevisiae ROT2;
                     In S. cerevisiae: required for normal cell wall synthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="alpha-glucosidase II, catalytic subunit,
                     putative"
                     /protein_id="XP_002420331.1"
                     /db_xref="GeneID:8048303"
                     /db_xref="GOA:B9WGW8"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR025887"
                     /db_xref="UniProtKB/TrEMBL:B9WGW8"
                     /translation="MKLFLCIIFIIASANAVKEYLFKSCSQSGFCHRNRHYATEVSNS
                     KNFQSPYSIDSIQVDNDTITGIVFKHLPQLEHPIQLPFEISIIEDNFRFKLTEKQNIV
                     TKNVNPVRYNETEKLAFKQGVKKSKGFDVSLRDNEASIIYGEHEVLIQYHPIVFVFKY
                     AGKEQLRINDKQFLNIEHRRLKDENETNMLPQESDFNMFSDSFQDSKFDSLPLGPESI
                     GLDFTLRGFSNLYGIPEHADSLLLKDTTSGEPYRLYNVDIFEYEPNSRLPMYGSIPLV
                     VAAKPDVSIGIFWLNSADTYVDIHKSKSSTVHWMSENGILDFIVIIEKSPAMVNQQYG
                     KVTGNTQLPPLFSLGYHQCRWNYNDEKDVLEVHAKFDEYEIPYDTIWLDIEYTDEKKY
                     FTWHKENFATPEKMLRELDRTGRNLVAIIDPHIKTGYEVSDEIIKKGLTMKDSNNETY
                     YGHCWPGESVWIDTLNPNSQNFWDKKHKEFMTPAPNLHLWNDMNEPSVFNGPETSAPK
                     DNLHFGQWEHRSVHNVFGLSYHEATFDSLLNRSPERRPFILTRSYFAGSQRTAAMWTG
                     DNMSKWEYLKISIPMVLTSNVVGMPFAGADVGGFFGNPSNELLTRWYQTGIWYPFFRA
                     HAHIDSRRREPWLAGEPYTQYIRDAIRLRYALLPLFYTSFYEASKTGTPVLKPVFYES
                     THKSDSYAIDDEFFIGDSGLLVKPVTDEGAKDIEFYLPDDKVYYDFTNGILQGVYKGG
                     KKPVQLSDIPMLLKGGSIIPMKNRYRRSSKLMKSDPYTLIIALDKKGSASGTLYVDDG
                     ETFAQGTEVAFTVNNNIISAKKIGPTASIPIEKIIVASEGKTTTLKNPKLDIYSDWSL
                     RFSFGIDHDEL"
     gene            complement(<54419..>55279)
                     /locus_tag="CD36_50260"
                     /db_xref="GeneID:8048304"
     mRNA            complement(<54419..>55279)
                     /locus_tag="CD36_50260"
                     /product="DNA replication structure-specific endonuclease
                     subunit, putative"
                     /transcript_id="XM_002420287.1"
                     /db_xref="GeneID:8048304"
     CDS             complement(54419..55279)
                     /locus_tag="CD36_50260"
                     /EC_number="3.6.1.-"
                     /inference="similar to AA sequence:UniProt:P38324"
                     /inference="similar to AA sequence:UniProt:Q5A4X4"
                     /note="Similar to S. cerevisiae SLX1;
                     In S. cerevisiae: subunit of a complex that hydrolyzes 5'
                     branches from duplex DNA in response to stalled or
                     converging replication forks"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA replication structure-specific endonuclease
                     subunit, putative"
                     /protein_id="XP_002420332.1"
                     /db_xref="GeneID:8048304"
                     /db_xref="GOA:B9WGW9"
                     /db_xref="InterPro:IPR000305"
                     /db_xref="InterPro:IPR027520"
                     /translation="MSQTNDKPALHLVPSFYGVYILKSIPKPRRTYIGSTPDPKRRLR
                     QHNGDLKVGGAYRTKKDGSRPWTMVVLVHGFPSRIAALQFEHSLQHAYQTRHINNDAR
                     ITSSSRQSSMHSKLANIRLLTTSFDKMSLKIAIFDEEVYRMWVENKHKIECNVPCTLF
                     KFDEFCNSIQEIDIEDAKNILLGKQLDCMVCKASIDYFKDSTPNISSREELSNYLAKG
                     NYPLIGICGDHAFHLSCIARQRGPAMVPKSVTCTTCGQKLDWSDIIKVSTRLRHYVVQ
                     DSLHLAITQL"
     gene            <56086..>57777
                     /gene="SKN7"
                     /locus_tag="CD36_50270"
                     /db_xref="GeneID:8048305"
     mRNA            <56086..>57777
                     /gene="SKN7"
                     /locus_tag="CD36_50270"
                     /product="nuclear response regulator and transcription
                     factor, putative"
                     /transcript_id="XM_002420288.1"
                     /db_xref="GeneID:8048305"
     CDS             56086..57777
                     /gene="SKN7"
                     /locus_tag="CD36_50270"
                     /inference="similar to AA sequence:UniProt:P38889"
                     /inference="similar to AA sequence:UniProt:Q6KFY0"
                     /note="transcription factor Skn7 homologue, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="nuclear response regulator and transcription
                     factor, putative"
                     /protein_id="XP_002420333.1"
                     /db_xref="GeneID:8048305"
                     /db_xref="GOA:B9WGX0"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014402"
                     /db_xref="InterPro:IPR027718"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:B9WGX0"
                     /translation="MSSLQQPIPPNSTLATTASSNQSGSNDFVKKLFLMLQEDSYKEV
                     VRWTAKGDSFVVLNTNEFTKDILPKHFKHSNFASFVRQLNKYDFHKVKISNEAKATYP
                     YGEDAWEFKHPEFRINDADALENIKRKGPTSKKAASSNVTIKTEANNNGTQPTCNHNY
                     SQLVSTTNHLKEQVESLKKDKHSLYQEISVLERKYKTVVENIVAINTFNERYYSSMNV
                     LMNSLVQNGMKLPPLDFPPPVQLGPDSGIGSNLGPLSSDTSLPSISHHLQSPLSHHQQ
                     LLNRTIRPISNPIDGIPLGKPQVQQQQSPLGQNLPAPIATPSAVPFSEGSSSSIQAPT
                     PGQLPHPVAQPPPPPPAPLPQQQPLAPAPPPTATAASTSQIPTAPAPPTQQQVGTSSS
                     SIPTISPKSQGIVVSNSASPNASSQINTISVPNPKFHVLLVEDDNVCIQLCRKFLVKY
                     GCSVTVVTDGLNAISTVEHTKYDLVLMDIVMPNLDGATATSVIRSFDTKTPIIAMTGN
                     IEDNDLVTYLQNGMSDILAKPFTKDDLYAMLSKHLLDPKENKQDNEPTVKKQKLN"
     gene            complement(<57774..>58454)
                     /locus_tag="CD36_50280"
                     /db_xref="GeneID:8048053"
     mRNA            complement(<57774..>58454)
                     /locus_tag="CD36_50280"
                     /product="Srr1-like protein, putative"
                     /transcript_id="XM_002420289.1"
                     /db_xref="GeneID:8048053"
     CDS             complement(57774..58454)
                     /locus_tag="CD36_50280"
                     /inference="similar to AA sequence:UniProt:Q06688"
                     /inference="similar to AA sequence:UniProt:Q5A4X6"
                     /note="belongs to the SRR1 family of proteins; SRR1
                     proteins are signalling proteins involved in regulating
                     the circadian clock in Arabidopsis (see Pfam entry
                     PF07985); signalling protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Srr1-like protein, putative"
                     /protein_id="XP_002420334.1"
                     /db_xref="GeneID:8048053"
                     /db_xref="InterPro:IPR012942"
                     /db_xref="UniProtKB/TrEMBL:B9WGX1"
                     /translation="MIIIIIIHNTILQNPTTRNMDYRQIIKTSKLFQDISLSLENLQI
                     STIRCLALGSPSESKNARFQLALLIELQHLFDAEVSLYDPVFNEKDCEILKDFTIEKE
                     FSSDSSKTLYFLPHASLELTEEVLNTHQPKHFLANDVIAHTDRLTKKKLADNYPTLSI
                     IVHLLGENKVDDGFTRVSRKRFKEPVIAYDIDSVYFDKVQISRYLHTNKNDAWGTSFS
                     DLAYHHIC"
     gene            <58639..>59853
                     /locus_tag="CD36_50290"
                     /db_xref="GeneID:8048306"
     mRNA            <58639..>59853
                     /locus_tag="CD36_50290"
                     /product="phosphoribosyl pyrophosphate synthetase,
                     putative"
                     /transcript_id="XM_002420290.1"
                     /db_xref="GeneID:8048306"
     CDS             58639..59853
                     /locus_tag="CD36_50290"
                     /EC_number="2.7.6.1"
                     /inference="similar to AA sequence:UniProt:P32895"
                     /inference="similar to AA sequence:UniProt:Q5A4X7"
                     /note="Similar to S. cerevisiae PRS1;
                     In S. cerevisiae: involved in nucleotide, histidine, and
                     tryptophan biosynthesis; ribose-phosphate
                     pyrophosphokinase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphoribosyl pyrophosphate synthetase,
                     putative"
                     /protein_id="XP_002420335.1"
                     /db_xref="GeneID:8048306"
                     /db_xref="GOA:B9WGX2"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:B9WGX2"
                     /translation="MRKCKIFVGSSHPELGQLVCDRLGVEPAPCTLKKFSNGETSVQI
                     GVSVRDEDVYIIQSGSPHINDHIMELLILISACRGGSANKITAVIPQFPYSKQSKMKK
                     HRGAITARMLANLLVMAGADHVVSMDLHASQMQGFFSKPVDNLFGAPTLARWIRHHIP
                     DWENAVVVSKNPGGTKRVTALADSLKINFAMIHTDRRRTQDEYAKKKELKQAQIIEEG
                     EDNIVSELQTARVVQGHVVDDDYQANGTTEHLTKEAILDSDVLGGTYDATGSDDEDET
                     TTSSEEKLITLVGDVKDKVAIILDDMIDKPNSFIAAAEHLRLNCGAKAVYVVGTHGVF
                     NDKCLKDLTDSKCIDKIVVTNTYPISKEQIEKHKDKLVVIDVSPIFAECIRRDHFGES
                     ISVLFDSLSSIE"
     gene            <60801..>61196
                     /locus_tag="CD36_50300"
                     /db_xref="GeneID:8048307"
     mRNA            <60801..>61196
                     /locus_tag="CD36_50300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420291.1"
                     /db_xref="GeneID:8048307"
     CDS             60801..61196
                     /locus_tag="CD36_50300"
                     /inference="similar to AA sequence:UniProt:Q5A4X8"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420336.1"
                     /db_xref="GeneID:8048307"
                     /db_xref="UniProtKB/TrEMBL:B9WGX3"
                     /translation="MKFSTVATVFAISTLAAAKGGDKDHNKPSTITEYVTETTHKYGR
                     FDKTKRPEEPKETGTHKYGKFNKTPRPVTKTVLVQDGDIPKKREAVVARDSKNSSSNS
                     TTSSGNNGVSTGVSLGLAGVLAVGAALVI"
     gene            complement(<61385..>62347)
                     /locus_tag="CD36_50310"
                     /db_xref="GeneID:8048308"
     mRNA            complement(<61385..>62347)
                     /locus_tag="CD36_50310"
                     /product="mitochondrial nuclease, putative"
                     /transcript_id="XM_002420292.1"
                     /db_xref="GeneID:8048308"
     CDS             complement(61385..62347)
                     /locus_tag="CD36_50310"
                     /EC_number="3.1.30.-"
                     /inference="similar to AA sequence:UniProt:P08466"
                     /inference="similar to AA sequence:UniProt:Q5A4X9"
                     /note="Similar to S. cerevisiae NUC1;
                     In S. cerevisiae: has roles in mitochondrial
                     recombination, apoptosis and maintenance of polyploidy"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial nuclease, putative"
                     /protein_id="XP_002420337.1"
                     /db_xref="GeneID:8048308"
                     /db_xref="GOA:B9WGX4"
                     /db_xref="InterPro:IPR001604"
                     /db_xref="InterPro:IPR018524"
                     /db_xref="InterPro:IPR020821"
                     /db_xref="UniProtKB/TrEMBL:B9WGX4"
                     /translation="MSKLLVNTLSLGTIGGTALYFWGKSSTPTTPVQSPNLPAPITSP
                     SGTVFDPSSINPQGFFKFGFPGPIHDLANRTEFVSCYDRSTRNPYWVIEHITKASLAK
                     AESNGDRKRSVFKEDEAIPLKFRNRLRDYFRSGFDRGHQAPAADAKFNQLAMDETFYL
                     TNMCPQVGDGFNRDYWSHFEDFVRRLTNKYDDVRVMTGPLYLPKLGADGKYRVTYEVI
                     GSPPNIAVPTHFFKLVVGETSGSEKISCAAFVLPNDVIDNSTPLTSFQVPVEALERSS
                     GLDLLQKVPYYNKQDLCKQVKCEIIVREFPKQVDKVLGLPAGKT"
     gene            <62827..>63849
                     /locus_tag="CD36_50320"
                     /db_xref="GeneID:8048309"
     mRNA            <62827..>63849
                     /locus_tag="CD36_50320"
                     /product="tRNA-dihydrouridine synthase, putative"
                     /transcript_id="XM_002420293.1"
                     /db_xref="GeneID:8048309"
     CDS             62827..63849
                     /locus_tag="CD36_50320"
                     /EC_number="1.-.-.-"
                     /inference="similar to AA sequence:UniProt:Q06063"
                     /inference="similar to AA sequence:UniProt:Q5A4Y0"
                     /note="Similar to S. cerevisiae DUS4"
                     /codon_start=1
                     /transl_table=12
                     /product="tRNA-dihydrouridine synthase, putative"
                     /protein_id="XP_002420338.1"
                     /db_xref="GeneID:8048309"
                     /db_xref="GOA:B9WGX5"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:B9WGX5"
                     /translation="MPSKLLRDPKYRPTEVIKQCQEKGRPAYIAGPMVRYSKLPFREL
                     CRFYDVDIVYTPMILAREFVRNEVARSTDFTTNDSDKCVIVQVGVNNVEDFMKFIEMI
                     HPFVDGIGINCGCPIKEQVREGIGAALMSDPDLVAELIKTAKCKYGDSICIDTKIRIH
                     RDINQTIDFVNKVVEAGTDMLTVHGRTKNTRSSVPVNLDAIKIIRDNVSSIPVIANGD
                     CFTLTDFQKIVAYTGVDGVMSARGVLANPALFTGLNKTPWSAVEMFLHLVTAYGLPYK
                     LAQYHLAKLVEDVIPRKYVKAINEKRNMVDIIDYLDEHFDLKRKGDKGFATRIEPPWK
                     IDLATL"
     gene            complement(<63888..>67994)
                     /locus_tag="CD36_50330"
                     /db_xref="GeneID:8048310"
     mRNA            complement(<63888..>67994)
                     /locus_tag="CD36_50330"
                     /product="condensin complex subunit, putative"
                     /transcript_id="XM_002420294.1"
                     /db_xref="GeneID:8048310"
     CDS             complement(63888..67994)
                     /locus_tag="CD36_50330"
                     /inference="similar to AA sequence:UniProt:Q12267"
                     /inference="similar to AA sequence:UniProt:Q5A4Y2"
                     /note="Similar to S. cerevisiae SMC4;
                     In S. cerevisiae: subunit of the condensin complex, which
                     reorganizes chromosomes during cell division; structural
                     maintenance of chromosomes protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="condensin complex subunit, putative"
                     /protein_id="XP_002420339.1"
                     /db_xref="GeneID:8048310"
                     /db_xref="GOA:B9WGX6"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WGX6"
                     /translation="MKRKRNTLPESEDDASFVNNSDYSVLDKSHTQQTLDGPFDVHKS
                     ELDHSIEETNETKMISHNARETSTNIQLVSPKDTNDLKSQSVQSETGQSAGDESDPVL
                     PKNLEAPTTSEAKMYSSPLSLSAHDSIIQDNKAMQEKRNEPRLIIDRLVLTDFKSYAG
                     KKVIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQGKLSELIHNSGDQRPN
                     YCQVDIHFQMVVDDLVVPQKADIVPDSELIISRKAFRNNQSSYYINGKTSSYSEVTTL
                     LKNKGIDLDHKRFLILQGEVESIAQMKPKAEKENDDGLLEYLEDIVGTSKYKKLIEDS
                     IVRIDELNDICLEKANRFDLVEKDKDLLEEKKVEALRFLELEKKLINCKSVQFQIEIS
                     AHQKRISVKQAEADAIQKELEENKESNKEILEGIENELNAQKEIEHDIKVLSGEIDSL
                     GKNRKDISKKNVSLEEKSKNNANKLKKIQKSLDHSKHTVSSSNQKLSNYAVTTEKFKS
                     DIDRLNNELETEEARLNDIRSSLTEKTSDFTKEIQSLQKSLDPWDSKLKEKENEIKLA
                     ESAIEILRSQLNNTTNQLEEHKERLIQIKKLGKDKEIEYRENESKLAKIEEQIALGEE
                     QCHTAKSALDNFKSQLMSFRQKTQDSAAVVHNNQNKNKVLTALLRLANSGRIQGFYGR
                     LGDLGTIDQKYDVAISTAAPGLDSMVVETVETAQGCIEYLRKNKLGYANFICLNKLRK
                     FNLAPIQTPGDPSSIKRLFDLIQPSSSKFAPAFYSKVYNTLVAPNLNEAKKVAYGAKR
                     WKVVTLDGKVVDTSGTMSGGGNYVSRGAMRLSDSSNSSDQVITADELDKMNTKLQEME
                     NEFEQMNSDYNEKIAMLNKLKALKPETEFAISRLKLDIQSLVSEKKEVTQICKNLIAE
                     QQKLEENNPFEQQLVEKEKELEKLVNAKTQIKEQMSGFEQRISVLEQKIMDVGGVELK
                     VQSSKVDSIKQQISIIHEKTSGDRMTVKKLENEINRHTKLIESLTIEQEEAEADLEKI
                     NEQQRSLLSKLEEVNSKLKELEDERNDKEDKLEKMKHDLEEKQEQINKFKSVEIELLN
                     KLEKCKGILKGLNQAIEQNKEDLDALVIRDVEPYISWLDETEQKKYNGALIDTLSEED
                     IADVDLEAVTSEIEELENYMANVKVDIEILKEYGAKIVEYNDKKSDLNQAVAERDSKK
                     NYCDDLKRKRLDEFMVGFNTISMTLKDMYRMITMGGNAELELVDSLDPFSEGILFSVM
                     PPKKSWKNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI
                     KERTKNAQFIVISLRNNMFELAQQLVGIYKVNNKTSSVSLANIEMHLV"
     gene            complement(<68235..>68777)
                     /locus_tag="CD36_50340"
                     /db_xref="GeneID:8048311"
     mRNA            complement(<68235..>68777)
                     /locus_tag="CD36_50340"
                     /product="DNA-directed RNA polymerase I subunit, putative"
                     /transcript_id="XM_002420295.1"
                     /db_xref="GeneID:8048311"
     CDS             complement(68235..68777)
                     /locus_tag="CD36_50340"
                     /inference="similar to AA sequence:UniProt:P50106"
                     /inference="similar to AA sequence:UniProt:Q5A4Y4"
                     /note="Similar to S. cerevisiae RPA14;
                     In S. cerevisiae: one of the final two subunits of
                     Saccharomyces cerevisiae RNA polymerase I and is proposed
                     to play a role in the recruitment of pol I to the
                     promoter"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-directed RNA polymerase I subunit, putative"
                     /protein_id="XP_002420340.1"
                     /db_xref="GeneID:8048311"
                     /db_xref="GOA:B9WGX7"
                     /db_xref="InterPro:IPR013239"
                     /db_xref="UniProtKB/TrEMBL:B9WGX7"
                     /translation="MSTYRSRRAIPSAINTPITVRVHKVNSTTGSEAERILTSFIDAS
                     EINISGKGTAETNATGISGGNESPAIVSQLKRIQRSLRGLPPLMSEEQFSKSNASLED
                     AERPNKKIKFDESDDSLSSEKVTEAGVEEEDKSNEGIEEVVSEDEKVEHKKEKKSKKD
                     KSSKEKDEKKHKKKHKHKEE"
     gene            <69010..>69303
                     /locus_tag="CD36_50350"
                     /db_xref="GeneID:8048312"
     mRNA            <69010..>69303
                     /locus_tag="CD36_50350"
                     /product="mitochondrial 54S ribosome protein
                     domain-containing protein"
                     /transcript_id="XM_002420296.1"
                     /db_xref="GeneID:8048312"
     CDS             69010..69303
                     /locus_tag="CD36_50350"
                     /inference="similar to AA sequence:UniProt:Q04598"
                     /inference="similar to AA sequence:UniProt:Q9P7L9"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 54S ribosome protein
                     domain-containing protein"
                     /protein_id="XP_002420341.1"
                     /db_xref="GeneID:8048312"
                     /db_xref="GOA:B9WGX8"
                     /db_xref="InterPro:IPR000271"
                     /db_xref="UniProtKB/TrEMBL:B9WGX8"
                     /translation="MFSNILRQSSRGLINFTSVSTRPLGAHIHGVNPLITVSPLQSVV
                     GLMQQRFKSRGNTYQPSTRKRKRKLGFLARLKSIGGRKILERRRAKGRWFLTH"
     gene            complement(<69401..>78313)
                     /locus_tag="CD36_50360"
                     /db_xref="GeneID:8048313"
     mRNA            complement(<69401..>78313)
                     /locus_tag="CD36_50360"
                     /product="Cold Sensitive for Fermentation protein 1
                     homologue, putative"
                     /transcript_id="XM_002420297.1"
                     /db_xref="GeneID:8048313"
     CDS             complement(69401..78313)
                     /locus_tag="CD36_50360"
                     /inference="similar to AA sequence:UniProt:Q12150"
                     /inference="similar to AA sequence:UniProt:Q5A4Z0"
                     /note="Similar to S. cerevisiae CSF1;
                     In S. cerevisiae: protein required for fermentation at low
                     temperature; the authentic, non-tagged protein is detected
                     in highly purified mitochondria in high-throughput
                     studies; low-temperature growth/nutrient
                     uptake/fermentation effector, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Cold Sensitive for Fermentation protein 1
                     homologue, putative"
                     /protein_id="XP_002420342.1"
                     /db_xref="GeneID:8048313"
                     /db_xref="GOA:B9WGX9"
                     /db_xref="InterPro:IPR029636"
                     /db_xref="UniProtKB/TrEMBL:B9WGX9"
                     /translation="MAFESSYISVASESTIKLSSWIYWADWILTLILSLGFVFYFHRL
                     LGFVVSFVFKIVLWRQYRINVNIRSFKVSPLGGRLFMKNLTISTSDMTISIINLTFTW
                     RYWIFKLNRLSNFYFEIDNETPEISQKRNDKSPSRFLLVIEGLEVFIYNRTVAYDNIM
                     DMLQKNNDVSSSEEKTDQESSLYSDDIKNGNLRFRNKKRTSNTSSSDEGSNNDQTAKD
                     SSSLFFLLQVLPIAVKIKRGAIVIGNVSTPSILVASYKAASGTIDVAKSPNILDPYRL
                     LYDCVFNNFQLWMRPNIGYEKYRYGLEAHQEYSQPTRNDTQKLTYMKKYRTWFKYQRA
                     TEKLRKLYYKVFRQEEPENMGYEPNFNWRGLKRYIGDNQDDSEVFAFLNSDVQYAKYS
                     LILDSVTTRLIYFYDNPGIQPQQTNLKTQMPPESGIEVEISNGTIHYGPWTDRERVPI
                     QNMLFPPVARDSSPTRGFLKPGSQREYGGFKVTVIVKDEVIIRIPTREPSKDKELIKS
                     NAANNGPTKNSRPFGWLEVKLSEGSNVSTFTSYVAKEDGWPNIMKVIFNSPEIRSSVN
                     HDVLFMADSHEIDAKIGFPLQWNGKCTWEFDQVSLNPQIFFLREHTMLFSDLFTDFGS
                     GDPQPYEYFRLFIYNIKWKLLNYKFYLNVNDLNIVNNPLDFEKNKYLSLQGEELDCDI
                     NLPLNGLLTKSTTVSFNITTPHFDLVLDTPPWHTVNAFWKESNVVGRSNHFSVDGLYK
                     FFSGIEVNTSDYVEIRCMGDEVSLKFYGFVIRYLFTVRENYFGDNIHFKTFEEYTNQE
                     SQDQESRDGTSSQEPNYWKLIKTENDMDVFFTFQVRSGLVMLPYHTYSCQSHIGLNFD
                     MLDIDIRFCNYYMDMQVDFSPISAVFVEDYYSVQDPLLSVNEYVERYFNRRADMHVDG
                     FSVHTHRMFGVPPEELTFYCKWDFCAGDWLVDSTPMFMRAVAGGISNFGVGFMDSENA
                     LDVAFPPAFDAANFTFKCPNFTFRLRPDSSSCLEIQLVDFLLSYNDMSNNRYSNKLVV
                     SIPTICLKVFKNDVIAAFLNTSLIFTNICQKRDMLGHRETQQLHVRNSDAPFHRSPFI
                     LLEEYRDDFYESSKGCLFTPVSLPNASIPLTELTFNMSKKLNIDIDTSSISSDSEYAF
                     TNRMPPTNDYLDEDFTPSYKVDPDTEYDSFIVELGDVEAFVSPKCIEIIVSTLQAMED
                     YSADTIMDQLNVSTIKFLGSLINSIKTVKNCRVVNHDLSIKFGEFLLADTKELTQKAK
                     KHPTITLQISDLSLALSEKASKTVNEGNITSNEEISLALHIKDILISVAQPFVFNAAV
                     IFTIQEVEYWMELTPDDFVASGNVETISLNIDDTQTTWLVDGITKTIETIEEMNSILK
                     KHTRKINASACLVHALTLASIEYYVDYDPDVLTKPAYILRAKKEHIRFFDSWKVIARL
                     RHILQSLPADWLHEVNGILRDKRYILPQDSLDEVTEIFSKWRAWEANQEERSRLLNRI
                     FSGDTANSDKRQMHLQFLFGNISLKLVSSNQTDYIVLQQFSTTLDLDTTKDRKPVDVV
                     VGLGAYQSSITVLLLDKLKLLQSIKENKKSNDMEQKEEEVQGELKNVLQDIDLSISIY
                     IEAFRQQISLLTLVLELQGNNMASISTIKEEMKSISNSFTLKNAVCNLWGSSNPVYSQ
                     AMENISWVVARTSAFDKDLYKVDLELDKVDIHMANKNDKILTVLQSILEADVPYVEKL
                     LSESESKSTSTLNISDLLGYISLKLSIQEFNWRIDILSPVVLEGNSIGCTVSACMIDD
                     NFIFDADFLKGKFNMNIDEHNVIEIENSKFVNVVEVGIWENLILFSVQSSMGYAKLLS
                     PNLISAIGLSDITLPKLEKKIHDFKSLLANNKSVKHNETDAPEREFAFKVQFSNDYMG
                     VSSFVNKTKLLFEVESFALGVYNVNQVESEDPIRSQQLVPIYGSISVPAVRISILDRK
                     IPIGLSNMLDVNFGIRLLSVDSLGVLQTLQFESQYCRICLSEPIVFKLIKISDEILKA
                     LPKPTTQETQQKPKESIAETENGDLEKFIFSRISTVQFLSYNFCVGWLFNDSSKDYPG
                     IIMGAERFFAATEFKLGKFTLMEAYFSVANGNRSSNFYSTSSEKSNLNRAFLPNLQLS
                     FFIDNNRKGKNLSLSMHGDELDVKFLSTSVAIIEKAVNSASNVQSYLDKRSKPFYQDI
                     ERESSTSHKESLFTSSFDAIEFITTFAGSNVLIHRLDNHDDSESPASLYLHAPAIKTA
                     IKYLNKKNQGKNKLMGEILTTSSDNTLYSKCMPVVMDIINGTKGLLGKSKKVSSNDLL
                     VEEQPQSSDFITTILDDTDIHFGVRIENQSLSLSCEPTAKVAAIVGLEGIFIQLNSSD
                     FRTSGFNVSMMVDSVSVSLQHIYSRDISASAGIKNILLTNTFEFSEVTRLFLSGSISD
                     ADAYINVKQYQDVDLFKDIWFPKEYFESYSGQAYPEEDQEESPIDDTFEELALAKNRN
                     ISSRFREVSTTYAFPWIVAFVISNVNVRVDFGQSLGNFNLRIENFWAVSKKSVDWSQD
                     LKTGVNEVSLSSIGRLGGILSIKNINLHTAISWKLDSEITLDVPLILVSGGVEELHLK
                     MSFDHHVIAIANFEEFSMDIYNKKSEVSIAKDHLFMTTTFKTAEIYITSLTASNFLDI
                     QNTISRMIQENQRSYKETLRDSSKGKSLEEKKRRRYSQNAILETVKKLETRIHVSAGK
                     VLMHIYPSSMDNSKVLVIKLDQSRAKFQQNEYSSGISNELDLKFNDLKVSLSSVSPVS
                     EEFVNEASVSELTQHAHKASGGTIFVFPSFRISMRTFQKYNSNLIEYMFQSTFNGTVD
                     IRWNLGSINFIREMYTIHSKSLESRMEYRKKMQPFDEGAGAIAKAILEHQITEEDTTQ
                     KIDDAIKETIEKVEKSSKFKYSALAPPIIEEPQLKELGNATPPLEWFGLHREKLPHVT
                     HQLAIVSLQKLIHEIELEYSKMLGKA"
     gene            <78648..>79619
                     /locus_tag="CD36_50370"
                     /db_xref="GeneID:8048314"
     mRNA            <78648..>79619
                     /locus_tag="CD36_50370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420298.1"
                     /db_xref="GeneID:8048314"
     CDS             78648..79619
                     /locus_tag="CD36_50370"
                     /inference="similar to AA sequence:UniProt:Q5A4Z1"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420343.1"
                     /db_xref="GeneID:8048314"
                     /db_xref="UniProtKB/TrEMBL:B9WGY0"
                     /translation="MSSHIFKDIQDKENELKISGIRRKGIISNENSGPLLSKDSNSKQ
                     VQQQPQPQQQQSKFTNKRIPLGGKNHNSNNLLLNRSHSSLNTKPTTQGVTNAKPPSLT
                     KSNSSLGFSVASDQQTEQPKQFPQSFVVHNEQVLPVKRKLLSDTKDELSQNNKRVKLE
                     KKESAANTFTDSLTKTIQNALAPVEDLQTTISPKTDQLNSSNLTYNDVNRNNVDPMKR
                     ESRMKAIDDLVELHWQDPIENIPETRGCENNGGDQLDELDIKLFSTPTESVDAVDMNQ
                     NHISNNEQNSSLELEFGDESNVGEIPIIDGIDEEIGLTSDDLDNLLG"
     gene            complement(<79709..>81031)
                     /locus_tag="CD36_50380"
                     /db_xref="GeneID:8048315"
     mRNA            complement(<79709..>81031)
                     /locus_tag="CD36_50380"
                     /product="DnaJ-like chaperone, putative"
                     /transcript_id="XM_002420299.1"
                     /db_xref="GeneID:8048315"
     CDS             complement(79709..81031)
                     /locus_tag="CD36_50380"
                     /inference="similar to AA sequence:UniProt:P39102"
                     /inference="similar to AA sequence:UniProt:Q5A4Z2"
                     /note="Similar to S. cerevisiae XDJ1;
                     In S. cerevisiae: involved in regulation of the HSP90 and
                     HSP70 functions; involved in protein translocation across
                     membranes; member of the DnaJ family"
                     /codon_start=1
                     /transl_table=12
                     /product="DnaJ-like chaperone, putative"
                     /protein_id="XP_002420344.1"
                     /db_xref="GeneID:8048315"
                     /db_xref="GOA:B9WGY1"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:B9WGY1"
                     /translation="MLETDLYDVLEIDRSATNAEIKKAYRKLALKYHPDKVAEEEREY
                     SETKFKEISFAYEILIDEVKRNEYDRYGTTDGLNGMPDFEFAGNPFDQFYGAGAGAHF
                     NEYGGDDFYNFFNNMNGGGGPRHHSSRANRTEDANIEVDLTLEDLYKGKVIKTTSTRN
                     IICTQCKGLGVKSSSVVSKQCSTCKGEGQVRKIKRVGPGMVAQTYVDCSTCQGIGRIY
                     RSKDKCKLCHGARVIEETKILEFEIPKGSPAHGVIYKNGESDQFPGKVTGDVILEYKC
                     KPHKVFTRKDDDLYMKVKIPLVDSICGFSKLVAVHLDGRGIKISTPKGKVIRPGEYLK
                     LSGEGMPKSTPKKSWFNSADSSRGDLYLKVEIEFPPDNWYIEKNDLAKIRNLLPTKHA
                     REEKEIDVPDPSIELFTDFSIIDSNQLPKYSQDRKHNEQGYEQSCAQQ"
     gene            complement(87678..87762)
                     /gene="tRNA-Ser (CAG)"
                     /locus_tag="CD36_tRNA_0079"
                     /db_xref="GeneID:8048316"
     tRNA            complement(87678..87762)
                     /gene="tRNA-Ser (CAG)"
                     /locus_tag="CD36_tRNA_0079"
                     /product="tRNA-Ser"
                     /note="CAG anticodon is translated as Serine"
                     /anticodon=(pos:complement(87727..87729),aa:Ser,seq:cag)
                     /db_xref="GeneID:8048316"
     gene            <88900..>89559
                     /locus_tag="CD36_50390"
                     /db_xref="GeneID:8048061"
     mRNA            join(<88900..88902,89031..89041,89148..>89559)
                     /locus_tag="CD36_50390"
                     /product="actin-depolymerizing factor, putative"
                     /transcript_id="XM_002420300.1"
                     /db_xref="GeneID:8048061"
     CDS             join(88900..88902,89031..89041,89148..89559)
                     /locus_tag="CD36_50390"
                     /inference="similar to AA sequence:UniProt:P78929"
                     /inference="similar to AA sequence:UniProt:Q03048"
                     /note="Similar to S. cerevisiae COF1;
                     In S. cerevisiae: promotes actin filament depolarization
                     in a pH-dependent manner; binds both actin monomers and
                     filaments and severs filaments;
                     spliced gene; cofilin, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="actin-depolymerizing factor, putative"
                     /protein_id="XP_002420345.1"
                     /db_xref="GeneID:8048061"
                     /db_xref="GOA:B9WGY2"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR017904"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:B9WGY2"
                     /translation="MSRSGVAVADESLTAFNDLKLGRKYKFVIYTLNDEKTQIVVEQT
                     STEQDYDAFLEKLPENECRYAVYDFEYDIGGGEGKRSKIVFFTWSPDTAPVRAKMVYA
                     SSKDSLRRALNGVAADVQGTDFSEVAYDAVHEKVSRGTH"
     gene            <90294..>92639
                     /locus_tag="CD36_50400"
                     /db_xref="GeneID:8048317"
     mRNA            <90294..>92639
                     /locus_tag="CD36_50400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420301.1"
                     /db_xref="GeneID:8048317"
     CDS             90294..92639
                     /locus_tag="CD36_50400"
                     /inference="similar to AA sequence:UniProt:Q5A4Z4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420346.1"
                     /db_xref="GeneID:8048317"
                     /db_xref="GOA:B9WGY3"
                     /db_xref="InterPro:IPR006600"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:B9WGY3"
                     /translation="MTSKLPRATLAQKLQILDYYHKSDRPQSETVDKFKNEVSISTSS
                     FSEWLKNEPELRKRYNQADFKFSKNSKRKVKFKYEEINKAMDKLVIGRLERNEPITEP
                     ILREHWSVYAHQYGVDDPKRLHSFSHGWLSQFKKRHGINKKSNNGSQKNAKNGTSKNA
                     VEVDSDSIHIQSNDEEENVENGFEPLDGPEVEVSGVEDQNYDPKFSTISHEHNIRNPT
                     ENSNEPRTKKARLDGRNNASQLEANSNFDLLAQQRQHSQPSSLLTSPSPNSDHSQQQL
                     ERRRRKRHQSPQEQQHIDHQQQQDQQQQQARLQGDKHSENSNRNNQEHYIQHGQANVR
                     NEAQLLQEQQKQLQKSKQQPTGTDTVPRNQFRPQQGLSFSHSNSPIMSFGMDKHNMQL
                     QNQYQKSHRHGANQSNTVPEDIQNPSPDQDFRNSLMNNNGNKNTINYSPNQLYKEQRQ
                     LLNDDYSSGITKSNDSRNSRVISNNDDTETEVSTNQALLTGRMTEEETKAASELNNIT
                     NPITATDMERFIYMFADRFFHLHQYEYPQTVKVFQEFKSSFFNERIMNNRTSKQQQQQ
                     QQQQQQQQQQTSLPQQSQVQPQLQQQQQPSPSMQSTQQIQQPMIYHHNGRQQQQQQQQ
                     QQQQLNRNTISSQLPALVAATASLVNNNQSNMSLKNANSTMVLNPQSNPHQRQQQQQH
                     EHQQPPTLPTPLQKIDSSKSHHLVMSPSPMDTLVQLQLRQQGAQSSLQQQQQQQQQIS
                     NFDDYLRSMNAQTLLNSQPSATRNNGLTEMNLDRNSRMTKS"
     gene            complement(<92861..>93313)
                     /locus_tag="CD36_50410"
                     /db_xref="GeneID:8048318"
     mRNA            complement(<92861..>93313)
                     /locus_tag="CD36_50410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420302.1"
                     /db_xref="GeneID:8048318"
     CDS             complement(92861..93313)
                     /locus_tag="CD36_50410"
                     /inference="similar to AA sequence:UniProt:Q5A4Z5"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420347.1"
                     /db_xref="GeneID:8048318"
                     /db_xref="UniProtKB/TrEMBL:B9WGY4"
                     /translation="MALRNYLYAKHNHDTSIDIKINKDTSLMSDITEKVSSDPSNPEK
                     GRSPMRIEQSRRRIIRIVHKKSSNQLKPTINHIEKLTNNIENVHIDKIKKENCLNDCN
                     LCDCKNETNNKEKDTPLIQVEVDNGINGGSGEHNEIGNKNEIDFTSSL"
     gene            complement(<95111..>97543)
                     /locus_tag="CD36_50420"
                     /db_xref="GeneID:8048319"
     mRNA            complement(<95111..>97543)
                     /locus_tag="CD36_50420"
                     /product="uncharacterized protein Sgm1 homologue,
                     putative"
                     /transcript_id="XM_002420303.1"
                     /db_xref="GeneID:8048319"
     CDS             complement(95111..97543)
                     /locus_tag="CD36_50420"
                     /inference="similar to AA sequence:UniProt:P47166"
                     /inference="similar to AA sequence:UniProt:Q5A4Z7"
                     /note="Similar to S. cerevisiae SGM1;
                     In S. cerevisiae: required for wild-type growth rate on
                     galactose and mannose; localizes to COPI coated vesicles
                     and the Golgi apparatus"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein Sgm1 homologue,
                     putative"
                     /protein_id="XP_002420348.1"
                     /db_xref="GeneID:8048319"
                     /db_xref="UniProtKB/TrEMBL:B9WGY5"
                     /translation="MNGSSNNDNEVIVLTQDITYPPVTPSKQQPLSNNNSPTPSFKSP
                     KRNNTLSPLRKKQQQQQQPKPAALSSSSSSSSSREHISRSNTSSNSALSQSHQVSEEE
                     FKSLQRSFADSLLNFNNLENENQRLQHDLTIKTTQLENQLERIHYLEQSIKEAEMDNL
                     HNQDILNKQVEMYKEMIDKLQTKIVELNDELERKPPLETIDASLFKKYEKLVRDYKIL
                     DSQFEVERNSKLVLIDQIEFLSRKNEDLIKQIGAPIEESDNESDANVDYLADLTDNVT
                     HTMNELTDDEHEQEQKASVISPGLNIYHGIAYQSSPIKSYDDSNSSVKVSPNFQFPPP
                     PPPPPTSHLPCLSEQQQRQQQQQSSTFPPSPEPECKDKKRSSLPTHLKQKHTGEEDDD
                     EGIDFVLSPFKLTPSQALYANDDSSVFPDDNGNAGVIKRYSATKPTHSRYNSHDLVPI
                     KVEFEKLESGIRSTSVPEKSLKESSTCETIDENTGNGNIKMSKYRNGTLFALNGYTHN
                     NNNNDDDDEGDNDYDDRPTNISKNFSEMDISSKRSSYLNSDEKTKQEIMKLKFELRSL
                     KLHNEKLLSFIGFELQKQRNNLKKLSRKQSARLLAGSKNIEYSDAKLIEKSRDLLINK
                     KRVLRSVSINTGFKDRFPIKNIGIIAPNSEPAYVNHYDEDDFIDDSHDFLDMNSLSHN
                     DKMIKKFASQVFSNTKALYEYDSDSDFENTSHWVLEEGEEGNEHDDEDNLTPNTSGSS
                     SEEEQIGVFRQIKHMVIGGEAVNKSKKKRSKKDDQHLVDDGLKFKFLTIALGIVIIGL
                     KLTPHNNQNITR"
     gene            98221..98507
                     /locus_tag="CD36_50425"
                     /pseudo
                     /db_xref="GeneID:8048320"
     misc_feature    98221..98507
                     /locus_tag="CD36_50425"
                     /inference="similar to AA sequence:UniProt:Q5A4Z8"
                     /pseudo
                     /db_xref="GeneID:8048320"
     gene            complement(<98969..>99328)
                     /locus_tag="CD36_50430"
                     /db_xref="GeneID:8048321"
     mRNA            complement(<98969..>99328)
                     /locus_tag="CD36_50430"
                     /product="mitochondrial 37S ribosomal protein YmS16"
                     /transcript_id="XM_002420304.1"
                     /db_xref="GeneID:8048321"
     CDS             complement(98969..99328)
                     /locus_tag="CD36_50430"
                     /inference="similar to AA sequence:UniProt:P28778"
                     /inference="similar to AA sequence:UniProt:Q5A4Z9"
                     /note="Similar to S. cerevisiae MRP17"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 37S ribosomal protein YmS16"
                     /protein_id="XP_002420349.1"
                     /db_xref="GeneID:8048321"
                     /db_xref="GOA:B9WGY6"
                     /db_xref="InterPro:IPR000529"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="UniProtKB/TrEMBL:B9WGY6"
                     /translation="MYYELFAIARITDPLNTAKEATKIASTVGKLILNNRGIIRDITS
                     LGAKPLPQIISKEQERHFQGYHFIIGFDSSPNVQTQLLRTLRRDPRILRSSIMKHDLT
                     HNLNPGTTIEQALRATK"
     gene            <100068..>100670
                     /locus_tag="CD36_50440"
                     /db_xref="GeneID:8048322"
     mRNA            <100068..>100670
                     /locus_tag="CD36_50440"
                     /product="adenosine-5' phosphosulphate kinase, putative"
                     /transcript_id="XM_002420305.1"
                     /db_xref="GeneID:8048322"
     CDS             100068..100670
                     /locus_tag="CD36_50440"
                     /EC_number="2.7.1.25"
                     /inference="similar to AA sequence:UniProt:Q02196"
                     /inference="similar to AA sequence:UniProt:Q5A500"
                     /note="Similar to S. cerevisiae MET14;
                     In S. cerevisiae: required for sulphate assimilation and
                     involved in methionine metabolism; adenylyl-sulphate
                     kinase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="adenosine-5' phosphosulphate kinase, putative"
                     /protein_id="XP_002420350.1"
                     /db_xref="GeneID:8048322"
                     /db_xref="GOA:B9WGY7"
                     /db_xref="InterPro:IPR002891"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WGY7"
                     /translation="MASNITWHPNLTHQERAELRKQKGVTVWLTGLSASGKSTIACAL
                     EQSILARGLNSYRLDGDNIRFGLNKDLGFSEADRNENIRRISEVAKLFSDSCCITVTS
                     FISPYRADRRLARELHEKDNLPFVEVYVDVPLEVAEQRDPKGLYKKAREGIIKEFTGI
                     SAPYEAPEKAEIHVKNHSGLSVEQAAEQIIDYLLEKGYIN"
     gene            complement(<100742..>101449)
                     /locus_tag="CD36_50450"
                     /db_xref="GeneID:8048323"
     mRNA            complement(<100742..>101449)
                     /locus_tag="CD36_50450"
                     /product="class E vacuolar protein-sorting and endocytosis
                     factor, putative"
                     /transcript_id="XM_002420306.1"
                     /db_xref="GeneID:8048323"
     CDS             complement(100742..101449)
                     /locus_tag="CD36_50450"
                     /inference="similar to AA sequence:UniProt:P36108"
                     /inference="similar to AA sequence:UniProt:Q5A501"
                     /note="Similar to S. cerevisiae DID4;
                     In S. cerevisiae: required for sorting of integral
                     membrane proteins into lumenal vesicles of multivesicular
                     bodies, and for delivery of newly synthesized vacuolar
                     enzymes to the vacuole, involved in endocytosis"
                     /codon_start=1
                     /transl_table=12
                     /product="class E vacuolar protein-sorting and endocytosis
                     factor, putative"
                     /protein_id="XP_002420351.1"
                     /db_xref="GeneID:8048323"
                     /db_xref="GOA:B9WGY8"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:B9WGY8"
                     /translation="MSQLFEWAFGKKLTPQERLRKNQRALEKTQRELSREITKLQQQE
                     KKLISDIKKSAKSGQISSAKIQAKDLIRTKSYVSKFTSMKTQLQAISLRIQSVRSNQQ
                     MAMSMRDATRVLGGMNRSMNLPQLSRIAQEFAKESDMMDQKQEFMDDAIDDAMAMDED
                     ELGEEEQVDEILSKVLDEIGVDLNTILKDTPTGINAGGIEQADKARVAEAVGANGASF
                     HDADEDDLQARLDSLKK"
     gene            complement(<101719..>102837)
                     /locus_tag="CD36_50460"
                     /db_xref="GeneID:8048324"
     mRNA            complement(join(<101719..102748,102815..>102837))
                     /locus_tag="CD36_50460"
                     /product="D-amino acid oxidase, putative"
                     /transcript_id="XM_002420307.1"
                     /db_xref="GeneID:8048324"
     CDS             complement(join(101719..102748,102815..102837))
                     /locus_tag="CD36_50460"
                     /EC_number="1.4.3.3"
                     /inference="similar to AA sequence:UniProt:A3LZE6"
                     /inference="similar to AA sequence:UniProt:Q9HGY3"
                     /note="Similar to Candida boidinii DAO1;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="D-amino acid oxidase, putative"
                     /protein_id="XP_002420352.1"
                     /db_xref="GeneID:8048324"
                     /db_xref="GOA:B9WGY9"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006181"
                     /db_xref="InterPro:IPR023209"
                     /db_xref="UniProtKB/TrEMBL:B9WGY9"
                     /translation="MTKYVIVGAGVVGLYTGFSLLEKGVPAVEITVIAEYLPGDESIN
                     YTSPYAGGNFSCITGDDPQTLQYDKYTYLNLHKIQKAIGGKTQGLDRYPSTEYWDQKP
                     SQTKIESLESYLDDYKVIDKTSSSSLPSGSEFGIKFLAWNFNCPKFLFNLQQFLESQG
                     IIFIRKKLTHIVQAYFSESTKIVFNCTGIGARSIGGVEDKNVYPGRGQVVVIKAPHIM
                     ENVLSWGDREPTYIIKRPYSNDQLILGGYFQKDDWTAATLKEQTQDILQRTTSLFPKI
                     LKENPNGNRIEDLEILRVAAGLRPCRYGGARIEKEVVESGKILIHNYGASGYGYQAGY
                     GMANKATDLALGRSKL"
     gene            complement(<103367..>105229)
                     /locus_tag="CD36_50470"
                     /db_xref="GeneID:8048325"
     mRNA            complement(<103367..>105229)
                     /locus_tag="CD36_50470"
                     /product="iron transport multicopper oxidase precursor,
                     putative"
                     /transcript_id="XM_002420308.1"
                     /db_xref="GeneID:8048325"
     CDS             complement(103367..105229)
                     /locus_tag="CD36_50470"
                     /EC_number="1.-.-.-"
                     /inference="similar to AA sequence:UniProt:P43561"
                     /inference="similar to AA sequence:UniProt:Q5A503"
                     /note="Similar to S. cerevisiae FET5;
                     In S. cerevisiae: ferro-O2-oxidoreductase required for
                     high-affinity iron uptake and involved in mediating
                     resistance to copper ion toxicity, belongs to class of
                     integral membrane multicopper oxidases"
                     /codon_start=1
                     /transl_table=12
                     /product="iron transport multicopper oxidase precursor,
                     putative"
                     /protein_id="XP_002420353.1"
                     /db_xref="GeneID:8048325"
                     /db_xref="GOA:B9WGZ0"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:B9WGZ0"
                     /translation="MLFNQFILWLISIPLILASGTIHRFDWNVSYVMANPDGIHPRRM
                     IGINNQWPNPTIRIKKNDRVIINLTNELPDKNVSLHFHGLFQRGYNDQDGPAFVTQCP
                     IAPGVTFIYDFNVTDQYGTYWYHSHMGSQYGDGLRGLFIIEYDNDDEYNKEFPYEYDE
                     DVTLTVGDHYHLESPEIVKNFKTRFNPTGAEPIPQNGLFNETKNVTWKVNPDTTYLLR
                     IVNVGLFPSHYVYIEDHTFTIVEVDGVVVEPYETDSLYIAVAQRYVVLMKTKKTTNKN
                     FRFINVLDQDMLDFLPSDLQIVSTNWIVYDKSLDLPPALPFNEFHKTIKALKGFDDFD
                     LRPLRKVNLLDEPDYTIQVNLTMEVLGDGVTYAMFNGKTFRPPKVPSLYTVLSTSGGD
                     TNLTTNELIYGSNTNSFVLQGDEVVEIVLNNMDPGKHPFHMHGHNFQVISRFDTDDED
                     NQLVFDPKNETYTNYPEFPMVRDTVEVGPNGFIVLRFKANNPGVWFFHCHVDWHLEQG
                     LALLLVEDPIELLSSNTTISSNHIDACKAVGMPIKGNAAGNNIDLLDLQGENIQPEPL
                     PAGFTNKGYFAIACCTLIAIYGLWSIYNYGMEDVSKDNAEDVIEKLYKILNDYD"
     gene            complement(<105450..>107249)
                     /locus_tag="CD36_50480"
                     /db_xref="GeneID:8048326"
     mRNA            complement(<105450..>107249)
                     /locus_tag="CD36_50480"
                     /product="beta-glucan synthase, putative"
                     /transcript_id="XM_002420309.1"
                     /db_xref="GeneID:8048326"
     CDS             complement(105450..107249)
                     /locus_tag="CD36_50480"
                     /inference="similar to AA sequence:UniProt:P32486"
                     /inference="similar to AA sequence:UniProt:P87024"
                     /inference="similar to AA sequence:UniProt:Q5A504"
                     /note="Similar to S. cerevisiae KRE6; beta-glucan
                     synthesis-associated protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="beta-glucan synthase, putative"
                     /protein_id="XP_002420354.1"
                     /db_xref="GeneID:8048326"
                     /db_xref="InterPro:IPR005629"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:B9WGZ1"
                     /translation="MSDSSNLSGLISSSSTSNDITPVVNEESESTISGLQQQQNFKIK
                     SHSRYFSPQSNITTKKFNYLDNPFYYMDKDFDSNHHHHHQQENRDHEGFRNGHSHTNS
                     TSSDGNNNINKKRKRIGKWNWRFKRIDLKKSFRFIIAIVSILVIFVLAIIFAIMSSFI
                     INNPIRNGHKIEKLTNINYAQLKSIRTNLIDPDTPIEFYNLNKTNHQEGDWTLVFSDE
                     FELDGRTFHEGDDQFFTAVELYYAATHDLEYYLPQMITTNNSNLEILFDKFNYSGLNY
                     VSGMLQTWNKLCFNKHVKIEIKAKLPYEIKNGLWPAIWSLGNLARPGFLATTDGIWPY
                     TYNECDFGILPNQSTLNEEMSYLPGQRLSKCVCTGEDHPNHGIGRGAPEIDIIEGLFQ
                     YDKFWGVQTLQVAPFDEWWRPDYDYVDIINDNITIIREDIGTVYQESISLGTLIDNEF
                     PFQKFTMEYKSDSQNNINSYLKFSIDDITTSVINGSALHPNEFIGWREITKEPMSIIL
                     NMGLSYMWNPRVNIDELKLPAKFLIDYIRIYQPNNIIEMTCDPIDYPTDDYIQSHSIA
                     YENPNLTSWFQAGFEFPKNSLSHQCKVPPPIVT"
     gene            complement(<108336..>109241)
                     /gene="SEC14"
                     /locus_tag="CD36_50490"
                     /db_xref="GeneID:8048327"
     mRNA            complement(<108336..>109241)
                     /gene="SEC14"
                     /locus_tag="CD36_50490"
                     /product="phosphatidylinositol/phosphatidylcholine
                     transfer protein, putative"
                     /transcript_id="XM_002420310.1"
                     /db_xref="GeneID:8048327"
     CDS             complement(108336..109241)
                     /gene="SEC14"
                     /locus_tag="CD36_50490"
                     /inference="similar to AA sequence:UniProt:P24280"
                     /inference="similar to AA sequence:UniProt:P46250"
                     /inference="similar to AA sequence:UniProt:Q5A505"
                     /note="In S. cerevisiae:
                     phosphatidylinositol/phosphatidylcholine transfer protein
                     involved in coordinate regulation of PtdIns and PtdCho
                     metabolism, products of which are regulators in Golgi to
                     plasma membrane transport; functionally homologous to
                     mammalian PITPs"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphatidylinositol/phosphatidylcholine
                     transfer protein, putative"
                     /protein_id="XP_002420355.1"
                     /db_xref="GeneID:8048327"
                     /db_xref="GOA:B9WGZ2"
                     /db_xref="InterPro:IPR001071"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:B9WGZ2"
                     /translation="MTTMTTEEILASYPQITAPTDQTGYTSNLTPEQKTSLEIFRQQL
                     TELGYKDRLDDASLLRFLRARKFDIQKAIDMFVACEKWRNDFGVNTILQDFHYEEKPI
                     VAKMYPTYYHKTDKDGRPVYFEELGKVDLVKMLKITTQERMLKNLVWEYEAMCQYRLP
                     ACSRKAGYLVETSCTVLDLSGISVTSAYNVIGYVREASKIGQDYYPERMGKFYLINAP
                     FGFSTAFKLFKPFLDPVTVSKIHILGYSYKKELLKQIPPQNLPVKFGGMSDVSDDDLL
                     LKDVGPWRDPEFIGPEGECPRSYNI"
     gene            complement(<110946..>114626)
                     /locus_tag="CD36_50500"
                     /db_xref="GeneID:8048052"
     mRNA            complement(<110946..>114626)
                     /locus_tag="CD36_50500"
                     /product="GTPase activating factor, cell
                     polarity/morphology, putative"
                     /transcript_id="XM_002420311.1"
                     /db_xref="GeneID:8048052"
     CDS             complement(110946..114626)
                     /locus_tag="CD36_50500"
                     /inference="similar to AA sequence:UniProt:P33314"
                     /inference="similar to AA sequence:UniProt:Q5A506"
                     /note="Similar to S. cerevisiae BUD2;
                     In S. cerevisiae: GTPase activating factor for Rsr1p/Bud1p
                     required for both axial and bipolar budding patterns;
                     GTPase activating protein involved in bud site selection,
                     putative; bud site selection protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="GTPase activating factor, cell
                     polarity/morphology, putative"
                     /protein_id="XP_002420356.1"
                     /db_xref="GeneID:8048052"
                     /db_xref="GOA:B9WGZ3"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023152"
                     /db_xref="UniProtKB/TrEMBL:B9WGZ3"
                     /translation="MPPTYQSAFHKIISRDKGVFEGHNFLVSVDTINWIHVNTLTITE
                     QGQLFSSDSDDNHYLLLQSLQSCFIQIYPDSNISGSGKNSISQPPPTTSTRRNLLRKT
                     SNLNSSDQSHSRSSEDNDHQPPAILIKTFDNDKLYIRIPSKSNFGNLLSCLIVWQNLK
                     PQGLAKKWYSENKVIDGFNPNAPIYELLVCRFKIYGPLPNKYKNLNIVPGPKAPVYQQ
                     KIDDFKTNFDNSYIITPQISSDNHNSINEGWFYAMGALNSHGILNFISELDGTLLYSI
                     DIKSVLSSEIREVHNSIFNSSNILFIGQLKELRYNNVIRTLSTLTPDQLLTPFLTRDG
                     KIIPNNQRILIEFPLHIDLEDWFVGLNYFAKREYIGSFDNESKLIHNVEHPQLHDFSK
                     ANFRVSKKMSIDIIEAKFENTETNKSGKIYAEVRMWGFPWSRTAIVNHTNNPFWKEEF
                     STDLPISTQMVHILIKKCVFNDSSYSTGDKLIGTVYVTPDILTKQMKTTSTIMTSSES
                     SQAIQMNTVPLSSMASTSNAGLDIVRLTINDPNNIPIGKLLLEVHLQEYHILSPSVFK
                     PLEKMLVNAPMKDLIRFCNENVPSSDFERVSLVLLDIFQSLEVEDDWFKSLMEVELVN
                     VDMMTRKNYHQRNSQDQAISNSKTQHQSSHNNVFNTLFRGSSIFSKSLEKYNLRIGQE
                     YLEKVFGDFFAKISNEKKNCEVDPRYVRIQERALRKGKSIHDTTGLDGNGYSQDASDD
                     DDDDDDDDDNSSDDADYNAERERERNERIKKMVEENFQNLYGYVEEIWNKIYITSNDL
                     PDQIKLQLKNFRTKVELVCDPEDKVTSLNCLSAFIFLRFFCPAILNPKLFYLAKNHQT
                     GSTQRTLTLIAKVLLNLANRQEFSPHKEPHLVRMNVFLRKHTPEIYDYFDKLTGRKND
                     FNEKILELSHEVKRFDLNLDKTSNELPTTPYLIDKYLRLTEIVHLLDYNKYAKNNPNG
                     SMSNLGTPVNSPSRDIDRDRSQSGTPDLDPILNLSDLKLNYENKYQIGSLEFEKSEFL
                     ELSGDNETEGFIKSLCKGNEEIFSFINSNITLKDIQKQSTKIMNRIQELEIYLENYEF
                     PNNYKDQFIWDSFTDDIMNKCWLDTSRNCLIYSDHVPSTNQYKKLIDHALSGLKLKFN
                     DHQKLNGNSTMNSLMNNSSGKRNGHDINGGPGGNDGNYGDGYNEMDRNQRLSLTFSTI
                     SIGSAIKPNTSKNPFKKWLRKN"
     gene            <116077..>119127
                     /locus_tag="CD36_50510"
                     /db_xref="GeneID:8048328"
     mRNA            <116077..>119127
                     /locus_tag="CD36_50510"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_002420312.1"
                     /db_xref="GeneID:8048328"
     CDS             116077..119127
                     /locus_tag="CD36_50510"
                     /EC_number="3.6.1.-"
                     /inference="similar to AA sequence:UniProt:P30771"
                     /inference="similar to AA sequence:UniProt:Q5A507"
                     /note="Similar to S. cerevisiae NAM7;
                     In S. cerevisiae: ATP-dependent RNA helicase of the SFI
                     superfamily, required for nonsense mediated mRNA decay and
                     for efficient translation termination at nonsense codons;
                     involved in telomere maintenance; atp-dependent helicase,
                     SFI superfamily, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_002420357.1"
                     /db_xref="GeneID:8048328"
                     /db_xref="GOA:B9WGZ4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018999"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WGZ4"
                     /translation="MSNLLFHNFDKNSEDIEDFNSTASNIISIRDNGSIKDGNGSETD
                     TINQYNEQELLNQLKDEHYTSDSPIEHVTQSYGDQEGDIDQDSEQHYEHACAYCGIHN
                     PNSVIKCNTCNKWFCNAKTNSSSSHIVTHLIMSRHNQVSLHEESELGDTTLECYNCGN
                     KNVFILGFVSAKQESVVVILCRLPCARSKDVNWDTSEWQALIEDRQFLSWLAPPPTED
                     DLIEAKLITPQQISKLEAQWRLNRAATINDIENNDETEQEVLPILMRYNDAFQYQRSF
                     GPLVKLEGDYDKNLKESQALEHIQVKWALGLNNRHLASFTLSTFETSDLKVAVGDEII
                     LRYSGNQGEPWEGHGYILRLPNAYQEEFTLELNPSKIIPPTNLTTDFTAEFVWKGTSY
                     TRMQQAMKDFATDEESVSSFIYHKLLGHEVLPIEFDIDLPKKFSHPKLTELNVSQTNA
                     VRTVLQRPLSLIQGPPGTGKTVTSATIIYHLSKLNKQKILVCAPSNVAVDHLAAKLDL
                     LGLKVVRLTAKSREDVESSVSHLALHNLVNNNAKGELKKLIKLKNQVGELSVGDTNNY
                     LKLSRSSELKILNKSEVVCCTCVGAADRRLSQFKFKTVLIDESTQASEPEVLIPIVKG
                     AKQVILVGDHQQLGPVILDKKAADAGLKQSLFERLVFLGHVPIRLEVQYRMHPCLSEF
                     PSNMFYEGSLQNGVTSDDRLIEESTFPWPVIDTPMMFWANYGREELSASGNSYLNRVE
                     AMNVEKIITKLFKDGIKPEQIGVITPYEGQRAYLVQFMSVNSTLLDKRDQYLNVEITS
                     VDAFQGREKDFIILSCVRANDSQSIGFLSDPRRLNVALTRAKYGLVILGNPRSLCRNR
                     LWNHLLIHFREKGCLVDGPLDNLQLSMVQLNTNNMRSTTSSNNNNYYNGRQRKGKFGA
                     ASTVDSVTDFDSASILSYDNSAIVHKSGHNGNSNVNLKEEMWPALNGKQQVFDGDNNL
                     TANFYNKLNKIDKNYGGGRYNTGGNNIEDDIKSITSTFAAGLNF"
     gene            <125174..>126664
                     /locus_tag="CD36_50520"
                     /db_xref="GeneID:8048329"
     mRNA            <125174..>126664
                     /locus_tag="CD36_50520"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420313.1"
                     /db_xref="GeneID:8048329"
     CDS             125174..126664
                     /locus_tag="CD36_50520"
                     /inference="similar to AA sequence:UniProt:Q5A508"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420358.1"
                     /db_xref="GeneID:8048329"
                     /db_xref="UniProtKB/TrEMBL:B9WGZ5"
                     /translation="MNQLPDQNNTENSNDNTTNTTTQDATDNSTNNQRNITEVTMEEV
                     ANHVRNPQRIKLSNDDIKLVLFLIVRVKPFKYIGYRKATQSQRWTRIQREFYVLKSKA
                     VKNKNFVVPTVRTLQRQLDTANKKTAFKLRTLTKNGVTTRKHHEIPNTLEEINQDEHY
                     QYKHINSNSTIEELETAVFELQELSDRIRHLIIQTNNVILPDQQPEESLVEPSVEQDQ
                     TVQSLPQEISNTTTSTSTSTFYPTIQNMIHMNNDEEPNSTPTPATTNTTTTTPATNTT
                     SNTSSSSTTTTASATASTTTTTSESAITNNHISHMTSPIPSSSSMIVTNTNTNDNQAH
                     GNTSTSTSTSTSTTTTSINQIYETITNQLTNLKEELTMNINNEPLTQQTNQVITLKKS
                     LDQRIKKFETTVTKINNQFRKKFEKLITDHFNKITNINNDFIKEQKDLIKEQIDLLIN
                     IENEKNENEKNENEKNNENIQSIINKFEELIEELLNQRNQRNQNQN"
     gene            <127891..>130353
                     /locus_tag="CD36_50530"
                     /db_xref="GeneID:8048330"
     mRNA            <127891..>130353
                     /locus_tag="CD36_50530"
                     /product="acid sphingomyelin phosphodiesterase, putative"
                     /transcript_id="XM_002420314.1"
                     /db_xref="GeneID:8048330"
     CDS             127891..130353
                     /locus_tag="CD36_50530"
                     /inference="similar to AA sequence:UniProt:Q4V7D9"
                     /inference="similar to AA sequence:UniProt:Q4WIJ8"
                     /inference="similar to AA sequence:UniProt:Q5A510"
                     /note="Similar to Rattus norvegicus Smpdl3b; sphingomyelin
                     phosphodiesterase precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="acid sphingomyelin phosphodiesterase, putative"
                     /protein_id="XP_002420359.1"
                     /db_xref="GeneID:8048330"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:B9WGZ6"
                     /translation="MCGGRKNKNNQTNKKKKEEGKIQNFTKSVAKLQKMIQSIIIILF
                     SIYQFIYSYNEHIINYYPPTELAISDEEIVNRAIQELHNIDAANDLNECMTCKTRLQV
                     AKFISLTRPDLVPQIFSTWCVESGYDEIQCHMNYGYPSEDYCTMGNDFTKMVSLMNPS
                     GLDGDYFCYYHDNNCGILPETPLVDMSRLWPSKPRNYLPPDNSGETFHVLHISDINLQ
                     SDYKMFAEANCTQSLCCSPHCRNLQNSAPNFNENLEGGYFDSSYSRNHFEKGSYMDIT
                     KIKKPTWRPARQFGEYSCDSPTLLLNSTMQGIRDLHQNHLSFEFALFTGGTVDHSDRS
                     FMSKNKNIMSQDISYRILKHYLDTVDVIPTFGTRDIFPMNQLPQKNLTENSNSYQWQF
                     DFLADLWSELGWIDHESSKQIRYSQIGYSLITSRGLKIICLNSNVWNVKNLYTFWEVL
                     SIDSFGIWKFLIEELIESERIHQRVWIVAHLPTNHQSLPLPTKVFAQIMERFSPQVIA
                     AIFFGHIQVDTFMIQYGGDGTDNKELEKAINHAIVGPSISPYSGVNPAWRYYAIDSKS
                     FSVVNAFTYYTKLDNTFINDGAEPVWEFGYSARDVYDPEQMWPMEWCLNTEWWHHVSE
                     KIKKVPEMDLMYQRLETRWFSQNEFDSNSYCKVTSFTMEAKKQCMLTGDQDDYVEPKQ
                     PNDYVPFIHVGSKIEYIDKQVAYPPEVEEEVEVDVEEEEEEFESEEVDEDYQPGKKLG
                     TKGNNTNVDQGLNDGGGGEGGGGGDKKNKGKGGLIGKEIEEQNYTVANDNSLISRFQR
                     KPQGKSLGLKIKNRHRVPIAQL"
     gene            complement(<132600..>133754)
                     /locus_tag="CD36_50540"
                     /db_xref="GeneID:8048331"
     mRNA            complement(<132600..>133754)
                     /locus_tag="CD36_50540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420315.1"
                     /db_xref="GeneID:8048331"
     CDS             complement(132600..133754)
                     /locus_tag="CD36_50540"
                     /inference="similar to AA sequence:UniProt:Q5A511"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420360.1"
                     /db_xref="GeneID:8048331"
                     /db_xref="UniProtKB/TrEMBL:B9WGZ7"
                     /translation="MVSASTIKVLPPANGKKLWRVRKSTPNTHQRSNSLPGNKSSTTL
                     PISSKSSNRSCSTSSIASTTATTPTTTTTNNNNNNNSSPMQSSSIECLNNSLKIVAAA
                     SKFTIKRPPLRRPKNKPGKPKDFVFVDLSPVQSDNSSESEPNGGITTTVSKSRRSSNS
                     GNSATATATGNKIAAINVPVLPTNVVAPATPMTTSNSMNSINDFNTYGKPPPPVKDAN
                     TYIGATNMEPSLSSNDGFGLPSPVESLDDFLISEFDLWENEVNWQSMIPNTQQQQQQQ
                     QQSTSSVVSPIIRTENNQQQQQQGQYEQYFDIVSIVQQQQEQIQKLQQQLQQITKSNN
                     NNNNNGNGNTLPQIDMINSIINNNIANSIPIPTSSATTTTTNNGFMDFVF"
     gene            complement(<144704..>145027)
                     /locus_tag="CD36_50550"
                     /db_xref="GeneID:8048332"
     mRNA            complement(<144704..>145027)
                     /locus_tag="CD36_50550"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420316.1"
                     /db_xref="GeneID:8048332"
     CDS             complement(144704..145027)
                     /locus_tag="CD36_50550"
                     /inference="similar to AA sequence:UniProt:Q5A512"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420361.1"
                     /db_xref="GeneID:8048332"
                     /db_xref="UniProtKB/TrEMBL:B9WGZ8"
                     /translation="MPPKLSPSAAASSAQGAPMSHKIIVGTIAILLGGYVTYKTGSDF
                     QFVKYTPHSPEEIERRKRENQTGISMKMTDELTLDLKPEAKQRIQKLLEEKNKSLEAN
                     QNDKK"
     gene            <145501..>146010
                     /locus_tag="CD36_50560"
                     /db_xref="GeneID:8048333"
     mRNA            <145501..>146010
                     /locus_tag="CD36_50560"
                     /product="ubiquitin-conjugating enzyme, putative"
                     /transcript_id="XM_002420317.1"
                     /db_xref="GeneID:8048333"
     CDS             145501..146010
                     /locus_tag="CD36_50560"
                     /EC_number="6.3.2.19"
                     /inference="similar to AA sequence:UniProt:P52490"
                     /inference="similar to AA sequence:UniProt:Q5A513"
                     /note="Similar to S. cerevisiae UBC13;
                     In S. cerevisiae: involved in the error-free DNA
                     postreplication repair pathway; ubiquitin-protein ligase,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ubiquitin-conjugating enzyme, putative"
                     /protein_id="XP_002420362.1"
                     /db_xref="GeneID:8048333"
                     /db_xref="GOA:B9WGZ9"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:B9WGZ9"
                     /translation="MAALPKRIIKETERLVSDPVPGIIATPSEDNLRYFEVTIIGPNQ
                     SPYAKGKFKLELYLPDDYPMCAPKVRFLTKIYHPNIDKLGRICLDVLKDNWSPALQIR
                     TILLSIQALLGAPNPDDPLANDVAQDWKSDEKKAIEVAKEWTAKYAIDETEKENNDKD
                     ASANKESNQ"
     gene            <148402..>153552
                     /locus_tag="CD36_50570"
                     /db_xref="GeneID:8048334"
     mRNA            <148402..>153552
                     /locus_tag="CD36_50570"
                     /product="aminophospholipid translocase (flippase),
                     putative"
                     /transcript_id="XM_002420318.1"
                     /db_xref="GeneID:8048334"
     CDS             148402..153552
                     /locus_tag="CD36_50570"
                     /EC_number="3.6.3.1"
                     /inference="similar to AA sequence:UniProt:P32660"
                     /inference="similar to AA sequence:UniProt:Q5A514"
                     /note="Similar to S. cerevisiae DNF1;
                     In S. cerevisiae: aminophospholipid translocase (flippase)
                     that localizes primarily to the plasma membrane;
                     contributes to endocytosis, protein transport and cell
                     polarity; type 4 P-type ATPase; probable
                     phospholipid-transporting ATPase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="aminophospholipid translocase (flippase),
                     putative"
                     /protein_id="XP_002420363.1"
                     /db_xref="GeneID:8048334"
                     /db_xref="GOA:B9WH00"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR026871"
                     /db_xref="UniProtKB/TrEMBL:B9WH00"
                     /translation="MTKNKHNFTLNNSSDGANNNDDPSDHHDYSDDSMPPTPTISTFN
                     KFPRQSSLRFKTPLPNDTPRSSSSGSTSNNNNSNSHSHNPRSPFLDENESSFDRKFGY
                     NYDKDKLVEEEDENEDEATYVVGEEDENENDNINEMEPSNLKTKRHRWGTTRHKHGRP
                     KNENINRSKTLKKILAPHKSKGKSHSNNSHSLNKRLLSIRKPNTHRVNFPHDNQPPPQ
                     DLDFEEQNDPKNRKSEKRTITFNRPLPPHLVDPETNKPITSYPRNKIRTTKYTPLSFF
                     PKNIWNQFMHNVANIYFLVLIILGAFEIFGVPSPVLAAVPLIVIVIITAIKDAIEDSR
                     RTVTDLEVNNQITHILTQVNEDNANGYHYENVNVDDEQVSLWRQFKKWNTRLLIRFWG
                     ASKRNLTKEGRANKIRERYNRENNIDGDGDQQQGRKSFDSDIMSTRTSFEQTENPFND
                     TLRQSFQQQRQQQQRQSSSYRHKTMKFAKKYWKNVKVGDVLRIYNNDEIPADLVILAT
                     SDEDNCCYVETKNLDGETNLKVKQALKYSSINEKIQKADDLINHDFEIDSEGPHANLY
                     SYQGNLKYTNRMNNLQPHDNREDSQEAITINNLLLRGCTLRNTKWAIGIVVFTGDDTK
                     IMLNAGVTPTKQSRMSRELNYYVLLNFILLFVICFISGLVNGIYYRSTNTSRDYFEFG
                     TIASTPALNGLVGFFVSLILYQSLVPISLYITIEIIKTAQAFFIYSDVGMYYSKLDFP
                     CTPKSWSISDDLGQIEYIFSDKTGTLTQNLMEFKKCTINGVSYGKAYTEALAGLRKRM
                     GIDVEIEAVQERELISRDKEVMIEKLHTINKNKTYDDEITFVSSEFINDLTDSSNNNE
                     QQRESNHHFMLALALCHSVMTEPDPKQPNKLLLKAQSPDEAALVGTARSLGFNFKGTT
                     KTGVIVDIHGVTKEYQVLNTLEFNSTRKRMSSIIKIPGDGPNDEPRALLICKGADSII
                     YERLSASENDPAMLEKTSKHLEEYATEGLRTLCIAERELSWKQYVEWNKRHQAAASSL
                     DDREAKMEAVADSIERELTLLGGTAIEDRLQDGVPDAISLLADAGIKLWVLTGDKVET
                     AINIGFSCNLLGNDMQLLVIKTAYNDDENGNNEDNSSDDKNSLQGLKFGHNASEPEIV
                     DTVISYYLRKHFDMTGSFEEKEAAVGDHSPPDERFGVVIDGDALKLVLLSPEVKRKFL
                     LLCKKCRAVLCCRVSPAQKAAVVKLVKDTLNVMTLAIGDGSNDVAMIQAADVGVGIAG
                     EEGRQAVMSSDYAIGQFRYLARLLLTHGRWSYKRFSEMIPSFFYKNIIFNIALFWYGI
                     YCEFDGTYLFEFTYLMFYNLAFTSLPVIFLGIFDQDVEAKVSLLVPQIYRTGITRTEM
                     SDAKFYLYCLDGIYQSAISYFFPYLLYMVAFPNMNGKPVDHRFWMGVLVTCIACISCN
                     CYILFHQFRWDWLSSLIVAISILIIFIWTGLWTVNYQSSGEFYKAAPEIFGMTAFWAC
                     MFVGILCCLIPRFFYDFVMRIFWPKDIDIIRECVARGDFEAYPFDYDPTDPNRPKIST
                     YSSDVVHRMSMNYPSPPQTQTASTDSNGKSPSSSSLDNGHQNRHPNNPNSNGYYEQDN
                     SSGSNMTYDRSIIFERVNDSPINAHHQQPPTPPPGIIASPIRKRKGFVPSMFRNSSDS
                     YIHHSNGHANGSSPGVATEEIPLEDFDDEQKRASRISYENQKRVSSMT"
     gene            154098..156194
                     /locus_tag="CD36_50580"
                     /pseudo
                     /db_xref="GeneID:8048335"
     misc_feature    154098..156194
                     /locus_tag="CD36_50580"
                     /inference="similar to AA sequence:UniProt:Q5A515"
                     /note="Similar to S. cerevisiae LPF6;
                     not a pseudogene in C. albicans"
                     /pseudo
                     /db_xref="GeneID:8048335"
     gene            <158005..>158910
                     /locus_tag="CD36_50590"
                     /db_xref="GeneID:8048336"
     mRNA            <158005..>158910
                     /locus_tag="CD36_50590"
                     /product="ADP/ATP carrier protein"
                     /transcript_id="XM_002420319.1"
                     /db_xref="GeneID:8048336"
     CDS             158005..158910
                     /locus_tag="CD36_50590"
                     /inference="similar to AA sequence:UniProt:P18239"
                     /inference="similar to AA sequence:UniProt:Q5A516"
                     /note="Similar to S. cerevisiae AAC2;
                     In S. cerevisiae: exchanges cytosolic ADP for
                     mitochondrially synthesized ATP"
                     /codon_start=1
                     /transl_table=12
                     /product="ADP/ATP carrier protein"
                     /protein_id="XP_002420364.1"
                     /db_xref="GeneID:8048336"
                     /db_xref="GOA:B9WH01"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:B9WH01"
                     /translation="MVDSNFFVDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQG
                     RLAKRYTGIVDCFKRTAADEGVISFWRGNTANVIRYFPTQALNFAFKDKFKAMFGFKK
                     DENYWKWFAGNLASGGLAGATSLAFVYSLDYARTRLANDAKSSKGDGKREFNGLVDVY
                     KKTLASDGIAGLYRGFGPSVIGIVVYRGLYFGLYDSLKPVVLVGPLEGSFLASFLLGW
                     AVTTGASTASYPLDTVRRRMMMTSGQAVKYDGALDCFRKVVAAEGVGSLFKGCGANIL
                     RGVAGAGVISLYDQLQVILFGKKFK"
     gene            complement(161194..162301)
                     /locus_tag="CD36_50600"
                     /pseudo
                     /db_xref="GeneID:8048337"
     misc_feature    complement(161194..162301)
                     /locus_tag="CD36_50600"
                     /inference="similar to AA sequence:UniProt:Q5A517"
                     /note="not a pseudogene in C. albicans"
                     /pseudo
                     /db_xref="GeneID:8048337"
     gene            complement(<162796..>164586)
                     /locus_tag="CD36_50610"
                     /db_xref="GeneID:8048338"
     mRNA            complement(<162796..>164586)
                     /locus_tag="CD36_50610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420320.1"
                     /db_xref="GeneID:8048338"
     CDS             complement(162796..164586)
                     /locus_tag="CD36_50610"
                     /inference="similar to AA sequence:UniProt:Q5A518"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420365.1"
                     /db_xref="GeneID:8048338"
                     /db_xref="UniProtKB/TrEMBL:B9WH02"
                     /translation="MATEDINNTSRSKEDDKDDDQVDPLKVINALFNDYDYDPKDTES
                     STDHIYPELMLQESEHGNKYYSCFQSYNRQFINETTTTNSTNSINQHSDIVRWTGSTI
                     ELTASIILDNWLNQSSGNGTRSNISNTTATSKRHISRPNALFVWASTDEYIEERKKEL
                     RRLQKLKDIDQIHAQDKPPQIQNGNNSSKSVDDNKNKNNNATGKSKQDIIKQNLKKKL
                     EIKFSNVAINNKLNKIIEIESNKFIHARIQRIKAHYSEQMEKQISERKRKDHELYLKK
                     LKLKEEEYEQESSLRSKHSTNSGGTFLGNLFGFNSNTVGGVNNLETTYNNRSSAESSR
                     TMDSTNNASITTPSVMTPSSKQKRFPLFSVAGLFGGSSKKNSSKTVLFESNEVNEEEK
                     TETASSTPPIENDRSVDDPQNDTQPKVVIKQDLESKPLPPQPTDTRSTPDFDQANTNN
                     QHSSQSQTTINNFFSIDELEQHIKNSAEPSPSKSNKFNDSMNEGKPTEKGTTNTIEDN
                     NYDEDDEEFDDFTSAQPVHNNDITIFQDPPKLNRNFFSIDKAKGSTISKSDNNQINND
                     LLEIFSPTTTSAPVSKSPSPALNELSLLDL"
     gene            <164835..>165434
                     /locus_tag="CD36_50620"
                     /db_xref="GeneID:8048339"
     mRNA            <164835..>165434
                     /locus_tag="CD36_50620"
                     /product="component of the KEOPS telomere regulatory
                     complex"
                     /transcript_id="XM_002420321.1"
                     /db_xref="GeneID:8048339"
     CDS             164835..165434
                     /locus_tag="CD36_50620"
                     /inference="similar to AA sequence:UniProt:Q03705"
                     /inference="similar to AA sequence:UniProt:Q5A519"
                     /note="Similar to S. cerevisiae CGI121;
                     In S. cerevisiae: involved in telomere uncapping and
                     elongation as component of the KEOPS protein complex; also
                     shown to be a component of the EKC protein complex;
                     homolog of human CGI-121"
                     /codon_start=1
                     /transl_table=12
                     /product="component of the KEOPS telomere regulatory
                     complex"
                     /protein_id="XP_002420366.1"
                     /db_xref="GeneID:8048339"
                     /db_xref="GOA:B9WH03"
                     /db_xref="InterPro:IPR013926"
                     /db_xref="UniProtKB/TrEMBL:B9WH03"
                     /translation="MTSEVIKFPQFAEFTIHISLFINISSENITTIKSNLISSTDNHN
                     KYDYCFLNTKYIISKEHLFQSIYKSLLNYTSKSGLSTRNLNSEIIYNLSPINNIGDAL
                     KRFGISEDCPNCIVIKIINNKEEEITKALDRANTDLKEIIDGELIELNDQYIFENFID
                     LAKFRKLYKLNDVADLNKEDNLQGRLTRLAIGACILRGY"
     gene            complement(<165476..>167623)
                     /locus_tag="CD36_50630"
                     /db_xref="GeneID:8048340"
     mRNA            complement(<165476..>167623)
                     /locus_tag="CD36_50630"
                     /product="exodeoxyribonuclease, putative"
                     /transcript_id="XM_002420322.1"
                     /db_xref="GeneID:8048340"
     CDS             complement(165476..167623)
                     /locus_tag="CD36_50630"
                     /EC_number="3.1.-.-"
                     /inference="similar to AA sequence:UniProt:P39875"
                     /inference="similar to AA sequence:UniProt:Q5A520"
                     /note="Similar to S. cerevisiae EXO1;
                     In S. cerevisiae: 5'-3' exonuclease and flap-endonuclease
                     involved in recombination, double-strand break repair and
                     DNA mismatch repair"
                     /codon_start=1
                     /transl_table=12
                     /product="exodeoxyribonuclease, putative"
                     /protein_id="XP_002420367.1"
                     /db_xref="GeneID:8048340"
                     /db_xref="GOA:B9WH04"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:B9WH04"
                     /translation="MGVNGLLQVLKEIQDPCSLERYRGQTLAIDTYGWLHRALVSCAE
                     ELCLGKPTRKYVTAILNKIQMLNHFGITPYFVFDGASLPTKQETNRERQLKRQEAKEL
                     AEKYIAANNQKLAYKQYMKAAYVTSQMAKSVMCELDNLSIKYIVAPYEADPQMVYLEK
                     MGVVDGILSEDSDLLIFGCKKLITKLKDDGTCVEINRDKFDKVKEIPYLNQYNMEQLR
                     LVAMLSGCDYTKGVPGIGLRTAFQLVRKYNNFTKVLIALRSMGKKIPDNFIDEVKLAN
                     LAFQFQKVFDPTNQKLTTLNEYPQNNREVDDYDDETLLENCCGKTFTDEIYQKLCNGK
                     IHPNTHEILVSREQSLTVLKSESVYSPNSQQIEKNYNQASNATIAHRSRSEGAICQAG
                     NGKSILDLLSISKKVTITNTTTTTANGSQLESCNNDKQMKTPERKLLKRSVKFEEIKL
                     SPTSKKLRKLVATATTTTTNDTSAATPSPNVTTSKFFTPKSHPIDKIQPANPTTKENS
                     IKPDWDSSLIDDSEITDYDQAHHHESSDKPVDTKNILDDLTDNDNDHEEEEEETNFNK
                     IKLDPIVDLKQSPQSDNGFDICSNDDEIEESPIKNRVGTVVGGQEQVRTRLIALKESF
                     SYQSTTTKSTHQFLKPDKPNNERKRIPLQPKNINQIQQKSPTKSIKLNRKVDHRHQGY
                     RNNNNVDISKAVSTVNSRSTIDIRQFAYKKQQT"
     gene            complement(<168021..>169553)
                     /locus_tag="CD36_50640"
                     /db_xref="GeneID:8048341"
     mRNA            complement(<168021..>169553)
                     /locus_tag="CD36_50640"
                     /product="Sam50p-like protein, putative"
                     /transcript_id="XM_002420323.1"
                     /db_xref="GeneID:8048341"
     CDS             complement(168021..169553)
                     /locus_tag="CD36_50640"
                     /inference="similar to AA sequence:UniProt:A3LZ83"
                     /inference="similar to AA sequence:UniProt:P53969"
                     /inference="similar to AA sequence:UniProt:Q5A521"
                     /inference="similar to AA sequence:UniProt:Q6IEH7"
                     /note="Similar to S. cerevisiae SAM50; sorting assembly
                     machinery subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Sam50p-like protein, putative"
                     /protein_id="XP_002420368.1"
                     /db_xref="GeneID:8048341"
                     /db_xref="UniProtKB/TrEMBL:B9WH05"
                     /translation="MVELQVNTNPDLKSKLIEEQYLQESTNLPIYLTKIEVVGGESFS
                     NQFFQNLLSPILQTGDLTFLQLINKIKSSQSKLIETGIFNKVAIQILPDNYYSLSSNK
                     IKSYNKEPSLITKILIDLSAINLSNNQGFLNFNNEEYLNLKLNHINHNFNGNGELISI
                     GVDYNPYKPLDHLIANGKFISYLKNPKFKFLIDFQLNQENNEVWQDTKQEIIGGKLGL
                     LYGGNKATTTTNDLNFFTGFQLLKRNLINLDDGNFDSIKFFNGQFLKSSILNQLKFQK
                     IEFLHEQSKNFPKNGYELLFNGEISSNQEQLNVNNRNEFIKTDFSINLYKSLFNEFFT
                     TKFQAQLGGIYSFNNNNNSKVTPIHPSDKFYLGGYNSFPGFTKNSVELQGGDQYYKFQ
                     ATLYSKIPCLLYAPPPPPPPKSASTISLDNEQDLNPLRVYATGIIGNVVNSSKANLLE
                     DENGAVSYGFGLKYFNNWANFDIGYYFSKRLGFTNDGNTNTAGIKDGLHFSISIGGSN
                     NN"
     gene            complement(<170001..>171074)
                     /locus_tag="CD36_50650"
                     /db_xref="GeneID:8048342"
     mRNA            complement(<170001..>171074)
                     /locus_tag="CD36_50650"
                     /product="homoserine kinase, putative"
                     /transcript_id="XM_002420324.1"
                     /db_xref="GeneID:8048342"
     CDS             complement(170001..171074)
                     /locus_tag="CD36_50650"
                     /EC_number="2.7.1.39"
                     /inference="similar to AA sequence:UniProt:P17423"
                     /inference="similar to AA sequence:UniProt:Q5A523"
                     /note="Similar to S. cerevisiae THR1;
                     In S. cerevisiae: required for threonine biosynthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="homoserine kinase, putative"
                     /protein_id="XP_002420369.1"
                     /db_xref="GeneID:8048342"
                     /db_xref="GOA:B9WH06"
                     /db_xref="InterPro:IPR000870"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:B9WH06"
                     /translation="MSISSFKIKVPASSANIGPGFDVLGIGLELYLTITVTIDPNIDT
                     SSDPHHALLSYEGDGKVPFESNENLITQTALYVMRCNGIKDFPRGTHIHVNNPIPLGR
                     GLGSSASAIVAGVYLGNEIGNLKLDKYRLLDYCLMIERHPDNIAAAMLGGFIGSYLNE
                     LSSKDSQLTTVPLEYILPKINQGQIITPQDKIICQPPPVNIGQYVRYNWNKKIKCLTI
                     IPNFELSTDLSRSVLPKNYQLQDIVYNLQRIAILTTALTQDPPSHKLIYQSMKDKLHQ
                     PYRFGLIPGLNNVLMKITPENYPGLCGICLSGAGPTILCLATDGFEKIANDVIEIFKQ
                     EGIECNSKLLDLAYDGATVEYRS"
     gene            complement(<171449..>173035)
                     /gene="ERG11"
                     /locus_tag="CD36_50660"
                     /db_xref="GeneID:8048343"
     mRNA            complement(<171449..>173035)
                     /gene="ERG11"
                     /locus_tag="CD36_50660"
                     /product="lanosterol 14-alpha demethylase"
                     /transcript_id="XM_002420325.1"
                     /db_xref="GeneID:8048343"
     CDS             complement(171449..173035)
                     /gene="ERG11"
                     /locus_tag="CD36_50660"
                     /inference="similar to AA sequence:UniProt:P10614"
                     /inference="similar to AA sequence:UniProt:Q09GR3"
                     /inference="similar to AA sequence:UniProt:Q96VP2"
                     /codon_start=1
                     /transl_table=12
                     /product="lanosterol 14-alpha demethylase"
                     /protein_id="XP_002420370.1"
                     /db_xref="GeneID:8048343"
                     /db_xref="GOA:B9WH07"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:B9WH07"
                     /translation="MAIVETAIDGINYFLSLSVTQQITILLGVPFVYNLIWQYLYSLR
                     KDRAPLVFYWIPWFGSAASFGQKPYEFFESCRQKHGDIFSFMLLGKIMTVYLGPKGHE
                     FIFNAKLSDVSAEDAYKHLTTPVFGKGVIYDCPNSRLMEQKKFAKFALTTESFKRYVP
                     KIREEILDYFVNDESFKLKEKNHGVANIMKTQPEITIFTASRSLFGDDVRKLFDRSFA
                     QLYSDLDKGFTPINFVFPNLPLPHYWRRDAAQKKISATYMKEIKSRRERGDIDPSRDL
                     IDSLLTHSTYKDGVKMTDQEIANLLIGILMGGQHTSASTSAWFLLHLGEKPHLQDAIY
                     QEVVELLKEKGGDLNDLTYEDLQKLPSVTNTIKETLRMHMPLHSIFRKVKNPLRIPET
                     NYVVPRGHYVLVSPGYAHTSERYFDNPNNFDPTRWDTAAAKANSVSFNSSDEVDYGFG
                     KISKGVSSPYLPFGGGRHRCIGEQFAYVQLGTILTTFVYNLRWTVEGNRVPDPDYSSM
                     VVLPTEPARIIWEKRETCMF"
     gene            complement(<174552..>176735)
                     /locus_tag="CD36_50670"
                     /db_xref="GeneID:8048035"
     mRNA            complement(<174552..>176735)
                     /locus_tag="CD36_50670"
                     /product="helix-loop-helix DNA binding protein, putative"
                     /transcript_id="XM_002420326.1"
                     /db_xref="GeneID:8048035"
     CDS             complement(174552..176735)
                     /locus_tag="CD36_50670"
                     /inference="similar to AA sequence:UniProt:Q5A586"
                     /codon_start=1
                     /transl_table=12
                     /product="helix-loop-helix DNA binding protein, putative"
                     /protein_id="XP_002420371.1"
                     /db_xref="GeneID:8048035"
                     /db_xref="GOA:B9WH08"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:B9WH08"
                     /translation="MIFKLNDYNAFLTSLFDKNNEQLQRHQLQNYNQSQNSDTIMTFP
                     NSNNNNNNNSNSNMNSNIVDDENNNNNSSSSYHQNGGFPVDFDFGLAPPPFVTDLPHN
                     NNSNTNGNSKYFNLPSNGTTTTTNGFQNIDYELPSNTEFIAEIGAYVKDTKSNNNNNN
                     NGRNKTDNFSSKNLNNNNSNQRNTTTTTPTKQNNNSNNNDGVVVNDIDQFSRFNAFET
                     NLGDPMILEQDEQMNSSNSPMIFNLNDQMGNNFNNEVTRNSQYSNYQQQQQQQQQQQQ
                     QQQQQQQQVPQGSVFQDQVSPHSRMGNIPQSMSNHQRIKSNQEFNSNLQSPMSMETSL
                     TSIKSNINKNIGSKGSKKSRNSNSIKRSSSSSGSSSVLDYQNSKSLTEQASQITFGTT
                     TTTGTSSSSSAVSQGRPTNTPITTTTTTTTTSSSNSNSMLPGSSPISPLNVHTSPLTT
                     TPSTSNAPTKSRGRKIKIEPSSSSSTTSTIINEPTNMINHNPHPGRPRIKSAHNVIEQ
                     RYRNKINDKFNALQNSVPTLRILAQKKQREKLLMQQHQHQQQQHRRNSSIATTSGKNP
                     EYDSSDDEMININKGLIMNNGGTTSYINTGTIGFNNNNNCGSGGGGNYNDDQLGILQN
                     SSNRLKQSEDYDDEFDGLMEIEEQEHEPNDDEEEGQEEEEEEEEEVIDLEGLEPARKL
                     NKGTILAKSIEYIKFLEMKNERMKQEHDELVLKARMLGLVIDEDM"
     gene            <180491..>181798
                     /locus_tag="CD36_50680"
                     /db_xref="GeneID:8048344"
     mRNA            <180491..>181798
                     /locus_tag="CD36_50680"
                     /product="arginine N-methyltransferase, putative"
                     /transcript_id="XM_002420327.1"
                     /db_xref="GeneID:8048344"
     CDS             180491..181798
                     /locus_tag="CD36_50680"
                     /EC_number="2.1.1.-"
                     /inference="similar to AA sequence:UniProt:Q03305"
                     /inference="similar to AA sequence:UniProt:Q5A526"
                     /note="Similar to S. cerevisiae RMT2"
                     /codon_start=1
                     /transl_table=12
                     /product="arginine N-methyltransferase, putative"
                     /protein_id="XP_002420372.1"
                     /db_xref="GeneID:8048344"
                     /db_xref="GOA:B9WH09"
                     /db_xref="InterPro:IPR017408"
                     /db_xref="InterPro:IPR026480"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B9WH09"
                     /translation="MSELHDLCKFPIRPIDQSYIEKLTQYLKDGIPATYTIEEAYNYI
                     NNINIEPTTTTTPLHLICQNAPIDITNDEQKIISQMVEKLFEYGAGWSFTDINNQTPG
                     CILISRRQKIGNEKWMNDVYQQIIDAGVRAELLLRKVNEFEEVEFIDEEEEEEEEEIP
                     QLVEDQQETKEEQQLQQQSGDIDDAPDAPSQNQQSYLNTKLEYINDALITKNDKDGVM
                     MAWENDIMKLASDTITSNLDSDDNHDSELNILNIGFGMGIIDNMIQSKLKDHPNAKHY
                     ICEAHPDVLEKMKLDGWYNKSNVIILEGRWQDKLNELLSSSEQKVPVFFDGIYYDTFS
                     EHYQDMLELFDIIVGLLKPNGIFSFFNGLGADRQIIYQVYKNLLIIDLENYGLNCQFK
                     EIEIPIEKFWNESKDKSIWDDVKRSYWSCPIYYHPIIKFIDDI"
     gene            complement(<181809..>182906)
                     /locus_tag="CD36_50690"
                     /db_xref="GeneID:8048345"
     mRNA            complement(<181809..>182906)
                     /locus_tag="CD36_50690"
                     /product="RNA polymerase II transcription factor B
                     subunit, putative"
                     /transcript_id="XM_002420328.1"
                     /db_xref="GeneID:8048345"
     CDS             complement(181809..182906)
                     /locus_tag="CD36_50690"
                     /inference="similar to AA sequence:UniProt:Q03290"
                     /inference="similar to AA sequence:UniProt:Q59XB2"
                     /note="Similar to S. cerevisiae TFB3;
                     In S. cerevisiae: subunit of TFIIH and nucleotide excision
                     repair factor 3 complexes, involved in transcription
                     initiation, required for nucleotide excision repair; ring
                     finger protein similar to mammalian CAK and TFIIH subunit;
                     transcription initiation factor TFIIH subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase II transcription factor B
                     subunit, putative"
                     /protein_id="XP_002420373.1"
                     /db_xref="GeneID:8048345"
                     /db_xref="GOA:B9WH10"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004575"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015877"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:B9WH10"
                     /translation="MKYTSITSYNNANANYHIIDDQLKDMCPICKTDKYLSPNMKFLI
                     NPECYHKICESCVDRIFSLGPAPCPYPKCGKILRKNKFKQQIFEDLIIEKEIDIRKKV
                     SAIYNKTEEDFPEDLSGYNRYLENIEDIIFKLSYSNDKQEIELIESELNKYEQEHKLE
                     ILERNMRESQRNDDLMKYKEARERLKQEKLRIQKQMELEDLQYQQEQQQELLDKLTNS
                     SSNSEELIKQQQNQMLKRSNLRRKQLQTINNQLDQQFNKSNPFANHDSDDEFNDGSSS
                     SIIPFTPFQGDRDLNKGYTMLPVPTDVESIMNIEQNISDSYYDPFINKLAKNKQYLGG
                     GWRLQNVFQQALDEAFIGLGCNIELEKANAT"
     gene            complement(<183212..>184363)
                     /locus_tag="CD36_50700"
                     /db_xref="GeneID:8048346"
     mRNA            complement(<183212..>184363)
                     /locus_tag="CD36_50700"
                     /product="S-adenosylmethionine decarboxylase proenzyme,
                     [contains: s-adenosylmethionine decarboxylase alpha chain;
                     s adenosylmethionine decarboxylase beta chain], putative"
                     /transcript_id="XM_002420329.1"
                     /db_xref="GeneID:8048346"
     CDS             complement(183212..184363)
                     /locus_tag="CD36_50700"
                     /EC_number="4.1.1.50"
                     /inference="similar to AA sequence:UniProt:P21182"
                     /inference="similar to AA sequence:UniProt:Q59XB1"
                     /note="Similar to S. cerevisiae SPE2;
                     In S. cerevisiae: required for the biosynthesis of
                     spermidine and spermine"
                     /codon_start=1
                     /transl_table=12
                     /product="S-adenosylmethionine decarboxylase proenzyme,
                     [contains: s-adenosylmethionine decarboxylase alpha chain;
                     s adenosylmethionine decarboxylase beta chain], putative"
                     /protein_id="XP_002420374.1"
                     /db_xref="GeneID:8048346"
                     /db_xref="GOA:B9WH11"
                     /db_xref="InterPro:IPR001985"
                     /db_xref="InterPro:IPR016067"
                     /db_xref="InterPro:IPR018166"
                     /db_xref="InterPro:IPR018167"
                     /db_xref="UniProtKB/TrEMBL:B9WH11"
                     /translation="MVAPALIYSNHELSTAIDSTHAFEGPEKLLEIWFYPSKELSPIN
                     LRNIKFDTWIKILNLVHCEVLSKVSSTLCDAFLLSESSLFVFPHKIILKTCGTTTTLA
                     CLDLLFETVTKELQKIYSGDEVVVFSSKEIYQIFYSRRSFMFPDRQIHVHGNWQEEVK
                     LLNQYFNNGKSYIVGNNTNWHLYVGGSGKNGKPNGVAPGDAIPAVNDCTLEIIMTQLS
                     LEASQQFYTTRKPGDTAIDENHDLGHDLGQQVLKQTGLNELFKLKEQSPITSNSSPIK
                     EIHDGFAFTPCGFSSNSINESDYYTIHVTPEPGWSYASFETNMIGADYKAIVDKCINV
                     FQPGQFMVTFLTNTDMQRFECCLDNYKVNHREELDVEDYKLYFVEFIRQ"
     gene            <187922..>189871
                     /locus_tag="CD36_50710"
                     /db_xref="GeneID:8048347"
     mRNA            <187922..>189871
                     /locus_tag="CD36_50710"
                     /product="[GPI-anchored] cell wall protein, HYR(-like)
                     family member, putative"
                     /transcript_id="XM_002420330.1"
                     /db_xref="GeneID:8048347"
     CDS             187922..189871
                     /locus_tag="CD36_50710"
                     /inference="similar to AA sequence:UniProt:Q59XA7"
                     /note="cell wall protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="[GPI-anchored] cell wall protein, HYR(-like)
                     family member, putative"
                     /protein_id="XP_002420375.1"
                     /db_xref="GeneID:8048347"
                     /db_xref="InterPro:IPR021031"
                     /db_xref="UniProtKB/TrEMBL:B9WH12"
                     /translation="MLFTLSILFPLLFNSIFAIEITQNRVDQGTINTKIGDITIDSGA
                     YWSIIDNSISSFIGDLNIKTNAGLYISSTISDLPLLVLLNSGSASITNNGIISLDSRS
                     STQGSSQYNLVGESFLNNGEFYLAASGVIPMTMGITGKSWNNNGLIVAYQNQRKSGSV
                     RFGVIGQTIINKGQICLINQVLQQTSKIDGSGCITTKENSSIYISNVLDPQSVSSEQN
                     YYLADDKSSIIVEAVGFNSQNFNVFGFGNGNKIGLTLSLKFGAGSGNSGSAYSYDSNT
                     GILSLTSGLFGQKFNIGPGYNSSLFSIVTDDSDGIPSVDNGAVTYSGPVPNQKSLPSA
                     CNVECKQIPDVPDNGPSSSSSSSSGVITTTTSTSTDTTIDTASVSSTSNEESSASESP
                     NNSASNELSTTFEVSQTIGTSEPSASESSEIDISGTTDPDTATSSGNDNSNSLSTFSS
                     NTNSDTISSETGSVSSYSTPSSGDSSEVSSLATGTLPDTITGSQESSTSGFTSGVIES
                     SGVSDNSNSVATTATTPNSVDVNTQSNTDNTVTSAITTDTGVNTPITTGTGSGSDNNG
                     VLPTDSNVNSNETDNISTLTTSSTTLISVVSSSQPIAEESTLPSSFASGIPGEVIPNA
                     NGSSKLSINLSFIISGCAIILGLFM"
     gene            <190454..>190942
                     /locus_tag="CD36_50720"
                     /db_xref="GeneID:8048348"
     mRNA            <190454..>190942
                     /locus_tag="CD36_50720"
                     /product="chromosome transmission fidelity protein,
                     putative"
                     /transcript_id="XM_002420331.1"
                     /db_xref="GeneID:8048348"
     CDS             190454..190942
                     /locus_tag="CD36_50720"
                     /inference="similar to AA sequence:UniProt:P38877"
                     /inference="similar to AA sequence:UniProt:Q59XA3"
                     /note="Similar to S. cerevisiae CTF8;
                     In S. cerevisiae: required for sister chromatid cohesion;
                     kinetochore protein, putative; sister chromatid cohesion
                     complex component, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="chromosome transmission fidelity protein,
                     putative"
                     /protein_id="XP_002420376.1"
                     /db_xref="GeneID:8048348"
                     /db_xref="InterPro:IPR018607"
                     /db_xref="UniProtKB/TrEMBL:B9WH13"
                     /translation="MPTATIDCSSVPDILNNNSSAQDDNNNLIFTPYGLMLLEIQGEL
                     NLPIEFPQGQPKTDEDREYLNNFITINEIHHAVKFGNLVFDEKDNSKVTLYVGKSQRL
                     LGNVVKLSTPLAVLKIPLKNEDEMMIDNDDNANQQEEELIKLMDIVKAKVIFKQRPLP
                     IM"
     gene            complement(<191077..>193080)
                     /locus_tag="CD36_50730"
                     /db_xref="GeneID:8048349"
     mRNA            complement(<191077..>193080)
                     /locus_tag="CD36_50730"
                     /product="putative uncharacterized protein ydl057w
                     homologue, putative"
                     /transcript_id="XM_002420332.1"
                     /db_xref="GeneID:8048349"
     CDS             complement(191077..193080)
                     /locus_tag="CD36_50730"
                     /inference="similar to AA sequence:UniProt:Q07379"
                     /inference="similar to AA sequence:UniProt:Q59XA2"
                     /codon_start=1
                     /transl_table=12
                     /product="putative uncharacterized protein ydl057w
                     homologue, putative"
                     /protein_id="XP_002420377.1"
                     /db_xref="GeneID:8048349"
                     /db_xref="GOA:B9WH14"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR025163"
                     /db_xref="InterPro:IPR026893"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:B9WH14"
                     /translation="MTASKYHPPTPREVEVTLGKGVTGTLAIPLAFDSDNPFEEGLVP
                     VTHKAALILHGQGGHRNYCYQKTLAHRLANELGIFSLRIDFRGCGNSADNANELEGRT
                     LTQDVEDIQSSVEFICDGKLNGTGIDLTLSSIISHSRGGVAMFLWAQIQDKLGRAGDP
                     NAIIVPNLVNCSARFTSPTVLDRYAGLEGLDFVPVTTYRHGSYQQVNLSAREVISLSK
                     PDLSKLTELSRDWSVLSVYGTEDEIIPKYDSANFANALNRGPLSHTLKLIPDADHNFY
                     GHKEINADDDELNELNPYNLPLKNGKRVNYNYLVTDYIIDFLTPEMELQRFIATSRDI
                     GRVARWKNVDGVSNFRDVGGWRVHAPTFKLLDTKNNNNNNNNNNNKTNQDHLVYYVKP
                     HYAFRCANIAGLTETGLETLQILGIKAIFDLRSDGEVKNDGYPENLSKYGIKRIHAPV
                     FSNDDYSPQAIAVRYTNLMTCWSTYVNVYEDMLEFGINAYKTIFEYIRDINQPFVFHC
                     TAGKDRTGMLGMLILLLAGVDKNTIAKEYELTTVGLKPDHPVLKGKFEETVKKLREKL
                     GDDGSGGIEQIISQGRKNWSIEEDGFRNLVSSRYEAMLATIGLFHEKYGGIIPYLKDK
                     LGFSSQDILKIYQNIVVADPQNMGFETSAQINWDHRTTERAKF"
     gene            <193881..>194618
                     /locus_tag="CD36_50740"
                     /db_xref="GeneID:8048350"
     mRNA            <193881..>194618
                     /locus_tag="CD36_50740"
                     /product="vacuolar-sorting protein, putative"
                     /transcript_id="XM_002420333.1"
                     /db_xref="GeneID:8048350"
     CDS             193881..194618
                     /locus_tag="CD36_50740"
                     /inference="similar to AA sequence:UniProt:Q12483"
                     /inference="similar to AA sequence:UniProt:Q59N31"
                     /note="Similar to S. cerevisiae SNF8;
                     In S. cerevisiae: component of the ESCRT-II complex, which
                     is involved in ubiquitin-dependent sorting of proteins
                     into the endosome"
                     /codon_start=1
                     /transl_table=12
                     /product="vacuolar-sorting protein, putative"
                     /protein_id="XP_002420378.1"
                     /db_xref="GeneID:8048350"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:B9WH15"
                     /translation="MNHSTTDRDAYLQLGKSLNEQHSNQLSTQLQVFQSALINFANDH
                     GDEISSNLEFKNKFTQIVQSIGIDPLDLLLYTSQNNNNSTNKRSNVVTTNFGVALAVK
                     IIEICQQTRDLNGGLISLKELISTLQSSCETEGISLIISEEDIETSLNNLNSLGKGYE
                     ILIINGKKWLKFSSTENLSNDQLKIYELCEFMGGYVTYRLLRDNYGWDKVRCKTVIDE
                     MIMNGFLWVDSQDNGEWQYWEPSWISN"
     gene            complement(<194644..>195978)
                     /locus_tag="CD36_50750"
                     /db_xref="GeneID:8048351"
     mRNA            complement(<194644..>195978)
                     /locus_tag="CD36_50750"
                     /product="tRNA pseudouridine synthase, putative"
                     /transcript_id="XM_002420334.1"
                     /db_xref="GeneID:8048351"
     CDS             complement(194644..195978)
                     /locus_tag="CD36_50750"
                     /EC_number="5.4.99.-"
                     /inference="similar to AA sequence:UniProt:P31115"
                     /inference="similar to AA sequence:UniProt:Q59N30"
                     /note="Similar to S. cerevisiae PUS3;
                     In S. cerevisiae: introduces pseudouridines at position 38
                     or 39 in tRNA, important for maintenance of translation
                     efficiency and normal cell growth"
                     /codon_start=1
                     /transl_table=12
                     /product="tRNA pseudouridine synthase, putative"
                     /protein_id="XP_002420379.1"
                     /db_xref="GeneID:8048351"
                     /db_xref="GOA:B9WH16"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:B9WH16"
                     /translation="MLKGVFFLRQLMLKRSFSKVATSNRPITTNMSTDYSNWSKEDLI
                     AKINQLENNPLPISNGEDVSHLRIKPPKKQKKKEFDWSKQNMRFVAFKFAYLGWNYNG
                     LALQGEPTPLPTVEEMFLKALAKVKLIKEPIEEVKFSRCGRTDKGVSAMNQVISIDVR
                     SNLSLENQANPEFDDQEIDYISVLNANLPSDIKVHSICLRPPPEFDARFSCLSCHYRY
                     IFRKQDLNIDLMNQGANLYQGIHDFRNFCKLDGSKQITNFVREIYQAQILHLHQDYYC
                     FDLKGSAFLWHQVRCMVAILFSIGQELESPSIITDLMDMTKYPTKPQYEMAHDIPLVL
                     YDCEFPPMEWKSTNDEYRLHRVIQSFTRMQYDLQLKTQMSQIMENTLLFKNQDSATTK
                     ILKTMNNGDGVGRSYNKYMPISERERTESYEVLNLRWMEKKGYKREQEKLNK"
     gene            <196158..>198065
                     /locus_tag="CD36_50760"
                     /db_xref="GeneID:8048352"
     mRNA            <196158..>198065
                     /locus_tag="CD36_50760"
                     /product="ATP-dependent rRNA helicase, putative"
                     /transcript_id="XM_002420335.1"
                     /db_xref="GeneID:8048352"
     CDS             196158..198065
                     /locus_tag="CD36_50760"
                     /EC_number="3.6.1.-"
                     /inference="similar to AA sequence:UniProt:P25808"
                     /inference="similar to AA sequence:UniProt:Q59NP8"
                     /note="Similar to S. cerevisiae SPB4;
                     In S. cerevisiae: nucleolar protein required for synthesis
                     of 60S ribosomal subunits at a late step in the pathway;
                     ribosomal biogenesis protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP-dependent rRNA helicase, putative"
                     /protein_id="XP_002420380.1"
                     /db_xref="GeneID:8048352"
                     /db_xref="GOA:B9WH17"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WH17"
                     /translation="MKSNTESLAWENLRYDLHPWIKEAIASMGYPTMTPVQASTIPLL
                     SGNKDVVVEAVTGSGKTLSFVIPVLQKISDRLYKPDSDGDLPEPVKRGHMLSIVLSPT
                     RELANQIQTVFNQVLQYLPEDDNYNNKSRRIGTQLLVGSIGNVRDDLNQFLQNQPHIL
                     IGTPGRILEFLGSSQSIKTSSLEIVILDEADKLLDFSFEKDVINILKKLPKQRRTGLF
                     SATISSAGNTIFRTGMNNPVKVQVKSKNYLGEQSNSPKSLQLSYMLINPELKITNLLT
                     ILSKYQYKKAIVYFPTCTSVKHFYQIFNKIYQNHPPATDGEEPLKFFSLHGQLNTKSR
                     LKTLDNFTQGDINLYKHILMTTDVAARGIDIPDVDLVIQIDPPTDPNVFLHRCGRTGR
                     ANKVGRAIVMLNDNSQEEDYIEFMEVKGILLSKQDSIPAVKNFHSDFQKKLRKYMLED
                     RARHELAVKSYVGFIRYYSKHIASSIFRLATLDYLAIAKMYGLLRLPKMPETKYIDNT
                     LMPTDGWLGDVIDMDKYSYADKVQEQIRLENLEKDKLQKIQNAKRRKELKIKNEAWSS
                     KLERKENKLDRKEKLKRKREAIEKQIMEEALSGDDEGEEEVVEDWKDMVRKNKKKQKN
                     DSSIQGSFDDL"
     gene            complement(<198127..>199737)
                     /locus_tag="CD36_50770"
                     /db_xref="GeneID:8048353"
     mRNA            complement(<198127..>199737)
                     /locus_tag="CD36_50770"
                     /product="NEDD8-activating enzyme E1 regulatory subunit,
                     putative"
                     /transcript_id="XM_002420336.1"
                     /db_xref="GeneID:8048353"
     CDS             complement(198127..199737)
                     /locus_tag="CD36_50770"
                     /inference="similar to AA sequence:UniProt:Q12059"
                     /inference="similar to AA sequence:UniProt:Q59NP9"
                     /note="Similar to S. cerevisiae ULA1; ubiquitin-activating
                     enzyme E1-like protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="NEDD8-activating enzyme E1 regulatory subunit,
                     putative"
                     /protein_id="XP_002420381.1"
                     /db_xref="GeneID:8048353"
                     /db_xref="GOA:B9WH18"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B9WH18"
                     /translation="MSIDKSAKYDRQLRLWASTGQSNLENSHICLINATSTGSEILKN
                     LILPGIGQFTIIDERKVSKQDLSSNFFLKNQDLHENLAVAVQKNLNELNNDVNGHAIV
                     ESLSTILAQESNLFWDQFNAVIVSDYTPNLEPLINLLWSKQIPLFIVNTIGFYGSLNI
                     IANETTVIETHDPSKLYDLRIDHPWPELQEFADSFDLDKLNDIEHAHVPYIIIFIKAL
                     DHWRLEHDGQVPITYADKKKFRLYVQSLSRNFESETNFIDADTAHLRPHQKTEIPESI
                     NQLISISDSKDLDESTSIFWIFIAALKKFLIINDQLLPLPGTLPDMASDTENYITLQK
                     IYRDRALKDQKLFTEQVYQILDSLGRSRNEVTSESIASFCKNARLLFATVGSKDLIND
                     KLINQYNYNPIRDSHHHHRGGGGSGSNITILDDEEKHKLGIYLGILIFNLFIDKYRYK
                     PTIDDFEDFSNLYHNEFSPKIKLNKDGETIFKEILTHNTTNYHNLNSLMGGIVSQEVL
                     KSTTAQYIPLDNLFVFDGVHSKSEKFKI"
     gene            <201917..>205069
                     /gene="TEF3"
                     /locus_tag="CD36_50780"
                     /db_xref="GeneID:8048354"
     mRNA            <201917..>205069
                     /gene="TEF3"
                     /locus_tag="CD36_50780"
                     /product="translation elongation factor 3 (EF-3),
                     putative"
                     /transcript_id="XM_002420337.1"
                     /db_xref="GeneID:8048354"
     CDS             201917..205069
                     /gene="TEF3"
                     /locus_tag="CD36_50780"
                     /inference="similar to AA sequence:UniProt:P25997"
                     /inference="similar to AA sequence:UniProt:P53978"
                     /note="In S. cerevisiae: stimulates the binding of
                     aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing EF-1
                     alpha from the ribosomal complex"
                     /codon_start=1
                     /transl_table=12
                     /product="translation elongation factor 3 (EF-3),
                     putative"
                     /protein_id="XP_002420382.1"
                     /db_xref="GeneID:8048354"
                     /db_xref="GOA:B9WH19"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015688"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WH19"
                     /translation="MSAASESKYSTEVLSELLSKLQIADNKDEAASNISTFLNSSIVE
                     HDVPVEFFEDLKKQIQSKDAKVAVAALDAYKHIASTNGLSPSVEPYVVDLVGEVASKA
                     GDKNKDVQTAASGALLAIASAITPTAVKAILPKLIDNLTNTNKWTEKVAILKAISQLV
                     DTAKAQIALRMPELIPVLSESMWDTKKEVKEAATATMTKSTETIDNKDIEKFIPQLIS
                     CIAKPTEVPETVHLLGATTFVSEVTMATLSIMAPLLSRGLAERDTAIKRKAAVIVDNM
                     CKLVEDPQIVAPFMDKLLPGLKNNFANMADPEAREVTQRALNTLRRVGAVGENDSIPE
                     VSTAGDIDVTLNEFNKLVADKKIAKRFDAALNYIAAIAGDLVDEREIQPEAWLQNVLP
                     FATIFLHEKEAKEIIEEFRKRAIDNIPQPPSFEDEEDEGEDLCNCEFSLAYGAKILLN
                     KTQFRLKRNRRYGLCGPNGAGKSTLMRAIANGQVEGFPTQDECKTVYVEHDIDGTHAE
                     TTVVEFVIEDGEVGLTKDVVVNKLREFAFTDEMINMPIQSLSGGWKMKLALARAVLKN
                     ADILLLDEPTNHLDTVNVAWLVNYLNTCGITSIIVSHDSGFLDKVTQYIIHYEGFKLR
                     KYKGNLSEFVKKCPSAQSYYELGASDLEFRFPEPGFLEGVKTKQKAIVKVSNMSFQYP
                     GTSKPQIQDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTTGEVYVHENCRIAY
                     IKQHAFAHIDNHLDKTPSEYIQWRFQTGEDRETMDRASRQINEEDEQNMNKIFKVEGT
                     PRRIAGIHARRKFKNSYEYEISWMLGENVGMKNERWVPMMSVDNTWLPRGELMETHAK
                     LVAEVDMKEALASGQFRPLTRKEIEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAA
                     CTWQRPHLIVLDEPTNYLDRDSLGALSKALKAFEGGIVIITHSAEFTKDLTEEVWAVL
                     DGRMTPSGHNWVQGQGSGPRLEKKDDDEEDKFDAMGNKIAAAKKKKKLSSAELRKKKK
                     ERMKKKKELGDAYVSSDEEF"
     gene            <205385..>207689
                     /locus_tag="CD36_50790"
                     /db_xref="GeneID:8048055"
     mRNA            join(<205385..205580,205657..>207689)
                     /locus_tag="CD36_50790"
                     /product="meiosis-specific phospholipase, putative"
                     /transcript_id="XM_002420338.1"
                     /db_xref="GeneID:8048055"
     CDS             join(205385..205580,205657..207689)
                     /locus_tag="CD36_50790"
                     /EC_number="3.1.1.-"
                     /inference="similar to AA sequence:UniProt:P53541"
                     /inference="similar to AA sequence:UniProt:Q59NQ1"
                     /note="Similar to S. cerevisiae SPO1;
                     In S. cerevisiae: required for meiotic spindle pole body
                     duplication and separation; required for spore formation;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="meiosis-specific phospholipase, putative"
                     /protein_id="XP_002420383.1"
                     /db_xref="GeneID:8048055"
                     /db_xref="GOA:B9WH20"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:B9WH20"
                     /translation="MLFLLLILPFGFSFNPFKNKNMAQDRLLCKNCSSYFPNQPPWNL
                     SYAPFTVICPPGELIRDANNASLCQEESNYITHRNAKTEISLKSLFHRNKIPNFDIET
                     FWSIKTKPIQIAISISGGGYRSMLTGAGVVLALDNRYPNSLLCLNGLLQSTSYIAGIS
                     GGSWLVMSNFINDFEPIHKLKDLISEKWDLEESLLQGVPNFDTSELQKDQQQQQQQNL
                     ESKNKYKNKKQGMFSSILELFISVKSSSAGNTNGNSQPGFSGWIGSLFNSPQEQPLTK
                     PNQTQTQTTDGYRLIKKYLHFYKELLIEVRDKKKAGFHTSFTDYWGRALVRRIFKSTA
                     RTPGATISAATHVLTSFKEYDQPFPIIGTIEKDPSNPEFSTNLESHCFELTPFEFGSW
                     DSYLHAFIPIKYLGTSLKSNVPTKKSTTGNYSYCVSGFDNVGFITGTSSSIFNHVFFS
                     VYKLLESYESDAVSLIETTLKSLGLSSEWKTLKNPKLHADYALYSPNPFFQYGKNNTS
                     IWESPDLYLVDGGDDGQNIPFHPFLTAARNVDIILAYDMSNEKDNYPNGTVLARTSQR
                     YKQTNNTKIEIPYFRLPDGITTKSLIKSIFPKVPTPKQITTSGLNKHPIFLGCDIVED
                     YEALEFHDMVPRETQIRPQNYLPPLIVYHANNNYSYRSNTSTFQLSYNKTEVYGMINN
                     GYNLATYMNSTLFSVCLNCAIIKREFDRLSLRINPKWHDNKFSIPKICKMCYKTFCWR
                     DN"
     gene            <208102..>208791
                     /locus_tag="CD36_50800"
                     /db_xref="GeneID:8048355"
     mRNA            <208102..>208791
                     /locus_tag="CD36_50800"
                     /product="glutaredoxin-like protein precursor, putative"
                     /transcript_id="XM_002420339.1"
                     /db_xref="GeneID:8048355"
     CDS             208102..208791
                     /locus_tag="CD36_50800"
                     /inference="similar to AA sequence:UniProt:Q12438"
                     /inference="similar to AA sequence:UniProt:Q59NQ2"
                     /note="Similar to S. cerevisiae GRX6; thiol
                     oxidoreductase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="glutaredoxin-like protein precursor, putative"
                     /protein_id="XP_002420384.1"
                     /db_xref="GeneID:8048355"
                     /db_xref="GOA:B9WH21"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:B9WH21"
                     /translation="MTGVRQLRIIALTAFILGLIFTLHKVGSNAASLVHAQASDQQPN
                     KHNTKTSTYTATNEDLVANLIDSKNDAETDDKINQKISKDQDEAINGNKNSNKETTKV
                     KSDNGEYDPISDLIKIRSLSPMTIFSKSYCPFSKKIKQLLLEKYDITPAPNVVELDRY
                     EYGAELQSYLAEKSGRRTVPNVLVGKSFESRGGCDEFEKLHKDNDLIKLLVEWGSGRL
                     QVAKKNTPSNA"
     gene            complement(<209120..>209961)
                     /locus_tag="CD36_50810"
                     /db_xref="GeneID:8048356"
     mRNA            complement(join(<209120..209542,209917..>209961))
                     /locus_tag="CD36_50810"
                     /product="40S ribosomal protein S11"
                     /transcript_id="XM_002420340.1"
                     /db_xref="GeneID:8048356"
     CDS             complement(join(209120..209542,209917..209961))
                     /locus_tag="CD36_50810"
                     /inference="similar to AA sequence:UniProt:P26781"
                     /note="Similar to S. cerevisiae RPS11B;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S11"
                     /protein_id="XP_002420385.1"
                     /db_xref="GeneID:8048356"
                     /db_xref="GOA:B9WH22"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019979"
                     /db_xref="InterPro:IPR028333"
                     /db_xref="UniProtKB/TrEMBL:B9WH22"
                     /translation="MATELTVQSERAFQKQPHIFTNPKAKANKKTKRWYKDVGLGFKT
                     PKAAIDGSYIDKKCPFAGTVSIRGKILTGTVVSTKMHRTIIIRRDYLHYVPKYNRYEK
                     RHKNVAAHVSPAFRVEEGDVVTVGQCRPISKTVRFNVLKVAASASKSKKFSKF"
     gene            <210619..>212064
                     /locus_tag="CD36_50820"
                     /db_xref="GeneID:8048357"
     mRNA            <210619..>212064
                     /locus_tag="CD36_50820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420341.1"
                     /db_xref="GeneID:8048357"
     CDS             210619..212064
                     /locus_tag="CD36_50820"
                     /inference="similar to AA sequence:UniProt:Q59NQ4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420386.1"
                     /db_xref="GeneID:8048357"
                     /db_xref="InterPro:IPR024274"
                     /db_xref="UniProtKB/TrEMBL:B9WH23"
                     /translation="MNLSENYISASRNSSSSTATTSMSNKYSSLPKFNHSHSNQSRVA
                     SNNDISTSSIFPYNRTVSSSSSIMSTPSNNIRKFQRQRQQEKRNNEHLPPPSQHQRQT
                     GNSKNDPTRTSKNGRLIKNKLLNLQQSSKQQLINRISDKDPGHLHSNNSQSNTKKVTP
                     PVFGLQKVASSPYDFSVFTKVITNEKHHDQVLFPAIKQSQIKAWESAEKICRGIIFDN
                     DDEYDDEESTEDESEDKKNPIISIPGYTDGELKELFKYPNLSSQEEKKLLTEYKRKVL
                     SLQEQSLSNNNLISFRRQLQIDQKKEILSKLFNNQNKLNLDYITDNDNNNNNIDSYTN
                     RNQYNVVDNNLISMDLHSLINNDMEEVNYLLEEDGNFKILQEEVKQNAFHKKIVTDNQ
                     HHNDENGHGQFDYERFQNLTSKKLDKIYDVHAIRYTGTNVDDDEYKEPSFYSDDVSNL
                     ELEEELLQFTTGHLRQRIHESIDEDEITEKS"
     gene            <212509..>214056
                     /gene="GLR1"
                     /locus_tag="CD36_50830"
                     /db_xref="GeneID:8048085"
     mRNA            <212509..>214056
                     /gene="GLR1"
                     /locus_tag="CD36_50830"
                     /product="glutathione reductase, putative"
                     /transcript_id="XM_002420342.1"
                     /db_xref="GeneID:8048085"
     CDS             212509..214056
                     /gene="GLR1"
                     /locus_tag="CD36_50830"
                     /EC_number="1.8.1.7"
                     /inference="similar to AA sequence:UniProt:P41921"
                     /inference="similar to AA sequence:UniProt:Q5W322"
                     /codon_start=1
                     /transl_table=12
                     /product="glutathione reductase, putative"
                     /protein_id="XP_002420387.1"
                     /db_xref="GeneID:8048085"
                     /db_xref="GOA:B9WH24"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006322"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:B9WH24"
                     /translation="MFTKSIISKSTTRLTQLTRQLSTTMAPTLTKNSLKHFDYLVIGG
                     GSGGVASARRAAKYGAKVLLIETKFKKLGGTCVNVGCVPKKVMWYTADLAHKKHDLYA
                     YGLDKDQESIKYGDFDWAKLKHKRDAYVSRLNGIYENNLKREKVDFAYGFAKFINSDG
                     EVEVTLSGDQTLPFLDDGKTYKEGEKLVFSADKTLIATGGTAIVPPSVPGAELGTTSD
                     GFFALEKQPKKVAIVGAGYIGVELSGVFSSLGSETHFFIRGDTVLRNFDEVIQNTVTD
                     YYIDNLGINIHKQSTITKIEGSKDSKKVVHLKDGTSVEVDELIWTIGRKSLIDIGLDK
                     VGVKLNDKLQIVADEYQVTNNPKIYSLGDVVGKVELTPVAIAAGRRLSNRLFGGPEFA
                     KDKLDYNNIPSVIFSHPEAGSIGLSTKEAIEKYGEENLKIYQSKFTAMYYAMMDDQKD
                     KSPTVYKIICAGPEEKVVGLHIVGDSSAEILQGFGVAIKMGATKKDFDNCVAIHPTSA
                     EELVTMT"
     gene            complement(<214207..>214527)
                     /locus_tag="CD36_50840"
                     /db_xref="GeneID:8048038"
     mRNA            complement(<214207..>214527)
                     /locus_tag="CD36_50840"
                     /product="small nuclear ribonucleoprotein, putative"
                     /transcript_id="XM_002420343.1"
                     /db_xref="GeneID:8048038"
     CDS             complement(214207..214527)
                     /locus_tag="CD36_50840"
                     /inference="similar to AA sequence:UniProt:P43321"
                     /inference="similar to AA sequence:UniProt:Q59NQ6"
                     /note="Similar to S. cerevisiae SMD3; snRNP core protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="small nuclear ribonucleoprotein, putative"
                     /protein_id="XP_002420388.1"
                     /db_xref="GeneID:8048038"
                     /db_xref="GOA:B9WH25"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:B9WH25"
                     /translation="MSAGIPVRLLNEAQGHIISIELVNGDTYRGKLLENEDNMNLSLY
                     EATITQGKSGKVSHMDQVFIRGSMIRFISVPDILKNAPMFFMKPGDKPKPPIRGPPPK
                     RKRV"
     gene            <216370..>219642
                     /locus_tag="CD36_50850"
                     /db_xref="GeneID:8048086"
     mRNA            <216370..>219642
                     /locus_tag="CD36_50850"
                     /product="zinc finger transcription factor, putative"
                     /transcript_id="XM_002420344.1"
                     /db_xref="GeneID:8048086"
     CDS             216370..219642
                     /locus_tag="CD36_50850"
                     /inference="similar to AA sequence:UniProt:P12351"
                     /inference="similar to AA sequence:UniProt:Q59NQ7"
                     /note="Similar to S. cerevisiae HAP1"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc finger transcription factor, putative"
                     /protein_id="XP_002420389.1"
                     /db_xref="GeneID:8048086"
                     /db_xref="GOA:B9WH26"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:B9WH26"
                     /translation="MGPIAVKMENSNSFSKQINSPNKVQKPKRQRNRVPVSCLACKKR
                     KVKCDKGKPACGGCVRNGVGHLCQYINPPWIDKDVSGEGSSPSSSCHSLSSPVKIETT
                     SEYKQLKAQNEKTISNQKKEIENLKRQLQVLQQLSPRNSQSPNGEGQDESALYLAKEI
                     TILSKLSPFAVFPRVPMEILSEYTVLNSRVLSFPVCLDIYSWVNTIKLDPQLTTLWFK
                     ITNLQKMYHMYKINKLKNDSTAKKLASVPLKKTPSKINEIDFTCSFSSSDSQTVEHQA
                     VPLATSTSNSHKCPVIECDFNFMGDEAQSQTPSPKKNLTSSTFTPIAQNQDDSEKLQC
                     PMIKSDIHNKSKSLQQKLQNLWESILNLTRGSTLNYRQLVFLLDFYFKSEIFESKTLL
                     LFYKTDILNVIQKGLDGELILNLPKGLDEDIYYQLKISGIYVSMIAIIVEETLTYLRN
                     VLKCEVVDEITQNFNIVFPQEYTYLGLGAKQTNILYIIEDFLTCDDENINLVSFVALY
                     ITVLNKIIYEYKKPGGLIVDPKTLFTKLFSKFIENILSSNTDMEIWKDPELIEFQSYQ
                     RKRAKHLKLHFSLLWTEVIRICNLVSFSFVPIIKQSSELDHLMQKMYAKIAIIDSLQC
                     HLKYLTSVGESNLIIALHVHYLIASITSSFHYGILNIGIPKLTVSKLDSLIKQCSTWL
                     QDSGLEGIIEIKRMEVVYMLSYLRLFMIYILLLQGEELNDEGLLEMFVFPGIVSRLSQ
                     FVEILKNGNHQSQYIYSALIELFTRSIQIAIGLLLRVKNQSGFLKSHQSLLEDQINKI
                     TKDVSSTLKFLQTVIVNNKEKLIKLSKLWKFYLTFVNNSNSKQVNYAALHKGVPEFSQ
                     PKSCPVIHDSDAKSTAMTSSSSSSVSIKSEGAKCPISHITTSMNENEESTRLQEVGSN
                     VILPPIVSYGNSLVENGVSSNGSGSGVSNQKRRKCPFDHTAMMKRKSIYNNPIESNMR
                     EYRSYTPSPLGSSIPITTPMMRQHQQDNDEEMLKPVPSYTPPSNQQIDSAASATSSPS
                     LFAFDDLDVFKEFNDFDLDFLHNEHLLNHIENNNTINVKNNVNSNTDSNESKNIENHF
                     QG"
     gene            <220059..>221852
                     /locus_tag="CD36_50860"
                     /db_xref="GeneID:8048087"
     mRNA            <220059..>221852
                     /locus_tag="CD36_50860"
                     /product="ABC1 family protein, putative"
                     /transcript_id="XM_002420345.1"
                     /db_xref="GeneID:8048087"
     CDS             220059..221852
                     /locus_tag="CD36_50860"
                     /inference="similar to AA sequence:UniProt:Q06567"
                     /inference="similar to AA sequence:UniProt:Q59NQ8"
                     /note="mitochondrial chaperonin, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ABC1 family protein, putative"
                     /protein_id="XP_002420390.1"
                     /db_xref="GeneID:8048087"
                     /db_xref="GOA:B9WH27"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:B9WH27"
                     /translation="MFRLGPSSGMLRRQINHIPNRSFSIFKNVKSSLGSRIPIIYYKS
                     NKLYSISTVSTINSSSKKTKSSSSSSRYGKFFKFGLAIGLGTTILYYTNDSFKHTVLT
                     IDRVNTVTVAMIRCFALYKETLGASYDNDSDRHKALSKTHKKAAEITLKALEKNGGIY
                     IKLGQHITALTYLLPPEWTNTMLPLQDKCPQSSLEEIEKLFENDLGKKMSDIFIDFNP
                     TPVGVASLAQVHIATLKNGEKVAVKIQHPSLKEFVPLDVALTKMVFDLMYKVFPEYPL
                     TWLGDEMQNSIYVELDFTKEAENARETAEYFKDYQRETALRIPKIVEAQSRILMMEYV
                     SGERLDNLKYMEQNNIDPSEVSSCLSHIFNNMIFTPDVSLHCDPHGGNLAIRSVSKSE
                     HNKSGHNFEIILYDHGLYRKIPLQMKRDYSHFWLAVLDNDVPNMKKYAMKIANFGEDD
                     QKFRIFMSAITGRAPDKALNYDISSRRSNEEIQKIQGQINNDNGVLEDLMDILSNMPR
                     MVLLILKTNDLTRNLDENLESSLGPERTFLIMANYCAKCVYDESKEEINQKYRGWSWL
                     THSISNWWHYQKRLSTLYLYDFVLMIRKLTF"
     gene            complement(<221949..>222377)
                     /locus_tag="CD36_50870"
                     /db_xref="GeneID:8048088"
     mRNA            complement(<221949..>222377)
                     /locus_tag="CD36_50870"
                     /product="rRNA processing protein, putative"
                     /transcript_id="XM_002420346.1"
                     /db_xref="GeneID:8048088"
     CDS             complement(221949..222377)
                     /locus_tag="CD36_50870"
                     /inference="similar to AA sequence:UniProt:Q12247"
                     /inference="similar to AA sequence:UniProt:Q59NQ9"
                     /note="Similar to S. cerevisiae FYV7;
                     possibly fungal-specific;
                     In S. cerevisiae: required for survival upon exposure to
                     K1 killer toxin; involved in processing the 35S rRNA
                     primary transcript to generate the 20S and 27SA2 pre-rRNA
                     transcripts"
                     /codon_start=1
                     /transl_table=12
                     /product="rRNA processing protein, putative"
                     /protein_id="XP_002420391.1"
                     /db_xref="GeneID:8048088"
                     /db_xref="GOA:B9WH28"
                     /db_xref="InterPro:IPR009149"
                     /db_xref="InterPro:IPR013730"
                     /db_xref="UniProtKB/TrEMBL:B9WH28"
                     /translation="MPPNTNNSFKSKKKFIDRREAKSQDIKRALTHRARLRKNYFKLL
                     EKEGLQEEKKVEDDKDIKPIKKKGINFEERAAIVKQRKDEKRKFQLARVQEKLEKIES
                     NSKERALKREQLKKSTTKGQPLMGPRINNLLDKIKKNEMS"
     gene            <223045..>224556
                     /locus_tag="CD36_50880"
                     /db_xref="GeneID:8048089"
     mRNA            <223045..>224556
                     /locus_tag="CD36_50880"
                     /product="vacuolar amino acid transporter, putative"
                     /transcript_id="XM_002420347.1"
                     /db_xref="GeneID:8048089"
     CDS             223045..224556
                     /locus_tag="CD36_50880"
                     /inference="similar to AA sequence:UniProt:P39981"
                     /inference="similar to AA sequence:UniProt:Q59NR2"
                     /note="Similar to S. cerevisiae AVT2;
                     In S. cerevisiae: member of a family of seven genes
                     (AVT1-7) related to vesicular GABA-glycine transporters"
                     /codon_start=1
                     /transl_table=12
                     /product="vacuolar amino acid transporter, putative"
                     /protein_id="XP_002420392.1"
                     /db_xref="GeneID:8048089"
                     /db_xref="GOA:B9WH29"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:B9WH29"
                     /translation="MSVPKTKTASNGYTSVPQGESQTDNLANTESLTNNNQERSIDEY
                     ELQTLNSLDYEVENGFEEQLREEEQTGSSTMKMAFMNMANSILGAGIIGQPYAFRNSG
                     LIGGILIMILLTVLIDWTLRLIIKNSILSQTKSYQDTVNYCFGVWGKIVLLASICSFA
                     YGGCMAFCVIIGDTIPHVLKAFIPESITRSDGPLGWLFARNTIIVLFTTCISYPLSLN
                     RDISKLAKASGFALVGMFIIVVLTIFRAPFVPPNIKGELTVKEWTVNANIFQGISVIS
                     FALVCHHNTMFIYQSMKNPSLAKFSKLTHISCLVSMIFCMIMAINGLINFGDITKGNI
                     LNNFKSNDNWINIARFCFGLNMLTTFPLEIFVVRDVLKEIILAKKASIDGSTADLELS
                     SKQHFFITSFLVFSSMSVSLFTCNLGMILELVGATSASLMSYIIPPLCYLKLSWNQVE
                     YKSAMPKEKKKFIIFKAIPSIACVLFGFAVMFISSFMTIKNTSSDGGDHCVID"
     gene            complement(<224633..>228424)
                     /locus_tag="CD36_50890"
                     /db_xref="GeneID:8048090"
     mRNA            complement(<224633..>228424)
                     /locus_tag="CD36_50890"
                     /product="replication-pausing checkpoint complex subunit,
                     putative"
                     /transcript_id="XM_002420348.1"
                     /db_xref="GeneID:8048090"
     CDS             complement(224633..228424)
                     /locus_tag="CD36_50890"
                     /inference="similar to AA sequence:UniProt:P53840"
                     /inference="similar to AA sequence:UniProt:Q59NW5"
                     /note="Similar to S. cerevisiae TOF1;
                     In S. cerevisiae: subunit of a replication-pausing
                     checkpoint complex that acts at the stalled replication
                     fork to promote sister chromatid cohesion after DNA
                     damage, facilitating gap repair of damaged DNA;
                     topoisomerase 1-associated factor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="replication-pausing checkpoint complex subunit,
                     putative"
                     /protein_id="XP_002420393.1"
                     /db_xref="GeneID:8048090"
                     /db_xref="GOA:B9WH30"
                     /db_xref="InterPro:IPR006906"
                     /db_xref="UniProtKB/TrEMBL:B9WH30"
                     /translation="MSDFESGSDIDNYYEADEFDDFIEYSDNELEQENSKPATGQSEV
                     EEIEEPEEDRIRTLTTTLKPNETQAQKLLKAHISVLVSALGGPDHTSDIQPPPYKLGH
                     DALACLKDIKRWIRAVDEKKNNYEVALACAESGLVSNDLIVILCQWDDKMQKKETIKN
                     KTTTEKTMLACLELLVLLTWPVEFGKDLSESQKLLYSEIKKVHVSYKKQILMFNNGQL
                     LKAAIRLVLPTIAKSRIDREPRDNQILKLVLFLIRNLLAIEPANMSISNKSRKGANVT
                     ASDLPLGVTQDDISINNVLSVFKKNKVLMLLLTISGSIGSEFDRDMFGEICLESIYLI
                     IKGLSASDVLVKKNLDSAPVGAPSSTQNRVPDAINASQPLQSVTTTVGMQLQDLLATE
                     SKKKKIQTQNIASRHGRFGSLLSIRSADSNSFVVSGQEALINTDSSLAKLDKSKKWKD
                     RTYFKYDSDEYVNTTTPVYLNLTGQDILYNFVEQFLSGGCFNNLIECMGSRLTSQTDL
                     NMVDELTLASYFFTIAWFLSYQRERIGLNPQDRELNYGSVGAALSEVNFILIIGYFRD
                     SFSLKKWNSLHVAMICFKELLQISNSVFGKEITHQTGEDNGEISQHEIDRELAEGIIR
                     KLFSFNDFLSIIVQIPQTAAKHSPNYLRVSVSVVHILLKAFETFANEDVHLYIQSKRK
                     QSKRNRKRVNNLDKSTEDRLRDVIYASDEELDQSSAKEITQERKLDFKKTEARFFHQT
                     IVSTYINYLSRYEDLSSQEIKTCLSYFHRLFVVRKDFTGLYRLDFMQLLQKLRNHLQR
                     GSSLRLQVEEFIYYYMKKFKTAFERFPMPIEVLFPRFEDNECKVYLATGEVYEKQETT
                     STSRSPRLAKDLEFVRDFGLDDQIKILVSQLHVQEKQSLLKWLIQEMERIINDRILNA
                     DSIAELNASDQYRRLFINNGYLRFLLRIIGFDLPYTVEEVPELATTVDMEHLTKVTEL
                     IKKWDSSQPVIFEDDKVPSYFVRTREAGYDDDQYNENDQEYDFDDDSIAFETEANPNS
                     NRNHVSELDHLEELERQLSSNGSRVNSKEHHGIKGKARKKSKEKKLSTPKNVRGLKRR
                     RIPKDLLEDDSQHVIKSAEFVHDSDDESDDEKDKAFFEREERMRSLLNDMGGIATSEQ
                     LKEIQEVWKNLETGGTNKVASTVAKAVKEVGLFVEESDDDDNAEEINSVPINEETNRA
                     IFEPAETDTQQDLSEDTSNTSEMESDTETAKRSFVEDGEEIPHVQSKKKRLVISDDEE
                     E"
     gene            complement(<228629..>230125)
                     /locus_tag="CD36_50900"
                     /db_xref="GeneID:8048091"
     mRNA            complement(<228629..>230125)
                     /locus_tag="CD36_50900"
                     /product="carboxypeptidase Y precursor, putative"
                     /transcript_id="XM_002420349.1"
                     /db_xref="GeneID:8048091"
     CDS             complement(228629..230125)
                     /locus_tag="CD36_50900"
                     /EC_number="3.4.16.5"
                     /inference="similar to AA sequence:UniProt:P00729"
                     /inference="similar to AA sequence:UniProt:Q59NW6"
                     /note="Similar to S. cerevisiae PRC1"
                     /codon_start=1
                     /transl_table=12
                     /product="carboxypeptidase Y precursor, putative"
                     /protein_id="XP_002420394.1"
                     /db_xref="GeneID:8048091"
                     /db_xref="GOA:B9WH31"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WH31"
                     /translation="MKALLLLYTVITVVLALPSQTPFSLSPLQQLKDELAGKLSQKQI
                     LDMEKIWVDYERQYGFDTLLKKFNKFKSRFQYGITSQDKSESVYSISVSKSTPKLLGF
                     DIVKQYTGYFNVNDKDENYFFWFFESRNDPKNDPLIIWLNGGPGCSSLCGLALELGPS
                     IINATLQPEYNPHAWNSNASVLFLDQPANVGFSYGGNIPITSDQASKDFVEFLKLFYE
                     RFPEYVALDLHISGESYAGHYVPSFANAVHKAGIPLNSILIGNGVTDPVVQLGEVSNM
                     GCGQGGIGKIYTDEECTEYPEKYEKFVPYGELCYRNPNVLTCFIAALAAPKTPDMGDL
                     NPYDSRVKCGNNSLCYDQIDYLNDYFNLQSVQEALGVEKSYTMCSSNVGSRFVSDFMR
                     PYHTYVADLLDDGIPVLIYVGDKDLVCDWLGNLAWVNKLNYTGHDQFEKAEFKPWYTV
                     DGKLAGEVKNHDHFTYLRIYESGHMVPMDQPENSLDMVNRWVRGDFGL"
     gene            <230598..>231815
                     /locus_tag="CD36_50910"
                     /db_xref="GeneID:8048092"
     mRNA            <230598..>231815
                     /locus_tag="CD36_50910"
                     /product="palmitoyltransferase, putative"
                     /transcript_id="XM_002420350.1"
                     /db_xref="GeneID:8048092"
     CDS             230598..231815
                     /locus_tag="CD36_50910"
                     /EC_number="2.3.1.-"
                     /inference="similar to AA sequence:UniProt:Q03289"
                     /inference="similar to AA sequence:UniProt:Q59NR8"
                     /note="Similar to S. cerevisiae PFA5; protein fatty
                     acyltransferase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="palmitoyltransferase, putative"
                     /protein_id="XP_002420395.1"
                     /db_xref="GeneID:8048092"
                     /db_xref="GOA:B9WH32"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:B9WH32"
                     /translation="MIWSKAYLTKNYIKLLVPIGVILVLAYLNYAINYAVGYKLVYLH
                     HSHAAAIVLWVLLGFFQLELFVYWGLIFVVGPGKSPVFPPIDLYSENNPNLIPLPDLF
                     FCDEKGFPYYCSNSNSIKLERSFFSKDVGYNVVKFDHYCIWIGQPIGQDNYLFFMKFT
                     MSFLSFFIIVLVYSARFTRDSIEQGEIDHNLIVLYIMSGFWIIMIGCLFGIHLRYVSI
                     NMTTLDEITINQRKRYNRWKDAKKNPNMPTWMKPKNTPRKETGRRYVNVKHKNGRAIV
                     KYHIEERPFDMGFRRNWINLVFNGNRNHGRDDEFYTLWRLISALVVFIIPFVDVPFCY
                     RTKLQVKNDVEQKLNEQENLLAKYTMYSSVVNDKFINMIDQKLKENNFCALGYLVEAT
                     PQNNQSIIDKDSI"
     gene            <231985..>233379
                     /locus_tag="CD36_50920"
                     /db_xref="GeneID:8048093"
     mRNA            <231985..>233379
                     /locus_tag="CD36_50920"
                     /product="RNA polymerase II-associated protein, putative"
                     /transcript_id="XM_002420351.1"
                     /db_xref="GeneID:8048093"
     CDS             231985..233379
                     /locus_tag="CD36_50920"
                     /inference="similar to AA sequence:UniProt:Q04418"
                     /inference="similar to AA sequence:UniProt:Q59NR9"
                     /note="Similar to S. cerevisiae RBA50"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase II-associated protein, putative"
                     /protein_id="XP_002420396.1"
                     /db_xref="GeneID:8048093"
                     /db_xref="InterPro:IPR013929"
                     /db_xref="InterPro:IPR013930"
                     /db_xref="UniProtKB/TrEMBL:B9WH33"
                     /translation="MMDFIGEIIEHETETPKEPTPKPTLGGFPELKKLKEKKVSRWKQ
                     KQQQEQQQKTASHKPTETRSEASKIHQENIEKMAQMSEEEILQEREELLKGLDPKLIE
                     SLIGRSKKREGTGHGHNGHTHEHAEGYHGWIGSMKTSEGLTDLSQLDKEDVDRALGIS
                     SLSLNESDGNNNSTKKVTFDDNIKTVKFEDLDEGIELDPNGWEDVTDVNELVPNSDHI
                     APDDYQINPDSDDEGLNNTVHFTKPKQPELDINDPDFFDKLHEKYYPDLPKETDKLSW
                     MTQPMPKQVSTVYESISDMRFDFKGDLIELSAEGEESKGSSSDIPTYMGLHHHSENPH
                     MAGYTLGELAHLARSTLAGQRCLSIQTLGRILHKLGLHKYSILPTTDSGDPSFTDEIK
                     QLSNSFEDMMWDLIDQLRIIETITEAADEKKTRNLSVRNYAIEALWLYRTGGGRPETT
                     KQTEEDLIAQAVQK"
     gene            complement(<234208..>234526)
                     /locus_tag="CD36_50930"
                     /db_xref="GeneID:8048094"
     mRNA            complement(join(<234208..234416,234484..>234526))
                     /locus_tag="CD36_50930"
                     /product="protein Sna2 homologue, putative"
                     /transcript_id="XM_002420352.1"
                     /db_xref="GeneID:8048094"
     CDS             complement(join(234208..234416,234484..234526))
                     /locus_tag="CD36_50930"
                     /inference="similar to AA sequence:UniProt:P56508"
                     /inference="similar to AA sequence:UniProt:Q59NS0"
                     /note="Similar to S. cerevisiae SNA2;
                     spliced gene; uncharacterized transmembrane protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="protein Sna2 homologue, putative"
                     /protein_id="XP_002420397.1"
                     /db_xref="GeneID:8048094"
                     /db_xref="GOA:B9WH34"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:B9WH34"
                     /translation="MDGHDWFLVFVGFFLPPVPVLIKRGFFSADFWINILLCLLGFLP
                     GLLHSYYIISIYPYRATYAALGGDGHNNRTDDYGATTST"
     gene            <234921..>237506
                     /locus_tag="CD36_50940"
                     /db_xref="GeneID:8048095"
     mRNA            <234921..>237506
                     /locus_tag="CD36_50940"
                     /product="uncharacterized endoplasmic reticulum membrane
                     protein precursor, putative"
                     /transcript_id="XM_002420353.1"
                     /db_xref="GeneID:8048095"
     CDS             234921..237506
                     /locus_tag="CD36_50940"
                     /inference="similar to AA sequence:UniProt:P25574"
                     /inference="similar to AA sequence:UniProt:Q59NS2"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized endoplasmic reticulum membrane
                     protein precursor, putative"
                     /protein_id="XP_002420398.1"
                     /db_xref="GeneID:8048095"
                     /db_xref="GOA:B9WH35"
                     /db_xref="InterPro:IPR011678"
                     /db_xref="InterPro:IPR026895"
                     /db_xref="UniProtKB/TrEMBL:B9WH35"
                     /translation="MLSILWLLVSFFLCFSNAVLIDDAFGSRESINYLYGGSLNNIRL
                     LKNNILVATNSHDQVLGIDVLNHDLIKWKIEINELEKSNVISTDTHIYVYGSCQDIYQ
                     IDNLGNLEIIELASIPKKLEDAKYGLLIIDSDNSLKYYNGEFHTIGDNASSIRVDQNK
                     GYMYLLVNDKNLIKLSKTGQVVFTTEVEVGSIKEFKKGIILTGNDQIFKFDERDKTFK
                     RIENDSFKNLVIVDNDLLYAKLNDVVQLIHITKNQKTELLEVIKLKPEAKVELLTTPL
                     NAFLVVSNKNLKQVHDLTDLIDTKDAKSIRQFTFKSTLDFPHEFVSINKDQLNILLIN
                     ENLVGEVYSLFDGSKVESIQPQIHQYSSKASKYIIIDEPESESIKHELESILHEGDGV
                     YVLTNWIRRVTRHLSELGKFVSSFNFKNLFASNESIGFVKLIVFYDEEYKKFVAVKSN
                     NFAIAWELPIQDDFITLRQIRNGNIIGIFKSTILEINTADGSIVNETANDSGFFDVFN
                     VEDVLGFENKYGFQLSAAVDTNTFFKKVINDNEVAGFVIPVGSLDSKKTWSFKLDEQI
                     ISCQNIPADSTTSSLGIPLADKSVLYKYLNPNIISLLTFGKSLKFHLIDGITGNLLYS
                     YTHDPSEIVDLQSINLVMDDNWIIYSYFISEPRLEQRINVIDLFDDQFSSNTSTVASL
                     KTIDKISTKSFIYPERIVQLQSTRSLYGITLKSIVALTESGSLIEIPKFILNSRRPEH
                     EVKAADYGNDFNMVPYDPIVAKTTFQVLNHKYQLNSGSDAGGKGSILVKPTLFESTSV
                     ICYFNNENQFCSVIQPSSSFDLLNKGFDKIKLLITIVVLFAGFIISKPFVFNKKLNAQ
                     WIDRK"
     gene            complement(<237540..>239546)
                     /locus_tag="CD36_50950"
                     /db_xref="GeneID:8048096"
     mRNA            complement(<237540..>239546)
                     /locus_tag="CD36_50950"
                     /product="zinc cluster transcription factor, putative"
                     /transcript_id="XM_002420354.1"
                     /db_xref="GeneID:8048096"
     CDS             complement(237540..239546)
                     /locus_tag="CD36_50950"
                     /inference="similar to AA sequence:UniProt:P34228"
                     /inference="similar to AA sequence:UniProt:Q5A1R9"
                     /note="Similar to S. cerevisiae SEF1"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc cluster transcription factor, putative"
                     /protein_id="XP_002420399.1"
                     /db_xref="GeneID:8048096"
                     /db_xref="GOA:B9WH36"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:B9WH36"
                     /translation="MIMATIPVKNRLKLIIPQPPKGGRILKTCTRCRRHKTKCDAQVT
                     NPYPCSHCFKRNLDCTLETISKTGGKITSLDVIEKLSIQVTDLKEVLDNIINRRNQMV
                     ELLIQRGKQLESFEDIDSTTTLIQEPEPSKIESPKVYTPPVAEIQSCISTPTLSPEVF
                     PCKTDFESPASSSKFIISCNKQFKAITLTHKQALKHFTNYENNFNHYLPIFPHEFFTS
                     LDLVAFHKENELLFWCIMLTSLLNQKESYHEYQCLAEHIKYLVVKKCWLNTPRSVYVI
                     SSLLILTTWPLPNYKNNIEDNISVKFISTMKSLSYQFGLHKLEFINEFSHKTKMNLSQ
                     EINSNNLIRERIYKFVNIVSNYWLINLGISNNNYNGFTQDYIINKASNIDIYKMDQFD
                     EPDQYINCMLKISMIQSKLNENMNNLIGDSNESILLLPNQANTSKLINFNMFEIIIND
                     LNKLKLENIDSIHKDLIDISIYYSKLQLFIYSMSHSEISFTEYQIYLSKLLKVCFQII
                     ELINSIPNFNLQQMPIFYKFPIELTILTLLRIFKSPMLNTIEDYKIIKYNGFDKLFKL
                     LFNDDNWKFINIKIWKIIEKFNQLDNVFILENQGDSFFLIDKMKNYLVGSLNYELIWL
                     IYKNQKNPTQTSHQGKDINLSFYNPHVIDYLKSNESIYISKIAI"
     gene            <241171..>241797
                     /locus_tag="CD36_50960"
                     /db_xref="GeneID:8048097"
     mRNA            <241171..>241797
                     /locus_tag="CD36_50960"
                     /product="RNase MRP complex component, putative"
                     /transcript_id="XM_002420355.1"
                     /db_xref="GeneID:8048097"
     CDS             241171..241797
                     /locus_tag="CD36_50960"
                     /inference="similar to AA sequence:UniProt:P40993"
                     /inference="similar to AA sequence:UniProt:Q5A1R8"
                     /note="Similar to S. cerevisiae SNM1;
                     In S. cerevisiae: subunit of RNase MRP, which cleaves
                     pre-rRNA and has a role in cell cycle-regulated
                     degradation of daughter cell-specific mRNAs; cell
                     cycle-regulated RNase, putative; pre-rRNA processing
                     complex subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RNase MRP complex component, putative"
                     /protein_id="XP_002420400.1"
                     /db_xref="GeneID:8048097"
                     /db_xref="InterPro:IPR007175"
                     /db_xref="UniProtKB/TrEMBL:B9WH37"
                     /translation="MQQAKNSLEKSLPDISSTITSSQPPMQDQSELKATKVSVPKKPL
                     NQSESKLIHLFNLAHSKIDSPFSKLYSLLYHKQEEQQTQTLPDPILKKFCLNCGGLLI
                     PGLTVSIRVVYTKQKIRKLRTRCLACRYSIFDDGLIQKQEKVEPVVKPVVVQSTKEDN
                     NHNITNLKSKERRKKRKMNNLSNLLQDKKKKKTEESKLNSLNLMEFLK"
     gene            complement(<242019..>244151)
                     /locus_tag="CD36_50970"
                     /db_xref="GeneID:8048098"
     mRNA            complement(<242019..>244151)
                     /locus_tag="CD36_50970"
                     /product="ferric reductase and cupric reductase, putative"
                     /transcript_id="XM_002420356.1"
                     /db_xref="GeneID:8048098"
     CDS             complement(242019..244151)
                     /locus_tag="CD36_50970"
                     /inference="similar to AA sequence:UniProt:P36033"
                     /inference="similar to AA sequence:UniProt:Q5A1R6"
                     /note="Similar to S. cerevisiae FRE2; ferric reductase
                     transmembrane component precursor, putative;
                     ferric-chelate reductase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ferric reductase and cupric reductase, putative"
                     /protein_id="XP_002420401.1"
                     /db_xref="GeneID:8048098"
                     /db_xref="GOA:B9WH38"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:B9WH38"
                     /translation="MKFIIAYLLVGFLFATTTNAAKPRKYERYGQLKPFYACNYQIGQ
                     SVSFCQSPKNTTCLCSNENALATFAGCFAFDNRNITQVVDYLVEYCEERGNVTVDKDW
                     YEKSYQNFVKNGKTAEEIPNFNKTIPINVPFKLDDTQMQFYQEGYNHFMGNYDDSLYY
                     GVGALGYWLLVMLFGAIFHWSKFLFPNLTKKLTFKPVNLWREYVSMPATFRKKKAEEF
                     RFLKIFDSLIPSRFESIVIFFYYVYTIVTHAVNMEALDNDPVFYTKYKAQIRYCADRT
                     GITATIVMPLVFLYAGRNNFLQWLTGWQYQTFVAYHRHTARVMFFLIVIHAVLFTIAL
                     ADYYSTDVKETYLIWGIIATVAGGIILVQAMLFFRRRWYEIFLFIHIVLAALWVAGAW
                     IHVEELGYIWFVYPTVAVWCFDRAVRIGRLIVFGFPKAQVTLMANETLKVVIPKPRHW
                     KSVPGGHAFIHFIRPTCFWQNHPFTFVEAPDGKNILVYCKVKGGITHSLYRYLSNNPG
                     RTASIRVGVEGPYGEPTPARYADTAVFVAGGNGIPGIYSEVTDMASRMPKETKTTIKL
                     YWIIREYKSLEWFHDELIELENTNIETTIYITKPELCCSSTDDGSDDAGSKKEYVAHE
                     KNAEGDESSQGPESIRSRLSHVTFKEGRPCIQDLVETNLHESNGSVAFVSCGHPAMVD
                     ELRYFCSKNVDNPEKKRVDFYEQVQVWT"
     gene            complement(<247103..>249235)
                     /locus_tag="CD36_50980"
                     /db_xref="GeneID:8048099"
     mRNA            complement(<247103..>249235)
                     /locus_tag="CD36_50980"
                     /product="ferric reductase and cupric reductase, putative"
                     /transcript_id="XM_002420357.1"
                     /db_xref="GeneID:8048099"
     CDS             complement(247103..249235)
                     /locus_tag="CD36_50980"
                     /EC_number="1.16.1.7"
                     /inference="similar to AA sequence:UniProt:P53746"
                     /inference="similar to AA sequence:UniProt:Q5A1R3"
                     /note="Similar to S. cerevisiae FRE4; ferric reductase
                     transmembrane component precursor, putative;
                     ferric-chelate reductase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ferric reductase and cupric reductase, putative"
                     /protein_id="XP_002420402.1"
                     /db_xref="GeneID:8048099"
                     /db_xref="GOA:B9WH39"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:B9WH39"
                     /translation="MNLVITYFFSWIVFGTNVQAAKGAKFQFYGDITNYYACNYQISQ
                     TVSFCESPTNVTCLCSNKNALATYAGCFAFDNRNKTKALNFLIEYCEEYGNVTVEKDW
                     YEKSYQYYLAKAKTEEEIPNFNATIPIDVPFKLDEAETKLYEKAYKQFLGNYDDSLYY
                     GAAALGYWLLIMCIGAIVNWGKVIFPGLTKKLTSKPINIWRQYVSMPATFQKRKAEAA
                     PIFKFFDSLIPSRLESIVIFLFYILILIIHAINMHYVDGDPVFNNDKYQSQVRNVADR
                     TGITGTIMMPLVFLFASRNNFLQWLTGWNYSTFVTYHRHIARVMFILIALHSILFTIL
                     LRTDMSEFAETYMIWGVLATVTGGIILFQAMLFFRRRWYEIFLLIHILFAALYVAGTW
                     IHVDELGYVWFVYPSVAVWCVDRVVRIARLVVFGFPKAQVTLLADETIKVEIPKPSYW
                     KTIPGGHAFIHFLKPTYFWQSHPFTFVESPTDTHIILYCKVKGGITHSLYQLLGRSPG
                     QTTSMRVGVEGPYGESTAARYADTAVFIAGGNGIPGIYSEVMDMARRMPSETKKAMKL
                     YWIIRDYKSLEWFNDELAVLQRTNIETTIYVTKPDLFSVSTEDGSDDTSSKKESDSQD
                     MNVESKEPLQGVDVVKSRFSHITFKEGRPSIENIVDSEIKESNGSIAFVACGHPAMVD
                     ETRYFCSRNVDNPQKKRVDFYEQVQVWT"
     gene            complement(<251228..>253093)
                     /locus_tag="CD36_50990"
                     /db_xref="GeneID:8048100"
     mRNA            complement(<251228..>253093)
                     /locus_tag="CD36_50990"
                     /product="peroxisomal integral membrane protein, putative"
                     /transcript_id="XM_002420358.1"
                     /db_xref="GeneID:8048100"
     CDS             complement(251228..253093)
                     /locus_tag="CD36_50990"
                     /inference="similar to AA sequence:UniProt:Q03370"
                     /inference="similar to AA sequence:UniProt:Q5A1R2"
                     /note="Similar to S. cerevisiae PEX29"
                     /codon_start=1
                     /transl_table=12
                     /product="peroxisomal integral membrane protein, putative"
                     /protein_id="XP_002420403.1"
                     /db_xref="GeneID:8048100"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:B9WH40"
                     /translation="MEQVSSILGNILSVEEGTTQPHSQSKTSSNRSSIDESSETLSKK
                     PQRRSKDFDFSSFWKTSDKEQHDINTANSEGGGEGDSRIVGDKTSKKVPSNLLDPESN
                     ATTTPLPAPSSSSSAQYMADKLMEKVISMMISNEVVDEQTSKILQDRIQMQKQRPPLS
                     IALMQNNSNELHRRNSDMYIFIDHVEKFFSWQDPFYTVGWLLIITHLILNPYLFSVLP
                     LIQLITSTMVPHYLMIYPPDGVTNQEYLEVNPKPSDKPLNLYKVPKPVPLFSREFFMN
                     FTDTQNFMTLNIKLFDFTVWLTSDYLYFKNEQITSGIYIICVALIFGNLYLMPYIVPF
                     LLNHFIIVQLSFIFNIWAITAILHPYPRGLLLEWIYKEDTRLNFQHFVNKIEDKLTKF
                     IVKTPTLEQSITNTNLQHATKDIGSSGDETLEDNDTKYVEIYELQKLNTKNKIWEAVG
                     FTPNFYTTNDVTRRYNSVMQELEQNDKSHSHSNEDHHQELHKLPLHKRDTLSEISPPQ
                     NYKFIPSEKWKIDYDISTWVENNLIQDLVIVDDDEKWAYDVITEVNQDHDEMNGKQLD
                     KAINEMTMDEIEKLTDLTKSTEFFRRRRWIRKVTRMNYKDFKEASVPLSSISAWV"
     gene            complement(<253569..>255017)
                     /locus_tag="CD36_51000"
                     /db_xref="GeneID:8048101"
     mRNA            complement(<253569..>255017)
                     /locus_tag="CD36_51000"
                     /product="NAD-dependent histone deacetylase, puytative"
                     /transcript_id="XM_002420359.1"
                     /db_xref="GeneID:8048101"
     CDS             complement(253569..255017)
                     /locus_tag="CD36_51000"
                     /EC_number="3.5.1.-"
                     /inference="similar to AA sequence:UniProt:P53687"
                     /inference="similar to AA sequence:UniProt:Q5A1R1"
                     /note="Similar to S. cerevisiae HST3;
                     In S. cerevisiae: member of the Sir2 family of
                     NAD(+)-dependent protein deacetylases; involved along with
                     Hst4p in telomeric silencing, cell cycle progression,
                     radiation resistance, genomic stability and short-chain
                     fatty acid metabolism;
                     known to play an important role in the regulation of
                     transcriptional repression, microtubule organisation and
                     DNA damage repair processes; member of the sirtuin (Sir2)
                     protein family, putative; regulator of transcriptional
                     repression"
                     /codon_start=1
                     /transl_table=12
                     /product="NAD-dependent histone deacetylase, puytative"
                     /protein_id="XP_002420404.1"
                     /db_xref="GeneID:8048101"
                     /db_xref="GOA:B9WH41"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:B9WH41"
                     /translation="MISIDLVDTAGINMPAETSIKLHEVIKFISKSKKMTVLTGAGIS
                     CNAGIPDFRSSDGLYNMVKAKHPKAVVRGQDLFDISLFRDEISLSVFCTFMESLYKST
                     LNAKPTETHKFIKILKDKNKLLRCYTQNIDCIEKHINLKLGINLQEFDNDKFKKVWNQ
                     LDVVQLHGNLHKLSCTNCFSQFNWNEEFQTLLANGLNPECSKCMDKYQQRLYSGKRLT
                     GQTIGLLRPDIVLYGEHHPQMEILTQGLNSDLKSKPDCLIIMGTSLKVAGVKSLVKSL
                     SKIIHNKGGKVIYINKTKLSASSWKNYIDYEVVSDCDEFVRMLKTEIPDLFLTQEQLD
                     SEKLNQVAVKGSGLNNPITTDAVKQEVKVKIEPGVKQETILEHSPETEPTVKQEPMVK
                     QEVENINVKKEPIPTPPTTPHKPKNAAKLKRKSHEEINTDELHSRIKRLRPRNDQLSS
                     PASSMNGSEEEEEDELVAKVLLENAKKGITLD"
     gene            complement(<256086..>257951)
                     /gene="SNF1"
                     /locus_tag="CD36_51010"
                     /db_xref="GeneID:8048102"
     mRNA            complement(<256086..>257951)
                     /gene="SNF1"
                     /locus_tag="CD36_51010"
                     /product="carbon catabolite derepressing protein kinase,
                     putative"
                     /transcript_id="XM_002420360.1"
                     /db_xref="GeneID:8048102"
     CDS             complement(256086..257951)
                     /gene="SNF1"
                     /locus_tag="CD36_51010"
                     /EC_number="2.7.11.1"
                     /inference="similar to AA sequence:UniProt:P06782"
                     /inference="similar to AA sequence:UniProt:P52497"
                     /note="In S. cerevisiae: AMP-activated serine/threonine
                     protein kinase required for transcription of
                     glucose-repressed genes, thermotolerance, sporulation, and
                     peroxisome biogenesis; serine/threonine protein kinase,
                     Snf/Sip transcriptional complex, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="carbon catabolite derepressing protein kinase,
                     putative"
                     /protein_id="XP_002420405.1"
                     /db_xref="GeneID:8048102"
                     /db_xref="GOA:B9WH42"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR013896"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:B9WH42"
                     /translation="MSEQTQPQASNDQQQESQQQQHHHHHHHHHHHHNNENQPQQPVP
                     IDPAANPANRIGRYQILKTLGEGSFGKVKLAQHIGTGQKVALKIINRKTLAKSDMQGR
                     VEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEFAGKELFDYIVQRGKMPEDEARRF
                     FQQIIAAVEYCHRHKIVHRDLKPENLLLDDQLNVKIADFGLSNIMTDGNFLKTSCGSP
                     NYAAPEVISGKLYAGPEVDVWSAGVILYVMLCGRLPFDDEFIPALFKKISNGVYTLPN
                     YLSAGAKHLLTRMLVVNPLNRITIHEIMEDEWFKQDMPDYLLPPDLSKNKNSKIDIDE
                     DVIRALSVTMGYDRDEIINVIEKANKQVATGNSSSQQSKSSNEILDAYLLMKENHALV
                     KDLKKSKSENIESFLSQSPPPSPFPNAGSTSSAPGVQQSLTYQTLATVPDLSTLPNST
                     IAILPTSLPSIHRAYMAETKQNGEQVAAPPPTKKSKTRWHFGIRSRSYPLDVMGEIYR
                     ALKNLGAEWAKPTEEELWTIRVRWKYDTSAQFECGSAPNLMKMQIQLFQLEPNNYLVD
                     FKFDGWESAHGSEGTDSPHSHRQQDLDEVGSFSAYPFLHLATRLIMELAVNSQSG"
     gene            complement(<258241..>258873)
                     /locus_tag="CD36_51020"
                     /db_xref="GeneID:8048054"
     mRNA            complement(<258241..>258873)
                     /locus_tag="CD36_51020"
                     /product="PWI domain mRNA processing protein, putative"
                     /transcript_id="XM_002420361.1"
                     /db_xref="GeneID:8048054"
     CDS             complement(258241..258873)
                     /locus_tag="CD36_51020"
                     /inference="similar to AA sequence:UniProt:Q2UPX9"
                     /inference="similar to AA sequence:UniProt:Q4WX39"
                     /inference="similar to AA sequence:UniProt:Q5A1Q8"
                     /note="pre-mRNA processing protein, putative; splicing
                     co-activator, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="PWI domain mRNA processing protein, putative"
                     /protein_id="XP_002420406.1"
                     /db_xref="GeneID:8048054"
                     /db_xref="GOA:B9WH43"
                     /db_xref="InterPro:IPR002483"
                     /db_xref="UniProtKB/TrEMBL:B9WH43"
                     /translation="MAYRLNPVDEDYVQAKVNKDKQNTTTKLPKIFNKNPNNYSNIKL
                     EKFKPWITEEINKQLPDDDIIIDYIYELLQDYGNETGKEFPDILNINLQLTDFLGEKE
                     SRVFCKQLWSLILEASNEPDGIPTVLKEKKEKPTIVQKEECKSTQKTKTKKTNYNRSS
                     SLVSDSNRRPRTIVNREYEHRYTTTAPDYQHRYRSRTERDRDESIYRRRH"
     gene            <260098..>261186
                     /locus_tag="CD36_51030"
                     /db_xref="GeneID:8048103"
     mRNA            <260098..>261186
                     /locus_tag="CD36_51030"
                     /product="uncharacterized YTH domain-containing protein,
                     putative"
                     /transcript_id="XM_002420362.1"
                     /db_xref="GeneID:8048103"
     CDS             260098..261186
                     /locus_tag="CD36_51030"
                     /inference="similar to AA sequence:UniProt:Q06390"
                     /inference="similar to AA sequence:UniProt:Q5A1Q7"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized YTH domain-containing protein,
                     putative"
                     /protein_id="XP_002420407.1"
                     /db_xref="GeneID:8048103"
                     /db_xref="InterPro:IPR007275"
                     /db_xref="UniProtKB/TrEMBL:B9WH44"
                     /translation="MFDTADSSRHYLVIETPSADYKQEERYNDDNDIIHNSKNYYIPS
                     LDDISSISTSASSHGTTFFSNNHSSLNRYGTPRSLSRLRSIESEIDNLPLVFKTNIWS
                     NEYSVNHNKTANLFANFTLESGNFACNLTTTACDKSQLSCNDSSYATTSSQVSPVNNI
                     PVIAADTNSRSFGSTTPSINTNAVVSGTPYSPPPSCLTFRTYTGAIFTVPKTSKFFVI
                     KSYNILDVNASFIHNIWTSTELGNRRLDKAYTELAKTNNSDVDGKIFLFFSVNSSGKF
                     CGIAEMKSAIDFTTASNIWCEQTRWKGIFPVEWLLIKDVPNKFFQHLKIPANDYKPVT
                     NSRDTQEIPFDIGISMLKIVSSFKSNEC"
     gene            <261475..>262215
                     /locus_tag="CD36_51040"
                     /db_xref="GeneID:8048104"
     mRNA            <261475..>262215
                     /locus_tag="CD36_51040"
                     /product="catabolite repression protein, putative"
                     /transcript_id="XM_002420363.1"
                     /db_xref="GeneID:8048104"
     CDS             261475..262215
                     /locus_tag="CD36_51040"
                     /inference="similar to AA sequence:UniProt:P41735"
                     /inference="similar to AA sequence:UniProt:Q5A1Q6"
                     /note="Similar to S. cerevisiae CAT5; ubiquinone (Coenzyme
                     Q) biosynthesis protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="catabolite repression protein, putative"
                     /protein_id="XP_002420408.1"
                     /db_xref="GeneID:8048104"
                     /db_xref="GOA:B9WH45"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR011566"
                     /db_xref="UniProtKB/TrEMBL:B9WH45"
                     /translation="MLSRSTISSVRQLSSTSALLNKPTKPKSKSPKKKLQKEVTYGPL
                     SDAQKAYLDRVIRVDQAGELGANYIYMGQYTVLASKYPHLKPVLHHMWEQEIHHHNTF
                     NELQTKRRVRPSLLTPLWKLGAIGMGMGTALIGKEAAMACTVAVETVIGGHYNQQLRV
                     LSNQYGVPIYDKKSGVLLNPDEVEKPAQTSEELTELKNQISEFRDDELEHLNTALDHD
                     AEKAVPYMLITEGIKLICRGAIWTAERI"
     gene            <262521..>263927
                     /locus_tag="CD36_51050"
                     /db_xref="GeneID:8048105"
     mRNA            <262521..>263927
                     /locus_tag="CD36_51050"
                     /product="kinetochore protein, putative"
                     /transcript_id="XM_002420364.1"
                     /db_xref="GeneID:8048105"
     CDS             262521..263927
                     /locus_tag="CD36_51050"
                     /inference="similar to AA sequence:UniProt:P33895"
                     /inference="similar to AA sequence:UniProt:Q5A1Q5"
                     /note="Similar to S. cerevisiae NUF2;
                     In S. cerevisiae: component of the evolutionarily
                     conserved kinetochore-associated Ndc80 complex; involved
                     in chromosome segregation, spindle checkpoint activity and
                     kinetochore clustering"
                     /codon_start=1
                     /transl_table=12
                     /product="kinetochore protein, putative"
                     /protein_id="XP_002420409.1"
                     /db_xref="GeneID:8048105"
                     /db_xref="GOA:B9WH46"
                     /db_xref="InterPro:IPR005549"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:B9WH46"
                     /translation="MKYRKDLFPLLDTREITACLLECEFNVTQELIVKPTADFVTNLF
                     EQFLDTFMGIPLGTIRKKASKMSWINPLESDQANGKSQQSTEDHNDTPDNDKTKDTFS
                     ALQLLTLHRYLAIFFSTCGINDFVLTDIARPDGYRIRRILSAVINFIRFREDQSPKFD
                     HLANECEATADKVSEVQAENTATMQKINAIKEKLEIDSESDESNRKNLQYINSYNRKL
                     ENKLRELKVMQESLTKEHDDYKQEKALLAKKLYDINFLYNETQEQVANLTKYAETDLS
                     ILVKITEDLSNDLTSMQTNYKNLEKNYQNMGITIDSIQVNEINLKDLLKLAEDITRNV
                     EKRQIEAKILKDNQDNLDELTRKQMELEGQILIVQNQLNKSNKKYQDLIVQAEKKESA
                     VKLKLEETKREFNDILSEKEKHNEEHKRIMDQIVKIQQETTAIQDAFVKESKEVEIKL
                     INLMSIIKRYMSDLRNNI"
     gene            complement(<264015..>265898)
                     /locus_tag="CD36_51060"
                     /db_xref="GeneID:8048106"
     mRNA            complement(<264015..>265898)
                     /locus_tag="CD36_51060"
                     /product="azole resistance protein, putative"
                     /transcript_id="XM_002420365.1"
                     /db_xref="GeneID:8048106"
     CDS             complement(264015..265898)
                     /locus_tag="CD36_51060"
                     /inference="similar to AA sequence:UniProt:P50080"
                     /inference="similar to AA sequence:UniProt:Q5A1Q4"
                     /note="Similar to S. cerevisiae AZR1;
                     In S. cerevisiae: involved in resistance to azole drugs
                     such as ketoconazole and fluconazole;
                     multi-drug-resistance transporter, putative; plasma
                     membrane transporter of the major facilitator superfamily,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="azole resistance protein, putative"
                     /protein_id="XP_002420410.1"
                     /db_xref="GeneID:8048106"
                     /db_xref="GOA:B9WH47"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WH47"
                     /translation="MGQRMLCSSSSHTTKLWKTPEQTASLSHDQDEITSPETNTYSPD
                     FSSYADNGITNRHVDKEICSYPPFENQTLSESNHEEANSQQYIEADAGDGTKAHEQYL
                     TGFPLFLTISSCIISLFLVALDQTIVSTILTTVGNKFNAFEKIGWLTSGFMLPMACLV
                     PSYGNISIAFGRKWTLVAGIIIFEIGSLISGISNSMSLLIGGRVIQGIGGGSIQAIVM
                     VILTEVVPMNRRSLVFASISVVYSTSSVLGPIIGGALEKITWRWCFYINLPLGGAALA
                     ILMFGFHPPRPQGNIREKLSKIDFIGFVLLTSGLVLVLLALTFGGTNYSWNSGSIIAL
                     FTVGGGMLLLFIVWNFRYSANPIILTALIVDWRVLSACLSGMFNFAFFISNLTYLAVY
                     FQVIFNAGSLQSGIDLLPMVISVTLASLANSFFIDFTKNVKITMLASGVLSPLGCGLF
                     LLLNEDSSIGIRIGLLIISGISIGLQFQSSLLSAQLAVSKDIPGATILVTVFSDFVKN
                     FASTISVTLAQLIYQTTGQKYVSEMMTNLSEDSQDYKDLNKYTTAKFISNPEVVQELP
                     NSAKSLVLRQLMKALKNVFYLGLGLAILCFITSLFTTNKRIPKNVEIKKNEDQESNKN
                     EPN"
     gene            complement(<266432..>268813)
                     /locus_tag="CD36_51070"
                     /db_xref="GeneID:8048107"
     mRNA            complement(<266432..>268813)
                     /locus_tag="CD36_51070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420366.1"
                     /db_xref="GeneID:8048107"
     CDS             complement(266432..268813)
                     /locus_tag="CD36_51070"
                     /inference="similar to AA sequence:UniProt:Q5A1Q3"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420411.1"
                     /db_xref="GeneID:8048107"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:B9WH48"
                     /translation="MQELSFIIHLPSEIIYQILQYLSQNILLELITVPFLNQYVTSYL
                     YPICLIDSRATDFKPNPKIKLFKTITAFMKFQKLHNYSPQRLILNNNRGINKVVENNH
                     WCSPYKLELVDNLELINTRNVVKVTFSSSFSQPIQEIPYQITELNILGDKLNLVHSNI
                     QILEINQFDLRYMELLPESIKDLKLLEFKLPSSIPSSGVKFPINLTHLTIVEGQRSLR
                     SVNFQSLLFLKSLNYKGNLKLSTSQLTSMQDLQLPESIEKVCLRCLNIVSLQNISNLK
                     CLTHLEIIDFPKLFTFFDTRFPSGLKKLIYKFDTVVPNLSYFQNQMVLNFDSSRLVRE
                     TTTANMIFLKIDERFQIPDNLKVLILENIPYVKISKSIKIPDTLNELIIRKLPGVVPS
                     SNFNMTLPNLTLYRLTLSNMMLDSLEGMKFPEKLSFLDLSRNQLQHIHGTNLYNLKYL
                     RDLNLSRNRFERFIDIENDIPSGLEILHLQSNLINQFEIKDNNIRLMQLNLMLVKNGR
                     YSNELFKFPTKLRYLQLSIQVDKLSDNFQLPANLQSLQIHHPYYGKIVTFRNFFQNVS
                     NLQLTQLSLLNLTFTKDCLIKIPSTIERLTIAGNFNQHIINNLNLQNCKSLTSLSLSG
                     GSVNYFNLNNIPSQNLEQLELKNMKLKYINGNFNEFRHLEYLNLEQNQITNESNNTIT
                     TTTTATNCGGKTKNSLNLPSSINTLILNKNDLNDLSNVFLDNCRYLRKIYLEMNPNLD
                     SRVILKIAKLLMQISDNFVGIYLSSNLIFSSNLFLENYEVYSKIIFNTDFIDG"
     gene            complement(<269385..>271838)
                     /gene="GPR1"
                     /locus_tag="CD36_51080"
                     /db_xref="GeneID:8048108"
     mRNA            complement(<269385..>271838)
                     /gene="GPR1"
                     /locus_tag="CD36_51080"
                     /product="plasma membrane G-protein coupled receptor
                     (GPCR), putative"
                     /transcript_id="XM_002420367.1"
                     /db_xref="GeneID:8048108"
     CDS             complement(269385..271838)
                     /gene="GPR1"
                     /locus_tag="CD36_51080"
                     /inference="similar to AA sequence:UniProt:Q12361"
                     /inference="similar to AA sequence:UniProt:Q8J2T2"
                     /note="regulates morphogenesis and hypha formation in
                     Candida albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="plasma membrane G-protein coupled receptor
                     (GPCR), putative"
                     /protein_id="XP_002420412.1"
                     /db_xref="GeneID:8048108"
                     /db_xref="GOA:B9WH49"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR022596"
                     /db_xref="InterPro:IPR023041"
                     /db_xref="UniProtKB/TrEMBL:B9WH49"
                     /translation="MPDLISIATSITTAFIPTSTPTIIPTTITTIATSVSAATETVTT
                     IIKDTNDSTTASILSTMFNDIILPTIFKRENFTRDHMANQLGEFTDHQARVQRIVAIS
                     SSCGSIAAVLIAMYFLFAIDPKRIVFRHQLIFFLLFFDLLKACILLLYPTRILTHSSA
                     YYNHNFCQVVGFFTATAIEGADIAIFAFAFHTYLLIFKPSFNTKVKNSNRVEGGLYKF
                     RYYVYSLSFFVPLIIASLAFIHSDGYDSLVCWCYLPMRPVWLRLVLSWVPRYCIVVGI
                     FAIYGLIYFRVISEFKTLGGVFKNAAGNGGAGNHHLASNSNPTFFSSLKYFFMSMKDQ
                     WFPSMPSDTLAPISSRHSHSHNGTGEITSPRQNGIGEITNDNDNDDDDNDDDSEELAE
                     ALEDESVDYQDIELNKQNSRNSYRQHNSDIQQANLENFRRRQRIIQKQMKSIFIYPFA
                     YCLVWLFPFILQATQFNYEEDHHAVYWLNVLGAFSQPLNGFVDTLVFFYRERPWRNTA
                     MKNFEKENRQRVDNIIVNNLEQRKYSEGAESAQSVATASKRIAKNSLSASSGLVNINI
                     YKPWRQFMNKYRFPFYQLPTEKNIAKSQDRYIKHKLMDSRKLDKLVQEVTRDRQDLSF
                     PSNIAEKYGDGSGGNHGGSTLSNTNDSSPMSMGAGINWTEPTNAHDFSNILHSGSGSP
                     NVFSWDTKDVPGFKPNFGRFSFGTRTSNLSSRKSSTVIGLQGTGRNVRQPSNDSFNDP
                     VRSLGGRRNSSFAMGANTILNKPYEIVSSPTSSTVTPIDRERSNDIDELPTVGSNSDK
                     ADDDGELDLMEFLKKGPPM"
     gene            complement(<274115..>275545)
                     /gene="IPC1"
                     /locus_tag="CD36_51090"
                     /db_xref="GeneID:8048039"
     mRNA            complement(<274115..>275545)
                     /gene="IPC1"
                     /locus_tag="CD36_51090"
                     /product="inositolphosphorylceramide synthase, putative"
                     /transcript_id="XM_002420368.1"
                     /db_xref="GeneID:8048039"
     CDS             complement(274115..275545)
                     /gene="IPC1"
                     /locus_tag="CD36_51090"
                     /inference="similar to AA sequence:UniProt:O13332"
                     /inference="similar to AA sequence:UniProt:P36107"
                     /inference="similar to AA sequence:UniProt:Q9Y799"
                     /note="mutations confer aureobasidin A resistance;
                     phosphatidylinositol:ceramide phosphoinositol transferase,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="inositolphosphorylceramide synthase, putative"
                     /protein_id="XP_002420413.1"
                     /db_xref="GeneID:8048039"
                     /db_xref="GOA:B9WH50"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:B9WH50"
                     /translation="MASAILRSRIIQKPYQLFHYYFLSEKAPGSTVSDLNFDTNIQTS
                     LRKLKHHHWTVGEIFHYGFLISILFFVFVVFPASFLIKLPIILAFATCFLIPLTSQFF
                     LPALPVFTWLALYFTCAKIPQEWKPAITVKVLPAMETILYGDNLSNVLATITTGVLDI
                     LAWLPYGIIHFSFPFVLAAIIFLFGPPTSLRSFGFAFGYMNLFGVLIQMVFPAAPPWY
                     KNLHGLEPANYSMHGSPGGLGRIDKLLGIDMYTTGFSNSSIIFGAFPSLHSGCCIMEM
                     LFLCWLFPRFKFVWVTYASWLWWSTMYLTHHYFVDLIGGAMLSLTVFEFTKYKYLPKN
                     KEGNFCRWSYTEIEKIDIQEIDPLSYNYIPVNNDDNNNNDIENRLYTRVYQESQVSPP
                     SRASTPEAFEMSNFSRSRQSSKTQVALSNLTNNDQVSGINVEDEEEEGDEISSSTPSV
                     FEDEPQGSTYAASSATSVDDLDSKRS"
     gene            <277086..>277985
                     /locus_tag="CD36_51100"
                     /db_xref="GeneID:8048045"
     mRNA            <277086..>277985
                     /locus_tag="CD36_51100"
                     /product="glucose-6-phosphate 1-epimerase, putative"
                     /transcript_id="XM_002420369.1"
                     /db_xref="GeneID:8048045"
     CDS             277086..277985
                     /locus_tag="CD36_51100"
                     /inference="similar to AA sequence:UniProt:Q03161"
                     /inference="similar to AA sequence:UniProt:Q5A1Q0"
                     /note="hexose-6-phosphate mutarotase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="glucose-6-phosphate 1-epimerase, putative"
                     /protein_id="XP_002420414.1"
                     /db_xref="GeneID:8048045"
                     /db_xref="GOA:B9WH51"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR025532"
                     /db_xref="UniProtKB/TrEMBL:B9WH51"
                     /translation="MPVEELEDRVIITDPTDPTNRATILKFGATVVSWKNNNEEKLWL
                     SEGAHLDGSKAVRGGIPLVFPVFGKQKDSTHPTFKLPQHGFARNSTWEFLGQTQESPI
                     TVQFGLGPENVDPETLKLWNYDFTLILTVSLTKDNLVTSIDIENTGKEAFEFNWLFHT
                     YYRIHDITDTLVTNLIDQQCYDQLIGESYIEKAPVISFHEEFDRIYSKVNLEKSIQIV
                     DKGKVLFNLHRKNLPDSVVWNPWTKKAEGMADFQPKSGFHQMVCVEPGHVDSMISLPA
                     GGKWSGGQEITIGGDIKVQANIY"
     gene            complement(<278096..>279400)
                     /locus_tag="CD36_51110"
                     /db_xref="GeneID:8048109"
     mRNA            complement(<278096..>279400)
                     /locus_tag="CD36_51110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420370.1"
                     /db_xref="GeneID:8048109"
     CDS             complement(278096..279400)
                     /locus_tag="CD36_51110"
                     /inference="similar to AA sequence:UniProt:Q5A1V5"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420415.1"
                     /db_xref="GeneID:8048109"
                     /db_xref="UniProtKB/TrEMBL:B9WH52"
                     /translation="MESSTNYPIVSMNTPIKKIRDLTLNSPSSRHQLDLHSHGTSAFN
                     NNNSNSNSIYPSLDDIQTSPTAAAMLQKGYSQKITNNVLSELNSRAQQLLGSPPQISQ
                     SNDYSSNDSSSNNVLNRRNKRYSTIHMNKFTQMDSINQHYSVHMKTPSPQKSESPSSG
                     EVEESATKRRRTLNGSDQIVAVPVMQKEPTVENNSSPNRKISPSKGSRDLNSILRRKT
                     TETGSPNKEAFARPYPPSNKLRQSSLEMAGVIHASSPSQHQQKLGDPPCLYKKRSIPQ
                     LQKKSSHPTLNRKSSIPTLNKKSSIPSLQKKSSIPNFSGSPSPNMSSMYFAHSPVNDM
                     PPPPPPHGSHLPALNKKPSFTQTNKNTPRLTRISPSKSIPSSVSSKSVDSRALQNSTN
                     LPTMIKSKSVTIPQPFSLYDKPTVSSSLKSLNKFQRFKDKLS"
     mobile_element  complement(279705..285984)
                     /mobile_element_type="retrotransposon:kotuku F, Tcd32,
                     LTR"
     gene            complement(<280030..>284601)
                     /locus_tag="CD36_51120"
                     /db_xref="GeneID:8048110"
     mRNA            complement(<280030..>284601)
                     /locus_tag="CD36_51120"
                     /product="retrotransposon polyprotein, putative"
                     /transcript_id="XM_002420371.1"
                     /db_xref="GeneID:8048110"
     CDS             complement(280030..284601)
                     /locus_tag="CD36_51120"
                     /inference="similar to AA sequence:UniProt:Q5AG24"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="retrotransposon polyprotein, putative"
                     /protein_id="XP_002420416.1"
                     /db_xref="GeneID:8048110"
                     /db_xref="GOA:B9WH53"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:B9WH53"
                     /translation="MLSYFISNIQSQALKSDFVDYDPMSLKYDSGASRTVVGNKKLLS
                     NYDSEAQQIFELPNGQKIRSHGSGDLVINVNHHELVLKDAHYIPGFKINLVSCGQITA
                     QGYDVILSHKMLLCVNFNEKHVIFAKQSLNTNLFTGPSRGKVYSNGKMFMDNNSFIED
                     EGERKGYLNSINAMTKIVDPRIDQVVANPDGRKDLYYYHLITGHMSIRSLIRLHEQGR
                     IKCSIDDQDAKDQIKGCKQCILVNAKQHSHNKTTQSPPERSLYRFHCDTMGPYHVGHV
                     KYYITLITDHYSGFSFTIVKTEKRFTKEILDLFEHLHADLYPKKIARFRSDNAKEFPT
                     EAELGTLKIKKEVLPPYSPEMNGMAESHNNVLKRRMLYVVLNFPNRYKELLIFFCEIV
                     AYAVFIKNHTPSERVETHKGWTPHELFYGRRYRPNYHQFGVDVFVILSNKQEADALGV
                     QFIKGFHRGVPGIFLGYGNDSNVYLIQLVDGNYTRRLFVNVRFLGSMNNINTFLDTFG
                     EKMRKNMDESGNFPFFEDSSRNELLNGRYVPYEDHLPTQGTSSQDVSSDRPTTIEPTA
                     TNINMDELIAEVPDEFLQNNIAGDFLTQQGFTFPSLQVTGKLLEHQSGQSLAPYNWMS
                     KDNMEYSKMGSDHKYLGQNDTENIEPNKNKQVHISEPSFQSSMANKPNESDLGVLPTA
                     DGIRHGVPNARGETTQDGTVSSNIDMHQPYSTIPTHRPPPPVGKNVQFSGVNNDSTTL
                     LPSEWGLPPQQHLSNGGAYESSPVSNVTTSVRLSASTMNIDVGNKNSIKRTKIDRHPL
                     LPNKETVNEISVRIEALKNEHNLNKTLDTIADSYLFTRTSELKNENMAYYKGNGRVSK
                     PPMLLNNLKIIDELIPPTKHISSIEARLETSTGDLNDIENDIDLSVYGVEKYVDYTDE
                     NWRRSMDNEMKKFKEMNVYQVVKKKKNFRMIPAKWVHSYKPNDPKGEFFRSRCVVQGF
                     RQIPGLDFDKNCVSSPVTDLTTIRVLTAIAVESKAQIHHIDIKSAYLNATLPKDTPIF
                     VKPPPGYDDGIHCWRLVKAVYGLKQSGFEWHSHVSKTFKKMGLYQCENVEGLFMLEKG
                     NEKIYIALYVDDLFVVASSNQFFNKFMDDLEAKFSLNYIGEISEYLGIEFQKNAFGYE
                     LHQNKFVKRLIEAFPTEIMKGADLPRTPDNIFKNGKYKIIDDNTGKPLKNQKDIPIPD
                     EYIYEDSNSPRLDKEHHDLYRSIVGMLLWLTNNTMPSISYGTNALAAKCHEPTENDYK
                     HLMQMIKYLYKNNNERLIMRRNQTKDISEDSHVIYAYSDASFAADLDRHSVSGFAIYL
                     NGNLVSWGTKKQRSITKSSMACELIALGETVDRSMIIRQIVQSIGYSAPKIIIFEDNQ
                     PVIMNSYNRKSSAIRRSVDICLKTIRQLILEYKLLSVVYINTKLNVADLLTKAVNNNT
                     MKTLKPLLYDKGNLDGVRKLIKDNFTSHRPVEMGQHSLVYNIITPTEEIKESYYVAPN
                     NVQSKVESRNNKHPEISGGIARIKRLSMP"
     gene            complement(<284626..>285429)
                     /locus_tag="CD36_51130"
                     /db_xref="GeneID:8048111"
     mRNA            complement(<284626..>285429)
                     /locus_tag="CD36_51130"
                     /product="hypothetical transposable element protein"
                     /transcript_id="XM_002420372.1"
                     /db_xref="GeneID:8048111"
     CDS             complement(284626..285429)
                     /locus_tag="CD36_51130"
                     /inference="similar to AA sequence:UniProt:Q59XL1"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="hypothetical transposable element protein"
                     /protein_id="XP_002420417.1"
                     /db_xref="GeneID:8048111"
                     /db_xref="UniProtKB/TrEMBL:B9WH54"
                     /translation="MRDMNVNYTNDAEKNFIAEHIKSIQNSIVKAIISRILFKAKAPE
                     TLEEMIDYYEKLCKKVAPELLFSYFERLVSHYLSVDEPKLTAPTTLMNRLRSPGQLIL
                     NESIARFCSHLNSGIVTQFQMFYKYKAIAMRYCGYIVGQMNDVRNGKPFDYDRLTNEI
                     DLDPVIEQTVTERHKEEIARIKSNNSVQNSVNSMYNTHQNNNNSNYYNNNDKNNKNNK
                     NYKNNKNKNNKNNYNKKGKVSKVSNETSDYEKLKRDLVRMMDDLRKEKE"
     gene            complement(<286356..>288437)
                     /locus_tag="CD36_51140"
                     /db_xref="GeneID:8048112"
     mRNA            complement(<286356..>288437)
                     /locus_tag="CD36_51140"
                     /product="GTPase, putative"
                     /transcript_id="XM_002420373.1"
                     /db_xref="GeneID:8048112"
     CDS             complement(286356..288437)
                     /locus_tag="CD36_51140"
                     /inference="similar to AA sequence:UniProt:P21576"
                     /inference="similar to AA sequence:UniProt:Q5A1V4"
                     /note="Similar to S. cerevisiae VPS1;
                     In S. cerevisiae: dynamin-like GTPase required for
                     vacuolar sorting; also involved in actin cytoskeleton
                     organization, late Golgi-retention of some proteins,
                     regulating peroxisome biogenesis; dynamin-like GTPase
                     required for vacuolar protein sorting, putative; vacuolar
                     protein sorting-associated protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="GTPase, putative"
                     /protein_id="XP_002420418.1"
                     /db_xref="GeneID:8048112"
                     /db_xref="GOA:B9WH55"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR003130"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WH55"
                     /translation="MDETLIATINKLQDALAPLGGGSSSPVDLPQITVVGSQSSGKSS
                     VLENVVGRDFLPRGTGIVTRRPLVLQLINRRPSKDSKKASDLIDVNSSESTGGQSENN
                     ADEWGEFLHLPGKKFFNFEDIRNEIVRETDAKTGKNLGISPVPINLRIYSPHVLTLTL
                     VDLPGLTKVPVGDQPKDIERQIKDMIMKFISKPNAIILSVNAANTDLANSDGLKLARE
                     VDPEGARTIGVLTKVDLMDQGTDVIDILAGRVIPLRFGYVPVINRGQKDIEAKKTIRD
                     ALKDERNFFENHPSYRAKAQFCGTPYLAKKLNGILLHHIKSTLPDIKMRIEHSLKKYQ
                     QELAMLGPEMAESPASIALSMITNFTKDYTGILDGESNELSSQELSGGARISFVFHEI
                     FKNGINAIDPFDQIKDADIRTIMHNTSGSAPSLFVGTQAFEVLVRQQIKRLEEPSVRC
                     INLIFDELVRILSQIISQPQYSRYPGLKEQLSQNFILYLRDLLVPTTEFVNDIIQAEE
                     TYVNTAHPDLLKGTQAMSIVEEKFHPKPQVAVDPKTGKPLPPSQQPAQATSPKPEDGT
                     SNGFFGGFFSSKNKKRLQQMEAPPPVLRATGTMSERETMETEVIKLLISSYYNIVKRT
                     VSDVVPKAIMLKLINKSKDEIQKTLLEKLYSSPDLDDLVKENELTVQKRKECVRMVEV
                     LRNASEIVSSV"
     gene            complement(<288786..>289256)
                     /locus_tag="CD36_51150"
                     /db_xref="GeneID:8048113"
     mRNA            complement(<288786..>289256)
                     /locus_tag="CD36_51150"
                     /product="phosphatase, putative"
                     /transcript_id="XM_002420374.1"
                     /db_xref="GeneID:8048113"
     CDS             complement(288786..289256)
                     /locus_tag="CD36_51150"
                     /inference="similar to AA sequence:UniProt:P38218"
                     /inference="similar to AA sequence:UniProt:Q5A1P5"
                     /note="Similar to S. cerevisiae POA1;
                     In S. cerevisiae: phosphatase that is highly specific for
                     ADP-ribose 1''-phosphate, a tRNA splicing metabolite; may
                     have a role in regulation of tRNA splicing"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphatase, putative"
                     /protein_id="XP_002420419.1"
                     /db_xref="GeneID:8048113"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="UniProtKB/TrEMBL:B9WH56"
                     /translation="MIQYIKGDLFTHTIPAGKKVILAHACNTHGSWGGGIAAVFRKRF
                     PKANNKYSQYCHKNTNLLGTSFIIESDQPSILIACLFTSDFNQTPEQIVNFTKQSIAD
                     LARKVSDNQEVERSDGKVVINMPKINAGIFGVPWEDTEQALQGFDNLHFNVYVI"
     gene            complement(<289349..>290464)
                     /locus_tag="CD36_51160"
                     /db_xref="GeneID:8048114"
     mRNA            complement(<289349..>290464)
                     /locus_tag="CD36_51160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420375.1"
                     /db_xref="GeneID:8048114"
     CDS             complement(289349..290464)
                     /locus_tag="CD36_51160"
                     /inference="similar to AA sequence:UniProt:Q5A1P4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420420.1"
                     /db_xref="GeneID:8048114"
                     /db_xref="UniProtKB/TrEMBL:B9WH57"
                     /translation="MMIRLFPRQIRSLSYLTKTTINPVDFQLKIPEQFVPKSLLVLST
                     PTNLPQVIEDSIKLYQKRDLQLVVAGVDTVVPYSHRNGVSELWLDEPISIGDSVLLEE
                     KDDINKPPRESDGLNVVSAQKHWKNIPSQLKINLRQEMELKLNLANTVFSTGSIITLF
                     YFGNGSNSGQHLCDLQISFPRGLIPRHSSAVIKDNWTDLYPGAGFKITNCVGNLVKSI
                     DNNPAAKYLEENKKLMSIGSKETEVYVKIKKPNSTRVERFKVTAGGGGWGAKADIIAL
                     SPEAKLVKGSEIQFFMVTPEDRYLPNHNDDEIAQFINAFTFTNSYEETNYNDNTDENQ
                     HIYENIFGGGSEQGFFFNDIKHHSPGESVSIKLEKKK"
     gene            complement(<290604..>291764)
                     /locus_tag="CD36_51170"
                     /db_xref="GeneID:8048115"
     mRNA            complement(<290604..>291764)
                     /locus_tag="CD36_51170"
                     /product="tRNA pseudouridine synthase, putative"
                     /transcript_id="XM_002420376.1"
                     /db_xref="GeneID:8048115"
     CDS             complement(290604..291764)
                     /locus_tag="CD36_51170"
                     /EC_number="5.4.99.-"
                     /inference="similar to AA sequence:UniProt:P48567"
                     /inference="similar to AA sequence:UniProt:Q5A1U9"
                     /note="Similar to S. cerevisiae PUS4;
                     In S. cerevisiae: atalyzes only the formation of
                     pseudouridine-55 (Psi55), a highly conserved tRNA
                     modification, in mitochondrial and cytoplasmic tRNAs"
                     /codon_start=1
                     /transl_table=12
                     /product="tRNA pseudouridine synthase, putative"
                     /protein_id="XP_002420421.1"
                     /db_xref="GeneID:8048115"
                     /db_xref="GOA:B9WH58"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR014780"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:B9WH58"
                     /translation="MNGVFAVYKPSGITSAKFIETIQSKFTKSEVFAKDLQEMKDKIR
                     SDLSRDRKWKPHKIEKKIASTKVKIGHGGTLDPLASGILVVGVGLGTKKLQYYLAECQ
                     KTYETKALLGISTTTGDSEGEIVSKNKIDHITSELIDSTVEKFIGDIKQTPPIFSALK
                     VNGKPLYEYARQGLPLPTNIKVRDVTVNSITVIKEDSLKTDHEFTKLESELDENGVPK
                     EHGLKDNPTLNDSPLFFSKQYLEKAEKEGLPKETGKPKLLPDDESLPEKLPMIHFISD
                     VSSGTYIRSLISDIGRAMESSAYMVELIRTKQSEWELGKNVFRLEDFEKDERIWGPVL
                     KKVFEKGGSEIQDLNKEFEEMSKTLESSVKKENKDSTSETIPQKRSIDEVEK"
     gene            complement(<291901..>292677)
                     /locus_tag="CD36_51180"
                     /db_xref="GeneID:8048116"
     mRNA            complement(join(<291901..291954,292051..>292677))
                     /locus_tag="CD36_51180"
                     /product="Ras modification protein, putative"
                     /transcript_id="XM_002420377.1"
                     /db_xref="GeneID:8048116"
     CDS             complement(join(291901..291954,292051..292677))
                     /locus_tag="CD36_51180"
                     /inference="similar to AA sequence:UniProt:P41912"
                     /inference="similar to AA sequence:UniProt:Q5A1U8"
                     /note="Similar to S. cerevisiae SHR5;
                     In S. cerevisiae: adds a palmitoyl lipid moiety to
                     heterolipidated substrates such as Ras1p and Ras2p through
                     a thioester linkage;
                     spliced gene; palmitoyltransferase subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Ras modification protein, putative"
                     /protein_id="XP_002420422.1"
                     /db_xref="GeneID:8048116"
                     /db_xref="GOA:B9WH59"
                     /db_xref="InterPro:IPR019383"
                     /db_xref="UniProtKB/TrEMBL:B9WH59"
                     /translation="MNETKTDSSVIPDQSIQELVFFNYHEYLVPGSDDTSLVINHFPN
                     THTVLSSSSFNETRIIRIPRVYHTVQFPDLIPQFSSYYPGTEPGAITSTQSTSGSFEG
                     NNFNESSSIPSLEGIISKNEFENIVNLVNESLVVAFNPMSKRILLENLLDLLSGGLFV
                     GLLNLLGIYSFTKRKLIDLENQINSINQINEKKGVDFKIISPRVTGYLSVNVKEYMKN
                     LYWATMWW"
     gene            <293689..>295920
                     /locus_tag="CD36_51190"
                     /db_xref="GeneID:8048117"
     mRNA            <293689..>295920
                     /locus_tag="CD36_51190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420378.1"
                     /db_xref="GeneID:8048117"
     CDS             293689..295920
                     /locus_tag="CD36_51190"
                     /inference="similar to AA sequence:UniProt:Q5A1P0"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420423.1"
                     /db_xref="GeneID:8048117"
                     /db_xref="UniProtKB/TrEMBL:B9WH60"
                     /translation="MIPLRQIVGRTVKSSALQIRNATKAGTMALRYQSTTTTTNTATP
                     TPDHASSKTSSESVQTEKSTVSKPTQKGNQDKKPLPRRTPVNPKLRDISGQIKETILQ
                     SSTDLNEAYSILEEGITFLREIQKSENITDRQIFREFYPLATELFVLAQKPETTIDHS
                     LNEILDMFVKNKIAHSIHFTSLAANTLKQNIEAYEEVLQYWLKSFEYTKSHDFLYVDN
                     FNGVKTKIEYQPYDLTNLAIYAYVQSCIAQKVAYSPVDAARFSPTGKVPPFYHIKKTL
                     EVLDIYDPNKFREYCNLLQTDSQERFNPNGAGSIKKIENTPDKKQLDKFYQNVVDICN
                     KRNIKIDEKVIVALMQRYFQFDEYNEVFSLFETIMNSGVKPSINAWNIVIKAMTNPSR
                     IASFGGKAKQQELLQNFERTLQTIVSSGVQFNGETIGAIVSGYANFGRFEKAQEYIDK
                     YAQGVKDNGDIISLCNDGILRGLVYNGKIEEAESKLKQFMEAYPQYKPHTHVMNDFLN
                     YYAKKKNYKAINGITNFMKKHNIAENVSIKTTMINAYFESLHAIGKTPDLSSFLAKME
                     SSENAGKRGFNEQMHSTLLKGLIQGANIEAARQLFDILKSRYPRSAWLNTNMMIGELT
                     LGNVKLGEDIFNHYIKEIRNEPIIWNTFIHNLLSRDEKLADFYFEKMKQDSQVQPNYY
                     TYYFMLQHYRRKAKKDRLQQLVNELAEVDWTSYGTSLPDFIKKLTNYLDVPALLLSKL
                     DKQ"
     gene            complement(<296087..>296881)
                     /gene="CYC3"
                     /locus_tag="CD36_51200"
                     /db_xref="GeneID:8048118"
     mRNA            complement(<296087..>296881)
                     /gene="CYC3"
                     /locus_tag="CD36_51200"
                     /product="cytochrome c heme lyase, putative"
                     /transcript_id="XM_002420379.1"
                     /db_xref="GeneID:8048118"
     CDS             complement(296087..296881)
                     /gene="CYC3"
                     /locus_tag="CD36_51200"
                     /EC_number="4.4.1.17"
                     /inference="similar to AA sequence:UniProt:P06182"
                     /inference="similar to AA sequence:UniProt:P53700"
                     /note="In S. cerevisiae: attaches heme to apo-cytochrome c
                     in the mitochondrial intermembrane space; holocytochrome c
                     synthase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cytochrome c heme lyase, putative"
                     /protein_id="XP_002420424.1"
                     /db_xref="GeneID:8048118"
                     /db_xref="GOA:B9WH61"
                     /db_xref="InterPro:IPR000511"
                     /db_xref="UniProtKB/TrEMBL:B9WH61"
                     /translation="MGWFWADKSSQNTVKASNSFTTASACPIDHSKLSTSSPTCPVKL
                     NNDNDEVLNPMNNMPMAISSERAPGQRIKLSTERTISTIPRGESEDQGLWEYPSPQQM
                     LNAMLQKGKGDGIPEDAVESMVEVHNFLNEGAWQQILTWEDHYTQQTKVEPRLKKFTG
                     RPHDLSPKARMYLWLGQLFPETFNTIPPFDRHDWTVLRSCGRNQGWKEVRYVIDYYGA
                     PDDEETGMPAFMLDTRPALDNFTNARDRFTHWAYPLWKKAMGEVRD"
     gene            complement(<304544..>305500)
                     /locus_tag="CD36_51210"
                     /db_xref="GeneID:8048034"
     mRNA            complement(<304544..>305500)
                     /locus_tag="CD36_51210"
                     /product="cysteine protease, putative"
                     /transcript_id="XM_002420380.1"
                     /db_xref="GeneID:8048034"
     CDS             complement(304544..305500)
                     /locus_tag="CD36_51210"
                     /inference="similar to AA sequence:UniProt:P38747"
                     /inference="similar to AA sequence:UniProt:Q5A1N7"
                     /note="Similar to S. cerevisiae OTU2; member of the
                     ovarian tumor-like (OTU) superfamily of predicted cysteine
                     proteases, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cysteine protease, putative"
                     /protein_id="XP_002420425.1"
                     /db_xref="GeneID:8048034"
                     /db_xref="GOA:B9WH62"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="UniProtKB/TrEMBL:B9WH62"
                     /translation="MSEPEQQPLVTTREELIQRHKKESKDLIATITGLKKQATKKTRK
                     SVLNKCQELQDNLDQKHRQELKEFDNPHGDQNEEDGEEITPEQLLAQLSLDKESSTIE
                     NSNSGSIGGGGDSDSSKPRKKRNRQRERLNRRQAEIDKIKQEAAVEASNTIDYRQIEI
                     ESMEKLLSLNNLQSFEIKPDGHCLFASIQDQLKVRHHEVDHSQHNGPENIPSIDQLRK
                     LAGDYIKSNQDDFIPFLIDENTGELRDLDDYINELTTTATWGSDMEILALSKVFNCPI
                     SIYMAGASTLTINEHGQLPELKLGYYKHSFGLGEHYNSLRDL"
     gene            <313604..>315043
                     /gene="CLN2"
                     /locus_tag="CD36_51220"
                     /db_xref="GeneID:8048119"
     mRNA            <313604..>315043
                     /gene="CLN2"
                     /locus_tag="CD36_51220"
                     /product="G1/S-specific cyclin, putative"
                     /transcript_id="XM_002420381.1"
                     /db_xref="GeneID:8048119"
     CDS             313604..315043
                     /gene="CLN2"
                     /locus_tag="CD36_51220"
                     /inference="similar to AA sequence:UniProt:P43062"
                     /inference="similar to AA sequence:UniProt:Q66RJ3"
                     /codon_start=1
                     /transl_table=12
                     /product="G1/S-specific cyclin, putative"
                     /protein_id="XP_002420426.1"
                     /db_xref="GeneID:8048119"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014399"
                     /db_xref="UniProtKB/TrEMBL:B9WH63"
                     /translation="MFPNSPDAFHQVRMMQSSIKASNFKLQSMEFKCHSYNVCEYQME
                     MLHHLLTVEAKTLPSLSLIEQQPEIKLGMRPLLLDFLMEVITILNLSRSTFPLTVNLI
                     DRYCSTRIVKKQHYQLLGLTSLWISCKNLDSKFKVPTLNDLRKICVDSYYKELFVEME
                     KHILKSLEWVVNAPTFDAFIDLYSNLLISNSSNVEVANIVKKSSHKIKLFSNYIGELF
                     QFYPNIYYDYTSSQIALIAILITVLTLKIPVDLISLLNFYNGLVKTDMFKSNIEQGSD
                     NEFEEILSVESFKSLFNKSFFKNLIKIIDNPPSSLKIKYFADNGKYSVLMKQLVTTAT
                     NTLKCMLDPVPTTPKANSFVKQQHHHHHNQQQQQQQQQQQQHYCPRPPMSINTSMIPL
                     TPVSNSTSPNRFSPDQIFSENESTPGIAFGTMTPDSQSTSPGEKRSYECIDELEIGTS
                     TITSYTSKNHDTLKRSKSANYGTLFYLQQ"
     gene            <324139..>325989
                     /locus_tag="CD36_51230"
                     /db_xref="GeneID:8048029"
     mRNA            <324139..>325989
                     /locus_tag="CD36_51230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420382.1"
                     /db_xref="GeneID:8048029"
     CDS             324139..325989
                     /locus_tag="CD36_51230"
                     /inference="similar to AA sequence:UniProt:Q5A1U2"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420427.1"
                     /db_xref="GeneID:8048029"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:B9WH64"
                     /translation="MDSNNTKRQKTGNHYSNYTITSNNEKIDIITDISNLSSEKFFNN
                     YISIRKPVKFNIPINQQIIQLNKFKINNLINTLNYNNNNTDNTNNDDDENFLLVEKKY
                     QNGFGSGQKRIKMKLNDLINEIKNGNDDYYLTTQYDFDDPDNITNDKEEEEEEEGDVS
                     FDQFSDTSSIDMNNFHDDFEDIENDFNESINGDENNNNNNNSNKNDEIMTPEEVEIRI
                     KELYQPPLTNLINKPEILPYCPSFFNLIPQQINLWMGSTTNNEKQSNNDHFIIDESKL
                     DLGLGKQIPLTNEPEPKPEFEPECEPESKTLTLMGTSTGLHHDHADNLYILIQGKKRF
                     TILSPNDAMKLYTIGNIYKIFHNGLIDYEINENSSNWKHIRDDGAIIEEIIYWKLDKL
                     RKSKKEKEKEKEQKGGQKEPKEEDEKGLDEEEEEEEEKLLNELQNHIKQYQIQQQQNK
                     RKNLNKKSNIRLDPPNFSKIPPILLHLDELKNNIIRKKIESFANKFFPGVLQLNKLKV
                     WLNPGEMLYLPAGWFHEVSSFGENIVKNNNDNKENLGTTTKTTTTGEGEGEGEGEGEG
                     EGGAHIAINYWFIPPNTTKFDDCYEDNYWKEDWEKTKKAMKLVKDGVVSL"
     mobile_element  complement(326236..326635)
                     /mobile_element_type="retrotransposon:solo LTR, epsilon B"
     gene            <331344..>333143
                     /locus_tag="CD36_51240"
                     /db_xref="GeneID:8048120"
     mRNA            <331344..>333143
                     /locus_tag="CD36_51240"
                     /product="mitochondrial protein, putative"
                     /transcript_id="XM_002420383.1"
                     /db_xref="GeneID:8048120"
     CDS             331344..333143
                     /locus_tag="CD36_51240"
                     /inference="similar to AA sequence:UniProt:P41913"
                     /inference="similar to AA sequence:UniProt:Q5A1N3"
                     /note="Similar to S. cerevisiae GDS1;
                     In S. cerevisiae: required for growth on glycerol as a
                     carbon source; uncharacterized protein Gds1 homologue,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial protein, putative"
                     /protein_id="XP_002420428.1"
                     /db_xref="GeneID:8048120"
                     /db_xref="UniProtKB/TrEMBL:B9WH65"
                     /translation="MSDLEDINSPNSPNSPNSPSLSLEQSTRGSTPPTSTSSPPSTQN
                     NDSKSKRNLETDDIHDTFDNKKLENEINESEQLTDLKNDQDLEDIKNNTKDVKDVKDV
                     KDIKTTGGGFGGFGGGGCSKKNQDFKDSKDSKKMKKLKPKSNPKSNSKPKPISRAPIA
                     TGISTEIEVTGEKPKPIQEGDPSLEDDVLYAIFVILYEEDLIEKEKEKENEKEKEKGM
                     TVKQITDILDEKYPQFTKNTGKVSNLVSAKINSYIKRLEAGQTNLRYAISRDWGKNTP
                     KRMLYKYRGILAPGWEIKLKELQKQQQEIKQQNDQQQEQEQQQNDDDDDDSQELNLQQ
                     QQQQIEEFKSSSSESPKSRKKNSQPQSISTNFKDHFNELDQQQQQQQEDQDQDQDQDQ
                     YQYQYPLLSSSISSSISKSKSTMKRRATMFDLGRPTFLTTGEFCDQLPPYLIRKSTKI
                     EDVLDEEVLQDDNDEEEEEENDLSSLSQKDKTSNKTNNNSSNSNNNINSGNIIKIKKR
                     RLTWAPLGETGDDDLGLAAFRALSTSTTSATNNNGGSGGNGNGNGNGGNGGNGGGGER
                     LLSSINYKKKWFQMTELPKPELTSLSELEKYWD"
     gene            <335664..>337175
                     /locus_tag="CD36_51250"
                     /db_xref="GeneID:8048121"
     mRNA            <335664..>337175
                     /locus_tag="CD36_51250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420384.1"
                     /db_xref="GeneID:8048121"
     CDS             335664..337175
                     /locus_tag="CD36_51250"
                     /inference="similar to AA sequence:UniProt:Q5A1N1"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420429.1"
                     /db_xref="GeneID:8048121"
                     /db_xref="InterPro:IPR021460"
                     /db_xref="UniProtKB/TrEMBL:B9WH66"
                     /translation="MVMPNPEEYTAIHGVSRILRFLNNYPAEGTGTLILSEKAKNLIG
                     PKLPQILIDYSTATQLNLFGDYPNKSDIIPSAIFIGLFSIIAILHLIVFSINYYRGHY
                     FWLSLGWVFYAICRILGFALRIVWSHDLTDCKVGITSEVFLIIPTVLIASFNLVLAQR
                     IFTWRHPVGGSRKIFWTLMWILYALVAGVVAMTIVTSGGLNIYLLSEANYSRYKKVVM
                     STSILIIIYSLTAVGLILLAWLFKPTKKDENLYTYQPWWIESFAPFYFVKKNEPQIAA
                     LSFLKRNHNHRYAIRVIAATHNLHKTVKGLTNQRGDLTHNVSLMIIGVTTLIILVSSI
                     LRAVICFQGRMKYFTAPVGKAPVMYVFWGGLEVGVNLLYIIGRVDLRFYRPDRLPKDV
                     RNIVTAEQSLYPSEIEDEGDDQNVLDKESLDKHPQPYSGKTFSNNNNNNNHHHDDNDD
                     NEFGFTDSDDKDVHTDLDGNEDFDFINGGSEKPKNNFPYPFKEKSETVSEFHF"
     gene            <337529..>338344
                     /locus_tag="CD36_51260"
                     /db_xref="GeneID:8048122"
     mRNA            <337529..>338344
                     /locus_tag="CD36_51260"
                     /product="S-adenosyl-L-methionine (SAM)-dependent
                     methyltransferase, putative"
                     /transcript_id="XM_002420385.1"
                     /db_xref="GeneID:8048122"
     CDS             337529..338344
                     /locus_tag="CD36_51260"
                     /EC_number="2.1.1.-"
                     /inference="similar to AA sequence:UniProt:P25627"
                     /inference="similar to AA sequence:UniProt:Q5A1M9"
                     /note="Similar to S. cerevisiae BUD23;
                     In S. cerevisiae: involved in bud-site selection; bud site
                     selection protein, putative; methyltransferase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="S-adenosyl-L-methionine (SAM)-dependent
                     methyltransferase, putative"
                     /protein_id="XP_002420430.1"
                     /db_xref="GeneID:8048122"
                     /db_xref="GOA:B9WH67"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR022238"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B9WH67"
                     /translation="MSRPEELAPPEVFYNDTESFKYTSSTRVQHIQAKMTLRALELLN
                     LEQDSSQFLLDIGCGSGLSGEILTEEGYNWIGMDISPSMLATGLDRNVEGDLFLGDVG
                     NGIPFRPGTFDAAISISVIQWLCNADISGIDPKKRLLNFFNSLYASLKRGGKFVAQFY
                     PKNDIQTENIMNAAKIAGFGGGLIIDDPESKRHKKYYLVLTAGMAERQINLTGAEMDS
                     PIDEKTKLSNKKRKRIMESKKQFINRKKEIMRKRGRKVAEDSKFTGRKRRPRF"
     gene            <338637..>339267
                     /locus_tag="CD36_51270"
                     /db_xref="GeneID:8048123"
     mRNA            join(<338637..338715,338804..>339267)
                     /locus_tag="CD36_51270"
                     /product="ribosomal protein, mitochondrial precursor,
                     large subunit, putative"
                     /transcript_id="XM_002420386.1"
                     /db_xref="GeneID:8048123"
     CDS             join(338637..338715,338804..339267)
                     /locus_tag="CD36_51270"
                     /inference="similar to AA sequence:UniProt:P25626"
                     /inference="similar to AA sequence:UniProt:Q5A1M8"
                     /note="Similar to S. cerevisiae IMG1;
                     In S. cerevisiae: required for both respiration and
                     maintenance of the mitochondrial genome;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="ribosomal protein, mitochondrial precursor,
                     large subunit, putative"
                     /protein_id="XP_002420431.1"
                     /db_xref="GeneID:8048123"
                     /db_xref="GOA:B9WH68"
                     /db_xref="InterPro:IPR001857"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="UniProtKB/TrEMBL:B9WH68"
                     /translation="MFGLITKSFGIKPVIQPIRSFHYLRKQLPTVFEPLPKRRNGEGV
                     MPYLHRQLLEKHDPTGKRRALVENSKTGLRAGDIIKVTYLDRSDVTGRVIGIKRGFLN
                     LGTNILIRTKLNKVGSELRIPVYNPNIRNIEVLHKPTRYMPRAKHFYIREHKRYDVDD
                     VEAFVKKQFGEGRKNTKSKK"
     gene            complement(<339351..>339704)
                     /locus_tag="CD36_51280"
                     /db_xref="GeneID:8048124"
     mRNA            complement(<339351..>339704)
                     /locus_tag="CD36_51280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420387.1"
                     /db_xref="GeneID:8048124"
     CDS             complement(339351..339704)
                     /locus_tag="CD36_51280"
                     /inference="similar to AA sequence:UniProt:Q5A1M7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420432.1"
                     /db_xref="GeneID:8048124"
                     /db_xref="InterPro:IPR007967"
                     /db_xref="InterPro:IPR023231"
                     /db_xref="UniProtKB/TrEMBL:B9WH69"
                     /translation="MEIQQQIEELTTIYHEYKSFFPKCELIVTPDIKSNSNSNYIQLI
                     TYEGRNIKVTVGFKGWYEITTTTTIRTIEKSFESFESFETFEALMQTISIDFQNRFGN
                     ELSNKLNQLLQQQQK"
     gene            <340365..>340640
                     /locus_tag="CD36_51290"
                     /db_xref="GeneID:8048125"
     mRNA            <340365..>340640
                     /locus_tag="CD36_51290"
                     /product="N-terminal acetyltransferase C complex subunit,
                     putative"
                     /transcript_id="XM_002420388.1"
                     /db_xref="GeneID:8048125"
     CDS             340365..340640
                     /locus_tag="CD36_51290"
                     /inference="similar to AA sequence:UniProt:P23059"
                     /inference="similar to AA sequence:UniProt:Q6FKX2"
                     /note="Similar to S. cerevisiae MAK31;
                     In S. cerevisiae: on-catalytic subunit of N-terminal
                     acetyltransferase of the NatC type; required for
                     replication of dsRNA virus"
                     /codon_start=1
                     /transl_table=12
                     /product="N-terminal acetyltransferase C complex subunit,
                     putative"
                     /protein_id="XP_002420433.1"
                     /db_xref="GeneID:8048125"
                     /db_xref="GOA:B9WH70"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:B9WH70"
                     /translation="MCASLTPDKFIGANLHVKLSDSRILEGILTVIDPFGNLLLSNVY
                     ETSIDKLNDKQLHVREIGLVSVPRESIENIKVDRKTHKSIFGMERSN"
     gene            complement(<340686..>341483)
                     /locus_tag="CD36_51300"
                     /db_xref="GeneID:8048126"
     mRNA            complement(<340686..>341483)
                     /locus_tag="CD36_51300"
                     /product="covalently-linked cell wall glycoprotein
                     precursor, putative"
                     /transcript_id="XM_002420389.1"
                     /db_xref="GeneID:8048126"
     CDS             complement(340686..341483)
                     /locus_tag="CD36_51300"
                     /inference="similar to AA sequence:UniProt:O13547"
                     /inference="similar to AA sequence:UniProt:Q5A1M6"
                     /note="Similar to S. cerevisiae CCW14;
                     In S. cerevisiae: present in inner layer of the cell wall"
                     /codon_start=1
                     /transl_table=12
                     /product="covalently-linked cell wall glycoprotein
                     precursor, putative"
                     /protein_id="XP_002420434.1"
                     /db_xref="GeneID:8048126"
                     /db_xref="UniProtKB/TrEMBL:B9WH71"
                     /translation="MLLLVVTLVFLKSIFATPPACFLSCINEIAHDCPEDAANLTCIC
                     INEDLIIGCLVDICPFGTFISARDHYIGTCLEHGRPSITNPIPPPAIWPPEPKVSSIS
                     DTTMKTEYTSSAMQVTQTVEFPARVTITPLPSEVINPEPEIVDESEDEFYNPNEPCEW
                     EETDELDENGAFIVIRRPVNVPKRYRDPTNVGNVRRVIITRPVNYYSNQHAFDKFDNP
                     KPRKIQHVKRIKKIPKNISKNANNLKMGSLILNQKIKPKKNKLEEIP"
     gene            <342226..>342945
                     /gene="CVB1"
                     /locus_tag="CD36_51310"
                     /db_xref="GeneID:8048127"
     mRNA            <342226..>342945
                     /gene="CVB1"
                     /locus_tag="CD36_51310"
                     /product="vacuole biogenesis protein, putative"
                     /transcript_id="XM_002420390.1"
                     /db_xref="GeneID:8048127"
     CDS             342226..342945
                     /gene="CVB1"
                     /locus_tag="CD36_51310"
                     /inference="similar to AA sequence:UniProt:Q9P859"
                     /codon_start=1
                     /transl_table=12
                     /product="vacuole biogenesis protein, putative"
                     /protein_id="XP_002420435.1"
                     /db_xref="GeneID:8048127"
                     /db_xref="UniProtKB/TrEMBL:B9WH72"
                     /translation="MQGSYNNNGLPRPYYMKPSKKKSSPYSNLKEPIVYFNTPKRKLM
                     GYIIMFSLIGILMWWISQDFKGKSEIEYELVKNEKSGEKNTHIDLKNSANLDKIVNAV
                     GSKADKESENLDLAENLSEGSKGQKGIGVAEAPKGGIANEAPVVGNDEEELVGTGKSG
                     QKQQKAEGNPKGKGYKASIGKANDKDSTGAAPAAAAGAAAAGADSPNGKEDPAPDVED
                     TAAAARLSNEDKVQQIIKDTA"
     gene            complement(343192..343263)
                     /gene="tRNA-Gln (CTG)"
                     /locus_tag="CD36_tRNA_0080"
                     /db_xref="GeneID:8048033"
     tRNA            complement(343192..343263)
                     /gene="tRNA-Gln (CTG)"
                     /locus_tag="CD36_tRNA_0080"
                     /product="tRNA-Gln"
                     /anticodon=(pos:complement(343228..343230),aa:Gln,seq:ctg)
                     /db_xref="GeneID:8048033"
     gene            complement(<343764..>345248)
                     /locus_tag="CD36_51320"
                     /db_xref="GeneID:8048057"
     mRNA            complement(<343764..>345248)
                     /locus_tag="CD36_51320"
                     /product="RING finger domain-containing protein, putative"
                     /transcript_id="XM_002420391.1"
                     /db_xref="GeneID:8048057"
     CDS             complement(343764..345248)
                     /locus_tag="CD36_51320"
                     /inference="similar to AA sequence:UniProt:P40072"
                     /inference="similar to AA sequence:UniProt:Q5A1M4"
                     /note="Similar to S. cerevisiae SLX8;
                     In S. cerevisiae: possible role in sumoylation and in
                     regulation of genome stability"
                     /codon_start=1
                     /transl_table=12
                     /product="RING finger domain-containing protein, putative"
                     /protein_id="XP_002420436.1"
                     /db_xref="GeneID:8048057"
                     /db_xref="GOA:B9WH73"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:B9WH73"
                     /translation="MKFAKTLERTLEEDEIPQEWVEAAIQYKALKKCINKVVNELEFL
                     GLQKNTLKILLNDKVVEVNEQETNPNNPIIAEYILSKTSTDAHNIKPMLKITLDYSTE
                     DYTKDHIVELGKELKSKIEALLNDTDTEYEEDKIIELKEDDGGDLQIVTSREGSLSPP
                     ASRMASPPTSPTIKVVDSSNTNIDEALLSPEDHHKKHEIFIMLNSDSKFFDMLNDELT
                     SLDSLTQSEESKIIEEVKKIAKYVNELKLKQSELYKWRELFKVYLDSEVYFKYNETAL
                     SSQQKSSEQIKSNLDLFVTNLKKSGIMTQFKKKQSLETFNQFLEMNYHLLKILQFQTI
                     NNEALRKILKKFDKQTSLGIQKTFPKLISNDHIFMSGTSLAQSICYIIQESVIKVIPQ
                     LDDYSCPICMNIAYKPIRLSCGHLFCVRCLVKMKQDDKTSCPLCRKENAILYADSSNL
                     DLESMELMKKYFPREVKEKLRERDKERYNELRKNANTGEKCIIM"
     gene            complement(345862..345957)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CD36_tRNA_0081"
                     /db_xref="GeneID:8048128"
     tRNA            complement(345862..345957)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CD36_tRNA_0081"
                     /product="tRNA-Glu"
                     /anticodon=(pos:complement(345922..345924),aa:Glu,seq:ttc)
                     /db_xref="GeneID:8048128"
     gene            complement(345971..346064)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CD36_tRNA_0082"
                     /db_xref="GeneID:8048058"
     tRNA            complement(345971..346064)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CD36_tRNA_0082"
                     /product="tRNA-Glu"
                     /anticodon=(pos:complement(346029..346031),aa:Glu,seq:ttc)
                     /db_xref="GeneID:8048058"
     gene            <346273..>347694
                     /locus_tag="CD36_51330"
                     /db_xref="GeneID:8048059"
     mRNA            <346273..>347694
                     /locus_tag="CD36_51330"
                     /product="uncharacterized zinc-finger protein, putative"
                     /transcript_id="XM_002420392.1"
                     /db_xref="GeneID:8048059"
     CDS             346273..347694
                     /locus_tag="CD36_51330"
                     /inference="similar to AA sequence:UniProt:P38890"
                     /inference="similar to AA sequence:UniProt:Q5A1M3"
                     /note="Similar to S. cerevisiae SET5"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized zinc-finger protein, putative"
                     /protein_id="XP_002420437.1"
                     /db_xref="GeneID:8048059"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:B9WH74"
                     /translation="MTQDISEKIEVISINDSQPEDPSPVVPHERQVVDCVIEIWKEDP
                     ATESLGMSKLHALVKQKHPNWSVSEKRVRALLKQFGLAFNNQEQFTYAKEITSVMTPD
                     IELPANVHIIMTSKRGKGLYAKRDIAKGDLIWSEEPLFFIPPLANVNLMKTASACTYC
                     GKLLKRPESATVLKGLDCNVCSEVWCSIKCKQLDGNLHSLLKHNLYNPGTKKHKLIDA
                     EAFLELQDYCLEEQWNALYAITLIYANCVTDKSGVKQKQFNAMARVSQDVRYKALNSS
                     AGTFDSLNGGALFVQEQQEHLWKIGYEKFLRVFPKKPVEYREFLFMMGTYNINNLDSN
                     VFLTQSHLNHNCAPTTSVETELDRTAGLKVFAAKDIKSGEELTTTYVNPSHTVHQRQR
                     ELRVNWGFICACGKCKDDLKQNERRKSSHNQQQNASNIRNMLKEAKDAVGEEGIELEI
                     PTEFNGERRKSVRFDEKVVAVKE"
     gene            <348030..>349070
                     /locus_tag="CD36_51340"
                     /db_xref="GeneID:8048129"
     mRNA            <348030..>349070
                     /locus_tag="CD36_51340"
                     /product="HAP CCAAT-binding (Hap2/3/4/5) transcriptional
                     modulator complex subunit, putative"
                     /transcript_id="XM_002420393.1"
                     /db_xref="GeneID:8048129"
     CDS             348030..349070
                     /locus_tag="CD36_51340"
                     /inference="similar to AA sequence:UniProt:Q02516"
                     /inference="similar to AA sequence:UniProt:Q5A1M2"
                     /note="Similar to S. cerevisiae HAP5;
                     In S. cerevisiae: subunit of the heme-activated,
                     glucose-repressed Hap2/3/4/5 CCAAT-binding complex, a
                     transcriptional activator and global regulator of
                     respiratory gene expression; required for assembly and DNA
                     binding activity of the complex; subunit of CCAAT-binding
                     transcriptional modulator complex, putative;
                     transcriptional activator, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="HAP CCAAT-binding (Hap2/3/4/5) transcriptional
                     modulator complex subunit, putative"
                     /protein_id="XP_002420438.1"
                     /db_xref="GeneID:8048129"
                     /db_xref="GOA:B9WH75"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR027170"
                     /db_xref="UniProtKB/TrEMBL:B9WH75"
                     /translation="MNEDPQSEIMERYNESAYLREDQLSQFDQNNIVVKEEQTHIQDH
                     HPSESGSHPDELQDQGIHTVIDEHEDQVSTQNIVDEEELLAAQAAAEAAAAAQQQQPG
                     DVFNNVAQGLSGKHRDMMMQYWQETINSIEHDEHDFKNHQLPLARIKKVMKTDEDVRM
                     ISAEAPILFAKGCDVFITELTMRAWIHAEENKRRTLQKSDIAAALTKSDMFDFLIDVV
                     PREEEKPKKSNNSSSRSDTYVNTQQSPQIPEVEEEVPNMLTQDVKNSHSDALQQQILQ
                     DQLLQQQLQQEVQQQLQQEVQRQLQEDVSPSGPQQGSQQEEDITNGVDNSNGHNDETT
                     TYQNFNGYQNNY"
     gene            <349985..>350620
                     /locus_tag="CD36_51350"
                     /db_xref="GeneID:8048130"
     mRNA            <349985..>350620
                     /locus_tag="CD36_51350"
                     /product="carboxypeptidase y inhibitor, putative"
                     /transcript_id="XM_002420394.1"
                     /db_xref="GeneID:8048130"
     CDS             349985..350620
                     /locus_tag="CD36_51350"
                     /inference="similar to AA sequence:UniProt:P14306"
                     /inference="similar to AA sequence:UniProt:Q5A1M1"
                     /note="Similar to S. cerevisiae DKA1;
                     phosphatidylethanolamine-binding protein, protein kinase A
                     signalling pathway, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="carboxypeptidase y inhibitor, putative"
                     /protein_id="XP_002420439.1"
                     /db_xref="GeneID:8048130"
                     /db_xref="InterPro:IPR001858"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="UniProtKB/TrEMBL:B9WH76"
                     /translation="MTLITISQSLDEAYTKHKVIPEVVDQFDTQGLLSIEYGPTELVT
                     LGNTLSVEGTQDVPKIQLTLNSPTQDGKIESISENDKFILVMTDPDAPSNSDHKWSEY
                     LHWLVTDLKLPHTKNEDGEPEISHFIDVKEGRELVPYMGPGPPPKTGKHRYVFLLYKQ
                     DPNVGELTAPKDRPNWGTGVPSSGVKDWIEKNAPNSKLLSVNFFFAQNEDN"
     gene            complement(<350681..>351127)
                     /locus_tag="CD36_51360"
                     /db_xref="GeneID:8048131"
     mRNA            complement(<350681..>351127)
                     /locus_tag="CD36_51360"
                     /product="pre-mRNA splicing U4/U6aU5 tri-snRNP complex
                     subunit, putative"
                     /transcript_id="XM_002420395.1"
                     /db_xref="GeneID:8048131"
     CDS             complement(350681..351127)
                     /locus_tag="CD36_51360"
                     /inference="similar to AA sequence:UniProt:Q06819"
                     /inference="similar to AA sequence:UniProt:Q5A1M0"
                     /note="Similar to S. cerevisiae DIB1; spliceosome complex
                     subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="pre-mRNA splicing U4/U6aU5 tri-snRNP complex
                     subunit, putative"
                     /protein_id="XP_002420440.1"
                     /db_xref="GeneID:8048131"
                     /db_xref="GOA:B9WH77"
                     /db_xref="InterPro:IPR004123"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:B9WH77"
                     /translation="MGSVFLPHLKTAWHVDQAILSEDDRVVVIRFGREEETQCMLMDE
                     ILFSISEKIKNFAVVYLVNLDKVPDFNQMYELDQNPLEPFTIMFFYRNKHMMCDFGTG
                     NNNKLNFMIYDKQEMIDIIETIYRGARKGKGLVMSPKDYSRSAKDI"
     gene            <351883..>352239
                     /locus_tag="CD36_51370"
                     /db_xref="GeneID:8048132"
     mRNA            <351883..>352239
                     /locus_tag="CD36_51370"
                     /product="thioredoxin, putative"
                     /transcript_id="XM_002420396.1"
                     /db_xref="GeneID:8048132"
     CDS             351883..352239
                     /locus_tag="CD36_51370"
                     /inference="similar to AA sequence:UniProt:P22803"
                     /inference="similar to AA sequence:UniProt:Q5A1L9"
                     /note="Similar to S. cerevisiae TRX2;
                     In S. cerevisiae: isoenzyme of the thioredoxin system
                     which protects cells against oxidative and reductive
                     stress"
                     /codon_start=1
                     /transl_table=12
                     /product="thioredoxin, putative"
                     /protein_id="XP_002420441.1"
                     /db_xref="GeneID:8048132"
                     /db_xref="GOA:B9WH78"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:B9WH78"
                     /translation="MLQNIETKQQFSSALQNKDDMIVLDFFDECSHCSDLNDKLDEFS
                     NMYGAQNIRFYKVNIEEDRELAEDYKVSSIPTTLFFKKGKVFDKVVGPEPNEIKKVLD
                     KNLLGWSGRPSHSTKT"
     gene            <352563..>353639
                     /locus_tag="CD36_51380"
                     /db_xref="GeneID:8048133"
     mRNA            <352563..>353639
                     /locus_tag="CD36_51380"
                     /product="dihydroorotase, putative"
                     /transcript_id="XM_002420397.1"
                     /db_xref="GeneID:8048133"
     CDS             352563..353639
                     /locus_tag="CD36_51380"
                     /EC_number="3.5.2.3"
                     /inference="similar to AA sequence:UniProt:P20051"
                     /inference="similar to AA sequence:UniProt:Q5A1L8"
                     /note="Similar to S. cerevisiae URA4;
                     In S. cerevisiae: catalyzes the third enzymatic step in
                     the de novo biosynthesis of pyrimidines, converting
                     carbamoyl-L-aspartate into dihydroorotate"
                     /codon_start=1
                     /transl_table=12
                     /product="dihydroorotase, putative"
                     /protein_id="XP_002420442.1"
                     /db_xref="GeneID:8048133"
                     /db_xref="GOA:B9WH79"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR004721"
                     /db_xref="InterPro:IPR006992"
                     /db_xref="UniProtKB/TrEMBL:B9WH79"
                     /translation="MSEIELGITADMHVHLRDGNMCELITPTVRTGGVAISYVMPNLV
                     PPITTKQQVIDYHNKLSELAPQTTFLMSFYLSKDLTPELIEECADLIHGVKCYPAGVT
                     TNSKYGVDPNDFSAFYPLFETMQKHGIVLNIHGEKPGTSEEDEINVINAEPKFLPALK
                     KLHDDFPRLKIILEHCTTSDAVETIRELNSNYKPGDELFVGATITAHHLFLIIDNWAG
                     NPINFCKPVAKFQKDRKALVDAATSGEPWFFFGSDSAPHPIHAKQTHVGVCAGVFTQS
                     HAIGYVAEIFDKANKLENLKKFVSDNGINFYGLSNEILNKHKNESVWLVKRDNKVPEI
                     IGNSNVEVVPFKAGETLKYAIEWR"
     gene            <355973..>357577
                     /locus_tag="CD36_51390"
                     /db_xref="GeneID:8048134"
     mRNA            <355973..>357577
                     /locus_tag="CD36_51390"
                     /product="glycerophosphoinositol permease, putative"
                     /transcript_id="XM_002420398.1"
                     /db_xref="GeneID:8048134"
     CDS             355973..357577
                     /locus_tag="CD36_51390"
                     /inference="similar to AA sequence:UniProt:P25346"
                     /inference="similar to AA sequence:UniProt:Q5A1S5"
                     /note="Similar to S. cerevisiae GIT1;
                     possibly fungal-specific;
                     In S. cerevisiae: mediates uptake of
                     glycerophosphoinositol and glycerophosphocholine as
                     sources of the nutrients inositol and phosphate"
                     /codon_start=1
                     /transl_table=12
                     /product="glycerophosphoinositol permease, putative"
                     /protein_id="XP_002420443.1"
                     /db_xref="GeneID:8048134"
                     /db_xref="GOA:B9WH80"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WH80"
                     /translation="MASRDLPHSFNELAFGWSKHLKEEIIVNKNSQQLVDEDFQPDED
                     ITKETKVKFDNLWPAFASGAGLFADGYVNNSIGIVLACLKILYGDEFTKSNAISNIGS
                     IGFVGTVVGQLSFGYISDRIARKGGMMTANIMLIVFTLLCAVGSWGTTIQGFFACLTV
                     WRFCLGVAIGAEYPTSSVIASEFANQLPSGKRNRYFIWFTGFMIDFGFVVSAFVPFVL
                     LWIFTEKHLRALWRVSIGLGAILPTALFFIRLKMKDSSSFEKLHMKNVRYRDYPWWLI
                     VKFYWFRLTIVSMIWFIYNFSVYSFGTFNAIILGQIIPDAPLWQQWGWSVVFNLFYIP
                     GSFLGAFSADYLGPRLTLAIGVGLQGIIGFIMSSCLNGLRKQVAAFTVVFGIFATLGE
                     FGPGGNIGLLASKTSATPIRGQYYGIAAAMGKIGAFVGTWIFPAIQRRYASKTNPDLE
                     LQVPFYLSSGLCIFSALLTFFLCPHVGQDAINREDKEFVDYLQKNGFDISKLGEDTSS
                     VEIDVVKDTDSAEKISETIDVGQKLA"
     gene            <359777..>361384
                     /locus_tag="CD36_51400"
                     /db_xref="GeneID:8048135"
     mRNA            <359777..>361384
                     /locus_tag="CD36_51400"
                     /product="glycerophosphoinositol permease, putative"
                     /transcript_id="XM_002420399.1"
                     /db_xref="GeneID:8048135"
     CDS             359777..361384
                     /locus_tag="CD36_51400"
                     /inference="similar to AA sequence:UniProt:P25346"
                     /inference="similar to AA sequence:UniProt:Q5A1L6"
                     /note="Similar to S. cerevisiae GIT1;
                     possibly fungal-specific;
                     In S. cerevisiae: mediates uptake of
                     glycerophosphoinositol and glycerophosphocholine as
                     sources of the nutrients inositol and phosphate"
                     /codon_start=1
                     /transl_table=12
                     /product="glycerophosphoinositol permease, putative"
                     /protein_id="XP_002420444.1"
                     /db_xref="GeneID:8048135"
                     /db_xref="GOA:B9WH81"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WH81"
                     /translation="MSTRDLPHSFSELSFGWVRRIRAEFTIGKSKEQLLAEDYHSTDD
                     DDSEVVTSVKANSLWPAFASGAGLFSDGYVNNSISTVLFCLKKIYPDEITKSNAINNI
                     ASIAFVGTVVGQLGFGYISDRIARKGGMMTANIMLIFFTLMCAVGSWGVTVQGFFACL
                     TVWRFFLGVAIGAEYPTSSVIASEFANQLPPGKRNRYFSWFTNAMIDSGFVVSAFVPF
                     VLIWIFTEKHLRALWRVAIGLGVIPPLSLFFMRLKMKNSSSFQKLHMKNVRYRDYPWW
                     LIVKFYWFRLTIVSLIWFIYDFSAYSFGNFNTIIIGEIIPEAPIWKQWGWSIVFNLFY
                     IPGAFLGAISADYIGPRLTLALGVGIQGIIGIAMSACLNSLKKHIAGFVVVFGIFTTF
                     GEFGPGDNIGLLASKTSATAIRGQYYGIAAAIGKIGAFVGTWVFPAIQSKYANNSNPD
                     LQLQVPFYISSALCLFSACLAIFFCPQVGQDAIYKEDHDFVQYLSNNGFDINMLGEGG
                     DVREICHESDSLEKGKRDDFQVDNNSL"
     gene            <362956..>364554
                     /locus_tag="CD36_51410"
                     /db_xref="GeneID:8048136"
     mRNA            <362956..>364554
                     /locus_tag="CD36_51410"
                     /product="glycerophosphoinositol permease, putative"
                     /transcript_id="XM_002420400.1"
                     /db_xref="GeneID:8048136"
     CDS             362956..364554
                     /locus_tag="CD36_51410"
                     /inference="similar to AA sequence:UniProt:P25346"
                     /inference="similar to AA sequence:UniProt:Q5A1L5"
                     /note="Similar to S. cerevisiae GIT1;
                     possibly fungal-specific;
                     In S. cerevisiae: mediates uptake of
                     glycerophosphoinositol and glycerophosphocholine as
                     sources of the nutrients inositol and phosphate"
                     /codon_start=1
                     /transl_table=12
                     /product="glycerophosphoinositol permease, putative"
                     /protein_id="XP_002420445.1"
                     /db_xref="GeneID:8048136"
                     /db_xref="GOA:B9WH82"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WH82"
                     /translation="MATRDLPHSVGDFCFGWVDQIRNEITLGKSQDQLIKEDLIEDDE
                     TVETKVEVKNLWPAFASGAGLFSDGYVNAGISTVLSCLKKIYGDEFTKSNAMNNIGSI
                     GFVGTVVGQLSFGYISDNFDRKTGMLTANVMLIFFTLMCAVASWGTTVQGFFACLTVW
                     RFFLGIAIGAEYPTSSVIASEFANQLPSGHRNRYFSWFTNAMIDFGFVVAAFVPLVLL
                     WIFTPHHLRAVWRLSIVLGVIPPLILFFIRLKMDNSKSFKKMNMKRVNYSNYPWWLII
                     KFYWFRLTVVSLIWFIYDFSVYSFGTFNTIIIGEVIPNGTLYENWGWSVVFNLFYMPG
                     AFLGAFVGDYLGPRLTLAIGVGAQGIIGIAMSACLKSLKKHIAGFVVVFGIFSTFGEF
                     GPGNNTGLLASKTCASSIRGQYYGIAAAIGKIGAFVGTWVFPAIQKHYAYNDDLSLQV
                     PFYVSSALCLFSAFLTIFFVPPVGQDAINKEDRLFKEYLEENGFDIRLLGDSGVVTQY
                     QEDEDIGVISDEKDDTVKVQQKNV"
     gene            complement(<365039..>365527)
                     /locus_tag="CD36_51420"
                     /db_xref="GeneID:8048137"
     mRNA            complement(<365039..>365527)
                     /locus_tag="CD36_51420"
                     /product="mitochondrial inner membrane protease subunit,
                     putative"
                     /transcript_id="XM_002420401.1"
                     /db_xref="GeneID:8048137"
     CDS             complement(365039..365527)
                     /locus_tag="CD36_51420"
                     /EC_number="3.4.21.-"
                     /inference="similar to AA sequence:UniProt:P46972"
                     /inference="similar to AA sequence:UniProt:Q5A1L4"
                     /note="Similar to S. cerevisiae IMP2;
                     In S. cerevisiae: required for maturation of mitochondrial
                     proteins of the intermembrane space"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial inner membrane protease subunit,
                     putative"
                     /protein_id="XP_002420446.1"
                     /db_xref="GeneID:8048137"
                     /db_xref="GOA:B9WH83"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019758"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:B9WH83"
                     /translation="MGIPRGVKTSLLTLTWFPVLYSFTNHGYQPYQITGSSMTPTFNP
                     GTSTMTKDIVLVQKYNVKKPGSLSRGDIIMFRSPENPEKLLTKRVVGIQGDIVRPKSP
                     PYPKSEVKIPRNHLWVEGDNSFHSIDSNKFGPVSQGLVIGKVVTIIWPPSRLGSDLQR
                     NL"
     gene            <365933..>366250
                     /locus_tag="CD36_51430"
                     /db_xref="GeneID:8048138"
     mRNA            <365933..>366250
                     /locus_tag="CD36_51430"
                     /product="mitochondrial intermembrane space cysteine motif
                     protein, putative"
                     /transcript_id="XM_002420402.1"
                     /db_xref="GeneID:8048138"
     CDS             365933..366250
                     /locus_tag="CD36_51430"
                     /inference="similar to AA sequence:UniProt:Q04341"
                     /inference="similar to AA sequence:UniProt:Q5A1L3"
                     /note="Similar to S. cerevisiae MIC14"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial intermembrane space cysteine motif
                     protein, putative"
                     /protein_id="XP_002420447.1"
                     /db_xref="GeneID:8048138"
                     /db_xref="UniProtKB/TrEMBL:B9WH84"
                     /translation="MDQAKPGFLDQFLLEDISRHCPHQFLSFHQCMTLPEPDPNQCFQ
                     QQVDLTKCIKTSVPSFAKIQNECFGKMQAYEACLKLNKSNTKSCSHELQSLRNCAFGT
                     IDK"
     gene            complement(<366310..>367326)
                     /locus_tag="CD36_51440"
                     /db_xref="GeneID:8048139"
     mRNA            complement(<366310..>367326)
                     /locus_tag="CD36_51440"
                     /product="WD-40 repeat domain-containing protein,
                     putative"
                     /transcript_id="XM_002420403.1"
                     /db_xref="GeneID:8048139"
     CDS             complement(366310..367326)
                     /locus_tag="CD36_51440"
                     /inference="similar to AA sequence:UniProt:P53851"
                     /inference="similar to AA sequence:UniProt:Q59X91"
                     /note="Similar to S. cerevisiae TEX1;
                     In S. cerevisiae: component of the transcription export
                     (TREX) complex; mRNA export protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="WD-40 repeat domain-containing protein,
                     putative"
                     /protein_id="XP_002420448.1"
                     /db_xref="GeneID:8048139"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:B9WH85"
                     /translation="MPSANDRNIKFFNSLIPIVLIDKPISSYAPSEIITVAINQTGTR
                     VVYSRTDRSIRIWKCLPESVIDPKTIFDAHSKAVECLSFNPMTEFTFATVAKDEYIKI
                     WNANTGDKLHEIKCEFDSLKLVRYSNDGQLLVVVDRASNFLFFNVGANYKLIHQFKLD
                     EHIYDLKWFNHDHQFFLVSSHDGSILLYEIIDGDEDNELSSKLRASVSGHNSSITTIA
                     ISPKGNYFTVGSSEGVISFWKTLENLINSKVITDVDQSIAQLDISRDGTYLAVAYDTD
                     SNSRIYEAEGGEMVHEIPNSSSGNQTFSSITWFPTKTGFAYTSDHGTVLTVMNKPIEK
                     KHRR"
     gene            <367620..>368864
                     /locus_tag="CD36_51450"
                     /db_xref="GeneID:8048140"
     mRNA            <367620..>368864
                     /locus_tag="CD36_51450"
                     /product="COPII-coated vesicle complex subunit, putative"
                     /transcript_id="XM_002420404.1"
                     /db_xref="GeneID:8048140"
     CDS             367620..368864
                     /locus_tag="CD36_51450"
                     /inference="similar to AA sequence:UniProt:P39727"
                     /inference="similar to AA sequence:UniProt:Q59X92"
                     /note="Similar to S. cerevisiae ERV46;
                     In S. cerevisiae: localizes to COPII-coated vesicles;
                     involved in the membrane fusion stage of transport;
                     ER-derived vesicle protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="COPII-coated vesicle complex subunit, putative"
                     /protein_id="XP_002420449.1"
                     /db_xref="GeneID:8048140"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:B9WH86"
                     /translation="MSSRPKLLSFDAFAKTVEDARIKTTSGGIITLICILITLVLIRN
                     EYVDYTTIITRPELVVDRDINKQLDINLDISFINLPCDLISIDLLDVTGDLSLNIIDS
                     GLKKIRLLKNKQGDVIVNEIEDDEPAFNNDIELTDLAKGLPEGSDENAYCGSCYGALP
                     QDKKQFCCNDCNTVRRAYAEKHWSFYDGENIEQCEKEGYVARLRERINNNEGCRIKGT
                     TKINRVSGTMDFAPGASFTREGRHFHDLSLYTKYEDKFNFDHIINHLSFGEMPVDGQA
                     DQLFDSIHPLDDHQFMLHKKAHLVSYYLKVVATRFESLDYKNRIDTNQFSVITHDRPL
                     RGGKDEDHQHTLHARGGIPGVNFNFDISPLKIINRQQYAKTWSGFVLGVISSIAGVLM
                     VGTLLDRSVFAAQQAIKGKKDI"
     gene            complement(<369002..>369850)
                     /locus_tag="CD36_51460"
                     /db_xref="GeneID:8048141"
     mRNA            complement(<369002..>369850)
                     /locus_tag="CD36_51460"
                     /product="mitochondrial 54S ribosomal protein YmL17/YmL30"
                     /transcript_id="XM_002420405.1"
                     /db_xref="GeneID:8048141"
     CDS             complement(369002..369850)
                     /locus_tag="CD36_51460"
                     /inference="similar to AA sequence:UniProt:P36528"
                     /inference="similar to AA sequence:UniProt:Q59X93"
                     /note="Similar to S. cerevisiae MRPL17"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 54S ribosomal protein YmL17/YmL30"
                     /protein_id="XP_002420450.1"
                     /db_xref="GeneID:8048141"
                     /db_xref="GOA:B9WH87"
                     /db_xref="InterPro:IPR021757"
                     /db_xref="UniProtKB/TrEMBL:B9WH87"
                     /translation="MRGLTVHRVIRSYSSIPASTSSSISSTLVLSRLPIITPDVPKFD
                     QQFYNYQTELWRRLMWTFPKWFYFRPGTLSEQKFKELNENPVSYDPKVIYPRGAPDLK
                     HNRDRRFRQYIRLPKTYKEESELAEGEENTQSDQDIARKIVPNSRITEADKKNDSTSL
                     ERKLSRTLYLVVKQGESGEWKFPNFKQPENGELVPLHELAETGLYSIGGKKINYFNVS
                     RVPCHVTQDTNNTSKQYFIKSHILSGAFEAQEKDVEFKWLTKEELGECLSTEYYRDIE
                     HLLNDV"
     gene            <370448..>371323
                     /locus_tag="CD36_51470"
                     /db_xref="GeneID:8048142"
     mRNA            <370448..>371323
                     /locus_tag="CD36_51470"
                     /product="cytochrome c peroxidase, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_002420406.1"
                     /db_xref="GeneID:8048142"
     CDS             370448..371323
                     /locus_tag="CD36_51470"
                     /EC_number="1.11.1.5"
                     /inference="similar to AA sequence:UniProt:P00431"
                     /inference="similar to AA sequence:UniProt:Q59X94"
                     /note="Similar to S. cerevisiae CCP1;
                     In S. cerevisiae: degrades reactive oxygen species in
                     mitochondria, involved in the response to oxidative
                     stress"
                     /codon_start=1
                     /transl_table=12
                     /product="cytochrome c peroxidase, mitochondrial
                     precursor, putative"
                     /protein_id="XP_002420451.1"
                     /db_xref="GeneID:8048142"
                     /db_xref="GOA:B9WH88"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR002207"
                     /db_xref="InterPro:IPR010255"
                     /db_xref="InterPro:IPR019794"
                     /db_xref="UniProtKB/TrEMBL:B9WH88"
                     /translation="MIRSYIKNIILAILSPLLITTPPLVLPPPYEKIIQEIITVFSVD
                     NYDDGSLAPIILRLAWHCCATYDVTTNTGGSNGATMRFVPEITDEGNYGLDVARAALE
                     PIKQRYPTISYADLWTLAGKVAIEHMGGPTIIWKSGRVDYTNDQDVPPNGLLPFADKN
                     ANHVRKTFTRLGFNDRETVALIGAHGVGRCHKRFSGWEGKWTSIPKTFSNQFYVVLLN
                     EIWSQGEVPETGKTQYFNADKSLIMLNTDMELIRDKSYLRWVEIYAKDEPRFLHDFSA
                     AFAKLLELGIKREPF"
     gene            <371370..>372692
                     /locus_tag="CD36_51480"
                     /db_xref="GeneID:8048143"
     mRNA            <371370..>372692
                     /locus_tag="CD36_51480"
                     /product="indoleamine 2,3-dioxygenase family protein,
                     putative"
                     /transcript_id="XM_002420407.1"
                     /db_xref="GeneID:8048143"
     CDS             371370..372692
                     /locus_tag="CD36_51480"
                     /EC_number="1.13.11.-"
                     /inference="similar to AA sequence:UniProt:P47125"
                     /inference="similar to AA sequence:UniProt:Q59XE2"
                     /note="Similar to S. cerevisiae BNA2;
                     In S. cerevisiae: required for biosynthesis of nicotinic
                     acid from tryptophan via kynurenine pathway; tryptophan
                     2,3-dioxygenase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="indoleamine 2,3-dioxygenase family protein,
                     putative"
                     /protein_id="XP_002420452.1"
                     /db_xref="GeneID:8048143"
                     /db_xref="GOA:B9WH89"
                     /db_xref="InterPro:IPR000898"
                     /db_xref="UniProtKB/TrEMBL:B9WH89"
                     /translation="MIIPNIKEFDVFPNSGFLPSKLPLERLPQEYYQPWENIVNNLPS
                     LILTKRIRATIDKLPVLETTRLTSEEEYRRAYQILGFLAHAYIWGTDTPTDKLPSQIA
                     TPWIKVSDHLGLPPIATYAGLCLWNFKQIMPSDDIWDLDNLTTINTFTGSIDESWFYL
                     VSVYFEHKGALAITTGLDAIKCAYNNDTKGLVENLQQLAEAIDSLGSVLMKMEEMCDP
                     HVFYFRIRPYLAGWKNMTEVGLKGVYYGEEKKVRNYSGGSNAQSSLIQFLDILLGVKH
                     YSTGERPLPFKSGSGSGAENGFMNEMRQYMPGNHQKFLSKIQEITNINQYVLDHKDSH
                     PELVLSYDACLAMLKSFRDKHIQIVTRYVVLQAKKTEKMGSSSTLRSGLARKKKEERG
                     TGGTSLLPFLKQCRDETGDPAAGNWGQRILSDGVMRLTFSKPNGINED"
     gene            <373756..>375801
                     /locus_tag="CD36_51490"
                     /db_xref="GeneID:8048144"
     mRNA            <373756..>375801
                     /locus_tag="CD36_51490"
                     /product="RNA maturation protein, putative"
                     /transcript_id="XM_002420408.1"
                     /db_xref="GeneID:8048144"
     CDS             373756..375801
                     /locus_tag="CD36_51490"
                     /inference="similar to AA sequence:UniProt:P53617"
                     /inference="similar to AA sequence:UniProt:Q59XE4"
                     /note="Similar to S. cerevisiae NRD1;
                     In S. cerevisiae: RNA-binding protein that interacts with
                     the C-terminal domain of the RNA polymerase II large
                     subunit, required for transcription termination and 3' end
                     maturation of nonpolyadenylated RNAs; RNA-binding protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA maturation protein, putative"
                     /protein_id="XP_002420453.1"
                     /db_xref="GeneID:8048144"
                     /db_xref="GOA:B9WH90"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:B9WH90"
                     /translation="MSSSGIEEFEAVLKEISTLPAPGVSGTRIKKLTDLAVKEINVEN
                     EPKLISILYSQCKANSSTNKLGTLYVVDSIVRRFIEEANKKNEALVPNAPEGTYASAV
                     FKINELVESLVDDAMELSINPSINIKIGKLIDIWAKSETFSPEVISNIRNKHFKSTTP
                     PGSPPKTSIAPVKPDATEGTKESSSILSALASLAKANGTNNETPPSSQSSSANNNESG
                     SNATNILSQLSALAGNSSNTDSASSQPPVQQQYPSYPQGGGQTGDAALLNMLQQMQGG
                     GGATAGASAVPPAGGVNGAREDHTAGFDRRRGRDNEYGSHYGRRNRSRSPKRGSNTWV
                     RSSPSSSVQALQQNMQNLRQQKQANHGYPQHTNGQVDQGFVPPNAMGGELNLPGTPHY
                     RPRTVQFDSTIPQGTVKVLSRTLFLGGVPRNMDERSLAQVLRPYAEIQSVILNSEKKH
                     AFVKVYSRREAEQVITSFNKDGALPLRTRWGVGFGPRDCCNYQHGISIIPIQRLTEAD
                     KNWIVNAQWGGTGGQPISSGMVVDEPDIEIGSGLSSKAMSKKMPTNSARNGPKSNRPG
                     EPDEEYVKTTLIPQGNIQMTHGAQPQFNTYSQSSVNPLQGLFENNVQQQQPPPPPQQQ
                     QQQQQQQQPPMQFPAGFPQIPPQQPGQPGMNNNEAMAMLAAMMQTMQQQQQQQHPPH"
     gene            <376137..>377315
                     /locus_tag="CD36_51500"
                     /db_xref="GeneID:8048145"
     mRNA            <376137..>377315
                     /locus_tag="CD36_51500"
                     /product="uncharacterized protein ynl254c homologue,
                     putative"
                     /transcript_id="XM_002420409.1"
                     /db_xref="GeneID:8048145"
     CDS             376137..377315
                     /locus_tag="CD36_51500"
                     /inference="similar to AA sequence:UniProt:P53850"
                     /inference="similar to AA sequence:UniProt:Q59X99"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein ynl254c homologue,
                     putative"
                     /protein_id="XP_002420454.1"
                     /db_xref="GeneID:8048145"
                     /db_xref="InterPro:IPR028094"
                     /db_xref="UniProtKB/TrEMBL:B9WH91"
                     /translation="MKEKDYGSLVNNTGNSKANVSKVSLPRTSSSVSGTSSIPSSPIH
                     DMFSPTKLSPRASKTYKKRPKGKILVHDNALETSKVKKLGEYQEIIVKPRKSLDPFDL
                     IDINHIEKSTPSPVKMTKKRKTETSFKVEGLLEISDDDDYDADKSKNNVNSQPKTLNE
                     KIDSNNILHSLEQQNRSKYHDVLKKYKNKKIPKPIVSRKALLVRANKYMDLIPKILGG
                     KLSTSIFYEYAKAQKMKSEHETMSTSDKWRIKWEKYCGGYYGFQRQSIIGAQILDKYE
                     KKLTRFCKSNKTASYWNPSQFSTYVLANEIIIRMIMEDMNLDFDKAEKLCLETVDYGI
                     VVADSIEVDYDNGPSQGQTKNKKSISPIKQKLLPISLSADDSSSDEESIFRVKKQKEK
                     "
     mobile_element  complement(377487..378008)
                     /mobile_element_type="retrotransposon:solo LTR, episemon
                     I"
     gene            complement(<378010..>379764)
                     /locus_tag="CD36_51510"
                     /db_xref="GeneID:8048146"
     mRNA            complement(<378010..>379764)
                     /locus_tag="CD36_51510"
                     /product="heat shock protein, putative"
                     /transcript_id="XM_002420410.1"
                     /db_xref="GeneID:8048146"
     CDS             complement(378010..379764)
                     /locus_tag="CD36_51510"
                     /inference="similar to AA sequence:UniProt:P15705"
                     /inference="similar to AA sequence:UniProt:Q59YX6"
                     /note="Similar to S. cerevisiae STI1; hsp90 co-chaperone,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="heat shock protein, putative"
                     /protein_id="XP_002420455.1"
                     /db_xref="GeneID:8048146"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:B9WH92"
                     /translation="MTTADEYKAEGNKYFAAKEFEKAIEAFTKAIEASPEPNHVLYSN
                     RSGSYASLKDFSNALKDAEECVKINPNWAKGYNRIAGAEFGLGNFDQAKSNYEKCLEL
                     DPNNAMAKEGLKSIESALASGNGGDDNDLGFGKILNDPNLYTKLKNNPKTSEFMNDPQ
                     FVAKLERLKTNPQLGNPEMFSDPRLLTAFAALMGIDMNLPNMGFTAPNESQSNEPKEE
                     PKEEETKPKAKEEPKATEDKDTPMTDAQDETTNDAKSQADIAKAEGNTLYKKRQFDEA
                     IAAYNKAWELHKDITYLNNRAAAEYEKGDYDAAITTCEKAIDEGRDMRADYKLIAKSF
                     ARLGNIYLKKDELPEAVKNFEKSLTEHRTPDVLNKLRSTQREIKTRELNAYIDPEKAE
                     EARLQGKEYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLLSFPDAVQDCNK
                     AIEKDPNFIRAYIRKANAQLAMKEYSHVMDTLTEARQKDIELNGGVGKSTHEIDELMN
                     KATYQRFQAIEGETPEQTMERVSKDPEIVQILQDPVMQGILAQARENPAALQDHMKNP
                     EVYKKINMLIAAGVIRTR"
     gene            complement(<380367..>381593)
                     /gene="FCR3"
                     /locus_tag="CD36_51520"
                     /db_xref="GeneID:8048147"
     mRNA            complement(<380367..>381593)
                     /gene="FCR3"
                     /locus_tag="CD36_51520"
                     /product="AP-1-like transcription factor, putative"
                     /transcript_id="XM_002420411.1"
                     /db_xref="GeneID:8048147"
     CDS             complement(380367..381593)
                     /gene="FCR3"
                     /locus_tag="CD36_51520"
                     /inference="similar to AA sequence:UniProt:P38749"
                     /inference="similar to AA sequence:UniProt:Q8X229"
                     /note="partially functionally complements the fluconazole
                     sensitivity of an S. cerevisiae pdr1 pdr3 double mutant;
                     basic leucine zipper (bZIP) transcription factor,
                     putative; fluconazole resistance protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="AP-1-like transcription factor, putative"
                     /protein_id="XP_002420456.1"
                     /db_xref="GeneID:8048147"
                     /db_xref="GOA:B9WH93"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:B9WH93"
                     /translation="MIFKTENSSTPPNADWSQSKGFTNPGSSIPILEDDCELDHENLA
                     LLNSGEHVHEQIFHQTSELNGIGVVAPSPEMMVNLNNQPGYQYNNNNNNLAHDLYFTG
                     PMQMPSTQHPYTTNANNRLSYSNSSEEFSPVGANNMSPDSTGNSSNLAGNNNYNNNKR
                     KASNESFSPVSSSHHHYGTETGNNGISKASHRSRKKLLDEKDAALIARDDSELTEEEL
                     QLKRKAQNRAAQRAFRERKESKLKELEAKLLASEEERQKLLDELESIKKQNISIATEN
                     EILKHNGIGNTNNNNDIQIGNNIIGHGRLLVDKFNFPKTQKDFIQHVLQGTNHQLKDE
                     NKDKIYNDNQGHKLLALGAVWDYLQIKAEEADLDFNSIDFNDVMEKLKGNEKCHGYGP
                     AYPLELVNEAIESSLN"
     gene            <384649..>386445
                     /locus_tag="CD36_51530"
                     /db_xref="GeneID:8048037"
     mRNA            <384649..>386445
                     /locus_tag="CD36_51530"
                     /product="amino acid transporter, putative"
                     /transcript_id="XM_002420412.1"
                     /db_xref="GeneID:8048037"
     CDS             384649..386445
                     /locus_tag="CD36_51530"
                     /inference="similar to AA sequence:UniProt:P19145"
                     /inference="similar to AA sequence:UniProt:Q59YI5"
                     /note="Similar to S. cerevisiae GAP1; general amino-acid
                     permease, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="amino acid transporter, putative"
                     /protein_id="XP_002420457.1"
                     /db_xref="GeneID:8048037"
                     /db_xref="GOA:B9WH94"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:B9WH94"
                     /translation="MTTKEKDEFNIDSLQNSLEPSTNMTSPANTTPISKWQAFKDSFK
                     PQEQKPPLASSSSSSLSSSSPHHTDLANDYDIEKSLKPDQQGELRRDLKNRHVQMIAL
                     GGSVGTGLLIGSGGALHQGGPAALLIAWGITGTMVFCIIHSLGELCVAFPVNGAFSTY
                     ANMFVDSSWAFAVGWNYAIMWLIVLPLELVAAAMCITYWNDNINPASWVAIFYVMIVV
                     INIFGVKYYGDAEMYLTIFKIIAIVGFIILGVVLVCGGGPTHEFIGNKYWKQDGAFAN
                     GFKGVATTFVTASYSMAGSEMVGLASAEVANPQKSLPKAIRQVFWRIFLFYFLSLTFI
                     GLLVPSNSPQLLGASGTSASPFVIAIKNGGIYALPSIFNACILISVLSVGNSAVYGCS
                     RTIQSLGAQGLGPKIFAYVDRKGRPLGGLAMSAIFGLLCFLSAYHDEATIFNWLLSVA
                     GLATIFSWFNIGLCHVRFRLALRKQGRSLQELTFTALTGVAGSIYSMIFLCVVLVIQF
                     WTALFPLNNKGKANAENFFQNYLGAVVILIFYIGHKLYTRNWKLWVKLEDIDLDSGRR
                     SFDLDLIRAEIEEEKAANMAKPLYKRLWNYWC"
     gene            386489..386635
                     /locus_tag="CD36_51535"
                     /pseudo
                     /db_xref="GeneID:8048148"
     misc_feature    386489..386635
                     /locus_tag="CD36_51535"
                     /inference="similar to AA sequence:UniProt:Q59YI4"
                     /pseudo
                     /db_xref="GeneID:8048148"
     gene            complement(<387083..>387705)
                     /gene="MTLALPHA2"
                     /locus_tag="CD36_51540"
                     /db_xref="GeneID:8048149"
     mRNA            complement(join(<387083..387158,387218..>387705))
                     /gene="MTLALPHA2"
                     /locus_tag="CD36_51540"
                     /product="MTL alpha 2, putative"
                     /transcript_id="XM_002420413.1"
                     /db_xref="GeneID:8048149"
     CDS             complement(join(387083..387158,387218..387705))
                     /gene="MTLALPHA2"
                     /locus_tag="CD36_51540"
                     /inference="similar to AA sequence:UniProt:Q64HL1"
                     /inference="similar to AA sequence:UniProt:Q6B2C0"
                     /inference="similar to AA sequence:UniProt:Q9UW22"
                     /note="no gene name yet assigned to C. dubliniensis gene;
                     no positional orthologue on C. albicans chromosome 5;
                     spliced gene; mating-type-like protein ALPHA2, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="MTL alpha 2, putative"
                     /protein_id="XP_002420458.1"
                     /db_xref="GeneID:8048149"
                     /db_xref="GOA:B9WH95"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:B9WH95"
                     /translation="MNTHSEALFQINQRLLFHIRTLSNFPVFDPQKITSDVETDIKKM
                     VSIMKFKRLTNEDEAIMKMINDCSKVLQEMLLERIMLQQDSIQFFTEKEASDSSFSNT
                     VDDAIEDGDDRKTKSRRLTKKQLLVLEGWFQKHKNHPYSQKDQTNLLIKSTKLSKSQV
                     QNWISNRRRKEKNTKVSPELAALLLTG"
     gene            <388413..>389702
                     /locus_tag="CD36_51550"
                     /db_xref="GeneID:8048049"
     mRNA            <388413..>389702
                     /locus_tag="CD36_51550"
                     /product="oxysterol binding protein, putative"
                     /transcript_id="XM_002420414.1"
                     /db_xref="GeneID:8048049"
     CDS             388413..389702
                     /locus_tag="CD36_51550"
                     /inference="similar to AA sequence:UniProt:Q02201"
                     /inference="similar to AA sequence:UniProt:Q64HL0"
                     /inference="similar to AA sequence:UniProt:Q9UW21"
                     /note="Similar to S. cerevisiae OSH6"
                     /codon_start=1
                     /transl_table=12
                     /product="oxysterol binding protein, putative"
                     /protein_id="XP_002420459.1"
                     /db_xref="GeneID:8048049"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:B9WH96"
                     /translation="MGLTAKLDKLKLKTSSEDNEDDSSHAKLDNSDDIDEVDSEYQNI
                     LLSIIAQLRPGMDLSKITLPTFILEKKSMLERITNFFQIPKLLIESNNIEDPLDRFIG
                     ILRWYLASWHISPKAVKKPLNPVLGEVFTCYWDELPNNKSAYYLSEQTSHHPPKSSYF
                     YIMPEEKIRVDGVVIPKSRFLGNSSAAIMEGCGYVTLGKWDNEVYVMNQPNVYVRGIL
                     FGKMRTELGDHMYVKCERNGLEANIEFKTKGFIYGTYDSIEGIIKDLETQKDLFQISG
                     KWNEVMYIKNIKTGKKEVLYDTGGSKTLKPKVRPLKEQWDFESRKLWKPTITGLAQRN
                     HEIATEEKSKVENEQRIKAKKRLEDGVEFHPKFFREVNEGDKGVKNLEYIIYKKFDLK
                     EDPEILRERLFTVAPIVPGQKFDEKFHYPAFKKPESN"
     gene            <389940..>392873
                     /locus_tag="CD36_51560"
                     /db_xref="GeneID:8048150"
     mRNA            <389940..>392873
                     /locus_tag="CD36_51560"
                     /product="phosphatidylinositol 4-kinase, putative"
                     /transcript_id="XM_002420415.1"
                     /db_xref="GeneID:8048150"
     CDS             389940..392873
                     /locus_tag="CD36_51560"
                     /inference="similar to AA sequence:UniProt:P39104"
                     /inference="similar to AA sequence:UniProt:Q64HK9"
                     /inference="similar to AA sequence:UniProt:Q9UW20"
                     /note="Similar to S. cerevisiae PIK1;
                     In S. cerevisiae: catalyzes first step in the biosynthesis
                     of phosphatidylinositol-4,5-biphosphate; may control
                     cytokineses through the actin cytoskeleton"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphatidylinositol 4-kinase, putative"
                     /protein_id="XP_002420460.1"
                     /db_xref="GeneID:8048150"
                     /db_xref="GOA:B9WH97"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021601"
                     /db_xref="InterPro:IPR027003"
                     /db_xref="UniProtKB/TrEMBL:B9WH97"
                     /translation="MSENTPEAPSKQLLERIQSSSFSLFNCIYELKNHNDSIGIQHEL
                     VKKLYSFPYEDLQFFIPQFVQLLVTYDSNSMALEEFIITSSCRYPHFSLIVFWNLQAY
                     IFELKNEPESRSFQAARNLVTKIQNIMFNTELSVVKAPEFRENLFPALVLCGAVASSA
                     LLPSFKNYCLPMIKAQGKQQKSLVFKLANFQKSLTKNLTLKNQRMSADIPKESHSDDE
                     TVVSSSIKPSLSRSASVPRRSTKKASLSFSSDESEAYTTDDDDNKTSIELEKEFYKMD
                     LNGSLKGGSTKFLETEENLHVNTAIKSKKRLSTLTSKVMASSWDSMDGYNVNSQSLPD
                     LSKADSRDLIPFLSSTESETSLLYNNNAIANDLQKNTLQQPKFMPGFDNDYLTKILQV
                     NYAKNETQFIMALQNISIRLSQVPKEARLSALRAELSIINDTLLPSEIDIPQLLPVTS
                     NRNKKYHKILKLNVNEASVLNSAERVPFLLFIEYLSDEIDFNPTTEYNQRIIARKNIV
                     GATNTSVKKMNSFSEVPDGNFSKENNLESHITETVTSAICNESTEEADLSEMPIARRT
                     AVSSDSFSPEMLVTPTVTEQSKLSGFPSLNSKEVSTKVLADQMRIAAVMLQQLDSSGK
                     ANSEQSFLIKNRIVESMIALQDQFDSFDFEKLSQLQSDQPSAGERKLENDFKLGEDWN
                     TKKQRIKKSSAYGHLKNWDLCSVIAKNGDDLPQEAFACQLISMISNIWKKNQVPVWTK
                     RMKILITSANTGLVETITNAMSIHSIKKSFTEHSIKSGENDKGKIFTLLDYFHSVFGS
                     ENSVSFRTAQQNFAKSLAAYSIICYVLQIKDRHNGNIMVDRDGHIIHIDFGFLLSNSP
                     GSVGFEAAPFKLTVEYVELLGGVDSEIYSQFVHLCKQCFKSLRDNSEEIIEIVELMQR
                     DSTLPCFNNGENTSVLLRQRLQLQLNDEDTDQFVENFLIGKSLGSMYTRLYDQFQMIT
                     QGIYS"
     gene            <393082..>393663
                     /gene="MTLALPHA1"
                     /locus_tag="CD36_51570"
                     /db_xref="GeneID:8048151"
     mRNA            <393082..>393663
                     /gene="MTLALPHA1"
                     /locus_tag="CD36_51570"
                     /product="MTL alpha 1, putative"
                     /transcript_id="XM_002420416.1"
                     /db_xref="GeneID:8048151"
     CDS             393082..393663
                     /gene="MTLALPHA1"
                     /locus_tag="CD36_51570"
                     /inference="similar to AA sequence:UniProt:Q64HK8"
                     /inference="similar to AA sequence:UniProt:Q9UW19"
                     /note="no gene name yet assigned to C. dubliniensis gene;
                     no positional orthologue on C. albicans chromosome 5;
                     mating-type-like protein ALPHA1, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="MTL alpha 1, putative"
                     /protein_id="XP_002420461.1"
                     /db_xref="GeneID:8048151"
                     /db_xref="GOA:B9WH98"
                     /db_xref="InterPro:IPR006856"
                     /db_xref="InterPro:IPR016325"
                     /db_xref="InterPro:IPR017931"
                     /db_xref="UniProtKB/TrEMBL:B9WH98"
                     /translation="MGNKKRSMKTVPKEFTSLFRVHPGRDPPRRDTREVQKSKKHGFR
                     FTSLPDLPVASNALQELLLEYGLLNDIRWDSKGSKASKTKKIKLKPINSFIAFRSFYS
                     RTISNPEHQRELSSKLAEVWTQESNQEVWKQYTQSYNNYLLLPEAKLNFVDWLCEALD
                     YTIENATPSLEDISLTSYNQLLSGTIEDVYMLK"
     gene            complement(<393698..>395374)
                     /gene="PAP1"
                     /locus_tag="CD36_51580"
                     /db_xref="GeneID:8048048"
     mRNA            complement(<393698..>395374)
                     /gene="PAP1"
                     /locus_tag="CD36_51580"
                     /product="poly(A) polymerase, putative"
                     /transcript_id="XM_002420417.1"
                     /db_xref="GeneID:8048048"
     CDS             complement(393698..395374)
                     /gene="PAP1"
                     /locus_tag="CD36_51580"
                     /EC_number="2.7.7.19"
                     /inference="similar to AA sequence:UniProt:O42617"
                     /inference="similar to AA sequence:UniProt:P29468"
                     /inference="similar to AA sequence:UniProt:Q64HK7"
                     /note="In S. cerevisiae: one of three factors required for
                     mRNA 3'-end polyadenylation, forms multiprotein complex
                     with polyadenylation factor I (PF I), also required for
                     mRNA nuclear export; may also polyadenylate rRNAs;
                     polynucleotide adenylyltransferase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="poly(A) polymerase, putative"
                     /protein_id="XP_002420462.1"
                     /db_xref="GeneID:8048048"
                     /db_xref="GOA:B9WH99"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="InterPro:IPR007010"
                     /db_xref="InterPro:IPR007012"
                     /db_xref="InterPro:IPR011068"
                     /db_xref="InterPro:IPR014492"
                     /db_xref="UniProtKB/TrEMBL:B9WH99"
                     /translation="MNTKTYGVTEPISTNGPTPKENILNDTLIQELKNRGSFESEQAT
                     KKRVEVLTLFQQLVQEFVYTVSKSKNMSDAMAQDAGGKVFTFGSYRLGVYGPGSDIDT
                     LVVVPKHVTRDDFFSVFADIIRKRPELEEIACVPDAYVPIIKIEFDGISIDLIMAKLN
                     IPRVPLDLTLDDKNLLKNLDEKDLRSLNGTRVTDEILQLVPKPTVFKHALRCIKMWAQ
                     QRAVYGNIFGFPGGVAWAMLVARICQLYPNAVSSVIVEKFFNIYTKWNWPEPVLLKSI
                     EDGPLQVRVWNPRLYPHDRLHRMPVITPAYPSMCATHNITSSTQKVILAELSRGSSIM
                     QDIHAGKKSWSDLFEKHCFFYKYKFYLCVVAATIDSAEEHKKWSGFIESKLRQLVLKL
                     EVAEGVEIAHPYVKDFSHTFLLDDKNAEDIINSYGTLSGEAFLRTLHSSDSDKDSDEH
                     NKIRLTKYYIGLDLNLTKSSDGVRKLDIQYPCAEFYSICKGSTSFTEGVNFIQIKNVK
                     LHDLPNDVYEDGEERPIKSGKKRKKVIKEDGQKRVRNESSASSASLNGSS"
     gene            complement(<395973..>398672)
                     /locus_tag="CD36_51590"
                     /db_xref="GeneID:8048050"
     mRNA            complement(<395973..>398672)
                     /locus_tag="CD36_51590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420418.1"
                     /db_xref="GeneID:8048050"
     CDS             complement(395973..398672)
                     /locus_tag="CD36_51590"
                     /inference="similar to AA sequence:UniProt:Q59YW4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420463.1"
                     /db_xref="GeneID:8048050"
                     /db_xref="UniProtKB/TrEMBL:B9WHA0"
                     /translation="MLKYQNISPLLIYRSRPNNLPIIKTSCSSSAFLSVYRLIFYQQK
                     RLSTSKSFFEQTDQPSTTTTTTKTIPINEYSIPHKISKYLSDLLIAQNERFLDEPIQN
                     LIEQIPNLSNELKRSIDFENKLFTILSYDPILIDPRIYLHYYDGIASLSFSSSSISSE
                     TSLKKLYIERLLYHRKFHLCWQLFLDSCNNNNNNNNTLNELDEFLETIHNYLINKSGS
                     YKFNLLDLIINLPQNINENNMLQQIIDSIEYICKPDFNIEQMLQISMDINQIYNLNEL
                     EKYYSNCQQDQNQDTFALDVLYLKRVMKLILQQQETSKGKKGIIQNYLLQFPHITSQP
                     GWLSSIFPSFSSSTNFVPKNSNQDIIKPPRDIIPFIEASKFIIHDKETKLNELDILYI
                     LRENLVKPYTIYSAYNQSTIVPITQQNQKKKRTKNKIIINELTRNLLNDPPRLQIIYK
                     ENMNLLNESLIMECLNILIPFSENIKDCNEVFNKFDEKIRLNIIQSIDIVNKLNCWQI
                     ENLILKYNYHEHKFTRVLINRYLYLYRSETMELDQLIKLAKSKQIKSRNALLEINRAS
                     LLRGSDDIDPTLVCIIFDRLIQLTVPKQSGGSSNDNHEVMTTTATNNNSQFALQFKWN
                     LTRKEKNKFHQTIRSFAQTLSLLTPDKLLKILIILGKFMKDNQQFYYHNDTEGKNYLI
                     KCLTNDIFQFINRNNKGRKSVDYINSLLDQINQDSLHVGEPKILYWIEYWWFKSIVLN
                     DYQKSFELLSNPSTTTTTTTMEMQKRNTRNNLIKFIPAIISGIIDNKQFNSIEDKFEF
                     LIKFLMDLKLNNFNNKLTMNASVKLINQIIKSNKGNNIKNTPDSNNNNNNNNNNNNTS
                     INSLNTTTNINTKSQLLNLIQSNPKMKQAIKLIVHHHKNKSHS"
     gene            <399125..>401668
                     /locus_tag="CD36_51600"
                     /db_xref="GeneID:8048152"
     mRNA            <399125..>401668
                     /locus_tag="CD36_51600"
                     /product="endocytic membrane traffic recycling protein,
                     putative"
                     /transcript_id="XM_002420419.1"
                     /db_xref="GeneID:8048152"
     CDS             399125..401668
                     /locus_tag="CD36_51600"
                     /inference="similar to AA sequence:UniProt:P39531"
                     /inference="similar to AA sequence:UniProt:Q59YH7"
                     /note="Similar to S. cerevisiae RCY1;
                     In S. cerevisiae: involved in recycling plasma membrane
                     proteins internalized by endocytosis; recyclin, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="endocytic membrane traffic recycling protein,
                     putative"
                     /protein_id="XP_002420464.1"
                     /db_xref="GeneID:8048152"
                     /db_xref="GOA:B9WHA1"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR009976"
                     /db_xref="UniProtKB/TrEMBL:B9WHA1"
                     /translation="MAQVIWNSDIDVYNKDVMPINIAENIVKYLPIQDLLSFSQVSKN
                     CHLAVNDPKLWVSMLKGMRVWQESKQLTKQDIKSNKFGNYLNDPLTCMDYIYRSNKNA
                     KFQVIKIYKCLHEFYNDLLIQQNYNRLKIFKRFQTPQDQVKILKNLRKFNKIDYIEST
                     RIIANEKIMQLFELLENALLRELEIHFDLEDYIKTKQFVNILIDLNNNNNNNQQILID
                     FFLQKSIFDENIELFNLENYDEMKYFKINEKRGEEEEKIDSIEKSINNDGIDELIINI
                     AKVFNQQSHIIDLIFPQSIPMMYKVSEELISNQLSELLMLLIESSKKFGLYSELVPMI
                     YEKLTMNLFIEKLNPSKNVGESYHQLIIELTDMSFESFTAEYMREEVGSFKNNTKRKL
                     LDWEQLISKREQETSQKILDRVKIETKNDFLTSFKNVFTINSSKNKQPIDNSKHSHDD
                     NSQSQEEVEAYSEIQAKAKILSENIKSLDKIFNPELTVEILNDCRISIHRLLKFQNFS
                     IASVRQDIFQSIQNCFVELIELINSDHLLPGFDRALTYLQTYNPKSSTYTKSHNETFD
                     QPLILFFNLINMADIIIQMIDIFYKQEILITQQNENSILNPSLQNKKKLEAIVDKYVA
                     DGLNIGIEILIDQVETIYQQNLSDKDYYPDQQEKQQQQQQQTESEQYSQAIPIPTPSK
                     PNTLSNFGPTEAAIKATEILEQNMNLLVDSADKSIVDVFQQEIAERFFQIIVKSLKLQ
                     TISVMGATRLISDLNLYFKFINNNVKSNKRLILPLYQALIKIGNIYLISGDDSKSIGK
                     LVSDLSKFNGIFSQEEIYEFVQRRQDWSIIKKHVEKVMYGFGFGDCTIS"
     gene            <401938..>404343
                     /locus_tag="CD36_51610"
                     /db_xref="GeneID:8048153"
     mRNA            <401938..>404343
                     /locus_tag="CD36_51610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420420.1"
                     /db_xref="GeneID:8048153"
     CDS             401938..404343
                     /locus_tag="CD36_51610"
                     /inference="similar to AA sequence:UniProt:Q59YH6"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420465.1"
                     /db_xref="GeneID:8048153"
                     /db_xref="UniProtKB/TrEMBL:B9WHA2"
                     /translation="MNSSFIIKVPIRSYLPEQFLRRSVTRVTPSLLIYISKRHNSTTQ
                     QQQQQEEQVLLLEPQDRFNYIKSLKSRKEIRKNLNRIYRLKNINFTKELIELNEYDYD
                     YEHKYKSILNRISKDYLYEDICELILEGDLSTLKRINLKNIRPKIDSEDHNSSSQSND
                     ASDTSIGEYINKFLLILINEGEYIKAIKFMIRFINKYKDEIPLPIIQYETFQFLLNQI
                     DNNSTIDDLSMINYGLLQICVNHYQGIEELKDYEMLLLLKIFNKNLIHGNYFSNYYYD
                     WLLIKNCEFLNFINNEKYSKLYFQLICQMLKTNLINLNSYRCLTIWKDNQKFIINKII
                     GNNEDDDKKVEIIDEILLNEFLDIMIEIFKLFTDKNQPILNNDVTLILDKFSEIDRIN
                     QNDKFINYKLQFYGTIVKNQQIFGNIITNQLNSSGSSSSSTTNKNKNVDGLTINKKFI
                     NRKNLSHLFVGFLNLNDEINSNKILETIHKQYSNPNIYYSTGTGTDNNNNNNNNNNNN
                     NNNNDNSFLNQYEINEIIKKLLTSHNDIIKSLELIENLSWNHCKWSYLEIFNYILVNA
                     TSEQQKDVEKFLKDFQLRLVENFKDEIFLEELTIIILKHISIMDNRDAIRLYNKILKL
                     SSNTSVVIARTSSTSSTSFINNKPNEPPILEPQPPPPQITNNTRGNLNTSDISLFEYL
                     NIEEIFDKYTLKSRNKKLRKSLLINERIKYLPDWLINKNYLKLINKNSMIKICLNLLI
                     QSIIEKDYYCIIWLFDELRKFGWRIEDILWYCNSYDLQDYLQEIINEKVLLHYKLKHH
                     HHH"
     mobile_element  complement(404394..404725)
                     /mobile_element_type="retrotransposon:solo LTR, upsilon F"
     gene            complement(<404910..>405557)
                     /locus_tag="CD36_51620"
                     /db_xref="GeneID:8048154"
     mRNA            complement(<404910..>405557)
                     /locus_tag="CD36_51620"
                     /product="mitochondrial 54S ribosomal protein YmL36"
                     /transcript_id="XM_002420421.1"
                     /db_xref="GeneID:8048154"
     CDS             complement(404910..405557)
                     /locus_tag="CD36_51620"
                     /inference="similar to AA sequence:UniProt:P36531"
                     /inference="similar to AA sequence:UniProt:Q59YH5"
                     /note="Similar to S. cerevisiae MRPL36"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 54S ribosomal protein YmL36"
                     /protein_id="XP_002420466.1"
                     /db_xref="GeneID:8048154"
                     /db_xref="GOA:B9WHA3"
                     /db_xref="UniProtKB/TrEMBL:B9WHA3"
                     /translation="MLIKRIISLKSLPISVISTRSKSTTSSSSSSSSSSGSSSPYGDV
                     NLSNRRIMKRIIQGKARPAIFYQFETLIELSDGSVIKRYSQAPKDEIRMINDQRNNLI
                     WNPNNNDLINGGGLGGGDLQAKGKINKFKSKFANSFEEGEREEQQKEVVVDEGEGERE
                     GEGEGEVDEEIIRRKQLELQKARDEELFELMGENAQEVDGGGKLYDKKADKKRFK"
     gene            <405896..>407566
                     /locus_tag="CD36_51630"
                     /db_xref="GeneID:8048155"
     mRNA            <405896..>407566
                     /locus_tag="CD36_51630"
                     /product="subunit of the cytosolic chaperonin CCT ring
                     complex, putative"
                     /transcript_id="XM_002420422.1"
                     /db_xref="GeneID:8048155"
     CDS             405896..407566
                     /locus_tag="CD36_51630"
                     /inference="similar to AA sequence:UniProt:P42943"
                     /inference="similar to AA sequence:UniProt:Q59YH4"
                     /note="Similar to S. cerevisiae CCT7;
                     In S. cerevisiae: required for the assembly of actin and
                     tubulins in vivo"
                     /codon_start=1
                     /transl_table=12
                     /product="subunit of the cytosolic chaperonin CCT ring
                     complex, putative"
                     /protein_id="XP_002420467.1"
                     /db_xref="GeneID:8048155"
                     /db_xref="GOA:B9WHA4"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012720"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:B9WHA4"
                     /translation="MAFSNQTPTIVVLKEGTDSSQGRGQILTNINACLAIQDTLKPTL
                     GPFGSDILIVDGNGRATISNDGATILKLLDIVHPAAQMLVDISRSQDCEVGDGTTTVT
                     ILAGELLKEAKNFIEDGMNPHLIIKGYRKACQLCIEKIESLSIDILTKDNGNDNDNLE
                     FRDLLEKCATTAMSSKLIKANSKFFTKMVVDAVLTLDQNDLNENLIGIKKIPGGSLED
                     SLFIDGVAFKKTFSYAGFEQQPKSFKNPKILCLNIELELKAEKDNAEIRIDQVNQYQE
                     IVDAEWKIIFDKLQSIYKTGAQIVLSKLPIGDLATQFFADRNIFCAGRVNDDDMNRVI
                     QAVGGDIQSSCSNLLKDGKLGQCESFEEIQIGNERFNIFKGCPKTKTCTLILRGGAEQ
                     VIAEVERSLHDAIMIVKRSITHKKIVAGGGAIEMELSKYLRDYSKQIHGKQQLIIAGF
                     AKALEIIPKQLCENAGFDSIELLNRLRSYHAKGETWYGIDFQLENIGDNFKNFIWEPS
                     LVKINALSSATEAATLLLSVDETIRNDEQDQQQQGQPQMAPGRGRGAF"
     gene            <410367..>412544
                     /gene="CLN1"
                     /locus_tag="CD36_51640"
                     /db_xref="GeneID:8048156"
     mRNA            <410367..>412544
                     /gene="CLN1"
                     /locus_tag="CD36_51640"
                     /product="G1/S-specific cyclin, putative"
                     /transcript_id="XM_002420423.1"
                     /db_xref="GeneID:8048156"
     CDS             410367..412544
                     /gene="CLN1"
                     /locus_tag="CD36_51640"
                     /inference="similar to AA sequence:UniProt:P13365"
                     /inference="similar to AA sequence:UniProt:P24866"
                     /note="In C. albicans: required for maintenance (not
                     initiation) of hyphal growth"
                     /codon_start=1
                     /transl_table=12
                     /product="G1/S-specific cyclin, putative"
                     /protein_id="XP_002420468.1"
                     /db_xref="GeneID:8048156"
                     /db_xref="GOA:B9WHA5"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014399"
                     /db_xref="UniProtKB/TrEMBL:B9WHA5"
                     /translation="MASLQQQQHQQPLKVKYGPPHHIKRRPYHPILESLEFQSNQQLI
                     QEYSSDIINTLSHLESLTLINPAMIDLQPEIQWFMRPFLLDFLIELHSSFKLQPTTLF
                     LCLNIIDRYCAKRIVFKRHYQLVGCTALWIASKYEDKKSRVPTLKELTIMCRNAYDEE
                     MFVQMEMHILSTLDWSIGHPTLEDCLQLAIDSNNFSNNNATTTTTTNRKSSISSAVTA
                     VARFLCELSLYDKYFLSVSPSLIAITANLLSCSMLQIPHASITLKNLIEQEIINPQKI
                     QIQRQKQQKQQQRQEQQKKAKVTPNYIHHNQLDARHSSIDEDIDLDSEEDDEDDDYID
                     EFYETNYYNNNNDDTNITTFDEDINNSTNIINDENQPPKIHTPFLSGLDEDSILSIKK
                     ICLMLIIQLSKVTEVLSKKYENLGVIQVINNFHSNYKFIIQSIYENQELLLNSLINDT
                     NTNNGNVNEIDYKLIQSSEILLQFPKFDEYLTEDEDENVSTDDEDDTNESQGYNDNTT
                     NNNNQLFTPKSPNVFSSNSSLTLNNNNQHPQFQSMVPITPPSATSQYSLFSNKNNRIH
                     ESTSGLNSTCNTPTHISINSFAPPQPPPGSILKPKLTSTNNNNNNNNNNNNSTNNSSS
                     NLKIKKLTINNNSSNISIKQEKRYSHISIGSNNSNNSTSNISNISNISKYDGFSPIKS
                     ISTNGSFTNITTSSSSPLMNQYHQQQQQQQMNQSSIYQQHNYH"
     mobile_element  413412..413928
                     /mobile_element_type="retrotransposon:solo LTR, episemon
                     G"
     mobile_element  complement(413965..414584)
                     /mobile_element_type="retrotransposon:solo LTR, moa C,
                     truncated"
     gene            <416732..>422605
                     /locus_tag="CD36_51650"
                     /db_xref="GeneID:8048028"
     mRNA            <416732..>422605
                     /locus_tag="CD36_51650"
                     /product="type II myosin heavy chain, putative"
                     /transcript_id="XM_002420424.1"
                     /db_xref="GeneID:8048028"
     CDS             416732..422605
                     /locus_tag="CD36_51650"
                     /inference="similar to AA sequence:UniProt:P08964"
                     /inference="similar to AA sequence:UniProt:Q59N33"
                     /note="Similar to S. cerevisiae MYO1;
                     In S. cerevisiae: required for wild-type cytokinesis and
                     cell separation"
                     /codon_start=1
                     /transl_table=12
                     /product="type II myosin heavy chain, putative"
                     /protein_id="XP_002420469.1"
                     /db_xref="GeneID:8048028"
                     /db_xref="GOA:B9WHA6"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR027401"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WHA6"
                     /translation="MVSSSRTNDNNHEDPIISKNWVWVPNQQDLFTKGYITDYLPNGK
                     CKVNVVKGQEASHDSTIVVDQDKLENCNPVKFNKCEDMAELTHLNEPSVVYNLYLRYL
                     DDLIYTYSGLFLVAINPYKSLPIYNQSILMKYHQYNNVTTNNNDYKSKNSQNLTSTNN
                     TSNNNNKGQSPPHIFAVAESTFRNLLSNKKDQSILVTGESGAGKTENTKKIIQYLSSI
                     TSSNHGNKVDNNNIDTKILQANPILESFGNAKTIKNNNSSRFGKFIQIYFSNTGEISG
                     ANINYYLLEKSRVISQSNHERNYHIFYQFLKGYENLPSLGLNKDMSTYNYLSGGKLTI
                     NNVDDFKEFNLLVEAFKIMGLTINEMNFIYQVLAIILHLGNINFTSWKSEQANFTNDS
                     PIDKICELLAIDKDLFVQNLLRPKVKAGREFITKSKKPNEVKFAIDAFAKYLYEKLFQ
                     FIITKINEKLDQSNTGNDNSNKNNDNNFFIGVLDIAGFEIFEINSFEQLCINYTNEKL
                     QQFFNHHSFILEQSEYLRENINWEFIDFGQDLQPTIDLIETKQPMGILKLLDEECLMP
                     KSSDASFMEKLSKNFSNTHKKFSENKFKNGFIIHHYAGKVEYNVENWLQKNTDPISES
                     ILNLLPDSQNELVAEMFINDPHINRPQTNGGGNSKLITASQKHKDQLKTLMDQLESTE
                     PHFVRCILPNLEKRANKFDKNLVLGQLRCNGVLEGIRITRAGYPNRMMFDEFIQRYSI
                     ICDNELSSSQARTNCEIILKYVKLNPEDFKVGLTKIFFKNGILGKLEIIRDLALKNIF
                     TDLQKVIRGNLTRLILKQKIKEIQSAQIISRTMVTLDEIKSNSPWMTLFFHVKPLLED
                     SVKVLDSKKLQENLQTLTVKLKDSEKLTKGLEMDNEKLREQMNTLQDEMINITSIAKE
                     KDDKLSQLRLTENKSKHRIETLEIKLKDFEKQNQDLINEHEKLTRRSLELHDKHNEKV
                     EELNSLNKLHDAAQSELSNLKQQLKEITKLKQDHSKELLKFKQMHDKSIEDSNEKMQR
                     LESLNKKLKADLNSSKDEISNEHGKLQNEIIKLKELCSDYERKQKDSQRTIDSLQIQL
                     KKDEDYKSKYDLKIEEAKEKVTLLKGKVEKKSQEIDQYKSEIKNLKTELASSNSKITQ
                     LDKSTKELAVLKSKESKYIEEMESTKQQLSKKIEEYSSIETDYNRLQIELKQMKQTNT
                     EYGTRIAELNSQLSQVTEEAKSKEIEKENQPPNPQFMEEFTHMKLKVNEQTASLRKEK
                     FENKKLSEELQMLKERIMNGSLTSMDLTPKRRSLAIGDKSMITNTVDSFNKEIENLKF
                     QLQQEQGNFQRAENYAIELQKKLNKLLTTRGLNTNTDYEKKFYESQKRITQLESKIGK
                     LLANSGGDYDDTDIDGNDDDWELRSSTGVGGGGGGGGSTSSSARNSLVKSESITAFHN
                     MRGVSQDYIQIYQDITKTLKSTREELNASKTEILRLKALLRESEDELYQVKQENYKAS
                     VHDYEQDLAQLKVKHETLLSRNKDINESLEIYKKRSDEYYKKLELAESAIVISKRHEE
                     QATKEMKESKSQLLLVREELRTSSILIKDFRIKVGNLEATIEEKNHQLDSNKEELKQL
                     QDKLNYHLKNFENKELNEKLKEEIKNLNRDLDFKTDIETKLIKENKKLQLDYEDILLV
                     KNNLQNEVEELILQEEKLQNKIDELTNTNRQLENEKLINERKIVNCTKQISGLKELVD
                     EISIERDKLLKDKDILQNDLQNMTTKFDSTTTELKQAHGELDFLKKHLEIQREDSEAI
                     KTELNQSKMSTSFDIRDQQKLRNELLVTKEENFSLSKTNKELNLKVSDLEDKLYSNEQ
                     LKYWESKVDTLSKALDGALNEKHESDKIIKDLQRTIKQLEIRVENESQLSKRYNDENF
                     DYQNKINHYKSTIDIIHNENIEKDLQLKSIQRENIEMKESMLMLQKEVLELRERLQV"
     gene            complement(<422745..>424310)
                     /locus_tag="CD36_51660"
                     /db_xref="GeneID:8048157"
     mRNA            complement(<422745..>424310)
                     /locus_tag="CD36_51660"
                     /product="mitochondrial-processing peptidase (MPP) alpha
                     subunit, mitochondrial precursor, putative"
                     /transcript_id="XM_002420425.1"
                     /db_xref="GeneID:8048157"
     CDS             complement(422745..424310)
                     /locus_tag="CD36_51660"
                     /EC_number="3.4.24.64"
                     /inference="similar to AA sequence:UniProt:P11914"
                     /inference="similar to AA sequence:UniProt:Q59N32"
                     /note="Similar to S. cerevisiae MAS2;
                     In S. cerevisiae: essential processing enzyme that cleaves
                     the N-terminal targeting sequences from mitochondrially
                     imported proteins"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial-processing peptidase (MPP) alpha
                     subunit, mitochondrial precursor, putative"
                     /protein_id="XP_002420470.1"
                     /db_xref="GeneID:8048157"
                     /db_xref="GOA:B9WHA7"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:B9WHA7"
                     /translation="MLSKRTITKKLNKSISTALLSFPRYNHSITTTTTPASSQPHIEL
                     TTFANGLRLITDSTPGHFSAVGAYIDAGSRYEDPKAPGLSYLRDRLSWKSTEDFTGQQ
                     MLENLSKLGGNYMSSGQRESMIYQASVFNKDIDKMVGMIGQTIRYPTFSDQEFQEALQ
                     TAEYEVAELAYKSDLYLPEELHTVAYKENTLGLPLFIPQERIPLVSKSDIVNYNNKFF
                     QPQNTVIAMVGVPHEYALKLIMENFGDWENKTTTKPNLGIKNYTGGEISLPYTPPLYA
                     NLPELYHIQIGFETTGLLNDDLYALATLQKLLGGGSSFSAGGPGKGMFSRLYTQVLNK
                     YPFVENCMSFNHSYIDSGIFGITLSLVPEAAHVSSQIIAHELSQLLVIEESQGGMNSK
                     EVQRAKNQLISSLLMNVESKLARLEDLGRQIQCQGKITTIDEMVDKINRLTIKDLQNV
                     AEKVLTGNVITSNSGTSSGLPSIVMQGEREAFGDVEFILRKYGLGNFKGPEITEPRDF
                     SNQNTKEKKSRWL"
     gene            complement(<425105..>427927)
                     /gene="HYR3"
                     /locus_tag="CD36_51670"
                     /db_xref="GeneID:8048158"
     mRNA            complement(<425105..>427927)
                     /gene="HYR3"
                     /locus_tag="CD36_51670"
                     /product="hyphally-regulated cell wall protein precursor,
                     putative"
                     /transcript_id="XM_002420426.1"
                     /db_xref="GeneID:8048158"
     CDS             complement(425105..427927)
                     /gene="HYR3"
                     /locus_tag="CD36_51670"
                     /inference="similar to AA sequence:UniProt:P46591"
                     /inference="similar to AA sequence:UniProt:Q8TGE1"
                     /note="this is more liklely to be HYR3 orthologue, since
                     (a) it is the best BlastP hit on CGD web site, and (b)
                     HYR3 is on C. albicans chromosome 5, whereas HYR1 is on
                     chromosome 1"
                     /codon_start=1
                     /transl_table=12
                     /product="hyphally-regulated cell wall protein precursor,
                     putative"
                     /protein_id="XP_002420471.1"
                     /db_xref="GeneID:8048158"
                     /db_xref="InterPro:IPR021031"
                     /db_xref="UniProtKB/TrEMBL:B9WHA8"
                     /translation="MIPNLAVTLLLLANSILAVDITSNRVDHGTVQNINGNVRIHSGA
                     YWSLIDNSLTTFTGGLQVDSDAGLYIKSNGPVLSLNVNLASLIDPVLNDGIISFDSRK
                     STSTSNYNIGGSSFTNNGEFYIASSGAGNSVSNLYARKWTNNGLIVASQNQRSSGLFS
                     IGTAGQSITNDGQICLYNQVFRQNTKVEGSGCITADENSSIYISNALTPISQSQSFYL
                     ADSKSSLIVQAVSSNQTFNVYGFGEGNKIGLTLPLTGTASNLPYEYNTETGILTLRAG
                     LLPQSFNIGTGYVTSLFSVVTDNGAGIPDAPKGAVTYSGPIPSRSIPDVCKQECKKVP
                     DTPEDAPSSSSSAEPSSTAEPSSSAEPSSSAEPSSSAEPSSSAEPSSSAEPSSSAEPS
                     SSAEPSSSAEPSSSTEPSSSAEPSSSAEPSSSAEPSSSAEPSSSAEPSSSAEPSSSAE
                     ESSSAEESSTAEPSSSTESGATSEYTTTWTTTNSDGSVETDSGIVDQSGSSLTTISTF
                     PGDQTSEYTTTWTTTNSDGSVETDSGIVDQSGSSLTTISTFPGDQTSEYTTTWTTTNS
                     DGSVETDSGIVDQSGSSLTTITTFPNDGTSEYTTTWTTTNPDGSVETDSGIVRQSGSS
                     LTTISTFPGDQTSEYTTTWTTTNSDGSVETDSGIVRQSGSSSTTFTTFPHGSDAGKST
                     VYTKSTVTATITHCSENKCSEDVVTYFTTVPCSTEGVNTDAQPTDDSNKSTVYTKSTV
                     TATVTHCKDSKCSEDVITYFTTVPCSTVAATTEAVATGDNSNEGSNNGSNNGSDHGSD
                     HGSDNSSNNSSNNGSDHGSDNSSNNGSDHGSDNSSNSGSDHGSDNGSNNGSNNGSNNG
                     SDNGSNNGSDHGSDNGSNNGSDNGSGNGPKPETTLAVVTSPGSTTGSTPSSGPTVAAN
                     ENGSSNVSVGKTMLFGFLATVFVLFI"
     mobile_element  complement(429997..430253)
                     /mobile_element_type="retrotransposon:solo LTR, iota E"
     gene            <434363..>436150
                     /locus_tag="CD36_51680"
                     /db_xref="GeneID:8048043"
     mRNA            <434363..>436150
                     /locus_tag="CD36_51680"
                     /product="GTPase-activating protein, putative"
                     /transcript_id="XM_002420427.1"
                     /db_xref="GeneID:8048043"
     CDS             434363..436150
                     /locus_tag="CD36_51680"
                     /inference="similar to AA sequence:UniProt:P48566"
                     /inference="similar to AA sequence:UniProt:Q59XE7"
                     /note="Similar to S. cerevisiae MSB3;
                     In S. cerevisiae: regulates exocytosis via its action on
                     Sec4p, also required for proper actin organization"
                     /codon_start=1
                     /transl_table=12
                     /product="GTPase-activating protein, putative"
                     /protein_id="XP_002420472.1"
                     /db_xref="GeneID:8048043"
                     /db_xref="GOA:B9WHA9"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:B9WHA9"
                     /translation="MVTTENVSSDIKITTTPNELLDPNNNISTLDKTNHQRNESSYSQ
                     NFSFLREYDIDSPSHRNSMSEDEIDQELPDPSFLNEIDNLELLQGTSNDDSSTPTNNY
                     QSSEEEIKSNRDSFVKPTNSETDEQILKSDYDRYGFKKTSSVTGLTLDEYNEWFKSYS
                     QYSQTRKKKWLILMKNNGLHVNDSDTESYNNNNNNVPTRFPPRSDKVKKMIRRGIPPE
                     WRGNAWFFYAGGYEKLSKNVGTYEKIVKATYNVKTKDTEVIERDLNRTFPDNIYFNSS
                     IKGIFSSMETLQQEKEHETLLIKSLRRVLVAFAQHQPQIGYCQSLNFLAGLLLLFMEE
                     ERAFWMLVILTERIIPKVHSANLEGVHTDQGVLMLCVKEYIPQLWQVLGKNFDGETLS
                     EDKILSRLPPVTLVTSSWFMSLFVGILPIETTLRLWDILWYEGSKTIFRFSLTIFKMC
                     SDSPEFNIKQNRRRDGGESEQIELFQFMQNFPKKILDANLLIDFCFKKIGGYGFGSLS
                     QDEINKCRAFVSKQREKMNKKSNQKGLTDMTDEERNTLLKSSTGFETSDIHDVYGFNR
                     SIMSGMVWNKNISNKMKKKFVVGKRNSSR"
     gene            complement(<436170..>438572)
                     /locus_tag="CD36_51690"
                     /db_xref="GeneID:8048159"
     mRNA            complement(<436170..>438572)
                     /locus_tag="CD36_51690"
                     /product="folic acid synthesis protein, putative
                     [includes: dihydroneopterin aldolase (ec 4.1.2.25);
                     dihydro-6-hydroxymethylpterin-pyrophosphokinase (ec
                     2.7.6.3); dihydropteroate synthetase (ec 2.5.1.15)]"
                     /transcript_id="XM_002420428.1"
                     /db_xref="GeneID:8048159"
     CDS             complement(436170..438572)
                     /locus_tag="CD36_51690"
                     /EC_number="2.7.6.3"
                     /EC_number="2.5.1.15"
                     /EC_number="4.1.2.25"
                     /inference="similar to AA sequence:UniProt:P53848"
                     /inference="similar to AA sequence:UniProt:Q59XE6"
                     /note="Similar to S. cerevisiae FOL1;
                     In S. cerevisiae: multifunctional enzyme of the folic acid
                     biosynthesis pathway, has dihydropteroate synthetase,
                     dihydro-6-hydroxymethylpterin pyrophosphokinase, and
                     dihydroneopterin aldolase activities"
                     /codon_start=1
                     /transl_table=12
                     /product="folic acid synthesis protein, putative
                     [includes: dihydroneopterin aldolase (ec 4.1.2.25);
                     dihydro-6-hydroxymethylpterin-pyrophosphokinase (ec
                     2.7.6.3); dihydropteroate synthetase (ec 2.5.1.15)]"
                     /protein_id="XP_002420473.1"
                     /db_xref="GeneID:8048159"
                     /db_xref="GOA:B9WHB0"
                     /db_xref="InterPro:IPR000489"
                     /db_xref="InterPro:IPR000550"
                     /db_xref="InterPro:IPR006157"
                     /db_xref="InterPro:IPR006390"
                     /db_xref="InterPro:IPR011005"
                     /db_xref="InterPro:IPR016261"
                     /db_xref="UniProtKB/TrEMBL:B9WHB0"
                     /translation="MLKNDTVFTKEISCTAITGKDAWNRPTPQPITISLSFNTDFHKA
                     SELDNLKYSINYAVITRNVTEFMKSNEHLNFKSLGNIAQAISDIGLDQSRGGGSIVDV
                     TIKSSKSEIRAESVEYKINRNILDQPIPLDIFQVNKLRLLTIIGVFTFERLQKQIVDV
                     DLQFKIEPNSNLYFHQIIADIVSYVESSNFKTVEALVSKIGQLTFQKYREGIAEVVAT
                     VTKPNAFSHVEGVGVSSTMVKGNFQNMEPIKFDNMIAQTNNSTFNLPVENEKTDDYTG
                     YHTAFIAFGSNTGNQVENINNSFELLKEYGITIETTSSLYISKPMYYLDQPDFFNGVI
                     KVNFQNISPFQLLKILKEIEYKHLEREKEFDNGPRSIDLDIILYDDLQLNTENLIIPH
                     KSMLERTFVLQPLCEVLPPDYIHPISAESLHSHLQQLINDKPQESVQESSDLLQFIPV
                     SRLPVKDNILKFDQINHKSPTLIMGILNMTPDSFSDGGKYLGKESDNIVKQAEKLVSE
                     GATIIDIGGVSTRPGSVEPSEEEELQRVIPLIKAIRHQSSNSDLSKVLISVDTYRSNV
                     AEQSLLAGADIINDISMGKYDEKIFDVVAKYGCPYIMNHTRGSPKTMSKLTNYESNTN
                     DDIIEYIIDPKLGHQELELSPEIKNLLNGISRELSLQMFKAMAKGVKKWQIILDPGIG
                     FAKNLNQNLAVIRNASFFKKYSIQINERVDDDDDDDDDDDVTIEHKYLSFNGACVLVG
                     ASRKKFLGELTGNEVPSERVFATGATISACIEQNTDIVRVHDVKEMKDVVCISDAIYK
                     NV"
     mobile_element  438796..439226
                     /mobile_element_type="retrotransposon:solo LTR, episemon
                     H, truncated"
     gene            complement(<439464..>442391)
                     /locus_tag="CD36_51700"
                     /db_xref="GeneID:8048160"
     mRNA            complement(<439464..>442391)
                     /locus_tag="CD36_51700"
                     /product="zinc finger-containing tanscription factor,
                     putative"
                     /transcript_id="XM_002420429.1"
                     /db_xref="GeneID:8048160"
     CDS             complement(439464..442391)
                     /locus_tag="CD36_51700"
                     /inference="similar to AA sequence:UniProt:Q12180"
                     /inference="similar to AA sequence:UniProt:Q1WCU2"
                     /inference="similar to AA sequence:UniProt:Q59YX7"
                     /note="Similar to S. cerevisiae HAL9"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc finger-containing tanscription factor,
                     putative"
                     /protein_id="XP_002420474.1"
                     /db_xref="GeneID:8048160"
                     /db_xref="GOA:B9WHB1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:B9WHB1"
                     /translation="MDPLLHSHEKQQPVVVNGSNIHQNNARNPSLASTGTSNSTISQS
                     PSPSEDEKPVTRKKRTRIAKACQYCRKKKVKCDGCQPCSNCQQSNFGNCEYAVDENKK
                     PKISKKKSKSLKNRSSKFQISKSIDERLSKIENTLAQLLNHIDTNNNTPTPTPTSNST
                     TANDKQTETDKYSFSPLPMAIEKEVTDESNQKYDPKVESNFLGSHSVINIFSKKSVEW
                     LLRPVIDKFKDDIEDFKKIAWVYEYYTQAFLDTISQPIKARISRRNDLMDNTFVDVTI
                     PLEILSCYDDIFLVSYVCKGDYIRNLFQTYFEEPDQDGSRRRNFLWSELLAMTAAIGI
                     CISVLIDDRNNTKETEKPKYSCSLSNQQLIEINFKCFYSMIFYHRRLCVISEGFPTIT
                     GFILLIMYFDFAVPVSQITFLAVSTTIHYAKQCGLHRQETYKDMSWEEQRTRRVLWWF
                     CEYLHTEYCFQKGYSLEIGDEDMISFSDDDTTTNAIVKSNWHLISSALNSENPIDALT
                     INEIRENKANHICASYIMHSLSKIRAESYQLLYSTSAQKKTLSSILTSVEKLTADMES
                     LYKESCSVMPVQSVSGYAKNTEIVLKLDNGYENVLMIQFEYFLHLMTINRLSLQDFPN
                     DVDHRDLTDKCLYHRNIANRSARTILHIAKDSTEKKVQFIIINWFSYAIFAAFAHLGS
                     MCLEDPQNPVVLEDIDLLIGISYSVFSFEDKSFKVSRFALKRYVYDMLTRYILKLYFK
                     VTNEQTRNMFYTKYKDLDDHLHLEKTFHEFFVNGNPGVDSTKTYRTLSKLFRPFWLKP
                     HERSKRAQVNPDDTGTPLGSSSSSSNGIYWTSTSILSQPSIRNDTSSTFSSQPVNYTQ
                     ESPRTDAKPLEISNLVDPFNAVIDSATKSNGKELPNSFIQQDLSAINAAPMQQPQPQP
                     PFPQPPFSQLPPFPPPPPPPPQQQEQQNLPRHQFNTNFNSLEEMIEENYVGDLNFPAM
                     FYE"
     gene            complement(<443724..>446693)
                     /locus_tag="CD36_51710"
                     /db_xref="GeneID:8048161"
     mRNA            complement(<443724..>446693)
                     /locus_tag="CD36_51710"
                     /product="zinc finger-containing transcription factor,
                     putative"
                     /transcript_id="XM_002420430.1"
                     /db_xref="GeneID:8048161"
     CDS             complement(443724..446693)
                     /locus_tag="CD36_51710"
                     /inference="similar to AA sequence:UniProt:Q12180"
                     /inference="similar to AA sequence:UniProt:Q1WCU0"
                     /note="Similar to S. cerevisiae HAL9"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc finger-containing transcription factor,
                     putative"
                     /protein_id="XP_002420475.1"
                     /db_xref="GeneID:8048161"
                     /db_xref="GOA:B9WHB2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:B9WHB2"
                     /translation="MDNLPSSETHHSSLDNLTKQQELTGNDPNDTNRKRIRVACDSCR
                     RKKIKCNGSYPCGNCIQAKNTNNCHFTERPMRKKLKQIKQENKSTAATNSNGVSKRKH
                     KDVFNGDSNNVNTVKQGNTFGIVENKPSDIESRLSRIENSMSRMMHTIESISQNFITQ
                     AMKSNHSSSSIFNNNSLSPTPSEDFNKSRSDSEEQRTSQTYTNLKDHAKDANELLKLR
                     NWDEFVGTHSITCIFSRESLDWMEKTLGAYGEEYLTPIRNLPLVFHSELKPYILKWID
                     PPVVDKLQRKKLLESPFPIDSKLISKLIDLYYEETSMINILVDESRVRSLFAAYYNNF
                     AEPVASKRRRFRLSELLLMTSILLISLSCLTEDDFNEERIATPTSSTSSNYSAASANL
                     LGDYSKNKLLALQNSLENSAIFYYHRISVISEGLETVEALLMFIIYVESNWLTSFFNY
                     TIITVTIRFAQEIGLHRAETYFNLDIEEATKRRKIWWFCYFFDIEFCFKSGKPPVINT
                     NDVTTNSDEDLLRVINQLRQYGPLSPKDRMYSPVCHTISTSLLDLSGADSICLEILRI
                     IQMGDVLDDPFYFQFCALLQSRIRSNSYHDLFIASAEKRDFSAISNTLEKLNADMFEL
                     AMYLADEAKPRFYNDPKFTSVQASNSTTIKRDTILAMKLTFFSHLMIINRYPLMIVTE
                     DSKFDDRVIKFRNLSLDSAKTILMLIRGWHRESASALFYNWAIYFPVAAYLVLVAAII
                     NHPQLPESGTNLNLLIETSLNFFKSSKQWNSSNNTQKKQQNNTTICVNKIVAIELIVR
                     LMLRVVIKVYELHNNVEILANNPTLQNHLQEAQEKFPDIFQNHAEFTSKMVALVGASP
                     FSGGSGNCNGSSCNLRDGYASHGQNTMYPSPKVPNNTYNTNISVGSSSTGDHQVYHAQ
                     SPSYNASLSNIINNESTGRSPATATATAATTMSQPMMNENYDLFNDYLIDNSAVNLPF
                     SQFNNLPNFFFDNNLGI"
     gene            complement(<448163..>450916)
                     /locus_tag="CD36_51720"
                     /db_xref="GeneID:8048162"
     mRNA            complement(<448163..>450916)
                     /locus_tag="CD36_51720"
                     /product="zinc finger-containing transcription factor,
                     putative"
                     /transcript_id="XM_002420431.1"
                     /db_xref="GeneID:8048162"
     CDS             complement(448163..450916)
                     /locus_tag="CD36_51720"
                     /inference="similar to AA sequence:UniProt:P50104"
                     /inference="similar to AA sequence:UniProt:Q1WCU1"
                     /inference="similar to AA sequence:UniProt:Q59YJ3"
                     /note="Similar to S. cerevisiae STB4"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc finger-containing transcription factor,
                     putative"
                     /protein_id="XP_002420476.1"
                     /db_xref="GeneID:8048162"
                     /db_xref="GOA:B9WHB3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:B9WHB3"
                     /translation="MSETNDTLNPVYTQDGEKRLRTKVACDYCRKRKSKCNGEQPCSK
                     CSDKNRNCTYTFVQKERKRKQRKSTTAGVENKNNGAVRKARTTSAATIRHLTSRINVL
                     ENLLGRLVDKLDPTVKSELSDELQSTSLTNDNNDSRERHNRSSSNSSDNGDEDDEEND
                     LQEAHESGDSDGSINYNHNNESNKQIDTKDSNENEVRKLRDMLAPAEKSCVSNIKNRL
                     MQYFGSHALFFSISGRAVEWLRSRVQGSNANNMHDIFAPLRHVPLSLNDAVQKSTKLL
                     NGPEVETDKKRQFDDLEKPLIFEIIDKYYKNLYWAPFLCDVSTIRELFQIYFYGAQRN
                     DAAILGNITYSDLLIMNIAIVLCLASISKDDVFESLEYPTLSTKSISYLQGELLNKLF
                     QNAMGAYGKVSRSSDGIRSLQGLALLILYFEINFVTDFHVNYSITSVLIRYAKESGIH
                     RVETLNNDNGIDATLKRKLWWFCEYKGVDITYKSGKPILIDMEDVTTLTEVDDFFMSV
                     PTTLFLDSKYLENANDIVLNSQIHGGEYYFAYFLLILSRIKAKSYAKVYSKLPMNINI
                     QAALTFVNEFDYDLRILTNLMSPILASPPPKDTTFKNPLNLSEGCFNYFKVELLLSQY
                     AHQLSINRVPFVKSFGINDSRLIPYGNQSLAGARFMLELIKDIDSLKISPRMYSTLSF
                     YPLAAFCSLLGNCLVFPNEPSAVNDSVLLASVAISFFRSEGCNNKIDNKRSIYDILVR
                     LLLRVLIDALKNLAKVDLYEKIPELEYHINSMFTLFPEVFANQQDHIISLMSERNSNN
                     ENSNQYPSMVENGASSTGSGSSGSSTSSSNTIIDSDYQHMDVDVKNATSLPQSFMNTP
                     GMLNIDNGNVMLMNGNYDLFSNINFENIMSDETFNNMIFSELNQLPDFFNSPSSGFNE
                     QNI"
     gene            <452144..>454501
                     /locus_tag="CD36_51730"
                     /db_xref="GeneID:8048163"
     mRNA            <452144..>454501
                     /locus_tag="CD36_51730"
                     /product="N-terminal acetyltransferase complex subunit,
                     putative"
                     /transcript_id="XM_002420432.1"
                     /db_xref="GeneID:8048163"
     CDS             452144..454501
                     /locus_tag="CD36_51730"
                     /inference="similar to AA sequence:UniProt:P12945"
                     /inference="similar to AA sequence:UniProt:Q59YJ5"
                     /note="Similar to S. cerevisiae NAT1;
                     In S. cerevisiae: N-terminally acetylates many proteins,
                     which influences multiple processes such as the cell
                     cycle, heat-shock resistance, mating, sporulation, and
                     telomeric silencing; amino-terminal, alpha-amino,
                     acetyltransferase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="N-terminal acetyltransferase complex subunit,
                     putative"
                     /protein_id="XP_002420477.1"
                     /db_xref="GeneID:8048163"
                     /db_xref="GOA:B9WHB4"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR021183"
                     /db_xref="UniProtKB/TrEMBL:B9WHB4"
                     /translation="MVTKKASPIFASKEDSNFREALSLYDAKQYKKALKLVDANLKKH
                     SNHAESLALKGCIIFQTNGNKDDAKSYIERAAAKNPSNYLVDHLIGLYYRANENYAEA
                     AKWLSAAVENGSTNKAILRDLSFMQIHIRDYKNLRDSRQQYLEHAPGYRANWTGVAVA
                     HHLNKDYASAVGTLAKIEDIIKDHLTESDMYEQSECVLYKNQLIGESGDFVKALDALQ
                     KDDESIKDRLSFLEYKAKYLLLLGEKKEASLVYRELLKRNPDNVSYYNLLETALGTTT
                     QPPEIRYKLYQKLNKFYPRSDPPKFLPLTFLPSDSSLFEKAARDYIIPQLLRGVPATF
                     VNVKPLYKNPTKLKVIESIVQDFYEHDVPKVSNPTIKVWTCYYFAQHYLYQNDLTAAS
                     KYIDIAIEHSPTLVELYIIKARIIKHQGDFVKASDVMNEGRLLDLQDRFINSKTTKYL
                     LRANKVNEAIDCISLFTKLDENAVNGCKDLHTMQANWVLVESAEAYSRIFHDYQAQLN
                     QLQKIVDNDKDKNDESLNALVENTEIYRGLALKRFHAVLKNFDIFYNDQFDFHSYCLR
                     RGTPRDYIDTLKWEDKIHTTPIFTRALKGLSELYFEIYEDQQKAKANENENGDGNDAV
                     VVKKNSKKQKKAKSQLNKKRAELVSKVESEKDDADPFGIKLYHDLIEKDILESLFELF
                     KPLSEEGKNLRLTWEVLFRIYLLQGKYVLALQAIKSLNKILTRGDVDKKLKQIGEMVL
                     ELSATATNDSNANVAIVKVVEKGLNTAFPDFEKLSNDEFIKLYNQ"
     gene            complement(<454589..>455245)
                     /locus_tag="CD36_51740"
                     /db_xref="GeneID:8048164"
     mRNA            complement(<454589..>455245)
                     /locus_tag="CD36_51740"
                     /product="Golgi transport protein, putative"
                     /transcript_id="XM_002420433.1"
                     /db_xref="GeneID:8048164"
     CDS             complement(454589..455245)
                     /locus_tag="CD36_51740"
                     /inference="similar to AA sequence:UniProt:P38166"
                     /inference="similar to AA sequence:UniProt:Q59YJ6"
                     /note="Similar to S. cerevisiae SFT2;
                     In S. cerevisiae: found mostly in the late Golgi, can
                     suppress some sed5 alleles; may be part of the transport
                     machinery, but precise function is unknown; protein
                     transport protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Golgi transport protein, putative"
                     /protein_id="XP_002420478.1"
                     /db_xref="GeneID:8048164"
                     /db_xref="GOA:B9WHB5"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="InterPro:IPR011691"
                     /db_xref="UniProtKB/TrEMBL:B9WHB5"
                     /translation="MSKFFKSFTSKYSPLSQNDNEDGAPLPPPVTQPGAGSSSSSNQS
                     LKTKLQRLNPFRSQSVYLEDDENYVTSDPGMFELSRWDRMLIFALCFAGSICCYLICI
                     FLFPILSLKPRKFALIWSIGSILFLVSFGVLQGFKAYMIHLFSSTRIIFTIIFGSSII
                     LTLISSVSLKNTLLSIIFAVIQLLAALWYTVSYFPMGKQTLSLAGNVARGQVDTWINS
                     "
     gene            <455490..>456164
                     /locus_tag="CD36_51750"
                     /db_xref="GeneID:8048165"
     mRNA            <455490..>456164
                     /locus_tag="CD36_51750"
                     /product="ubiquitin-like protein, putative"
                     /transcript_id="XM_002420434.1"
                     /db_xref="GeneID:8048165"
     CDS             455490..456164
                     /locus_tag="CD36_51750"
                     /inference="similar to AA sequence:UniProt:Q12285"
                     /inference="similar to AA sequence:UniProt:Q59YJ7"
                     /note="Similar to S. cerevisiae MDY2"
                     /codon_start=1
                     /transl_table=12
                     /product="ubiquitin-like protein, putative"
                     /protein_id="XP_002420479.1"
                     /db_xref="GeneID:8048165"
                     /db_xref="UniProtKB/TrEMBL:B9WHB6"
                     /translation="MSTATALETTNAERKFVNTYLELMQLSKAESLDKFNSTQDYNNL
                     SSLGPSLPKCIYKFPEPQNVTEATESRVNLKFKSIKPPFKFQTELTNIPVNFTIYKVK
                     AQLIESLEVLHNAGVTAKDLKLMVKSKVAQDTAVLSTLINSEEPISFNCMVSAPTGVK
                     PVASSTRTDEDDPEVEAASDAVSTTATTIGISEAGWNKIYEIILQDIKDAGKAKELLT
                     KLKQSV"
     gene            complement(<456245..>456409)
                     /locus_tag="CD36_51755"
                     /db_xref="GeneID:8048166"
     mRNA            complement(<456245..>456409)
                     /locus_tag="CD36_51755"
                     /product="non-classical export protein, putative"
                     /transcript_id="XM_002420435.1"
                     /db_xref="GeneID:8048166"
     CDS             complement(456245..456409)
                     /locus_tag="CD36_51755"
                     /inference="similar to AA sequence:UniProt:A5E2C8"
                     /inference="similar to AA sequence:UniProt:Q02820"
                     /note="Similar to S. cerevisiae NCE101;
                     In S. cerevisiae: involved in secretion of proteins that
                     lack classical secretory signal sequences"
                     /codon_start=1
                     /transl_table=12
                     /product="non-classical export protein, putative"
                     /protein_id="XP_002420480.1"
                     /db_xref="GeneID:8048166"
                     /db_xref="GOA:B9WHB7"
                     /db_xref="InterPro:IPR024242"
                     /db_xref="UniProtKB/TrEMBL:B9WHB7"
                     /translation="MQYPYLISKSLDPIVGVGIGVLSYYSYEQRVGRKPGHSLHELIV
                     KKFYNGKDKN"
     gene            <456837..>457364
                     /locus_tag="CD36_51760"
                     /db_xref="GeneID:8048167"
     mRNA            <456837..>457364
                     /locus_tag="CD36_51760"
                     /product="zinc finger protein, putative"
                     /transcript_id="XM_002420436.1"
                     /db_xref="GeneID:8048167"
     CDS             456837..457364
                     /locus_tag="CD36_51760"
                     /inference="similar to AA sequence:UniProt:P53849"
                     /inference="similar to AA sequence:UniProt:Q59YJ9"
                     /note="Similar to S. cerevisiae GIS2"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc finger protein, putative"
                     /protein_id="XP_002420481.1"
                     /db_xref="GeneID:8048167"
                     /db_xref="GOA:B9WHB8"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:B9WHB8"
                     /translation="MAAVYPRTCYKCGEVGHLADDCQQEERLCYNCHKPGHESNDCPD
                     PKQNTAKQCYSCGDVGHIQTECPNQAQGAKCYNCGQFGHISKNCDAAPSSTDHAPSFK
                     RSSGRASGTTCYKCGGPNHFARDCQANTVKCYACGKVGHISKDCHSAAGGSNFSAKTC
                     YNCGKSGHISKECTA"
     gene            complement(<458132..>459505)
                     /locus_tag="CD36_51770"
                     /db_xref="GeneID:8048168"
     mRNA            complement(<458132..>459505)
                     /locus_tag="CD36_51770"
                     /product="inositol polyphosphate-5-phosphatase, putative"
                     /transcript_id="XM_002420437.1"
                     /db_xref="GeneID:8048168"
     CDS             complement(458132..459505)
                     /locus_tag="CD36_51770"
                     /EC_number="3.1.3.36"
                     /inference="similar to AA sequence:UniProt:Q08227"
                     /inference="similar to AA sequence:UniProt:Q59YK0"
                     /note="Similar to S. cerevisiae INP54;
                     inositol-1,4,5-trisphosphate 5-phosphatase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="inositol polyphosphate-5-phosphatase, putative"
                     /protein_id="XP_002420482.1"
                     /db_xref="GeneID:8048168"
                     /db_xref="GOA:B9WHB9"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:B9WHB9"
                     /translation="MIEYSTKKESDIPLYLFTYNCNKRVIDANVFKSKVSQSLPPKDN
                     PSHLYVFALQEFCTILDGSFKASANQQLIAYNELLQIMLFEEYGTDHFQTIAINHTGA
                     IGLIIISPYPSKFQNVRLANTSCGYGYSSMKGGVGIRLKYYPDGKYGDNSVELSFAGI
                     HLNAYEGEYYYLQRNANLLRIARSLNFGDGYGLIKPNNHVFILGDLNYRTTKDYKKTS
                     VVAQNLLSLADQHSEFNNEYINQLFVQYDELHNALKNGEVLFGFSEGKVDFKPSYKYY
                     INTGIYNSKRCPSWCDRILFLSTYETIGNDDLGLQLLRAKGKDSKQKNEGLPVVGKYD
                     CIDELLVSDHRPVFAHIEIPFAPPKSIISPMSGCLEIVSTGLTSDESFSELEQLQGIE
                     NSTLIESGPTSIYLKPTKLDLLIHTIVTPFMDTTIGFGLWFGTTSEGRLVLLIFILLT
                     FSLWYLF"
     gene            <459702..>461243
                     /locus_tag="CD36_51780"
                     /db_xref="GeneID:8048169"
     mRNA            <459702..>461243
                     /locus_tag="CD36_51780"
                     /product="pre-mRNA-splicing factor, putative"
                     /transcript_id="XM_002420438.1"
                     /db_xref="GeneID:8048169"
     CDS             459702..461243
                     /locus_tag="CD36_51780"
                     /inference="similar to AA sequence:UniProt:P19736"
                     /inference="similar to AA sequence:UniProt:Q59YK2"
                     /note="Similar to S. cerevisiae PRP9;
                     In S. cerevisiae: required for spliceosome assembly"
                     /codon_start=1
                     /transl_table=12
                     /product="pre-mRNA-splicing factor, putative"
                     /protein_id="XP_002420483.1"
                     /db_xref="GeneID:8048169"
                     /db_xref="GOA:B9WHC0"
                     /db_xref="InterPro:IPR000690"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:B9WHC0"
                     /translation="MSNFIEISRSNIEEIGIIEDSLSKRLLRNPYILPSNLQPRPNIL
                     LSKVTKPNSTKRISILQQYELVYFKSRYNQIIKRLNHCLTEEKESFSNTLALITEGDD
                     NFEKFDEMINGISQNDSIVEGPRRLYSSFSSLNKELNPQDVTLKINKKTGKEQEFVKR
                     KHFLSSIASHLKDIEINDILDLHHFHDLYVSNFGPISYIEYLYKFSSFPYSKVNGFYS
                     KYLMELSSFLEASLIKLQPLLDYDELLQRWKTEFDDADEERKSNNGKDRDNLFCKACN
                     KLFSKETVYQSHLSGKKHKKNASQQKPDNFVSSLPWLEYLIGKLCQVLAPDLEYTRAQ
                     VEKLSNLSERELQLERQVQHDIANEFVAINNELDEDDLSGNEHDNDDDDDYLDNSFKN
                     LPLGPDGTPIPFWLYKLQGLHKQYNCEICGNISYKGKTVFSKHFSGPKHQYGLKCLGV
                     DEKNMKMFKNITKIDEATELWKVLRKETKLKTTELENSVEVEDKEGNVMSEKDYMDLK
                     KQGLL"
     gene            <461460..>463229
                     /locus_tag="CD36_51790"
                     /db_xref="GeneID:8048170"
     mRNA            <461460..>463229
                     /locus_tag="CD36_51790"
                     /product="DRAP deaminase, putative"
                     /transcript_id="XM_002420439.1"
                     /db_xref="GeneID:8048170"
     CDS             461460..463229
                     /locus_tag="CD36_51790"
                     /inference="similar to AA sequence:UniProt:Q12362"
                     /inference="similar to AA sequence:UniProt:Q59YK3"
                     /note="Similar to S. cerevisiae RIB2;
                     In S. cerevisiae: catalyzes the third step of the
                     riboflavin biosynthesis pathway; cytoplasmic tRNA
                     pseudouridine synthase involved in pseudouridylation of
                     cytoplasmic tRNAs at position 32; pseudouridine synthase,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="DRAP deaminase, putative"
                     /protein_id="XP_002420484.1"
                     /db_xref="GeneID:8048170"
                     /db_xref="GOA:B9WHC1"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:B9WHC1"
                     /translation="MPIFKSGQVYPLQTLETLSLLFSRGMKRAASPKAEQPPHSKKVV
                     DAKGFRVRQQNIDKHKITSENTATQKSIHEEETEGANYLIEGRLRRVTPYFYTYLTYC
                     KLRWQDRKLIDVFIDEFRDRTPDAYRKAVEGGLVKVNSKVANLETILRNGDLISHRSY
                     RREPPVSSREIKIVFEDDDLLVIDKPSGIPVHPTGRYRYNTITKVFEHEMGKIVHPCN
                     RLDRLTSGLMFLGKSSKGANNMMSQIRDRNVTKEYIARVKGEFPLERLIVDKPLSTKS
                     PKLTLNVVDTENGKEAKTEFQRVSYDPMTNTSVVKCHPLTGRTHQIRVHLQFLGYPIA
                     NDPLYSSEFVWGENLGKSGEADLDQVMAKLDLIGKSRAATSWIHPQGDGEVALDEICP
                     VTGLPLYSDPGPNDLDLWLHAYKYEADDKSWSYKTEYPEWALEPSRKFMEMAIKEAEK
                     CGKTQTQFNVGCVLVHNGQVISTGHSRELPGNTHAEQCALEKYFSKNGGEREVPSGTE
                     IFTSMEPCSLRLSGNLPCVDRILQTKSIKTCFVGVLEPDIFVKNNSSYKKLLDHGVEY
                     IHIPGYEETCLEIAKRGHENIQK"
     gene            complement(<463248..>464852)
                     /locus_tag="CD36_51800"
                     /db_xref="GeneID:8048171"
     mRNA            complement(<463248..>464852)
                     /locus_tag="CD36_51800"
                     /product="pH-response regulator protein, putative"
                     /transcript_id="XM_002420440.1"
                     /db_xref="GeneID:8048171"
     CDS             complement(463248..464852)
                     /locus_tag="CD36_51800"
                     /inference="similar to AA sequence:UniProt:P48565"
                     /inference="similar to AA sequence:UniProt:Q59YK4"
                     /note="Similar to S. cerevisiae RIM21"
                     /codon_start=1
                     /transl_table=12
                     /product="pH-response regulator protein, putative"
                     /protein_id="XP_002420485.1"
                     /db_xref="GeneID:8048171"
                     /db_xref="InterPro:IPR014844"
                     /db_xref="UniProtKB/TrEMBL:B9WHC2"
                     /translation="MYWKNAWWVGTVYSSCEPIELPEGMIISKQFEKYPISVVSKAIY
                     KQLCYRNCIPVLNTNVGFVIDTFAKPLPIVTESWREFTRDSLRGSFAYSVVSIIYAIA
                     VSAVIIWFLTIFVLTNYTIKPSWLLKTSTILSTVYILVVVIKSILILHGQQRDGYLHG
                     AKLLSELNDYNPIQIIDLIVVLLLQINQVQIIMRIFQRQKDKRMALLIGIVATLASQV
                     IWAIAQFYTPADANEASDILPAFIYLVRIAMALCYAAIITVFFISKIQIILANKKIWL
                     LTLLTFILIYSPVAFFVADVSNAFVYELSEIFSVVNYVIGVVIPWEWCNKFNLIMKAK
                     EKEGVLGRRFYEDELYELDRFELFVEEQIPEDEDNSDTHSDPPDNELNGGAHHNNQEQ
                     REGLIRRNSPTNKLHGDNNDNDNSVPASKFRRILTTTKDAFLTLTDNIIAAGFAIPRS
                     VSVSTQSLTGRHRNNSTTHAEYTQEVVPDFCPEMFLHPEGNSHIAESSSEQNAAPLTT
                     TNSNHRRRNVYVYSRKEVILDVSSDE"
     gene            complement(<465488..>467371)
                     /locus_tag="CD36_51810"
                     /db_xref="GeneID:8048172"
     mRNA            complement(<465488..>467371)
                     /locus_tag="CD36_51810"
                     /product="electron transfer flavoprotein-ubiquinone
                     oxidoreductase, mitochondrial precursor, putative"
                     /transcript_id="XM_002420441.1"
                     /db_xref="GeneID:8048172"
     CDS             complement(465488..467371)
                     /locus_tag="CD36_51810"
                     /EC_number="1.5.5.1"
                     /inference="similar to AA sequence:UniProt:Q08822"
                     /inference="similar to AA sequence:UniProt:Q59YK5"
                     /codon_start=1
                     /transl_table=12
                     /product="electron transfer flavoprotein-ubiquinone
                     oxidoreductase, mitochondrial precursor, putative"
                     /protein_id="XP_002420486.1"
                     /db_xref="GeneID:8048172"
                     /db_xref="GOA:B9WHC3"
                     /db_xref="InterPro:IPR007859"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="UniProtKB/TrEMBL:B9WHC3"
                     /translation="MLIQSLLSRVGSRRLLPRSLPPLRNPINYTPFIRRLHQSWTRYN
                     LTSEQEEILHQERARDYVDVCIVGAGPAGLSTAIKLKQLDNEQGNGDLRVIVLEKAGD
                     FGSHIVSGAVIEPHAFKELFPDSELTEENGIPLPSDIITKVTSDHMKYLTPKKAFPLP
                     EPPQLTNKGKNFIVSLNEVVKYLAEQAEELGVELYPGISVNELIYNEDKSAIKGVITQ
                     DMGVDRNGAPKDSFEPGMEFFARLTVLAEGCHGSLTKNAIGNFNLRENSEPQTYGLGI
                     KEVWEVLPENFDKGYVGHSLGYPLTSKEYGGGFIYHFGDGLVAVGLVIGLDYANPYIS
                     PYQEFQKMKTHPFYANTLKGGKCISYAARALNEGGYQSIPKLHFPGGILVGCAAGFVN
                     VPKVKGTHTAVKSGIVAAEAILSTFKQMELDPCDEDNFEELSTPIDLHQYEENFKDSW
                     AYKELYAVRNVRPSFNSPLGMVGGLVHSGLSTMITQGKEPWTLSHHGTDSGATQDANQ
                     FQPIEYPKPDNELTFDILTSVSRTGTYHDEDEPCHLKIPNQDSRKHTELNWIKYKGVE
                     QRFCPAGVYEYIEDESEPLGVKFQINSQNCIHCKTCDIKVPSQDITWSVPEGGDGPKY
                     YMS"
     gene            complement(<468210..>470753)
                     /locus_tag="CD36_51820"
                     /db_xref="GeneID:8048173"
     mRNA            complement(<468210..>470753)
                     /locus_tag="CD36_51820"
                     /product="GDP-GTP exchange factor for Cdc42p, putative"
                     /transcript_id="XM_002420442.1"
                     /db_xref="GeneID:8048173"
     CDS             complement(468210..470753)
                     /locus_tag="CD36_51820"
                     /inference="similar to AA sequence:UniProt:P11433"
                     /inference="similar to AA sequence:UniProt:Q875H9"
                     /note="Similar to S. cerevisiae CDC24; guanine nucleotide
                     exchange factor Cdc24 homologue, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="GDP-GTP exchange factor for Cdc42p, putative"
                     /protein_id="XP_002420487.1"
                     /db_xref="GeneID:8048173"
                     /db_xref="GOA:B9WHC4"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR001331"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR010481"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:B9WHC4"
                     /translation="MEHPPPALRSFSTQSTSSLNSASTVSSARIVSSGPVNINNFNKQ
                     STPKDHLFYRCESLKRKLQKIPGMEPFLNQAFNQAEQLSEQQALALAQERSNGNGHSN
                     GKRHQSLDGAMNRLSVGSDSSSIQGSLTRMATNASASSLISGMPNNTLFTFTAGVLPA
                     NISVDPATHLWKLFQQGAPFCVLINHILPDSKIPVVSSDDLRICKKSVYDFLIAVKTQ
                     LNFDDENMFTISNVFSDNAQDLLKIIEVVNKLLSEYSNVGDTATDSGSADEDVNMDVQ
                     ITDERSKVFREIIETERKYVQDLELMCKYRQDLIDAENLSSEQIHLLFPNLNEIIDFQ
                     RRFLNGLECNINIPIRYQRIGSVFIHASLGPFNAYEPWTIGQLTAIDLINKEAANLKK
                     SSSLLDPGFELQSYILKPIQRLCKYPLLLKELVKTSPEYSKQDSHGSSSSTSFNELLV
                     AKTAMKELANQVNEAQRRAENIEHLEKLKERVGNWRGFNLDAQGELLFHGQVGVKDAE
                     NEKEYVAYLFEKIVFFFTEIEDNKKSDKQEKKSKFSTRKRSTSSNLSSSTANLLESIN
                     NSRKDSTLPLELKGRVYISEIYNISAPTTPGSTLIISWSGRKESGSFTLRYRSEEARN
                     QWEKCLRDLKTNEMNKQIHKKMRDSDSSFNTDDSAIYDYTGISMSPVNQSTQQQYYDH
                     RTSHGSRHHSSSSTLSMMKNNRIKSGDLSRISSTSTTLDTFSNNMNGSPNTTNPSLTS
                     SEATKVTPTFDVAIKLLYKSTELPDPLIVNAQIEYNDLLQKIISQIITSNIVADDIHI
                     NRLRYKDDEGDFVNLNSDDDWGLVLDMLTGEDFYQTSGNEKRSVTVWVS"
     gene            complement(<472231..>472905)
                     /locus_tag="CD36_51830"
                     /db_xref="GeneID:8048174"
     mRNA            complement(<472231..>472905)
                     /locus_tag="CD36_51830"
                     /product="secretory pathway protein, putative"
                     /transcript_id="XM_002420443.1"
                     /db_xref="GeneID:8048174"
     CDS             complement(472231..472905)
                     /locus_tag="CD36_51830"
                     /inference="similar to AA sequence:UniProt:P39931"
                     /inference="similar to AA sequence:UniProt:Q4WVC8"
                     /inference="similar to AA sequence:UniProt:Q59YK7"
                     /note="Similar to S. cerevisiae SSP120"
                     /codon_start=1
                     /transl_table=12
                     /product="secretory pathway protein, putative"
                     /protein_id="XP_002420488.1"
                     /db_xref="GeneID:8048174"
                     /db_xref="GOA:B9WHC5"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:B9WHC5"
                     /translation="MKISVVTPLLLTFLSLTTAHGGHEQESLKIKPQDLSWQDWHMKE
                     EHGLEEYDGKTFFILHDLNNNGILEPKEILNLYGLVHKIIIGDGSGMGQDKIEVTPEL
                     QKQAVENIFELIPHGNPEGISQIEWLKFYENGGRLPDLGYGPGHHLGFEEEYEEHHWR
                     KYHANDDPDVKVKHKEDIEHELLHHQQEIEETHDRSSRLKKFVGDYWSEINIENLKPK
                     YRKQQK"
     gene            <473542..>473931
                     /locus_tag="CD36_51840"
                     /db_xref="GeneID:8048175"
     mRNA            <473542..>473931
                     /locus_tag="CD36_51840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420444.1"
                     /db_xref="GeneID:8048175"
     CDS             473542..473931
                     /locus_tag="CD36_51840"
                     /inference="similar to AA sequence:UniProt:Q59YZ6"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420489.1"
                     /db_xref="GeneID:8048175"
                     /db_xref="UniProtKB/TrEMBL:B9WHC6"
                     /translation="MARNENTISDSPISTCVTTKSHDKNYYLSLMNPQLMYIQDIVFL
                     RNDHYFSSSSSSSSSSSSSSSSSSLSFVNRDLFLSIYDPLKVLQCHEKEYYVRYHHHK
                     NNSSHIIEFWIAKPFVDTLEERLEKIS"
     gene            complement(<474335..>475909)
                     /locus_tag="CD36_51850"
                     /db_xref="GeneID:8048176"
     mRNA            complement(<474335..>475909)
                     /locus_tag="CD36_51850"
                     /product="acetyl-CoA hydrolase, putative"
                     /transcript_id="XM_002420445.1"
                     /db_xref="GeneID:8048176"
     CDS             complement(474335..475909)
                     /locus_tag="CD36_51850"
                     /EC_number="3.1.2.1"
                     /inference="similar to AA sequence:UniProt:P32316"
                     /inference="similar to AA sequence:UniProt:Q59YK9"
                     /note="Similar to S. cerevisiae ACH1;
                     In S. cerevisiae: required for acetate utilization and for
                     diploid pseudohyphal growth; acetyl-coa acylase, putative;
                     acetyl-coa deacylase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="acetyl-CoA hydrolase, putative"
                     /protein_id="XP_002420490.1"
                     /db_xref="GeneID:8048176"
                     /db_xref="GOA:B9WHC7"
                     /db_xref="InterPro:IPR003702"
                     /db_xref="InterPro:IPR026888"
                     /db_xref="UniProtKB/TrEMBL:B9WHC7"
                     /translation="MSAILKQRVRYAPYLKKLRTGEQCLDLFKHGQYLGWSGFTGVGA
                     PKVIPTALVDHVEKNNLQGKLGFHLFVGASAGPEESRWAENNMILTRAPHQVGKPIAA
                     AINDGRTQFFDKHLSMFPQDLTYGFYTKNKPNGSNLDYTIIEATAITEDGSIVPGPAV
                     GASPEMISVSDKIIIEVNTKTPSFEGIHDIDMPVNPPFRQPYPHTSADFKIGKTAIPV
                     DPEKVVAIVESTSGDKVPPNTPSDEQSRSIANHLIEFLEHEVKQGRLPANLHPLQSGI
                     GNIANAVVEGLASSNFKNLTVWTEVLQDSFLDFFESGSLDYATATSIRLTNDGFKKFY
                     DNWDTYSKKLCLRSQVVSNSPEIIRRLGVIAMNTPVEVDIYGHANSTNVMGSRMLNGL
                     GGSADFLRNAKLSIMHTPSARPSKVDPTGLSCIVPMASHVDQTEHDLDVVVTEQGLAD
                     LRGLAPKARAKVIIDNCSHPDYKPQLQEYYDRSVFYATKKKTLHEPHILRDVFKMHLN
                     FQENGTMKLDSWDKKF"
     gene            complement(<478681..>480897)
                     /locus_tag="CD36_51860"
                     /db_xref="GeneID:8048177"
     mRNA            complement(<478681..>480897)
                     /locus_tag="CD36_51860"
                     /product="bud site selection protein, putative"
                     /transcript_id="XM_002420446.1"
                     /db_xref="GeneID:8048177"
     CDS             complement(478681..480897)
                     /locus_tag="CD36_51860"
                     /inference="similar to AA sequence:UniProt:P43573"
                     /inference="similar to AA sequence:UniProt:Q59YL0"
                     /note="Similar to S. cerevisiae BUD27"
                     /codon_start=1
                     /transl_table=12
                     /product="bud site selection protein, putative"
                     /protein_id="XP_002420491.1"
                     /db_xref="GeneID:8048177"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR024325"
                     /db_xref="UniProtKB/TrEMBL:B9WHC8"
                     /translation="MSSTPKLTTQTHAQYSDQDGFQQLTTQIDSTITNLKQKRDYLQD
                     QLVQFESVHQGLKASGDSTTPIKFQLDDGTMIEKTKSEAIEFLDKRVTEIKEALTQFN
                     TKINEAESTKEKLNQYNQFVQEGGNHEDLQQDKLNEEGLPFVDIQEELDEDGNVINVE
                     FKDVQKDTAIDKSQNNTHETPKVEMLEEKIDETKKLDKIEQSENDEFQALLEDMEIIS
                     KDKKAQELNFDQDDLLDKIDKLQISAEDKFKLKQVCVEEFKNLEPEHDTGDKIEENSG
                     GDKTIGNFENLAIDKNDLIELELLADDFDDSETFQGEHYDDDEEWDYEFDEEEEEEDD
                     DDIADELLYGGGRAKIIGSDEKSNNMLWDQIINLRKNKLVATDKVADEIEENAGNEKK
                     PKAVRFAEHLDINEVENISESLRNPPPETAKISLFKQNRMTAQHKNRTQEIKETVEND
                     SVMTDVSENDVMSDIVEKEPVMTDIIEKNDDNDDEIVDSGGVVESTIIEHEPVATVNE
                     PTPEVRTGTVSQKPVSRFKAMRSSIPSKNTEKLNSQAPAKIPIPGNAENEAEPSESST
                     SLSVSELRDLQSDMDKMAQAYVSGMYDDDIVTEGPVVHKLDDFETLNKMVEAKKQDNE
                     ELGIQEHDAVSNEVGMEIDEEEEEDDDDDDEGPILVDEIVENELDESNGVFNDEVILD
                     REIRENYHKLRNKLILDQNGFKKTQQELEMEPVDEEGNPIKISRFKAAKMNRGGLS"
     gene            complement(<481166..>482224)
                     /locus_tag="CD36_51870"
                     /db_xref="GeneID:8048178"
     mRNA            complement(<481166..>482224)
                     /locus_tag="CD36_51870"
                     /product="ATP-binding protein, putative"
                     /transcript_id="XM_002420447.1"
                     /db_xref="GeneID:8048178"
     CDS             complement(481166..482224)
                     /locus_tag="CD36_51870"
                     /inference="similar to AA sequence:UniProt:Q08726"
                     /inference="similar to AA sequence:UniProt:Q59Z00"
                     /note="uncharacterized protein yor262w homologue,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP-binding protein, putative"
                     /protein_id="XP_002420492.1"
                     /db_xref="GeneID:8048178"
                     /db_xref="GOA:B9WHC9"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WHC9"
                     /translation="MFGQIVIGPPGSGKSTYCHGMYQFMSAIGRKSCIINLDPANDRL
                     PYPCELDIRDYISLEEIMEELDLGPNGGLMYALESLDKQGIDLFIGKIEQLINESNYL
                     LFDCPGQVELFTHHNSLYRIFKKLTQLKRLRLCVVSLIDCIYLTSPSQYISILLLSLR
                     SMLQLDLPHVNVISKIDMLKNYGDLPFRLDYYTEAQDLQYLTPYLEKESNSVLGQNYV
                     RLTELIGELVEDFHLVSFEVLSVENKKSMISLLSVIDKANGYSFGSEIGGDTIWSEAT
                     RQNGSGNGGYQDVDIHERWIDHKEEYDAEERRQEQAFKESLPQEEVDNKPLTEDEEWE
                     AALKDWEEKHGGEGAMLR"
     gene            <482554..>483546
                     /locus_tag="CD36_51880"
                     /db_xref="GeneID:8048179"
     mRNA            <482554..>483546
                     /locus_tag="CD36_51880"
                     /product="proteasome regulatory subunit, putative"
                     /transcript_id="XM_002420448.1"
                     /db_xref="GeneID:8048179"
     CDS             482554..483546
                     /locus_tag="CD36_51880"
                     /inference="similar to AA sequence:UniProt:Q08723"
                     /inference="similar to AA sequence:UniProt:Q59YL2"
                     /note="Similar to S. cerevisiae RPN8"
                     /codon_start=1
                     /transl_table=12
                     /product="proteasome regulatory subunit, putative"
                     /protein_id="XP_002420493.1"
                     /db_xref="GeneID:8048179"
                     /db_xref="GOA:B9WHD0"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:B9WHD0"
                     /translation="MSTAATSTNELALLDKSVVVSPLVLLSVVDHYNRVAKDSKKRVV
                     GVILGDNSTDTIKVTNSYAIPFEEDEKNPGVWFLDHNFIDSMGEMFKKINAKEKLIGW
                     YHSGPKLKPSDLKINEVFRRYTDNPLLLIVDVQPREVGIPTDAYFAVDDIKNDGSAAE
                     KTFIHVPSLIEAEEAEEIGVEHLLRDIRDQAAGNLSLRVAETHQSLLGLHQKLGEIAN
                     YLDKVYQKKLPMNHTILGKLQNVFNLLPNLMQQSGSDPHSSSDSSHELATAFTVKTND
                     ELMIIYISMLVRAIIAFHDLIENKLENKKLNESKAQASVADLSLNSEKKDSIEE"
     gene            <483785..>485170
                     /locus_tag="CD36_51890"
                     /db_xref="GeneID:8048180"
     mRNA            <483785..>485170
                     /locus_tag="CD36_51890"
                     /product="heme A:farnesyltransferase, putative"
                     /transcript_id="XM_002420449.1"
                     /db_xref="GeneID:8048180"
     CDS             483785..485170
                     /locus_tag="CD36_51890"
                     /EC_number="2.5.1.-"
                     /inference="similar to AA sequence:UniProt:P21592"
                     /inference="similar to AA sequence:UniProt:Q59Z02"
                     /note="Similar to S. cerevisiae COX10;
                     In S. cerevisiae: catalyzes the first step in the
                     conversion of protoheme to the heme A prosthetic group
                     required for cytochrome c oxidase activity; human ortholog
                     is associated with mitochondrial disorders; protoheme IX
                     farnesyltransferase, mitochondrial precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="heme A:farnesyltransferase, putative"
                     /protein_id="XP_002420494.1"
                     /db_xref="GeneID:8048180"
                     /db_xref="GOA:B9WHD1"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006369"
                     /db_xref="InterPro:IPR016315"
                     /db_xref="UniProtKB/TrEMBL:B9WHD1"
                     /translation="MSHRVVTLPRLHSVSNFNYFFQNTKRNLVIEQNFINNQYLLRKV
                     LLPNLSGRVRHLTSQTSRFSDNTNAGRLSSSTSVIENVASKVLTCQEPEAQSSQKTGI
                     DPSNATTHKHIPFKIIPKDSQASKTQPVTLFPKSKAQLKNTCTAYLKLTKPNLTVLVT
                     LSSICSYAISPLSVSLQELLFLTVGTALCSGAANAINMGREPEFDKQMPRTVGRPVVR
                     GLITPTQAYQFAAVSGAIGCGMLWFGVNPTVSLLGFSNIVLYAWLYTSMKRKSIINTW
                     VGAVVGAIPPLMGWAASSSLAHPAAWCLAGLLYAWQFPHFNALSHGIAQQYKSAGYVM
                     AAAENPRLNARVALRYSVLMFPLCFGLSYFGVTDWVFPFDSAIANGWLTYLAYIFWQQ
                     QERNYKNGAKATSEGLALAGVHAKKLFWCSVWHLPAVLILAMLHKKDQWNRLFEHIGL
                     KTRKIEGRLEV"
     gene            <485515..>490518
                     /locus_tag="CD36_51900"
                     /db_xref="GeneID:8048181"
     mRNA            <485515..>490518
                     /locus_tag="CD36_51900"
                     /product="cellular morphogenesis regulator, putative"
                     /transcript_id="XM_002420450.1"
                     /db_xref="GeneID:8048181"
     CDS             485515..490518
                     /locus_tag="CD36_51900"
                     /inference="similar to AA sequence:UniProt:Q03921"
                     /inference="similar to AA sequence:UniProt:Q59YL6"
                     /note="Similar to S. cerevisiae DOP1;
                     In S. cerevisiae: involved in establishing cellular
                     polarity and morphogenesis; member of the Dopey family of
                     cellular morphogenesis regulators;
                     morphogenesis/filamentation protein, Dopey family,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cellular morphogenesis regulator, putative"
                     /protein_id="XP_002420495.1"
                     /db_xref="GeneID:8048181"
                     /db_xref="GOA:B9WHD2"
                     /db_xref="InterPro:IPR007249"
                     /db_xref="InterPro:IPR010472"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B9WHD2"
                     /translation="MSPLSKAKLSPKDKKYSQSVEKTLATFDSLEEWADYIAFLSRLQ
                     KSLQFNIDTAKESYYVPYSSQVANRLALCLSSDLPNGVHQKALSVYEYIFERLPESTL
                     NKDINIWLPGLLPLFSYSSISVKPLQIKMFRHLILSQLSATTLRSISKPFILCLLSGL
                     DDENSEVFGDVIELLDAYKQKLNDDSHFWQSMFLCIIRNPERRPGALHWCVKRLPSFI
                     SFKDQNGNPVLSEEAQLCLKPEPGLLIRAMAISIDNPESFDIVVVRGFFDLMLSHIPL
                     DSDVITNRITPTDREALIMACSKITLCKDMSLNRRLWTYFLGPETEHESSKALTRTEY
                     FKQYVEETLIGGLLTMANSDKIESKCDAFKILLPLIMDKWEIGNVLTPKLFSSFLKIA
                     YNNCDHQDLMISASTLFDGVESVYIWSDIIGVILGDGNDDEEHDFDVVHFVLKDFNVN
                     EEEMATVHVPFAILCLLSKSTITSKRLDTLELLVNLASGRSLGTLDEEVTCCESEIIS
                     KIKAWYSSSLKGESLDTPFSQGQVSFLIVNLLQKVYIDNMEDTRFCVRIAELLNHVRN
                     FAMIKSSHGIQDSKLVEKILNISVPDFGCEPNQDGLLVAFGISKLVGIFAKSLTHETN
                     EKVLKVLLSNLWTAVVSSDPANHQVEAVRAIFELETCYSLKKLEAGLVELFLTLPENR
                     RVKAFEILWIHSISINESDRILEKALQLLLDGCSDDSSQNRLPIDEFLKQIIKTGASN
                     RLLKLITNPILAFDFIVAENESLVLDDDLGQFSYFLNLIVKVITADVKSFRDCFNNEL
                     AVMDSKSKIALVKENNWDISTYKSLLLSVIQKFFQLNLASEMAKDREQMQNYYSSIDN
                     CLQLLHLLVTGNENDFGDLLMFLIQISLKLSKSDTISPTIEAVQSKILQCIFYYLERA
                     TELRLDLNLLHVEEQNKNPLLINFISLGISKSESPILLEKWISLLIKSLYLFGESVFS
                     VLLILNDTLIKKIDNLFDQFSTWQHFKDPQDFESSIDILFSGLEDLLTISHGYLMTSN
                     IKSQAENQKNSTTDNGFLNTVISGVFQIESPAIRSSEQNKLYSILLAFHDAVRVSFKI
                     WNWSDSKTTTPSTVNYYSDRSLTYISHKLKFRARKLLESLLDMERQEVVESILISNGS
                     VNAKLKLIDILDGGRPQMTLPSILKSILSRSNLPVFSELSRVAVDLDFDLNMKELSRF
                     LVDFLNFIDNDSVADVWNYIMVFFKDILAHVGAFNEILSDCLLICSGLSKKLASIKNR
                     DHKYEKELGDIFVRLFNQVLSLKQFLLSDMSKTNPKTMDNGNLVNSKVDLENNFKTFC
                     QIIPVFEDILQDNDKVTSLANSTVTNFIIPRTKSKTVSEIPEDVVVIMNILGEANSCR
                     SWKTLVSDLFMERSFFNNTSSISSVWRSVINSWMVHDKERFGEIISRITITSGASPSN
                     LFVWNEMSEIENKANLLKRLVYLILVLPKDYFLNYLEPLFDKVNVLLNGNCPDIIRIQ
                     IMILFRAVCLKFNELHLLSKWTLISHELLSIFENLLAKSAKELSTLSQDSLQLIFFGC
                     KLLDQLLILSYDEFNLKECLFVSTSPDLDDGESISVISKISKKYDLTYLKDEPFKVDQ
                     ASGSLRPLLEGRRKIESLTQLRLFFDSLGLINYERTYSLYPIDYGSCITDALNDLVN"
     gene            <490728..>491714
                     /locus_tag="CD36_51910"
                     /db_xref="GeneID:8048182"
     mRNA            <490728..>491714
                     /locus_tag="CD36_51910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420451.1"
                     /db_xref="GeneID:8048182"
     CDS             490728..491714
                     /locus_tag="CD36_51910"
                     /inference="similar to AA sequence:UniProt:Q59Z07"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420496.1"
                     /db_xref="GeneID:8048182"
                     /db_xref="UniProtKB/TrEMBL:B9WHD3"
                     /translation="MSRESSPEYEEFDETYIETPQRASNSPKKNKSTNFLSFRTVRSS
                     PLRQPPIERKHGISLDEESIIQSNKSNPISDLPAISNAPSSPPASIRFNKTMKQTRSF
                     EDTPKKESNTTADLNQQFSRHSKGLNFSDFGFSRSSKFSTSQSRRPSLRELSEKSIVR
                     PQVSRDVDTYSHSVLEKVNSTLEELHNYDGKWGPNCIENDEKIESTKTDPVTVTNKYT
                     GNSDLRGHEVLDNSTPIKPNSREGAVQSQTKSGLLQSAWWSSAKWGKLRKIVKSKSIS
                     REEAINSTLLMSELECTNKMELRKRYDFLAKYINRNPKSNTTRGKGRVSKTH"
     gene            complement(<491750..>492724)
                     /locus_tag="CD36_51920"
                     /db_xref="GeneID:8048183"
     mRNA            complement(<491750..>492724)
                     /locus_tag="CD36_51920"
                     /product="pre-rRNA-processing protein, putative"
                     /transcript_id="XM_002420452.1"
                     /db_xref="GeneID:8048183"
     CDS             complement(491750..492724)
                     /locus_tag="CD36_51920"
                     /inference="similar to AA sequence:UniProt:P53743"
                     /inference="similar to AA sequence:UniProt:Q59YL9"
                     /note="Similar to S. cerevisiae ESF2;
                     In S. cerevisiae: essential nucleolar protein involved in
                     pre-18S rRNA processing; component of the small subunit
                     (SSU) processome"
                     /codon_start=1
                     /transl_table=12
                     /product="pre-rRNA-processing protein, putative"
                     /protein_id="XP_002420497.1"
                     /db_xref="GeneID:8048183"
                     /db_xref="GOA:B9WHD4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:B9WHD4"
                     /translation="MSTASARESDRESDFESEDESNFQDKVFNMKSKTSTFFRATRSE
                     DEEFSEDEKDKDERNEFNTKTEPKEGKHNFEDIVYDEESGESNGEDEDGNTDLSLDSG
                     SKVNKKLKKLTDKELAKEQKRIKRTGVCYLSRVPPYMKPAKLRSILSRFGEVDRLFLK
                     PEDPAVYHKRVKYGGNKKKNFTEGWIEFVNKSDAKLCAATLNGNKLGGKKTSYYYDDI
                     INIKYLSGFKWLDLTQQIAKENEVRQAKLAMEISQQQKLNKSFVSNVEKSKMIANIQK
                     KRKTTDDDNIRRDFKQRKVTTTRSDAKDDLKSKSKPTDKLNDILSKVF"
     gene            complement(<493689..>494072)
                     /locus_tag="CD36_51930"
                     /db_xref="GeneID:8048184"
     mRNA            complement(<493689..>494072)
                     /locus_tag="CD36_51930"
                     /product="glucose and lipid-regulated protein, putative"
                     /transcript_id="XM_002420453.1"
                     /db_xref="GeneID:8048184"
     CDS             complement(493689..494072)
                     /locus_tag="CD36_51930"
                     /inference="similar to AA sequence:UniProt:P22943"
                     /inference="similar to AA sequence:UniProt:Q59YM0"
                     /note="Similar to S. cerevisiae HSP12; heat shock protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="glucose and lipid-regulated protein, putative"
                     /protein_id="XP_002420498.1"
                     /db_xref="GeneID:8048184"
                     /db_xref="GOA:B9WHD5"
                     /db_xref="InterPro:IPR007250"
                     /db_xref="UniProtKB/TrEMBL:B9WHD5"
                     /translation="MSDAGRKNISTKINEAITPDSNKSTLEKGKEQVTSTIDKAVGSN
                     VPDNQKSFTQTVADNVQKGADNAKADLKKQSEQAEGETKTLAETAQEYVEVAKTEIGK
                     AAEYVSGVVTGATEGAKTGADSTKK"
     gene            <500592..>500975
                     /locus_tag="CD36_51940"
                     /db_xref="GeneID:8048185"
     mRNA            <500592..>500975
                     /locus_tag="CD36_51940"
                     /product="glucose and lipid-regulated protein, putative"
                     /transcript_id="XM_002420454.1"
                     /db_xref="GeneID:8048185"
     CDS             500592..500975
                     /locus_tag="CD36_51940"
                     /inference="similar to AA sequence:UniProt:P22943"
                     /inference="similar to AA sequence:UniProt:Q59YM0"
                     /note="Similar to S. cerevisiae HSP12; heat shock protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="glucose and lipid-regulated protein, putative"
                     /protein_id="XP_002420499.1"
                     /db_xref="GeneID:8048185"
                     /db_xref="GOA:B9WHD5"
                     /db_xref="InterPro:IPR007250"
                     /db_xref="UniProtKB/TrEMBL:B9WHD5"
                     /translation="MSDAGRKNISTKINEAITPDSNKSTLEKGKEQVTSTIDKAVGSN
                     VPDNQKSFTQTVADNVQKGADNAKADLKKQSEQAEGETKTLAETAQEYVEVAKTEIGK
                     AAEYVSGVVTGATEGAKTGADSTKK"
     gene            complement(<501427..>503919)
                     /locus_tag="CD36_51950"
                     /db_xref="GeneID:8048186"
     mRNA            complement(<501427..>503919)
                     /locus_tag="CD36_51950"
                     /product="ATPase of the AAA family, putative"
                     /transcript_id="XM_002420455.1"
                     /db_xref="GeneID:8048186"
     CDS             complement(501427..503919)
                     /locus_tag="CD36_51950"
                     /inference="similar to AA sequence:UniProt:Q07844"
                     /inference="similar to AA sequence:UniProt:Q5AGG2"
                     /note="Similar to S. cerevisiae RIX7;
                     In S. cerevisiae: required for export of pre-ribosomal
                     large subunits from the nucleus; ribosome biogenesis
                     ATPase, putative; ribosome export protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ATPase of the AAA family, putative"
                     /protein_id="XP_002420500.1"
                     /db_xref="GeneID:8048186"
                     /db_xref="GOA:B9WHD7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WHD7"
                     /translation="MKAMSKSKSITGSLDQKIYNLIHDLLQEQTEENKRTVTTDEEHD
                     PFSCMASSHNLTVSQVLTYVQMKDFQLKRMKKNYLEKSIAASLKVIRQDEAEEFGNRE
                     NGNGEESEVDYDKENENELMEVKDSNAINKSVVSLWNQEKTEGESDGANNEESQQTDS
                     ADLLKGSKRKAKDSARTQLKKQKRKIDYSTPNIDLSSLGGVESVTTQLLEIIGLPILH
                     PEIYSSTGVEPPRGVLLYGPPGCGKTTIANALAGELKVPFINISAPSVVSGMSGESEK
                     KLREIFEEAKQIAPCLIFMDEIDAITPKRDGGAQREMEKRIVAQLLTLMDELTLEKTG
                     GKPVVVIGATNRPDSLDSALRRAGRFDREICLNVPNEEQRISILKAMTKNIKLENGEY
                     FNYRELSKLTPGYVGADLKSLVTAAGITAIKRIFETMSELQEETHSAKDDSMDVDPVN
                     LDASKEDMIKKFEKKSEAEKLSTIKKFLNMHPDPLNQEQLTPLAIKYQDFVNALPSVQ
                     PSAKREGFATIPDVTWQNVGALFKIRMELHMCIVQPIKKPELYLKVGIAAPAGVLMWG
                     PPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESEKAVRQVFQRARASTPCIIFF
                     DELDALVPRRDTSMSESSSRVVNTLLTELDGLNDRKGVFVIGATNRPDMIDPAMLRPG
                     RLDKTLYIELPTPEERLEILKTLVRTNNSPLNENVDLNAIARDPRCGNFSGADLFSLV
                     KEAGVWALKKRFFQNQKIQELDSSGFYEDSIGGDDISITAEDFDHALSSIRPSVSDRD
                     RLRYEKLNKKLGWNIIADKEPDDVGSTAEKKD"
     gene            complement(<504332..>504883)
                     /locus_tag="CD36_51960"
                     /db_xref="GeneID:8048187"
     mRNA            complement(<504332..>504883)
                     /locus_tag="CD36_51960"
                     /product="putative pyridoxamine 5'-phosphate oxidase
                     ylr456w (ec 1.4.3.5 (pnp/pmp oxidase ylr456w) (pnpox
                     ylr456w)"
                     /transcript_id="XM_002420456.1"
                     /db_xref="GeneID:8048187"
     CDS             complement(504332..504883)
                     /locus_tag="CD36_51960"
                     /EC_number="1.4.3.5"
                     /inference="similar to AA sequence:UniProt:Q06199"
                     /inference="similar to AA sequence:UniProt:Q5AGF9"
                     /note="pyridoxamine 5'-phosphate oxidase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="putative pyridoxamine 5'-phosphate oxidase
                     ylr456w (ec 1.4.3.5 (pnp/pmp oxidase ylr456w) (pnpox
                     ylr456w)"
                     /protein_id="XP_002420501.1"
                     /db_xref="GeneID:8048187"
                     /db_xref="GOA:B9WHD8"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:B9WHD8"
                     /translation="MSQKESLPESVLNLLNSSRFIHLATCLDNKPHVSLMNYTFVRQG
                     DDNLVIVSTPRKTTKFENMLSNPNVSLLIHDWISVKNTAGQSVEESSASPKRNSLYEL
                     LANFNRNELSRVSVMLDGEAKILDKTVDGKDFDFYKSLHLNNSKIDHTQVKNYIENDD
                     NALIIIRITNCKVTDTDNNVESY"
     gene            complement(<505092..>506774)
                     /locus_tag="CD36_51970"
                     /db_xref="GeneID:8048188"
     mRNA            complement(<505092..>506774)
                     /locus_tag="CD36_51970"
                     /product="origin recognition complex subunit, putative"
                     /transcript_id="XM_002420457.1"
                     /db_xref="GeneID:8048188"
     CDS             complement(505092..506774)
                     /locus_tag="CD36_51970"
                     /inference="similar to AA sequence:UniProt:P54791"
                     /inference="similar to AA sequence:UniProt:Q5AGF8"
                     /note="Similar to S. cerevisiae ORC4;
                     In S. cerevisiae: directs DNA replication by binding to
                     replication origins and is also involved in
                     transcriptional silencing"
                     /codon_start=1
                     /transl_table=12
                     /product="origin recognition complex subunit, putative"
                     /protein_id="XP_002420502.1"
                     /db_xref="GeneID:8048188"
                     /db_xref="GOA:B9WHD9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR016527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WHD9"
                     /translation="MSSQDHLEDDFEGEFRSIRYLPKRKIDNEESGELATNSSNSYVT
                     NKRSKKVSVVAGSSGVDTSPDDPLNKTGYSKIATDLAKPLPETSEDDIEIVKTQLLDQ
                     LNGNFEIFSSTPSVSEKYTEIYSIFERTIRDKESHSVLMVGPRSSGKTTIVKSALKEL
                     DRNYNGEFISIYLNSSVQTDDSSALREIARQLDINVKKDVGDDGSEPMGLTNEKIGYA
                     SFEKKSINDTFSNILSVLTSHKGERDERMPLVFVIDEFEKFTVDNRQTLLYNLLDISQ
                     SSATPICVVGLTTKITTKETLEKRVSSRFSQRVISLVHETSLDNFWDNCKASLLLQDS
                     TINTLKNPEYGLSWNEHIEQLYCKKNSLLRNMVVRNYHSVKDYRKFNNACRVPVSKLS
                     AHHAYIEEDYFKLRSAGSNGVQDLVTSLSDLELLLVIAGVRWIEKFEIQTINFNLAYT
                     EYQEMVKDFNTGNAIVSSASLDNRIAASIKVDRRVLSRKVSLNSWGTLYKLGILLDPK
                     GDTVEAQSNTYSYHINKNLIIEENQMVLVDITLDELNNFIEDKHAFKRFVRL"
     gene            <507377..>509389
                     /locus_tag="CD36_51980"
                     /db_xref="GeneID:8048189"
     mRNA            <507377..>509389
                     /locus_tag="CD36_51980"
                     /product="GTPase-activating protein, putative"
                     /transcript_id="XM_002420458.1"
                     /db_xref="GeneID:8048189"
     CDS             507377..509389
                     /locus_tag="CD36_51980"
                     /inference="similar to AA sequence:UniProt:P11972"
                     /inference="similar to AA sequence:UniProt:Q5AGF7"
                     /note="Similar to S. cerevisiae SST2"
                     /codon_start=1
                     /transl_table=12
                     /product="GTPase-activating protein, putative"
                     /protein_id="XP_002420503.1"
                     /db_xref="GeneID:8048189"
                     /db_xref="GOA:B9WHE0"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:B9WHE0"
                     /translation="MSQSNMELNDESQKRTKKSILSASLSSRREKSQGLITELGCSPS
                     KISVLHEATHHKFSRTSSGRIFEKDIKDIFSLLVISLRLERDGSTNYLFNSPPIIKFH
                     KPLRKNYPYSFSLESAIEKMKDLQLDIESVNTVTCISYSFNSEVSLALIESFYKGRLL
                     HSPADRTRGKPKSNVALQPTPKGIAIVQEFCERIGMEREAFPEVLLSHDFNTMELFNF
                     DRDSRSDSILYSEYLLYLLFNIMMGPEPNVWTPSNTQDALPSWNFSDTESFDKLYEVF
                     SNSKDTKNVKGNNKNASEFEGFNFGDYQYISKARQSSEIHSFTDHREIASSPFHHRYF
                     TNPESDAHSQYYVSSVGVRLLKDKIVLAASNKSVTVDYCISGKAVCQWILDCTDIINP
                     NHAIELARLLVKHNLIKPISLSGNHSFSRDAYYQLSTLGLALSSWDFSERNLQDSSCF
                     QTGTKILRLTNNATLENILNDPGMRLQFRKHLIKDHCAENLEAYIQLTQFEEKYKAWE
                     NLSDIIDNQNHSCKPVSCSDVNRRLKNLQTTCMSFAFQIFHTYLSIDSPKIVNIDFRL
                     RSKITTLMIGDSGAKVNGDNESIIFLKTPTEDFALGSSVLEETADSASRSHVDGKLLA
                     PDNSFRKIANSLLQIKFQIYHLMKVDSIPKFLETLGITSNKRITTF"
     gene            complement(<509470..>511074)
                     /locus_tag="CD36_51990"
                     /db_xref="GeneID:8048190"
     mRNA            complement(<509470..>511074)
                     /locus_tag="CD36_51990"
                     /product="eukaryotic translation initiation factor 2
                     (eIF-2) subunit gamma, putative"
                     /transcript_id="XM_002420459.1"
                     /db_xref="GeneID:8048190"
     CDS             complement(509470..511074)
                     /locus_tag="CD36_51990"
                     /inference="similar to AA sequence:UniProt:P32481"
                     /inference="similar to AA sequence:UniProt:Q5AGF6"
                     /note="Similar to S. cerevisiae GCD11;
                     In S. cerevisiae: involved in the identification of the
                     start codon; binds GTP when forming the ternary complex
                     with GTP and tRNAi-Met"
                     /codon_start=1
                     /transl_table=12
                     /product="eukaryotic translation initiation factor 2
                     (eIF-2) subunit gamma, putative"
                     /protein_id="XP_002420504.1"
                     /db_xref="GeneID:8048190"
                     /db_xref="GOA:B9WHE1"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR015256"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WHE1"
                     /translation="MSYDDIENATPDIVIGSTIEEPEEDYQIESDNELQAADHESSQI
                     NEDSAKGKKSVAFTGLDEDEENAEEIARKEFEEGGGLPEQPENPDFSELTPLSPEIIN
                     RQATINIGTIGHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCDNPE
                     CPEPDCYRSFKSDKEIRPKCQRAGCDGRYKLLRHVSFVDCPGHDILMSTMLSGAAVMD
                     AALLLIAGNESCPQPQTSEHLAAIEIMKLKHVIILQNKVDLMREESALEHEKSIIQFI
                     RGTIADNAPIVPISAQLKYNIDAVNQFIVNYIPVPMRDFTASPRLIVIRSFDVNKPGA
                     DVDELKGGVAGGSILTGVFKIGDEIEIRPGIVTKDDQGKIQCKPIFSNVVSLFAEHND
                     LKFAVPGGLIGVGTKVDPTLCRADRLVGQVVGAKGNLPSIYTDIEINYFLLRRLLGVK
                     TEGQKQGAKVRKLEQSEVLMVNIGSTATGARVVAVKADMARLQLTTPACTEINEKIAL
                     SRRIEKHWRLIGWATIKKGTALEPIS"
     gene            complement(<511259..>514069)
                     /locus_tag="CD36_52000"
                     /db_xref="GeneID:8048191"
     mRNA            complement(<511259..>514069)
                     /locus_tag="CD36_52000"
                     /product="zinc finger-containing transcription factor,
                     putative"
                     /transcript_id="XM_002420460.1"
                     /db_xref="GeneID:8048191"
     CDS             complement(511259..514069)
                     /locus_tag="CD36_52000"
                     /inference="similar to AA sequence:UniProt:P08638"
                     /inference="similar to AA sequence:UniProt:Q5AGU1"
                     /note="Similar to S. cerevisiae LEU3;
                     In S. cerevisiae: regulates genes involved in branched
                     chain amino acid biosynthesis and ammonia assimilation"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc finger-containing transcription factor,
                     putative"
                     /protein_id="XP_002420505.1"
                     /db_xref="GeneID:8048191"
                     /db_xref="GOA:B9WHE2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:B9WHE2"
                     /translation="MSQEFRLPNRTSIPANQSLSQTPLNHQPASDYNSATSTPSPSTT
                     TGRKSSRSKKMACVECRQQKSRCDAFEKQPDPCTRCAKKGLQCDVKSDYKRTYKRARI
                     AQIEKEFEELKKTLTNTQAAELLSKFPSLSSASPDTNPQEETSQIKVKIEPGTSCDSS
                     RGIAADAGVTKSISNIDLPRHSTIVAETAYPQQSLAKSTQIPPYQFQSLNSSETSQSL
                     PNTPSITRQVESNILHQIPAASHENQVQLPESSLICEEKSVDDISLMPETIKKLYLEY
                     FERYHPILPVVDVSLGPERIYRLCPALFWVIMFVSLRRFPDNSSKSLLVRLSPVVKGI
                     LAEIMISPITRYNPIEEDEPIYNVSSVYSVQAFLLYSYWPPITSSLSADSSYNTVGTA
                     FLQAIRIGLHTPTLVNTSEMNKDERTQQQLAMTHEQLKTWIFCNIASQTIATAFGFPA
                     CTQFDSSMWFYNQPGSTIRIPRNLQLMMEIAQFEDQMAKALNSNPMDPCGLIDASERL
                     PLLKLLSKRLDNIEITLKNEMLQPSDRRFRVFEILSTRVHLLSYYFMDTVRIAQFELQ
                     KGLIRLYNAAISFINHTSECQANDKKFVKYLPGVYLLNLWQAGCIIGKLIHSSLKKFI
                     DVGTGKQSYESVIAFTASASILKHDMAYRSSGITRNMWQLFRTLDANKTNSLSIDIRN
                     RMSASVFFDCLKLLRAQVGITKLTTKTDENHPADDEEAIEESLEEDEEPTDMDNEKTV
                     HSEDDKNGSLHNGSQKSTPNSTTSSRVRKARTLSNNMDAESKTRKIIRTIPLDPEPIS
                     IGASKRSSIFKVVNSSTDSSPLMKSDVSTPNSNRINNHQIKTQTYNPTHVEKQQSPYP
                     SSKQTPQFLQFQQQPQQSDNRSYQSAQNASEVPLSQFSAFAFNESPIQLGLENLDIDN
                     FDHDMLWKDVDSVMNDFGFHAS"
     gene            complement(<514768..>515137)
                     /locus_tag="CD36_52010"
                     /db_xref="GeneID:8048192"
     mRNA            complement(join(<514768..514988,515065..>515137))
                     /locus_tag="CD36_52010"
                     /product="mitochondrial 37S ribosomal protein YMR31"
                     /transcript_id="XM_002420461.1"
                     /db_xref="GeneID:8048192"
     CDS             complement(join(514768..514988,515065..515137))
                     /locus_tag="CD36_52010"
                     /inference="similar to AA sequence:UniProt:P19955"
                     /note="Similar to S. cerevisiae YMR31;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 37S ribosomal protein YMR31"
                     /protein_id="XP_002420506.1"
                     /db_xref="GeneID:8048192"
                     /db_xref="GOA:B9WHE3"
                     /db_xref="InterPro:IPR020373"
                     /db_xref="UniProtKB/TrEMBL:B9WHE3"
                     /translation="MKTAIRLLKYVQSIKFVGGPHPAPKPHAAGPHPLAPEGLVPSGL
                     NSAKSSTYHNSNPVEPQNGEFFARSELSARFRYRPIKAEEIEQVESGGAEFVF"
     gene            <515681..>516724
                     /locus_tag="CD36_52020"
                     /db_xref="GeneID:8048193"
     mRNA            <515681..>516724
                     /locus_tag="CD36_52020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420462.1"
                     /db_xref="GeneID:8048193"
     CDS             515681..516724
                     /locus_tag="CD36_52020"
                     /inference="similar to AA sequence:UniProt:Q5AGF2"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420507.1"
                     /db_xref="GeneID:8048193"
                     /db_xref="UniProtKB/TrEMBL:B9WHE4"
                     /translation="MKSMEEESPISILALPYPIIARILYECWKETYKVCSILPMLCTC
                     KQLYYGYKYMLYTLRPLVIINKSTKNTGKDCISCSGFLKLLQDTRIRQKLDTLCLHLF
                     PAMFNNKSVSSIVTNLNQFSNLTHLIIHVKSMEWLVQWIKHFPTTITILKITLVKHVM
                     SSSSSLNTETFSIPEFQLKQLKFQSLVPLQKKKLCYGLSIISTAASTYTPQTIEERYK
                     SNLPLFQTGQVLANLIHANRESLQFMELEMINLNEIYLILQQQYGFNNQCSKYFTTLN
                     LLKVDQCTNYPILQLSHWLRNCKQIIYLNHFLSTFIVLQQNSSSNVIKEFKYHMSLFE
                     YKMQKYKYEIKFN"
     gene            <516975..>517958
                     /locus_tag="CD36_52030"
                     /db_xref="GeneID:8048194"
     mRNA            <516975..>517958
                     /locus_tag="CD36_52030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002420463.1"
                     /db_xref="GeneID:8048194"
     CDS             516975..517958
                     /locus_tag="CD36_52030"
                     /inference="similar to AA sequence:UniProt:Q12125"
                     /inference="similar to AA sequence:UniProt:Q5AGF1"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_002420508.1"
                     /db_xref="GeneID:8048194"
                     /db_xref="InterPro:IPR007317"
                     /db_xref="UniProtKB/TrEMBL:B9WHE5"
                     /translation="MSDKLARTIQRFQAKIDSGSFYEAHQTLRTITNRYVKAKQYKEA
                     RDLLYQGSTILLNNKEYASASDLINYLIQIYDEEGILVSDKDAKLKLIDLISNLPNND
                     PSLNDLAKSSLNWSKKSSGCEKFGDCELHHLFGSKFLKFVEYGTFQDNAESENGKTVL
                     DPEERAKVFAIAELHLVLGTFESVPLYINYLVQYAKANPDVDPGVFLGRAIINYSYLK
                     NIKFVKEAQDLFLKEIKVSNKETLKTDFQFYQDYPVLNFLQLLVITLQKEHTSNSQKF
                     IKLYEQYKSTLQQYEFLAPIEYLGKIYFNVNIGNSNQQGNMLANIMSGLFK"
     gene            complement(<518100..>518684)
                     /locus_tag="CD36_52040"
                     /db_xref="GeneID:8048195"
     mRNA            complement(<518100..>518684)
                     /locus_tag="CD36_52040"
                     /product="diadenosine 5',5'''-p1,p6-hexaphosphate
                     hydrolase, putative"
                     /transcript_id="XM_002420464.1"
                     /db_xref="GeneID:8048195"
     CDS             complement(518100..518684)
                     /locus_tag="CD36_52040"
                     /EC_number="3.6.1.-"
                     /inference="similar to AA sequence:UniProt:Q5AGF0"
                     /inference="similar to AA sequence:UniProt:Q99321"
                     /note="Similar to S. cerevisiae DDP1;
                     In S. cerevisiae: member of the MutT family of nucleotide
                     hydrolases with high specificity for diadenosine hexa- and
                     pentaphosphates, required for efficient hydrolysis of
                     diphosphorylated inositol polyphosphates; diadenosine and
                     diphosphoinositol polyphosphate phosphohydrolase,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="diadenosine 5',5'''-p1,p6-hexaphosphate
                     hydrolase, putative"
                     /protein_id="XP_002420509.1"
                     /db_xref="GeneID:8048195"
                     /db_xref="GOA:B9WHE6"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:B9WHE6"
                     /translation="MEQQQQQSYNNPNLPAKSQKAREGRENQRYNPETGARIVSGCIC
                     LNETKDKIIMISSSKHKNRWIVPKGGNELDESELETAVRETWEEAGVEGIIIKKLPVV
                     LDSRGNQAPVIKGEFDPDIATPKSEFHFFELQVDQLSTTWPEMKKRQRRWCTYSEAKH
                     ELLKSKRPELVDALNMSSIIKDTIDNKNPKEDKY"
     gene            <519378..>520214
                     /locus_tag="CD36_52050"
                     /db_xref="GeneID:8048196"
     mRNA            <519378..>520214
                     /locus_tag="CD36_52050"
                     /product="proteasome beta-type subunit, putative"
                     /transcript_id="XM_002420465.1"
                     /db_xref="GeneID:8048196"
     CDS             519378..520214
                     /locus_tag="CD36_52050"
                     /EC_number="3.4.25.1"
                     /inference="similar to AA sequence:UniProt:P30657"
                     /inference="similar to AA sequence:UniProt:Q5AGT6"
                     /note="Similar to S. cerevisiae PRE4"
                     /codon_start=1
                     /transl_table=12
                     /product="proteasome beta-type subunit, putative"
                     /protein_id="XP_002420510.1"
                     /db_xref="GeneID:8048196"
                     /db_xref="GOA:B9WHE7"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016295"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:B9WHE7"
                     /translation="MNHDPYSWGRPSNDTYGPYNYKIAHANNNQVEQTTHNFPKMNTQ
                     QPIITGTSVIASKFKNGVIMAADHVGSYGSLLRFNNIERLIKVGKETVVGISGDISDL
                     QYIVRLLDELEIEEEVYDNDGGDYLRAPNVHEYLSRVLYNRRSKMNPLWNAVIVGGFN
                     KDRTPFLKYVDLLGVTYHASTIATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSKAVE
                     DSMKVLFYRDARSGENYSVVIIKIDENTGELNFQFIKDAQVQNQSWKFAGDIRGYGSA
                     QQ"
     gene            <525645..>526838
                     /locus_tag="CD36_52060"
                     /db_xref="GeneID:8048197"
     mRNA            <525645..>526838
                     /locus_tag="CD36_52060"
                     /product="cAMP-independent regulatory protein, putative"
                     /transcript_id="XM_002420466.1"
                     /db_xref="GeneID:8048197"
     CDS             525645..526838
                     /locus_tag="CD36_52060"
                     /inference="similar to AA sequence:UniProt:Q10294"
                     /inference="similar to AA sequence:UniProt:Q4WXI6"
                     /inference="similar to AA sequence:UniProt:Q5AGE8"
                     /inference="similar to AA sequence:UniProt:Q9Y7F9"
                     /note="Similar to S. pombe PAC2;
                     In S. pombe: controls the onset of sexual development, by
                     inhibiting the expression of ste11, in a pathway that is
                     independent of the cAMP cascade"
                     /codon_start=1
                     /transl_table=12
                     /product="cAMP-independent regulatory protein, putative"
                     /protein_id="XP_002420511.1"
                     /db_xref="GeneID:8048197"
                     /db_xref="InterPro:IPR018608"
                     /db_xref="UniProtKB/TrEMBL:B9WHE8"
                     /translation="MLIISEFNPQLMHSDDSEDDYDHQSNHRNSSNGATTINQIITYK
                     GQISSLNDALLIIEACRLQKLPMVTRRLTGIERNKFIKPNTVFVWNETQCGMKRWTDG
                     RLWSASKVYNGNFLVYKQLNKKTKREQEEEESGGQGLVKQSFSVVTKDHQRYHLISYY
                     ENIPGTFRPRSASKQATTINIPSQDSKVCHLDLSNTVYPDSLLNSVYKRKHQQQQYEQ
                     KLEQLRQQSHSPAILSNNNNNNNNNNNNNNPVHQESYPSPGINSNLYSPMHQTATYCK
                     SSSSLSSSSRSSSSSRSSNSSSSNITSQRTTQSSSPLPMSSLNTKSAAYFTSSGHNHA
                     AFALQRASPQNHLQRPHNTLTLQPLSKISQLSQTPTLGNNNNTGIINDYDSRTVSVLN
                     KTWLK"
     gene            complement(<527828..>529237)
                     /locus_tag="CD36_52070"
                     /db_xref="GeneID:8048198"
     mRNA            complement(<527828..>529237)
                     /locus_tag="CD36_52070"
                     /product="mitochondrial import protein, putative"
                     /transcript_id="XM_002420467.1"
                     /db_xref="GeneID:8048198"
     CDS             complement(527828..529237)
                     /locus_tag="CD36_52070"
                     /inference="similar to AA sequence:UniProt:P53230"
                     /inference="similar to AA sequence:UniProt:Q5AGE7"
                     /note="Similar to S. cerevisiae TAM41;
                     In S. cerevisiae: involved in protein import into the
                     mitochondrial matrix; maintains the functional integrity
                     of the TIM23 protein translocator complex"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial import protein, putative"
                     /protein_id="XP_002420512.1"
                     /db_xref="GeneID:8048198"
                     /db_xref="InterPro:IPR015222"
                     /db_xref="UniProtKB/TrEMBL:B9WHE9"
                     /translation="MITKCYVQVFRYRRVCHNTKYSFNSVVSVKWLHSAGSSLSQANP
                     SKASSSSLRSSGFLYYEDPHRYNGSDDNFNVSATTTTSTTKPIIHSATPYSDKYYQPI
                     ISQGAKGFDKLIIPVGFRADNQTVLLEEDKEAPIQQDQLQEIVNSFDAPIDVSIGYGS
                     GILPQDGYDTDKSTTNNTNKNSKQLDFMFLVKDCRKFHEENLKQNRDHYSVKSLRLIN
                     KIQGVNGMYFNPFIKINEKLVKYGVISSKSALMDLSEWHSLYFAGRLQKPVNFITAND
                     PRVKFLNQYNLKNAMTIAIFLIDGEGNSRQATFDERQLYEEITKLSYLGDFRMYIGGE
                     NPNKSKNIVAKQFHHFKKLYEPILQYFIHKNFLIIVDNDPINRTFKPNLNVNNRIKLI
                     TGLPLKFRQQLYGRYYEKSIKEIVIDDQLSQNLTKIISRTIIISSIKQAIRGLLSAGL
                     FNSIKYAIAKQIKFWTSNK"
     gene            <529614..>531146
                     /locus_tag="CD36_52080"
                     /db_xref="GeneID:8048199"
     mRNA            <529614..>531146
                     /locus_tag="CD36_52080"
                     /product="threonine synthase, putative"
                     /transcript_id="XM_002420468.1"
                     /db_xref="GeneID:8048199"
     CDS             529614..531146
                     /locus_tag="CD36_52080"
                     /EC_number="4.2.3.1"
                     /inference="similar to AA sequence:UniProt:P16120"
                     /inference="similar to AA sequence:UniProt:Q5AGE6"
                     /note="Similar to S. cerevisiae THR4;
                     In S. cerevisiae: conserved protein that catalyzes
                     formation of threonine from 0-phosphohomoserine"
                     /codon_start=1
                     /transl_table=12
                     /product="threonine synthase, putative"
                     /protein_id="XP_002420513.1"
                     /db_xref="GeneID:8048199"
                     /db_xref="GOA:B9WHF0"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR004450"
                     /db_xref="InterPro:IPR029144"
                     /db_xref="UniProtKB/TrEMBL:B9WHF0"
                     /translation="MPSSSQVYRSTRSNQPEELSFEDVVMTGLAPDGGLYLPSSIPQL
                     PNDFLTKWSDLSFNELAFEILRLYINENEIPNADLKDLIARSYSTFRSSEVTPLKKLN
                     DNLYILELFHGPTYAFKDVALQFVGNLFEYFLTRRNAQKDLTKQPKDIITVVGATSGD
                     TGSAAIYGLRGKKDVSVFILYPTGRISPIQEEQMTTVEDGNVHTLSVNGTFDDCQDIV
                     KQIFGDKEFNDKYHVGAVNSINWARILAQQTYYFYSYFQLQKQAKTTNKVRFVVPSGN
                     FGDILAGYYAYRMGLPVDKLIIATNENDILDRFIKSGEYAKEQEVGVKATYSPAMDIL
                     ISSNFERLLWYLIRDNVPEVNKSDEKAGQLLNDWMKQLKEQGKFKVPAEVIDAARQVF
                     DSQRVDNDTTVQTIKQVYDQSGDKYVIDPHTSVGVTTSYSFIAKDTEPTQYISLSTAH
                     PAKFSEVVNKALDSFDGYSFDKDVLPAELKALSSKEKRIKLIDEASVEKVKQAIKDEL
                     KF"
     gene            complement(<531198..>532592)
                     /locus_tag="CD36_52090"
                     /db_xref="GeneID:8048200"
     mRNA            complement(<531198..>532592)
                     /locus_tag="CD36_52090"
                     /product="copper transport protein, putative"
                     /transcript_id="XM_002420469.1"
                     /db_xref="GeneID:8048200"
     CDS             complement(531198..532592)
                     /locus_tag="CD36_52090"
                     /inference="similar to AA sequence:UniProt:P25355"
                     /inference="similar to AA sequence:UniProt:Q5AGE5"
                     /note="Similar to S. cerevisiae CTR86"
                     /codon_start=1
                     /transl_table=12
                     /product="copper transport protein, putative"
                     /protein_id="XP_002420514.1"
                     /db_xref="GeneID:8048200"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019156"
                     /db_xref="UniProtKB/TrEMBL:B9WHF1"
                     /translation="MTDIAIDTIINRTLHALENSDYSEFDLLLNQLSFLIKQSANNNN
                     KPAPEERITQILDYTPNDFNQIKTLRLYRGLLILVRNFAPALDIDLFPKVVVSFEKFL
                     KLHQTNEWTDKILEAYWQILTNFQRNEFIAIVNELFGQWECKYKWSNSLMAVMSPVIH
                     FLFRQFNTQDPHITNENLLHLLKIFETNHVMNAVYEIFKMIDFTDTNNIGHDYKMFVH
                     LLYDIITHESFQKWIEQQDEEETITKWLSLTSIVVQTKTDWNNYELIALLSWNGSLFM
                     KYAPLLNSNKGNTTTNGEDNLNYVEDDLSTIISILAELSQFNATKQYFEHYQDLLPQL
                     IFVFKWIHENIEPITIKNKQIEELGRYSSVKTNIITILSYLSYDSFQFQEKIRELGGL
                     SLVLSNCIIDNNNPFIKEQAIVCLKYLLQKNPKNQQFVADLEAKKVVDDQVLSEVGYQ
                     VEVIDGKVEVKRKQ"
     gene            <534404..>535681
                     /gene="PDE1"
                     /locus_tag="CD36_52100"
                     /db_xref="GeneID:8048201"
     mRNA            <534404..>535681
                     /gene="PDE1"
                     /locus_tag="CD36_52100"
                     /product="3',5'-cyclic-nucleotide phosphodiesterase,
                     putative"
                     /transcript_id="XM_002420470.1"
                     /db_xref="GeneID:8048201"
     CDS             534404..535681
                     /gene="PDE1"
                     /locus_tag="CD36_52100"
                     /EC_number="3.1.4.17"
                     /inference="similar to AA sequence:UniProt:P22434"
                     /inference="similar to AA sequence:UniProt:P32782"
                     /codon_start=1
                     /transl_table=12
                     /product="3',5'-cyclic-nucleotide phosphodiesterase,
                     putative"
                     /protein_id="XP_002420515.1"
                     /db_xref="GeneID:8048201"
                     /db_xref="GOA:B9WHF2"
                     /db_xref="InterPro:IPR000396"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR024225"
                     /db_xref="UniProtKB/TrEMBL:B9WHF2"
                     /translation="MSFEITILGSSGGPLEGSTCSILLKPANISYHDIINDNLPDQLL
                     CIDAGSGMGKLTEIIHQETTTKTSYCNFLQYYPDCETVSYYYHPDIAITTPFSNFQPG
                     RPILHTQKVFNNLQNYLISHSHLDHVCSVVINSAGFNKNVSNKTLYGSHYTINSMQKH
                     LFNGKIWPNMPSFKIVNLNYLESNRSERIGIYTVRMFDLSHGEFNKLTEEKEEAQHHI
                     NSNSNNIWKKRYDRRRSSITTIPENTSGLIIKNSEALNHHYLSSAFLITLDVPESTIT
                     KENPPSILIFGDFESDLTSKLSRNLFIWKNIAPLILRNQMKAIVLECSNCIEIDANEL
                     YGHLTPKLLIYELKQLAHECKQLDTTTNIEQPLLGLNIIVNHVKEPITDPNEESQLHD
                     PRKRILTELNKLNAVEKLGCNISIALSGTSIMV"
     gene            complement(<535894..>537606)
                     /locus_tag="CD36_52110"
                     /db_xref="GeneID:8048051"
     mRNA            complement(<535894..>537606)
                     /locus_tag="CD36_52110"
                     /product="delta subunit of the coatomer complex, putative"
                     /transcript_id="XM_002420471.1"
                     /db_xref="GeneID:8048051"
     CDS             complement(535894..537606)
                     /locus_tag="CD36_52110"
                     /inference="similar to AA sequence:UniProt:P43621"
                     /inference="similar to AA sequence:UniProt:Q5AGE3"
                     /note="Similar to S. cerevisiae RET2;
                     In S. cerevisiae: coats Golgi-derived transport vesicles;
                     involved in retrograde transport between Golgi and ER"
                     /codon_start=1
                     /transl_table=12
                     /product="delta subunit of the coatomer complex, putative"
                     /protein_id="XP_002420516.1"
                     /db_xref="GeneID:8048051"
                     /db_xref="GOA:B9WHF3"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027059"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:B9WHF3"
                     /translation="MVVLSASICTRGGKALLSRQFRDISRDRITALLANFPSLISNSS
                     GQHTSVEDENVRYVYQPLEEFYIVLITNKTSNILQDIDTLHLFASTVSNLLRNIDERE
                     IFESSFEIIDAFDEVLSLGYKENLTLTQVQTFLEMDSHEEKIQEIIERNKELEATEER
                     KRRAKEIQRKEMARKTMDQLHSGASAGVGASSFGYDSYQNNHQPTYQPTPVVETTHSA
                     GSNTTNSSSHSLLSKPRGGGLQLGGKKTAGRTLPSGNGAHEPLLATSQPVFAHRTAVE
                     SPQTSAGAGSGVKSGSVSRTGSPAPSNAATRVPNNGILITVNEKVSAQLSRDGSISSS
                     EVKGDLQLRINQTELANAKILLKIAGDKKQFKTHPNVDRNLFQSDSHISVKDKSKTFP
                     SNDQPLGVLRWRSVGKQDDTSLVPIVFTIWVSVNEEGQAQVTVEYELTNEFVENHPNH
                     PNVENLKILVPVLTDNVQLQDGGNDTVSYELYDGQGVVFNIGTIAIDDPQGSFEFTVP
                     VVDEDSLFPMQVQVDILNQEVVESDISLGGVSITDVVSNNEDEESLPFDLHSNISFEN
                     YVIQ"
     gene            complement(<537868..>539987)
                     /locus_tag="CD36_52120"
                     /db_xref="GeneID:8048202"
     mRNA            complement(join(<537868..537906,537990..>539987))
                     /locus_tag="CD36_52120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420472.1"
                     /db_xref="GeneID:8048202"
     CDS             complement(join(537868..537906,537990..539987))
                     /locus_tag="CD36_52120"
                     /inference="similar to AA sequence:UniProt:Q5AGE1"
                     /note="spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420517.1"
                     /db_xref="GeneID:8048202"
                     /db_xref="UniProtKB/TrEMBL:B9WHF4"
                     /translation="MSDCLSNKVILEYFNHHSKQLMPSCDLQTVLPREFTSETLKLNR
                     STSIKLHDLIRITPVQVTLKGPFPYELNAAKYIVKCENPISESNTGFKNTIKRHHWYP
                     NVNINPTYNNEVLQLESIEPYSPPPFQTLHSEMKKWRNSGFKVDSPINFNTSHKSISI
                     HPSPKWVLPDSIDLFSISQDNLNSHIPKHSIPEREVLLIKDKTPSCKYFCESQLIFTP
                     LEPCINTMRYDPWLYNDSSLPNPCVEDITQYLLDQNRVTKSGKYLVVPVACPNTKMKD
                     SPVVIISKFIFSHLKPEKHNWKLPMRVLIENMTWNPFNVDTANFVNKYLIETIAQDRN
                     FMATTDKTIISSVQMAIPPTTTHAFPKLSKTESAQELKPVNIKYPQRNNTPTKSDGLI
                     NTQIETNVATYHNDTDIMNELISSRKRKRKKLDTVSNAVLPPEISMLSFVEPKIPQNK
                     ETIEEINSSVLSITTIDKSVFAKTQHIIINETLWDTNYQLAKSLSDVVHALEMKIKLP
                     IDIIVNATTGIYCTSSDYLFQSDGHGEFLILKTLLHLKKHFRSLLLFSTVSTPIFLKY
                     NSKKLQKLQVLCMSLNIKLFLIPPQDLVVWILQVLNVEGPENSTLSVDTDDQEGNLLA
                     ECGLSYFQVNQVLQRCSFDEFLIMDTKEKINQFGEIITSELIYQLESILSQQLY"
     gene            complement(<540217..>541401)
                     /locus_tag="CD36_52130"
                     /db_xref="GeneID:8048203"
     mRNA            complement(<540217..>541401)
                     /locus_tag="CD36_52130"
                     /product="ER protein processing protein, putative"
                     /transcript_id="XM_002420473.1"
                     /db_xref="GeneID:8048203"
     CDS             complement(540217..541401)
                     /locus_tag="CD36_52130"
                     /inference="similar to AA sequence:UniProt:P25625"
                     /inference="similar to AA sequence:UniProt:Q5AGD9"
                     /note="Similar to S. cerevisiae PER1;
                     putatively involved in lipid remodelling of GPI-anchored
                     proteins in the ER"
                     /codon_start=1
                     /transl_table=12
                     /product="ER protein processing protein, putative"
                     /protein_id="XP_002420518.1"
                     /db_xref="GeneID:8048203"
                     /db_xref="InterPro:IPR007217"
                     /db_xref="UniProtKB/TrEMBL:B9WHF5"
                     /translation="MNHFLHFTFTIALLAYTILASPGDDLYAFQDCLYQCEQITCHNN
                     PYHIIQQEFYTELSSNPDYEFKYYNPYWEFDSMPLPLYLRLLGWNCESNCDYQCQRII
                     TSERIKNHEEIYQFHGKWPFLRILGIQELTSVIMSLGNLYVNYQSFKKIWRSVINNDS
                     VPSNLKYQFTNICVVQIVTMCAWLFSTIFHVRDYILTERLDYYFAGLTVLTQFHALGA
                     RYFNLYKHSRVVYRWLFSLSCALAYAYHVYRLYTDWSYTYNMQANICVGLFQNVFYCL
                     VCFGLYVKYYNLEQTENKVILNHLNYIESSRIILSSFFTRSSKLFSLYPLLLCFIVVC
                     GMALEVFDFPPVFFDLVDAHSLWHLVTILPVYMGWYDWLVWDVNENVWSNIQEEEKKK
                     KE"
     gene            complement(<543434..>547012)
                     /gene="CST20"
                     /locus_tag="CD36_52140"
                     /db_xref="GeneID:8048204"
     mRNA            complement(<543434..>547012)
                     /gene="CST20"
                     /locus_tag="CD36_52140"
                     /product="pseudohyphal/invasive-growth/pheromone-pathways
                     signal transduction serine/threonine-protein kinase, PAK
                     (p21-activated kinase) family, putative"
                     /transcript_id="XM_002420474.1"
                     /db_xref="GeneID:8048204"
     CDS             complement(543434..547012)
                     /gene="CST20"
                     /locus_tag="CD36_52140"
                     /EC_number="2.7.11.1"
                     /inference="similar to AA sequence:UniProt:Q03497"
                     /inference="similar to AA sequence:UniProt:Q92212"
                     /note="In S. cerevisiae: signal transducing kinase of the
                     PAK (p21-activated kinase) family, involved in pheromone
                     response and pseudohyphal/invasive growth pathways;
                     In C. albicans: protein kinase of Ste20p/p65PAK family,
                     required for wild-type mating efficiency and virulence in
                     a mouse model; serine/threonine-protein kinase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="pseudohyphal/invasive-growth/pheromone-pathways
                     signal transduction serine/threonine-protein kinase, PAK
                     (p21-activated kinase) family, putative"
                     /protein_id="XP_002420519.1"
                     /db_xref="GeneID:8048204"
                     /db_xref="GOA:B9WHF6"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:B9WHF6"
                     /translation="MSILSENNSTPTSITDPRKTSHSHNTESNPRSRVSSAPEVGSTP
                     LAPPTQVMNTTSANTSSLSLGSPMHEKIKQFDQDRVDTGEINDAFTKSVSGDVDDLQQ
                     SRNNHIESDKEQNEDDDEKTQGMPPRMPGTFNVKGLHQNDDSDNEKQYTELTKSINKR
                     TSKDSYSPGTLESPGTINAMDANNVSPAVIEEEQTQSFQDVPSTLQHQNENASLSAPR
                     SGPPPIPNSKTSSYHDMSSDISSSASVHKIPSNPTSTRGSHLSSYKSTLDPGKPSQAA
                     PPVDIDNLLTKSELDSEPDTSSSATDSPNLLRNDTLQGIPTRDDENIDDSPRQLSQNT
                     SGTSRNTSGTSTSTVVKNSRSGTAKSTAHNQTAAITPVIPNHNKFHQQATNTSSSSLE
                     PLGVGINSNSSPKNGKKRKSGGKVRGVFSSMFGKSKSSSSSSSSNSASNSHSQEVNIK
                     ISTPFNAKHLAHVGIDDNGSYTGLPIEWERLLSASGITKKEQQQHPQAVMDIVAFYQD
                     TSENPDDAAFKKFQFDNNKSSSSGWSNENTPPATPGGSSSGGGAPSSPHRTPPSSVVE
                     RSSIEQKTSTPSQSVPKTDSKQSQHDDNVQYTPKTPTSHIQENQFIPSRPAPKPPSTP
                     LSAMSGSHRTPSSQPLPRNDSQSDLRSSTPKSHQEVSPNKIKIRSLSSKSLKSMRSRK
                     SGDKFTHIAPAPPPPSLPVIPKSKSHSASLSSQLRPATNGSTTAPIPSSAAFGENNAL
                     PKQRVNEFKAHRAPPPPPPPPPPPANILSDQNVEIPQQRTAPSQALADATAPTNIYEI
                     QQTKYQEAQQKLREKKAREIEEIQKLREKNKQHNAEQNISELRTNAATTGTAGASNNA
                     PPVPIPNKKQPTGSGGGRDAKQAALIAQKKREEKKRKNLQIIAKLKTICNPGDPNELY
                     IDLVKIGQGASGGVFLAHDIRDRSNIVAIKQMNLEQQPKKELIINEILVMKGSSHPNI
                     VNFIDSYLLKGDLWVIMEYMEGGSLTDIVTHSVMTEGQIGVVCRETLKGLKFLHSKGV
                     IHRDIKSDNILLNMDGNIKITDFGFCAQINEINSKRITMVGTPYWMAPEIVSRKEYGP
                     KVDVWSLGIMIIEMLEGEPPYLNETPLRALYLIATNGTPKLKDPESLSYDIRKFLAWC
                     LQVDFNKRADADELLHDAFITGCDDVSSLSPLVKIARLKKMSESEQ"
     gene            complement(<548966..>550663)
                     /locus_tag="CD36_52150"
                     /db_xref="GeneID:8048030"
     mRNA            complement(<548966..>550663)
                     /locus_tag="CD36_52150"
                     /product="ubiquitin-binding protein, putative"
                     /transcript_id="XM_002420475.1"
                     /db_xref="GeneID:8048030"
     CDS             complement(548966..550663)
                     /locus_tag="CD36_52150"
                     /inference="similar to AA sequence:UniProt:P36075"
                     /inference="similar to AA sequence:UniProt:Q5AGS2"
                     /inference="similar to AA sequence:UniProt:Q5AGS3"
                     /note="appears to be a fusion of orf19.4243 and
                     orf19.4244;
                     Similar to S. cerevisiae CUE2"
                     /codon_start=1
                     /transl_table=12
                     /product="ubiquitin-binding protein, putative"
                     /protein_id="XP_002420520.1"
                     /db_xref="GeneID:8048030"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="UniProtKB/TrEMBL:B9WHF7"
                     /translation="MTLNKTYNNNGLSYPTTNVTNTFDFSNNNNNDKSRKTIYQLIYG
                     ELKTKNDNERNRTGGKYTLGSNDPDINSETIKMIENLCELFPMSTIDELRDHPTNVDH
                     SEDLVTELFDKATALIQSEKDREKEKEKEKKNNQKEPLSQQSKRYNQKYMKVGTSLYS
                     DAVYELQVMFPSIAIKSVEKILQENNGNIEDAAIALLELSSGTTTAASQKQRENDNEW
                     VEESSIVIKVCRFLQTNSNDIFLDKSDVLHYTRKNGGDYYKTLYDVVMNCKSMVLTKQ
                     QESTSGGATKTHDKSRNNRRVQRGGAMGLASSTRNRISHGQEPQNEISTTTPTPSNYR
                     YDENSMEAKELWSLIPLNKDGKNSVESISSQKLPINKKFAIKALEFFQGNVYKVIELI
                     SELSSSQISSSKQSRHLNEKQPVDIKIENSKFGMPKDSSNNTFIPSSTREYQTDRIIL
                     DSHDEQYLFDRYLKTGTVDLHGFTVVEAMELVPLILHHWWNQELTHRQSIGQLEKFGN
                     SASLGSVLIITGRGVHSTGGVSTVKVSVNRYLTNNNYIFEQPTSGSFEVTGKRINKK"
     gene            complement(<550972..>552285)
                     /locus_tag="CD36_52160"
                     /db_xref="GeneID:8048205"
     mRNA            complement(<550972..>552285)
                     /locus_tag="CD36_52160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420476.1"
                     /db_xref="GeneID:8048205"
     CDS             complement(550972..552285)
                     /locus_tag="CD36_52160"
                     /inference="similar to AA sequence:UniProt:Q5AGD4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420521.1"
                     /db_xref="GeneID:8048205"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:B9WHF8"
                     /translation="MVDRSETTGTITIIPPQPQPLQNSTITNVSPKSDVNKIYSRTST
                     IDTSATSTFDNNKLLISTVLYKRSRHTRQWKKKWVVLRKCQLSYYKDSKEHKPLKVYH
                     GEDLLSFSIIPDHTKNHFALYTSNKVLHFKAPDETIFRSWVDTLNGYFNSQDNEDDTQ
                     LLDQQEEDSLDCENKEENGEPRGSEADRNPEEDRDSQISSPVSPPLNSQQTLPIHSIQ
                     NKQQAQVRRSISLTDSINTSTEFSDCSSEVWSTIDSPITPSNAVNMNRGSSLFNALDA
                     PNEEDERRKAEPSLSCDEPQTKLTKDKSKSSTPVTDLTESVIEQGYMTVLKKKYNRNH
                     TKRVYLVLTNMNLTVYKTREDYHADFQQPKPLSELIYKNFPVNDILDIIELDPMNSKY
                     QWCLLIITPLKRIRFCCRDEEDMVKWFSALKAVVVTQKKKQKEMS"
     gene            <554837..>556630
                     /locus_tag="CD36_52170"
                     /db_xref="GeneID:8048206"
     mRNA            <554837..>556630
                     /locus_tag="CD36_52170"
                     /product="cardiolipin synthase, putative"
                     /transcript_id="XM_002420477.1"
                     /db_xref="GeneID:8048206"
     CDS             554837..556630
                     /locus_tag="CD36_52170"
                     /EC_number="2.7.8.-"
                     /inference="similar to AA sequence:UniProt:O13899"
                     /inference="similar to AA sequence:UniProt:P36151"
                     /inference="similar to AA sequence:UniProt:Q4WYA3"
                     /inference="similar to AA sequence:UniProt:Q5AGS0"
                     /note="mitochondrial protein, lipid/cell membrane
                     biosynthesis, putative; phosphatidyl synthase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cardiolipin synthase, putative"
                     /protein_id="XP_002420522.1"
                     /db_xref="GeneID:8048206"
                     /db_xref="GOA:B9WHF9"
                     /db_xref="InterPro:IPR006353"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:B9WHF9"
                     /translation="MTKEQSNNDSKNSVIVEEDGGAQFQSYLNNDGIDELTPSVRKHR
                     VSSLSLSDLNQWQTGLTKLSSSTSLSKKNSSSANLKKVDSLAKLSRNASIIKRKKKEI
                     IDHERVASYAFCFDIDGVILRGPDTIPQAVEAMKLLNGENKYHIKVPSIFVTNGGGKP
                     EQQRADDLSKRLNCTITKEQIIQGHTPMKDLVDVYKNVLVVGGVGNVCRNVAESYGFK
                     NVFTPLDIMKWNPAVSPYHDLTEEERVCTRDVDFSKIPIDAIMVFADSRNWAADQQII
                     LELLLSVNGVMGTQSKTFDEGPQIYFAHSDFIWATNYNLSRYGMGALQVSIAALYREH
                     TGKELKVNRFGKPQKGTFKFANKVLSHWRKGVLDEHLKKLSVNDPNANDADILINEDG
                     EEIINQSKLENYNWSDSEDEEDQEDEEGNGCSTTNTALKNVSKIADVGKPDKITLELP
                     PASTVYFVGDTPESDIRFANSHDASWHSILVKTGVYQEGTEPKYKPKHLCNDVLEAVK
                     YAIEREHAKELAEWNETAQDANDDDKGSRLNFADLVMTPSEKKESDKNGKKPASAVST
                     SKSSIAEAEEVEVPDILAAQIEKLKDVSVSK"
     gene            complement(<556901..>557800)
                     /locus_tag="CD36_52180"
                     /db_xref="GeneID:8048207"
     mRNA            complement(<556901..>557800)
                     /locus_tag="CD36_52180"
                     /product="Der1-like family member, putative"
                     /transcript_id="XM_002420478.1"
                     /db_xref="GeneID:8048207"
     CDS             complement(556901..557800)
                     /locus_tag="CD36_52180"
                     /inference="similar to AA sequence:UniProt:Q12743"
                     /inference="similar to AA sequence:UniProt:Q5AGD2"
                     /note="Similar to S. cerevisiae DFM1;
                     contains a DER1 domain (Pfam: PF04511); putative component
                     of the ER proteolytic system involved with selectively
                     degrading misfolded lumenal secretory proteins;
                     ER-localized protease, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Der1-like family member, putative"
                     /protein_id="XP_002420523.1"
                     /db_xref="GeneID:8048207"
                     /db_xref="GOA:B9WHG0"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="UniProtKB/TrEMBL:B9WHG0"
                     /translation="MDVILPNLPPITKGWCIAILSTATLISANRLKLVNLLFFPDKAL
                     TTEPWRLLTSFCTFRPLSIELFLEVFYAASSCGQLESRFTTELSLFPTRIIDQFNQNH
                     RNARDQGQGQISQLELLRSFIDRNKSIDFLYYVGQICLSIIVVACLIHYRLQFTILNL
                     GQILSHLLIYVDSQKTPNEQINVVGLFSIKKSYYPWLVAIVTIILNTSGGLLDINNIF
                     NSPLVWTYIVATGLGHFWWMLRDVFVSSIHYDSNDRRRLLKQKLLSRHGIMKFDIIRE
                     GLIWLLLPPWYWVILTKIKQRRA"
     gene            <558554..>559249
                     /locus_tag="CD36_52190"
                     /db_xref="GeneID:8048208"
     mRNA            <558554..>559249
                     /locus_tag="CD36_52190"
                     /product="acyl-protein thioesterase, putative"
                     /transcript_id="XM_002420479.1"
                     /db_xref="GeneID:8048208"
     CDS             558554..559249
                     /locus_tag="CD36_52190"
                     /EC_number="3.1.2.-"
                     /inference="similar to AA sequence:UniProt:Q12354"
                     /inference="similar to AA sequence:UniProt:Q5AGD1"
                     /codon_start=1
                     /transl_table=12
                     /product="acyl-protein thioesterase, putative"
                     /protein_id="XP_002420524.1"
                     /db_xref="GeneID:8048208"
                     /db_xref="GOA:B9WHG1"
                     /db_xref="InterPro:IPR003140"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WHG1"
                     /translation="MSVSAIRIPANGSSAKAAVIFLHGLGDSGDGWSWLPQLVGQSKL
                     IHEPINYVFPNAPKIPVTINNGFAMPAWFDIYELGNPHARQDVAGFFKSCEVLKEFIL
                     EQHNQFNIPLEKIVIGGFSQGAAISLATLALLDIKIGGCVALSGFCPVKNEITDRYNK
                     NPGVNFDTPIFQGHGTVDPVINYDYGKQTSELYKQLGFKNLKFNTYTGVAHSASEEEL
                     ADVIKFIKNVVEK"
     gene            complement(<559357..>559881)
                     /locus_tag="CD36_52200"
                     /db_xref="GeneID:8048209"
     mRNA            complement(<559357..>559881)
                     /locus_tag="CD36_52200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420480.1"
                     /db_xref="GeneID:8048209"
     CDS             complement(559357..559881)
                     /locus_tag="CD36_52200"
                     /inference="similar to AA sequence:UniProt:Q5AGC9"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420525.1"
                     /db_xref="GeneID:8048209"
                     /db_xref="UniProtKB/TrEMBL:B9WHG2"
                     /translation="MFRSIIQSRRQLVQFRNLSKYARNPQIYIHEDTLVPQLYKFSLS
                     KSPSALHMGTSLSLNPTAADFKANNEFIKLLDFTLQDNIHDDFTYIMEASTNASSFMP
                     IYDMREIPRYARTPYIEDVFGYVQVDDKGSMIPNSYQKNEMYQICSGKTGLPVFSEFL
                     FETLQEKCEQSSSS"
     gene            <560395..>562470
                     /locus_tag="CD36_52210"
                     /db_xref="GeneID:8048210"
     mRNA            <560395..>562470
                     /locus_tag="CD36_52210"
                     /product="zinc cluster transcription factor, putative"
                     /transcript_id="XM_002420481.1"
                     /db_xref="GeneID:8048210"
     CDS             560395..562470
                     /locus_tag="CD36_52210"
                     /inference="similar to AA sequence:UniProt:Q4WG88"
                     /inference="similar to AA sequence:UniProt:Q5AGR5"
                     /note="possibly fungus-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc cluster transcription factor, putative"
                     /protein_id="XP_002420526.1"
                     /db_xref="GeneID:8048210"
                     /db_xref="GOA:B9WHG3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:B9WHG3"
                     /translation="MNSEISTSNDDVDPLLSSDQELQNPNPKRRKHNRVRTGCFTCRK
                     RKKKCDEHKPHCENCIRNKLKCQYPSQWNEALPLDFKLETFQYDELVPLHYKRKKISS
                     NLKLQKVPQDLFGVFLLNASSLDVSSSSPKNKEILIVEEMADSEQVKEREVIGTELAG
                     SIIHDKMENVTQLPIKTSLSTSSTSLPLLMHEENNISQVVRYEVDEHSNDALSWVFTG
                     PMTNLHLFGKYIPNIELSPQDAELYVHCARDFMQQVSLPHAHPSLSPPNVWVNLALES
                     SILIDVYLSCGATYLACLHQNSKVEQSQLQTNDNEQLAQKYHELSETKYNLAVKSLMS
                     AISTNSIDLDSDWLMTAGLSLCLRDRANGLNGSRCTKHVSFVYNLIKRRIDKKRQSQR
                     LGNTSPLSSITPVERLLIDSFLFNYTCSFLTCGKQDFASLPSPYSFFPDIENWFDVPI
                     FQNCEVKWMNNPVLGAARNSFQTLAKLIYLLRSHYEFDGDGADNCHHMNDEIFWGLIL
                     AINDQEIDQVEKDNVLKLKQLLEIFPLGSKTMATSHSGEELSYSVLRSNLAVSIITIN
                     ACKILAAKLINPKIPAYLPQIQSSVSIILEELSLYIPQDNYSSSICIASLFFCGVAII
                     NKSQQDLLCCKLSNLKNNLSQIVANNLISILRKCWDKETTERVIFGDKCYKCFDTIFD
                     RAILESVAF"
     gene            complement(<562529..>563395)
                     /locus_tag="CD36_52220"
                     /db_xref="GeneID:8048211"
     mRNA            complement(<562529..>563395)
                     /locus_tag="CD36_52220"
                     /product="bud site selection protein, putative"
                     /transcript_id="XM_002420482.1"
                     /db_xref="GeneID:8048211"
     CDS             complement(562529..563395)
                     /locus_tag="CD36_52220"
                     /EC_number="2.7.11.1"
                     /inference="similar to AA sequence:UniProt:P53323"
                     /inference="similar to AA sequence:UniProt:Q5AGC7"
                     /note="Similar to S. cerevisiae BUD32;
                     In S. cerevisiae: protein kinase proposed to be involved
                     in bud-site selection, telomere uncapping and elongation,
                     and transcription; component of the EKC/KEOPS protein
                     complex; bud site/morphogenesis serine/threonine-protein
                     kinase, BUD family member, putative;
                     serine/threonine-protein kinase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="bud site selection protein, putative"
                     /protein_id="XP_002420527.1"
                     /db_xref="GeneID:8048211"
                     /db_xref="GOA:B9WHG4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR022495"
                     /db_xref="UniProtKB/TrEMBL:B9WHG4"
                     /translation="MTDNLIAKVQEHVPNIPLKLISQGAEALVFETSVHPYYNYNSND
                     RSHEKPYLHNYTTFIIKYRPTKPYRHPKIDLQINKSRTIGEVKFMYKLSKLNIACPNI
                     ISTDFNNGIIWMECLGSKLPNDTISSFKNWLWYLESQEKENPNINLHDDGQVELVCQK
                     VGQLIGRLHLNDMIHGDLTSSNIILTEMDASNNLFNFEPALIDFGLSSFSGLAEDKAV
                     DLYVLERAILSTHSSYADKLNRWLLEGYQQIHDSAEFNKTKQQQGKLKLKDTLKRLED
                     VRLRGRKRSMLG"
     gene            <563677..>565989
                     /locus_tag="CD36_52230"
                     /db_xref="GeneID:8048212"
     mRNA            <563677..>565989
                     /locus_tag="CD36_52230"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420483.1"
                     /db_xref="GeneID:8048212"
     CDS             563677..565989
                     /locus_tag="CD36_52230"
                     /inference="similar to AA sequence:UniProt:Q5AGC6"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420528.1"
                     /db_xref="GeneID:8048212"
                     /db_xref="UniProtKB/TrEMBL:B9WHG5"
                     /translation="MSDNNSSSGSSTIPTLCYVIPPYLLNSNYGSNLQKQLLAKNQQM
                     GLLNVISTDSKNYYNHFKEQQQDQGEGNNNKRKRKFSKDPYLNEIIKMKLIYKLSIIG
                     VLGDNPMEFLNGNDNDEYIYDMLDTFKRRLISSDDNDDNNGDNNSRDESKNGNVANNA
                     DAQHILVESLRRNNKDNNNSNNDKLPKSVFNSRNNKIGEVEFNQLGGIPPQYKKYLSM
                     SLKDLILVTNCHINDRYKFPPSFIDFGNDDFFNYTLPITWIPLIPNRYLNYLEKSFNL
                     VIQDDQGFSNITMSIDSSPSSLSGIKNGASANLYQHDDSNEDFDIDIDNEISRKQRQS
                     RYYNLITDKPIISSVGIFYYEVEIEQVITESTNFNSIIQMNDSSINSNNSLMLSLGFI
                     KRFINFESTPTTSPNSLHNHHNDNNSAANNNTGSILSGRVDLENIKSDLFVNDSLEEE
                     ESIGDIEIKKYLTARPGELRGSVAINLEDSTFYNSINSISGEFGASLASASSSMHRAQ
                     ILNMNRRLSNRSEYDSTATTIAGGGGVAGKINIDIPLKTKLIKDCRDERVYKTDIIGM
                     GVNFIDKSIFITLNGVLARVVTETELNNNVDGDKTSSNNSNNSNDNSNSNKTSATNNG
                     RIDEDAMYPMIGFKINEISRNINNVTDQKANDKTKSTKVNIKTNFGSKSFFYDIDSYV
                     AHYKKLTRQLLNMKILEMINLDVKEYNAAQQEIDKSNVFEIIKNYMMSNGGVHNNNIF
                     ANLQRNLLELNEKDNKDHLFTLINLENDFM"
     gene            complement(<566265..>567506)
                     /locus_tag="CD36_52240"
                     /db_xref="GeneID:8048213"
     mRNA            complement(<566265..>567506)
                     /locus_tag="CD36_52240"
                     /product="uncharacterized GPI-anchored cell wall protein,
                     putative"
                     /transcript_id="XM_002420484.1"
                     /db_xref="GeneID:8048213"
     CDS             complement(566265..567506)
                     /locus_tag="CD36_52240"
                     /inference="similar to AA sequence:UniProt:P38248"
                     /inference="similar to AA sequence:UniProt:Q5AGC4"
                     /note="Similar to S. cerevisiae ECM33"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized GPI-anchored cell wall protein,
                     putative"
                     /protein_id="XP_002420529.1"
                     /db_xref="GeneID:8048213"
                     /db_xref="GOA:B9WHG6"
                     /db_xref="InterPro:IPR000494"
                     /db_xref="UniProtKB/TrEMBL:B9WHG6"
                     /translation="MQIKSFLLPIVAALLASVSAADSSDKCSFSKTSITEATGISQLN
                     ACSTLDGEVTISGNSIGNIDLSSVKVLKAKLSILNSPSIVSLNFNQLQNITGSLVINN
                     ATQLNSIDLTQLTNVETLQLVSLPSFATLNLNQGVQKAGTIVLSDTALHNLNGLASFN
                     TIESININNNKNISSIEFSDLQTVTDSLILSFNNDDAEVKLNSLKWAGNLTIQDVSSI
                     QASNLTSVNGSLLISYNTFDELEFPNLKNVGNSMQIFAHDELARVSLPKLSELDGELE
                     MFNNTQLEEIDFGNLTTIKGAVTISGPFDNLTMENLKLVSGDFEVNSTSDKFDCSDFD
                     KLHEKGKIEGHNYVCTHPANPSSSSKSGSSSQTGKSDSKSSDGSSKSDSTSSSKKGAG
                     NALVVPGMVLTTALGVLLALI"
     gene            <571664..>577143
                     /gene="INT1"
                     /locus_tag="CD36_52250"
                     /db_xref="GeneID:8048214"
     mRNA            join(<571664..571789,572206..>577143)
                     /gene="INT1"
                     /locus_tag="CD36_52250"
                     /product="integrin alpha chain-like protein, putative"
                     /transcript_id="XM_002420485.1"
                     /db_xref="GeneID:8048214"
     CDS             join(571664..571789,572206..577143)
                     /gene="INT1"
                     /locus_tag="CD36_52250"
                     /inference="similar to AA sequence:UniProt:P53705"
                     /inference="similar to AA sequence:UniProt:Q5AGQ9"
                     /note="spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="integrin alpha chain-like protein, putative"
                     /protein_id="XP_002420530.1"
                     /db_xref="GeneID:8048214"
                     /db_xref="GOA:B9WHG7"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR012966"
                     /db_xref="UniProtKB/TrEMBL:B9WHG7"
                     /translation="MQTSLSTTTIEDHLHHHYSPEESQKLISRESSINTDLFKHENES
                     VDLLLKEMNSTPSKLLPIDKHSQLQLHPQSSSASIFNSPTKPLNFPRTNSKPNLDPNS
                     SSDTYTSEHDQDKAKEEKKDSTVQTSFDRNFDLDNSIDIQQTIQHQQQQPSQPDHNLV
                     DEFSFQTPMTSTLDLTKQASTADKVNQNHAPTYINTSPNKSIMKKATPKASPKKVAFT
                     ATNPEVHHYPDDTAEEEDQSQQKQDSVEPPSIQHQWKDPSQLNYSDEDTNASVPPTPP
                     LHTTKPTFAQLLSKNKDANLETEALTDMKLRHENFSNLSLDEKVNLYLGPNTNNNIGG
                     NNKNVSDMDLHLQNLQDASKNKTNESIHNLSFSLKTPKNDIENPLNSLTNADISLRSS
                     GSSQSSLQSLRDDNRVLESVPGSPKKSNPGLSLNDGIKGFSDEIVESLLPRDLSREKF
                     ETAKENDVAEHNNDAKSTNAIKGQPLVSSDEHLDSFDRSYNHTEQSILNLLNSASQSQ
                     VSLNGLHKQTHGPEQEQTQQEEASSTDNIKVKQEPKNSMDSIKVTVKKEPAMSTEEKP
                     PKREFSSQRLKIENTKEFAELAEYYPKKENEANIQVEDTDGLLKKALDDDDESDATQN
                     STKMSIRFHIDSDWKLEDSNDGDREDNDDISRFEKSDILNDMSQTSDTTGDKYGNSSS
                     EITTKTLAPPRSDNNGNKTSKVPTNTDSSQQQPQLEVPHTKEDDSILANSSNIAPPEE
                     LTLPVVEANDYSSFNDVTKTIDAYSSFEESLSAEHDTDTKPIDFISIWHKQEKQKKHQ
                     IHKVPTKQIIASYQQFKNEQESRVTGDKVKIPNTLQSKKFKEVNVMSRRVVSPDMDDL
                     NISQFLPELSEDSGFNDLNFANYSSNTNRPRSFTPLSTKNVLSNIDNDPNVVEPPEPK
                     SYSEIRNARRLSANRTVSNQAPPLPPQRQPSSTRINSNKRMSRFRVPTFEIKRTSSAL
                     APRDMYNDIFDDFGTGSKPTIKAEGMKTLPSMDKDDVKRILSAKKGMTQDEYINAKLV
                     EQKPKKNSIVTGPEDRYEELQQTASIHNATIDSSIYGRPDSISNEMLPYLSDELKKQP
                     VALLSADRLFMEQEIHPLRSNSVLARPAANSSMLPEPDFELINSPTRNVSNNSDNAAV
                     SGNASTISMNHLDMNFDDEATIGPNTREQFATKAVNCADGGDNVPETPRTPTKTESIS
                     GKRAVLSSNSPRKSPIKIGSPVRVVKKNGSITGIEPIPKATQKSKKSFQGNEISNHKV
                     RDGGITPSYWSDHQQHNPSMVSVPSQYTDATSTLPEENKDTQHQPREKHHHHHHQHKH
                     KSDISGVVDDEIPDVGLQERGKLFFRVLGIKNINLPDIKNHKGRFTLTLDNGVHCVTT
                     PEYNLEDNNVAIGKEFELTVADSLEFILTLKASYEKPRGTLVEVTEKKVVKSRNRLSR
                     LFGSKDIITTTKFVPTEVKDTWANKFAPDGSFARCYIDLQQFEDQITGKALQFDLNCF
                     NEWETMSNGDQPMRRGKPYKIAQLEVKMLYVPRSDPREILPTSIRSAYESINELNNEQ
                     NNYFEGYLHQEGGDCPIYKKRFFKLMGTSLLAHSEISHKTRAKINLSKVVDLIYVDKE
                     NIDRSNHRNFSDVLLLDHAFKIKFANGELIDFCAPNKQEMKLWIQNLQEIIYRNRFRR
                     QPWVNLMLQQQLQQQNQQE"
     gene            <577689..>578594
                     /locus_tag="CD36_52260"
                     /db_xref="GeneID:8048044"
     mRNA            <577689..>578594
                     /locus_tag="CD36_52260"
                     /product="pre-mRNA polyadenylation factor, putative"
                     /transcript_id="XM_002420486.1"
                     /db_xref="GeneID:8048044"
     CDS             577689..578594
                     /locus_tag="CD36_52260"
                     /inference="similar to AA sequence:UniProt:P45976"
                     /inference="similar to AA sequence:UniProt:Q5AGC1"
                     /note="Similar to S. cerevisiae FIP1;
                     In S. cerevisiae: interacts directly with poly(A)
                     polymerase (Pap1p) to regulate its activity; subunit of
                     cleavage polyadenylation factor (CPF), putative"
                     /codon_start=1
                     /transl_table=12
                     /product="pre-mRNA polyadenylation factor, putative"
                     /protein_id="XP_002420531.1"
                     /db_xref="GeneID:8048044"
                     /db_xref="InterPro:IPR007854"
                     /db_xref="UniProtKB/TrEMBL:B9WHG8"
                     /translation="MANSDDDDAFLYSDEEQQVEEQQPKTKRVKFADEESKKEDKSKE
                     KEQQQKEEHTDGASDSESGSGSESSSESDSDDDIDIIIGDNQPTKSKSSGTTIIGNEA
                     LSEMTDPEASSSSSTAGAGAASGSNKRQSTSTVDLDSVPRYQEGEDGEGEGTLITQLD
                     IETLKLKPWRAPGVDVSDYFNYGFDEFTWLAYCHKQDKLRGEFNPQKVMENIMKGPGG
                     ANGVNSGDKTGQQQQQQQQPPQPPMGMMMPPPGFMANMPMPPMGSMPPMPNMPNMANM
                     PPPPPGFNGQFPAPYNIPHNMNQKQ"
     gene            complement(<579042..>580271)
                     /locus_tag="CD36_52270"
                     /db_xref="GeneID:8048215"
     mRNA            complement(<579042..>580271)
                     /locus_tag="CD36_52270"
                     /product="eukaryotic translation initiation factor eIF-5,
                     putative"
                     /transcript_id="XM_002420487.1"
                     /db_xref="GeneID:8048215"
     CDS             complement(579042..580271)
                     /locus_tag="CD36_52270"
                     /inference="similar to AA sequence:UniProt:P38431"
                     /note="Similar to S. cerevisiae TIF5;
                     In S. cerevisiae: N-terminal domain functions as a
                     GTPase-activating protein to mediate hydrolysis of
                     ribosome-bound GTP; C-terminal domain is the core of
                     ribosomal preinitiation complex formation"
                     /codon_start=1
                     /transl_table=12
                     /product="eukaryotic translation initiation factor eIF-5,
                     putative"
                     /protein_id="XP_002420532.1"
                     /db_xref="GeneID:8048215"
                     /db_xref="GOA:B9WHG9"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:B9WHG9"
                     /translation="MSFINICRDNTDPFYRYKMPPIQSKTEGRGNGIKTAIVNLAEVA
                     RALNRPPAYLVKFFGYELGAQTQILNDRYLVNGAHDSNELQDSLDGFINKFVLCGSCK
                     NPETEIVLKGKDSLERDCKACGKISLVDPKHKLYSFIVKNPPDNKKGKKSATATANVV
                     GGGKSISDIASGHNGQGDSGNNAANGESGENGEGYNDDEDDDLLAKKINAEVAQLKDV
                     EIKDDDWAVDMSQEAIAARARELEGLSLQNNKFDEFGEWLLKESNGSKDDLPSDVEIY
                     KRIVELDIADSPETLQVLGQVLFDDDIINQIEPHVGLLAKLINGDEEFEKALLGGLER
                     FFGLEKPNLIPQIPKILHGFYDRDLISEEVLIKWGSKVSKKYVPKDVSKKVRKAAKPF
                     VKWLQEAEEEEEESDDE"
     gene            complement(<581161..>584025)
                     /locus_tag="CD36_52280"
                     /db_xref="GeneID:8048216"
     mRNA            complement(<581161..>584025)
                     /locus_tag="CD36_52280"
                     /product="RNA-binding protein, putative"
                     /transcript_id="XM_002420488.1"
                     /db_xref="GeneID:8048216"
     CDS             complement(581161..584025)
                     /locus_tag="CD36_52280"
                     /inference="similar to AA sequence:UniProt:Q12221"
                     /inference="similar to AA sequence:UniProt:Q5AGB7"
                     /note="apparent fusion of orf19.4262 and orf19.4263;
                     Similar to S. cerevisiae PUF2;
                     In S. cerevisiae: member of the PUF protein family;
                     preferentially binds mRNAs encoding membrane-associated
                     proteins"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA-binding protein, putative"
                     /protein_id="XP_002420533.1"
                     /db_xref="GeneID:8048216"
                     /db_xref="GOA:B9WHH0"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B9WHH0"
                     /translation="MNTGSSQDSIPIENISLGLSTSPLNTISSGGSDSTIGHLNTPPT
                     TRVRSGSLFSIWNEPSLSHNSNNTSNGHEMATSTSRNRSYTTTGALPSITIDSFSESL
                     QKSSAPRVSTSPFISVPNNDMIVLDNFQTNLPRLRSQTISGTPISSQNTLPHPSESLN
                     APHHFPQVFETVSSNPSSASVLPFNQSPQLFDDVDFTRFLITTSFDNPNLGPTKYLLF
                     DNLPLIINASKLFGILSNSLNQRMGSIHGIRITTTTTSKLALVECTSIDTAMSLKASF
                     NHLELVPGNILYVAFAKVDDVQSIGQQRVRSQHPQQLVTSPAQPLPQLQQQHQPLPLP
                     QLSPNHNTNHTHNHNHNHNHQQPQLVQHSLPDKSESPDPTDILSIQQNLMNSIAKLSS
                     TVDSKKIESLINKCIAYSNDQYQSDFGPLPDPIPLRKFDSPTLRDLRKVLENNEAQLI
                     GQNVDGGEVMSSFELEEFCLAMLDELPELSYDYLGNTIVQKLFTLVESPLVKLMMVKE
                     VAPYLTQLGIHKNGTWAIQKIINLCHSDYQQMNLIGASLKPYAVKLFNDQFGNYVIQG
                     CIKFGSPFNDFVFEAMLDNFLEISVGRFGARCIRTVLESCHDSSSTSPVTNEQVLLVA
                     GLIIEFANELAVNSNGSLLITWYLDTFKDCDSKIELLMSKFLPNIKTLCVHKLANLTV
                     LKILNNRVDDKSRVTTMDAIFNNKETLEYILQESDNSNTTAGPLFIYKILSNPILADL
                     VNQHVPTIRKILMELNIVNFQNYKKLMDEVGISSTRIGRNGSTKRNGTFNGNRRGGSM
                     RGNKQDGYIAPPPPPPPPPQQQQYFVQGIPNPQGQHSPIKPQLQPQQQQQQQRSGSPP
                     FQNRYIPMPQVPSQYNNVTPQMYMKQMYAQQQAQIQQQFYLQQQQQQQQQQQQQQQQQ
                     QMSPQEFAVMQQLEQLSLSSAALGYNSNPGTPTLQRHSFT"
     gene            <586180..>587043
                     /locus_tag="CD36_52290"
                     /db_xref="GeneID:8048217"
     mRNA            <586180..>587043
                     /locus_tag="CD36_52290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420489.1"
                     /db_xref="GeneID:8048217"
     CDS             586180..587043
                     /locus_tag="CD36_52290"
                     /inference="similar to AA sequence:UniProt:Q5AGB5"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420534.1"
                     /db_xref="GeneID:8048217"
                     /db_xref="UniProtKB/TrEMBL:B9WHH1"
                     /translation="MSIKIDHIIKSSKELYPQIIEELSSQFKKKYDKNTKTFEQLNTW
                     KEDELTNTLLKRYQQTGTTWITKDELVNLLDWKLAKGKFRPMLPKLIKSNDSLVVEET
                     TKQGYQFLLDYFKLHSNSKKQSQSLDKFWGEAKDEDKIEYSETIKKSFEKFSLLKGVG
                     PAMASLLGSLVIKINPYLTPPFFSEESFLFYYLESFGSGEKVKYNMKEYIEELLPVYF
                     EIITQHPEVTMDTLERGGWALKAYQIQNDDKLANIETEYTDEDTDRLKLEHKPDLKLI
                     ASAPRRKKQKK"
     gene            <588205..>589665
                     /gene="UAP1"
                     /locus_tag="CD36_52300"
                     /db_xref="GeneID:8048218"
     mRNA            <588205..>589665
                     /gene="UAP1"
                     /locus_tag="CD36_52300"
                     /product="UDP-N-acetylglucosamine pyrophosphorylase,
                     putative"
                     /transcript_id="XM_002420490.1"
                     /db_xref="GeneID:8048218"
     CDS             588205..589665
                     /gene="UAP1"
                     /locus_tag="CD36_52300"
                     /EC_number="2.7.7.23"
                     /inference="similar to AA sequence:UniProt:O74933"
                     /inference="similar to AA sequence:UniProt:P43123"
                     /note="In S. cerevisiae: catalyzes the formation of
                     UDP-N-acetylglucosamine (UDP-GlcNAc), which is important
                     in cell wall biosynthesis, protein N-glycosylation, and
                     GPI anchor biosynthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="UDP-N-acetylglucosamine pyrophosphorylase,
                     putative"
                     /protein_id="XP_002420535.1"
                     /db_xref="GeneID:8048218"
                     /db_xref="GOA:B9WHH2"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:B9WHH2"
                     /translation="MTVKSQQPIIDSFKQAHQDQLFQYYDSLTIDQQQQFIDQLSTIE
                     EPAKLISTVEQAIQFSQNNSASRNFTQLPNEQTASTLDLSQDILQNWNDLGLKAIANG
                     EVAVLLMAGGQGTRLGSSAPKGCFNIDLPSQKSLFQIQAEKILKIEQLAQQHLKLETK
                     PVINWYIMTSGPTRNATESFFIENKYFGLDSKQVIFFNQGTLPCFNLQGNKILLESKN
                     SICQSPDGNGGLYKALKDNGILDDLNSKGIKHIHMYCVDNCLVKVADPIFIGFAIAKE
                     FDLATKVVRKRDANESVGLIVLDEDTQRPCVIEYSEISEELANKKDPQDSSKLFLRAA
                     NIVNHYYSVEFLNKMIPKWISSQEYLPFHIAKKKIPSLNLETGEFYKPTEPNGIKLEQ
                     FIFDVFPSVELNKFGCLEVERLDEFSPLKNADGAKNDTPTTCRNHYLERGSRWVTQNG
                     GVIDNEGLVEVDSKTSYGGEGLEFVNGKHFKNGDII"
     gene            complement(<589775..>590895)
                     /locus_tag="CD36_52310"
                     /db_xref="GeneID:8048062"
     mRNA            complement(join(<589775..590261,590324..590543,
                     590643..>590895))
                     /locus_tag="CD36_52310"
                     /product="meiotic septin, putative"
                     /transcript_id="XM_002420491.1"
                     /db_xref="GeneID:8048062"
     CDS             complement(join(589775..590261,590324..590543,
                     590643..590895))
                     /locus_tag="CD36_52310"
                     /inference="similar to AA sequence:UniProt:Q04921"
                     /inference="similar to AA sequence:UniProt:Q5AGB3"
                     /note="Similar to S. cerevisiae SPR28;
                     spliced gene; sporulation-regulated protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="meiotic septin, putative"
                     /protein_id="XP_002420536.1"
                     /db_xref="GeneID:8048062"
                     /db_xref="GOA:B9WHH3"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WHH3"
                     /translation="MIYTAEQIRHKKKLKKGINFNLLVVGVNDLGKKTFINTLINQPY
                     YQINQPIPNTSQSSIAGTSSSKSFQDSSNNNELSIETNSFECCPGSIPVKLKISVTHN
                     FGFNVHDDSHGHTLLSFIENKHRAILHEELKISRNPNLQDNRLHLGLYFISANVKGLS
                     KFDISMMTTICHRINLLPIIAQRDGLTDTELSQCKHAITRDIQENNIQIFNFLSKSND
                     DDHKRDGDFEEYMTLSAKEYDYLSELNKLIPFAVIGSNSIGELQNEIVRNTKWGAIRI
                     EDKNICDFKLLKNVIFETHLQEFKDVTVEKIYEKFRLQQLIRN"
     gene            complement(<591132..>593504)
                     /locus_tag="CD36_52320"
                     /db_xref="GeneID:8048219"
     mRNA            complement(<591132..>593504)
                     /locus_tag="CD36_52320"
                     /product="U3 small nucleolar RNA-associated protein,
                     putative"
                     /transcript_id="XM_002420492.1"
                     /db_xref="GeneID:8048219"
     CDS             complement(591132..593504)
                     /locus_tag="CD36_52320"
                     /inference="similar to AA sequence:UniProt:Q05946"
                     /inference="similar to AA sequence:UniProt:Q5AGB1"
                     /inference="similar to AA sequence:UniProt:Q9USN3"
                     /note="Similar to S. cerevisiae UTP13;
                     In S. cerevisiae: component of the small subunit (SSU)
                     processome containing the U3 snoRNA that is involved in
                     processing of pre-18S rRNA; U3 snoRNA-associated protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="U3 small nucleolar RNA-associated protein,
                     putative"
                     /protein_id="XP_002420537.1"
                     /db_xref="GeneID:8048219"
                     /db_xref="GOA:B9WHH4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013934"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:B9WHH4"
                     /translation="MDTLKTTYAHTDIEPIYVGGTSASISTSNGELLATPLNEDVIVT
                     NLTTNEIIYKIPGDGEVVTNLAITPDGSYLAMISQSQLLRIFDLNKGSVVKNFKLPSP
                     VYISSVDTTSSLFAFGGSDGVITVWDIENGYVTHLLKGHGTTICSLTFHGELNSQDWR
                     LASGDTMGTVKIWDLVKRRCIHTLKDHNTAVRGVGFDRDGDLFISGGRDNVVIIYNTK
                     NFKTLNTFPINEQIEAAGFVSLIDERQYFYTAGSENVLKVWDIKLGEMIGRSPIPLKT
                     NEELLIIDVIKLYNNNLYLVISDQTLIELDLQELTPDHEVVEFPIVKRIAGNQGIIAD
                     IKYVGPEFNLLAMATNSPALRIVDTEKPLELRVYEGHTDILNAVDVSTDGKWIATASK
                     DNEARLWRWNDELQDFEPFARFQGHAGAVTAISLSKSQNEPRFLITGSSDLTIKKWKI
                     PNAPNSIVKTSEYTRRAHDKDINSIDVSPNDEYFATASYDKLGKVWQTDSGETIGVLK
                     GHKRGLWDINFYKFDKLIVTGSGDKTIKVWSLLDFSCKKTLEGHTNSVQRVKFFNREH
                     PQLLSCGADGLIKLWDYKQGEIIKSLDNHDQRIWAMDLKNDGEFFTTADADGKLSSWT
                     DNTEEEVKLKELQAKEKIEQEQSLSNFIKNKDWSNAFLLALTLDHSMRLYNVIKSSIE
                     TNDDKDSIIGSFALENTISLLDDVQLVKLFKKIRDWNVNFKFFEISQKLLNVILNNFA
                     VDKLTEVPGLMKIMESIIPYNERHYNRIDEMVEQTYVLDYTVEQMNKLIA"
     mobile_element  complement(593649..594128)
                     /mobile_element_type="retrotransposon:solo LTR, epsilon A"
     mobile_element  594131..594425
                     /mobile_element_type="retrotransposon:solo LTR, nu G"
     gene            complement(<594458..>596137)
                     /locus_tag="CD36_52330"
                     /db_xref="GeneID:8048220"
     mRNA            complement(<594458..>596137)
                     /locus_tag="CD36_52330"
                     /product="ABC1 family protein, putative"
                     /transcript_id="XM_002420493.1"
                     /db_xref="GeneID:8048220"
     CDS             complement(594458..596137)
                     /locus_tag="CD36_52330"
                     /inference="similar to AA sequence:UniProt:O42653"
                     /inference="similar to AA sequence:UniProt:Q06567"
                     /inference="similar to AA sequence:UniProt:Q5AGB0"
                     /note="mitochondrial chaperonin, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ABC1 family protein, putative"
                     /protein_id="XP_002420538.1"
                     /db_xref="GeneID:8048220"
                     /db_xref="GOA:B9WHH5"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:B9WHH5"
                     /translation="MFRQSLIYINRPKKSVNPVYLRHYVKTQIPITTFEFSKPKPQNK
                     FRPLVYRVAIVATGLGTAYYIDNHYYSALMTRSVRAVYVLLWIAYAYGFNSNSYKNID
                     DLHEIASDKLLHLLTTNKGLYIKLGQAIANQGNLFPLAYQKKFPQLYDQAPVQSWQDV
                     DRTLKENLGDDYQTRLFETIDHEPIASASIAQVHYGKLKNGEEVAIKVQHGYIENQIV
                     VDLMIYRFISKVYEKVFDIPLSMFTKYISEQLIKETDFVHEMQNSEKLKKLIDNDSSL
                     KHDNIKLPKNYPHLTTKQVLTAEWINGIPLTNKQTLLDHNYDLTLIMKQYIKLFGRQI
                     FEYGFIHSDPHPGNLLVCFDSNNKQQLVLIDHGLYITLSDLFRLQYCNLWRYLFSLNT
                     KGIEKIGREWGISSIDLFATVVQLRPVLLSPEVQSNENGEDHRNISDLFRDFIGDEKK
                     FPGELPFLSRTMRMIQNLNQSFGSPVNRINLLTKESINALLSEKDLKFGNYWDLLRIK
                     ITLLFSGFMFYIVRLRQILSGDRFGGKGKGLEDYIEMYMQNTAKSLGMEWI"
     gene            <596775..>599000
                     /locus_tag="CD36_52340"
                     /db_xref="GeneID:8048221"
     mRNA            <596775..>599000
                     /locus_tag="CD36_52340"
                     /product="alpha-1,3-mannosyltransferase, putative"
                     /transcript_id="XM_002420494.1"
                     /db_xref="GeneID:8048221"
     CDS             596775..599000
                     /locus_tag="CD36_52340"
                     /EC_number="2.4.1.-"
                     /inference="similar to AA sequence:UniProt:P53059"
                     /inference="similar to AA sequence:UniProt:Q5AGN6"
                     /note="Similar to S. cerevisiae MNT2;
                     In S. cerevisiae: involved in adding the 4th and 5th
                     mannose residues of O-linked glycans"
                     /codon_start=1
                     /transl_table=12
                     /product="alpha-1,3-mannosyltransferase, putative"
                     /protein_id="XP_002420539.1"
                     /db_xref="GeneID:8048221"
                     /db_xref="GOA:B9WHH6"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:B9WHH6"
                     /translation="MFRPVLGTKKIRRVICIISLLCILLLIGAVKYNYINSVKDEASN
                     STTGFEAEQYTFPKTVLFESNNNLDDLLAKKNNWKFQSNVYNQLFTDHSIESVLSLSF
                     NQRCELLVRNVISQKVSWAFDPLETFEINYESKDYIQFIQEEGLKLTEEFERTKNNLK
                     YKTSLNNFLKDEYKTIRSKQYEQKIIDQLTIVRIFNKCFIHNDQRDRNNLLERLIQEQ
                     QKQVANANSANVQSELKLTENEKMVEALAEDYTTLGKRVYPWISQQFPLYERWNGDSY
                     YHPPNYEEILKDETHKGETPTTRYSTSQIFLNQFKDTSNGKGIVLSITEKHIDDTVNL
                     IRLLRALNNKLPIQIIYFDDLSQSSKTKLLRAARGEINKFPKSYEKVYNGKQPSFPPQ
                     EVWFVNIYESVNPRYRNLFKKFDFKLLASLFNSFDEFMLIDADTILVKRPEFFFKQQA
                     YQQAGAFFFKDRTPLLKRPITDGQFLDKMGPSAIDSMMFDIPMMSQYTTHRELFKGLR
                     LYMESGLVMIDKRRHFSSILMMIQLKFIHPISGSMWGDKELFWLGFAINGDENYKFNN
                     RFAAAIGQLTSSQYRKGKDGKTLNAKEICSSHPGHISDDDDRSLLWFNSGFRFCHEAN
                     NLNYEKESKNSEILKSLNGPLEFEKYYSDPLRITHAIVPPLNKNLQKMYNYDEEPADG
                     WTSEPNCNKYMWCAYSSIGGRTSPEENSHKETLDGLLIDYTPEEIAYFNYLGDVWVGN
                     Y"
     gene            <599443..>599727
                     /locus_tag="CD36_52350"
                     /db_xref="GeneID:8048359"
     mRNA            <599443..>599727
                     /locus_tag="CD36_52350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420495.1"
                     /db_xref="GeneID:8048359"
     CDS             599443..599727
                     /locus_tag="CD36_52350"
                     /inference="similar to AA sequence:UniProt:Q5AGA8"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420540.1"
                     /db_xref="GeneID:8048359"
                     /db_xref="UniProtKB/TrEMBL:B9WHH7"
                     /translation="MFSVSRQLFRSSIRSYSTTAAANGAPVKVTKKVGAFRGGFIGFL
                     LGVTTTGALSYYYLLDQYKLANTVVVADIVALQNSISNLEKHIKSLEERK"
     gene            complement(<599932..>602508)
                     /locus_tag="CD36_52360"
                     /db_xref="GeneID:8048360"
     mRNA            complement(<599932..>602508)
                     /locus_tag="CD36_52360"
                     /product="sigma-like sequence protein, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_002420496.1"
                     /db_xref="GeneID:8048360"
     CDS             complement(599932..602508)
                     /locus_tag="CD36_52360"
                     /inference="similar to AA sequence:UniProt:P42900"
                     /inference="similar to AA sequence:UniProt:Q5AGA6"
                     /note="Similar to S. cerevisiae SLS1;
                     In S. cerevisiae: mitochondrial membrane protein required
                     for assembly of respiratory-chain enzyme complexes III and
                     IV; coordinates expression of mitochondrially-encoded
                     genes; may facilitate delivery of mRNA to membrane-bound
                     translation machinery"
                     /codon_start=1
                     /transl_table=12
                     /product="sigma-like sequence protein, mitochondrial
                     precursor, putative"
                     /protein_id="XP_002420541.1"
                     /db_xref="GeneID:8048360"
                     /db_xref="UniProtKB/TrEMBL:B9WHH8"
                     /translation="MALSSKKCFYKYLNPYGSLLRNFTVSSLRSQKIQSLDDFVLPEL
                     KSEEKTLYDTSKRIFLKANQIYNDQKKNKYKNKAQRGNKGSGRSPRDLDKLPVIDRSF
                     FMDFKPTESEEGNDINNSIETYKPLDSVIGAKKFGKLVKTMNNAFTKEQLREYYDHQQ
                     SINPGMRWKGSSSLVKLKLIERIILDVWNISKSKKLIVNDMLEDRQLLLKPWQRYLLG
                     FNQSLLFKNMLRLKVKGKFSKNKLQLTGSESDLNFIEPELHKLLSDYTMESVDLSLFL
                     EKNIVINFDLIQEMAKVYFHRTKKTSNVYEIYAKKTEGISLAKRLLIWSLNSNPHIKD
                     EVFGKSTLLESTFVPFSNEELFPWYKRPFNYFAPLKKDHKSSNDLVFDKFDKMSNYFI
                     ESEELEELTDARFSLGEERFQDNTEIDLDELLNTATDESSKVDFPDMTKILDNQEKAK
                     QQKQSHQDLEDLRKELGTFSNEDVDVSEFPNIAKLVEDFENADSSKQPDNLENLRKEL
                     NQFAETEESKDINFDVIDKLIESETDQGVLSSESLDTDISEHLTKQQIDDLYENVSDL
                     TFTSDLNGVNEENIVSSAYTLQFGTLVMKNKKSPSDGLIPKPVSPITENQEFQFVNSA
                     PFMNDLISSYPVISQPGRQELSEQPYANSMAIRLVPSMYQMKKKNKYEVTDKYVNYPP
                     VEIQANLDRGRILHYTLQVLSLEAVKNVAVPLPKLPCDIQVSRLLLGSLLPMNEESSS
                     SSSSSSSSSSPEVRLASQPDLINFLEESKLNFSGTEKISVKPSLELIINGEPVKYDYL
                     HVSYKTDMNFKVNERELLVSFIEGGEFGGRSCEIAIGNGELSRDDFEKLLKDSIQLIN
                     QI"
     gene            <603869..>605311
                     /locus_tag="CD36_52370"
                     /db_xref="GeneID:8048361"
     mRNA            <603869..>605311
                     /locus_tag="CD36_52370"
                     /product="proline oxidase, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_002420497.1"
                     /db_xref="GeneID:8048361"
     CDS             603869..605311
                     /locus_tag="CD36_52370"
                     /EC_number="1.5.5.2"
                     /inference="similar to AA sequence:UniProt:P09368"
                     /inference="similar to AA sequence:UniProt:Q5AGA5"
                     /note="Similar to S. cerevisiae PUT1;
                     In S. cerevisiae: nuclear-encoded mitochondrial protein
                     involved in utilization of proline as sole nitrogen
                     source"
                     /codon_start=1
                     /transl_table=12
                     /product="proline oxidase, mitochondrial precursor,
                     putative"
                     /protein_id="XP_002420542.1"
                     /db_xref="GeneID:8048361"
                     /db_xref="GOA:B9WHH9"
                     /db_xref="InterPro:IPR002872"
                     /db_xref="InterPro:IPR015659"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:B9WHH9"
                     /translation="MSIRLYSKQSLNIFRRSARIPTATQLYRAQLRYFHDTPNKQNVT
                     VNNMMPGVTKPTNTFTTPQLASTEYLKAFNNRELISFFMIGIVTLNKPILQLCIKLFP
                     YVPMSIIKALVYRIYCGGETIDQVKQTGLRLHERGIDNMMISLTIEACDGNDNVDPKY
                     IVEETAKSIENILVPHTVKMIDQAADINDIPPGYVALKPTGFAKDAANVLKNYNTTMS
                     KEFDELVDKATTVCQTVYDSNLKLAKQYPDRVSPFVVGVIDAEKHDLQEGVYELQRRL
                     YKKFNKLNQPVSIVGTLQMYLSESASLLTKEEKLANENKYRLGLKLVRGAYIHSEKNR
                     DVVIHKTKQDTDNNYNSGISYCIDSIMNQSGNESTIGHLVVASHNAESMRLASGKVYN
                     PVNESNKNKTNVVLGQLLGMADNVTYDLITNNKIGNVIKYVPWGPPLETKEYLLRRLE
                     ENGDAVKNDNGWPLVKASFKMLTKRVFGSA"
     gene            complement(<605496..>608693)
                     /locus_tag="CD36_52380"
                     /db_xref="GeneID:8048362"
     mRNA            complement(<605496..>608693)
                     /locus_tag="CD36_52380"
                     /product="DNA repair protein Rad9 homologue, putative"
                     /transcript_id="XM_002420498.1"
                     /db_xref="GeneID:8048362"
     CDS             complement(605496..608693)
                     /locus_tag="CD36_52380"
                     /inference="similar to AA sequence:UniProt:P14737"
                     /inference="similar to AA sequence:UniProt:P87074"
                     /inference="similar to AA sequence:UniProt:Q5AGA4"
                     /note="Similar to S. cerevisiae RAD9;
                     In S. cerevisiae: DNA damage-dependent checkpoint protein,
                     required for cell-cycle arrest in G1/S, intra-S, and G2/M;
                     In C. albicans: involved in regulation of
                     DNA-damage-induced filamentous growth; putative component
                     of DNA damage checkpoint"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA repair protein Rad9 homologue, putative"
                     /protein_id="XP_002420543.1"
                     /db_xref="GeneID:8048362"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR013914"
                     /db_xref="UniProtKB/TrEMBL:B9WHI0"
                     /translation="MDTQVDQHVLPQSAQSENSQFQQQGHSAINVNSEPTQKDSSLFK
                     DYEDHNSSLIFGGNITNDDNVDDNDTEIIPTVEDQIIVDRTVEDVTEADDKYQNDDTI
                     SPFSKKLKEMIDEQKQSSHDQGQTNGTHSEYLKSYSRESFRDNGNDDTQIIIQRHYNS
                     NDNYDIESSNGTSQQKQTNSKIIVENKMNTQDNQLGDTQVIGRALPDTQIINNVLPDT
                     QVINKVLPDTQVIKKVLSDTQIINKALADTQVIPKLLPNTQVINRVLSDTQVIQKNIP
                     ESQVIQLPDTQTQSVSYYDSQKVLHSSPADHSQAISPSHNKKTCKSQTQVLNTQDLSD
                     ISTSEDTTQEHASKSVIEIQTDSDEDESEDKKIQSKYYDDSLTAHQFKRKLSLSPQKI
                     KRRNTELIPSRTNKNSLLTTINGISSSSSSSNKDFLKTPGLRQYSIPLVLASPTNPLS
                     SSSPLKKQLNLDEEDKSIQTDKIEEDSTSMDIAPLPSSPNKGVKISFEEEHEPSDLEE
                     FDIDIDQIKAKNKAIIEIDDDDEEEVDDDDDDDDDDSSSSSKKQSDEAIPIIAPRSRA
                     NKKIIDSQSMNTNEDVDSITEDSTEPDILRQEESTTLTEDDIINHDSVWAIYNLKMYT
                     GRIVAKYIEDSNIEFDEGTYNVKNVDLNVLDIRIGDTVNVKGNRHKYTVTGLSTLAGD
                     EKSKLSNIKCMRGYNVVYLRRSQQKPNLNVPAKEFSVILSDCFMELSDWIMHQQKYKL
                     IIGNYNIFTDEAILPSTPKKSQKYKLPSTPLKSLKHTNSEIIKPNSADSKIFQEMIFC
                     ITSIDGDRKMELKSIIETNGGILWDKEIHELFSYHEQQEKEGSQISLNLTCDLEVAQT
                     FNFIALISNNFCRSAKYLQALALGWPIISDVYIDDCLKDTTNKQKWTNYLLPSGLSKK
                     LTTIKSIDIFRFKENYEAGKMLVDQFNNNHHVFNGLDILILQNKSINHNSMETCKFIF
                     YAFGAKSLQYFTKTDQIIKCIKEDFTGIEDNITIYDESNDMVQALTNNRNITGKNNRD
                     KPKSNYSIKLIDWEWVVQCVINGAILESPKYTVSV"
     gene            complement(<609119..>611065)
                     /locus_tag="CD36_52390"
                     /db_xref="GeneID:8048363"
     mRNA            complement(<609119..>611065)
                     /locus_tag="CD36_52390"
                     /product="negative regulator of transcription elongation,
                     putative"
                     /transcript_id="XM_002420499.1"
                     /db_xref="GeneID:8048363"
     CDS             complement(609119..611065)
                     /locus_tag="CD36_52390"
                     /inference="similar to AA sequence:UniProt:P36106"
                     /inference="similar to AA sequence:UniProt:Q5AGA2"
                     /note="Similar to S. cerevisiae BYE1"
                     /codon_start=1
                     /transl_table=12
                     /product="negative regulator of transcription elongation,
                     putative"
                     /protein_id="XP_002420544.1"
                     /db_xref="GeneID:8048363"
                     /db_xref="GOA:B9WHI1"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:B9WHI1"
                     /translation="MEEPTKRVTRVNRGQNMKRHIEELLSNDVKYFSSQSVDSTNKKQ
                     KVKKNATKDVTVTQSNTEDHADESDDEVRCRPCGATKDNYDEDEDTLGDMVQCDQCKT
                     WQHAKCMGYKTKRSIPNIHKCDVCTGKPIPQSKTNPKKTTTKTEEEEEDTIEITDVNE
                     KKSVAILKDEVRISTFKAFYNFFKKVIPKDGENTSEEAIESRVNDMALEIESIIHEEF
                     PGKAYPTEGRRILFVLKKHFMQEIFDGTITFKDVIHKTPQEINADIVRIEKQNKENIK
                     NIILTENDTTQIIRRTHKGEIVKENDFENSNQIDESIATRKVDHRHFSPEIVPESKFR
                     SHTKTQSKGYNNLNPRFEEDDDDEIVNQNNEEEEEEEEEEGSVATVTESSGTNPPQSE
                     NKSTPKSSESLSDVDTLNHNDADDSHLYSFLSGVENSVTNNTKVESKHVWSGRITFPE
                     FATFKAKGEFYTSTDYNDKPMDHLINTAKDILHLPSYTILGRLDRHVADKYLPKVIGS
                     RDFYFVQILNDDDNDDQFQKLYQYLLIKNKVGVLSGQPSFVKDSYLIPIDFRDENLPP
                     FLKNSRRDLRIGLFALFVVRKDYQPRPRSSVTNSSNHYHHVEERNRSLSATGDSTSSA
                     SAHSVEAKQETKEPRLDDILSQLN"
     gene            complement(<611743..>614145)
                     /locus_tag="CD36_52400"
                     /db_xref="GeneID:8048364"
     mRNA            complement(<611743..>614145)
                     /locus_tag="CD36_52400"
                     /product="alpha-1,3-mannosyltransferase, putative"
                     /transcript_id="XM_002420500.1"
                     /db_xref="GeneID:8048364"
     CDS             complement(611743..614145)
                     /locus_tag="CD36_52400"
                     /EC_number="2.4.1.-"
                     /inference="similar to AA sequence:UniProt:P53059"
                     /inference="similar to AA sequence:UniProt:Q5AGN6"
                     /note="Similar to S. cerevisiae MNT2;
                     In S. cerevisiae: integral membrane glycoprotein of the
                     Golgi complex, required for addition of alpha1,3-mannose
                     linkages to N-linked and O-linked oligosaccharides"
                     /codon_start=1
                     /transl_table=12
                     /product="alpha-1,3-mannosyltransferase, putative"
                     /protein_id="XP_002420545.1"
                     /db_xref="GeneID:8048364"
                     /db_xref="GOA:B9WHI2"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:B9WHI2"
                     /translation="MIRKLIRNRQRSKWVLFTGASIWIFFILYFINSNYYNTESHLSS
                     YSIYNIYDNLHEENESPSKSILSPLVDNSANDQQHISNFKNHTLYESLIKSTFQNTTK
                     RTKDLNSNIYDDIFTNHKLETVLGTLSFKERCDLYFKNVFAQDVNWHFNPDTKYDVNF
                     DKKTKEYQEFNKVKELIIQEKFDKMKQKLKEEDYSKELEKLQKSMFTDYMHQKFEQEI
                     VNRLSTFRIFNKCYITNDETPQINKINQFITNQQKLVQNLHRESETSDKTKIDKLELT
                     DKEALVDLMVTKSSTFEHRVYPWISKEYPVYERWTGKVYHEPPNYYEILNHDPMQKTT
                     KKTQHSNNAAEPFLKQFKNKFNGRGIVLTIGNQHSDYAANLIHLLRALDNKLPIQIVY
                     YDDVNEKSKRKIVTAAQEDFRSLPHSFEKVAHLFGDKYINSQGKGLQPQEVWFVNAYN
                     SIHKNYRGKFSRFGNKLLASLFNSFSEFILIDVDTVLMQPPEFFFQLKNYQTTGTYFF
                     KDRSVFQKRSLEDGKFFERMGPSTVDQIMFDIPIMTNYTTTRELFRGLQHYMESGLVM
                     INKDKHLNSILMITQINLIGPITGKVWGDKELFWLGFAINGDEEYYFDNNFAAAIGEL
                     TPPQDRARKDGTWHHSKEICTPHPGHISSDDNHSLLWINSGFRFCHQADEVDFEKEAE
                     KKTRLKHLQTADQFRTFYYNPLRITHAIVPPLDPDLQDRKNAMDEPTNGWFWESGYCR
                     RYMWCAYSSVGGPQKRPDEKDDKNDNNKIKDNTLEGILVEYNQDEIALFDYLGDIWVG
                     TE"
     mobile_element  complement(616320..616505)
                     /mobile_element_type="retrotransposon:solo LTR, phi F"
     gene            <616844..>617443
                     /locus_tag="CD36_52410"
                     /db_xref="GeneID:8048365"
     mRNA            <616844..>617443
                     /locus_tag="CD36_52410"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420501.1"
                     /db_xref="GeneID:8048365"
     CDS             616844..617443
                     /locus_tag="CD36_52410"
                     /inference="similar to AA sequence:UniProt:Q5AG99"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420546.1"
                     /db_xref="GeneID:8048365"
                     /db_xref="UniProtKB/TrEMBL:B9WHI3"
                     /translation="MSNNHLQPPNNSHEDSSQITTISDISCSKISTLADLEPFCIGTG
                     TTPRVHLQCRYYRFPNEDSFETWLDDRKQVVHWICRQKKPHKNSAFLEYREYECNFAG
                     RYTQTSANHINTTNDLQQQNGDGTNETTPAPIKKRKRKPTIKINCPAKIQMKITPKDP
                     DGIYVTWIYKHNHDVGTEEYFNSSREKKNAKRKSKKRKR"
     gene            complement(<617842..>620451)
                     /locus_tag="CD36_52420"
                     /db_xref="GeneID:8048366"
     mRNA            complement(<617842..>620451)
                     /locus_tag="CD36_52420"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420502.1"
                     /db_xref="GeneID:8048366"
     CDS             complement(617842..620451)
                     /locus_tag="CD36_52420"
                     /inference="similar to AA sequence:UniProt:Q5AG98"
                     /inference="similar to AA sequence:UniProt:Q5AGN3"
                     /note="appears to be a fusion of orf19.4281 and
                     orf19.4282"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420547.1"
                     /db_xref="GeneID:8048366"
                     /db_xref="InterPro:IPR018837"
                     /db_xref="UniProtKB/TrEMBL:B9WHI4"
                     /translation="MGYKNSDNTNNKFSRKSMSPSFTGGKGRKTVGKKVKKTIPRKTV
                     TWSSYNVNSDSNEDSDEDIENDSDDDDDDDEDEDEDDETEHHHLDGLYSLIGKKPQDS
                     SSNDDDEDEKNNKNIFSSTSSDGDSDEAMFSSSDDDSDVDFVKLQAQQKAHALKVARA
                     RKGLKSKPKNESNDNAIASSSDSESEPLSDSDNEDDVASMKKLKPRKTSFLKYGRRRS
                     DAVLPDINFKFEFDTGENEEVDADHQQTHIREPEEEDIGEEVDYSPEIPVDSTNVPSL
                     EFEFDHHLIDVPKINEEELNSDEDYEIDDNELLATLQAENDADEFLPPIIKENDQPHR
                     NDSLISSSIEEEEERNNGDDDDDDENDPFLKEEEKYLVNEFETNGFDENENEEEDEDD
                     LHTFDSDFSTTNRIVNSFKGIGEDRSKPIVKYESSASGGSDYDEDDYIDLINFDVPLF
                     DDKNGSIGNGTKSSHHKGDSDKSKKDKIKQRSNSNHNSDEDDDSYLWNYFFSSDNESS
                     SEEADEKNNNPKPVIKNRKNKQNKKALSTKAITGADELFEQIENDNTFKSKTKPIHHG
                     NSLYKAYSDSPMTIQELGAGLGVGSDDDDNYDSSESTDVDESLPKSSSNNSLVGSSKK
                     ATEVLSSKTADYRPPKLGSWVTVDCKPFGVIDGLSTRTLQLNKSQEPRSAVQSGASHS
                     TSIVNSPNGAGLPTTSSMASSLATNSRKSIVVGPTNASSMISSDDSALGLDELLNVSE
                     LDNDDENDVKIWRDFNNNQNKKKIPLGAFRNKSVLYNNHIYQDNDNNHHLNHRHSNVD
                     KKFNGSGHIKKQQPIRRQSQSKIERRRASIVEAVSQGYRPTKSGLFSETALADVEELF
                     GDDRDLMELIQGL"
     gene            complement(<622967..>623965)
                     /locus_tag="CD36_52430"
                     /db_xref="GeneID:8048367"
     mRNA            complement(<622967..>623965)
                     /locus_tag="CD36_52430"
                     /product="translation initiation factor eIF3 subunit,
                     putative"
                     /transcript_id="XM_002420503.1"
                     /db_xref="GeneID:8048367"
     CDS             complement(622967..623965)
                     /locus_tag="CD36_52430"
                     /inference="similar to AA sequence:UniProt:O43060"
                     /inference="similar to AA sequence:UniProt:Q4WTH0"
                     /inference="similar to AA sequence:UniProt:Q5AG96"
                     /note="no apparent S. cerevisiae orthologue"
                     /codon_start=1
                     /transl_table=12
                     /product="translation initiation factor eIF3 subunit,
                     putative"
                     /protein_id="XP_002420548.1"
                     /db_xref="GeneID:8048367"
                     /db_xref="GOA:B9WHI5"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="UniProtKB/TrEMBL:B9WHI5"
                     /translation="MSQTNSFMHLVRPNVIAPAAGSANGPASIKIHAPAMLTILEIIS
                     QQVLNKRIIGTLLGSRSDDGLEMEIKDGFMVPINETGDSIAIEDQVHKSLYQLYKKAH
                     PKETVLGWFGSSNQIDDITSLIHDFYSKGADRAFPFPAIYLNVEFLNEQNQIIEPKIT
                     TYIGAAVGKPVTNAQQIGWKTTNVNNSYIFTPIPNEVINATITERIAFKNLIDVKNNH
                     HQNDTTATTTNNNNNTDDLSYLSQQLNKANNNVAQLLSYIENNGNKDQDIDLLRLLSN
                     QLLNKPSILTNLPELEKLFKDHNQDVIMIEYLTKAVKDQIELNARLTASAEADKAR"
     gene            <624863..>626491
                     /locus_tag="CD36_52440"
                     /db_xref="GeneID:8048368"
     mRNA            <624863..>626491
                     /locus_tag="CD36_52440"
                     /product="cyclin subunit, putative"
                     /transcript_id="XM_002420504.1"
                     /db_xref="GeneID:8048368"
     CDS             624863..626491
                     /locus_tag="CD36_52440"
                     /inference="similar to AA sequence:UniProt:O74627"
                     /inference="similar to AA sequence:UniProt:Q05949"
                     /inference="similar to AA sequence:UniProt:Q5AG95"
                     /note="Similar to S. cerevisiae BUR2;
                     In S. cerevisiae: cyclin for the Sgv1p (Bur1p) protein
                     kinase; Sgv1p and Bur2p comprise a CDK-cyclin complex
                     involved in transcriptional regulation through its
                     phosphorylation of the carboxy-terminal domain of the
                     largest subunit of RNA polymerase II"
                     /codon_start=1
                     /transl_table=12
                     /product="cyclin subunit, putative"
                     /protein_id="XP_002420549.1"
                     /db_xref="GeneID:8048368"
                     /db_xref="GOA:B9WHI6"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="UniProtKB/TrEMBL:B9WHI6"
                     /translation="MTSTTTKINNSITRLFEDDKFLLPQLKSLNNTWIFSEDAVINNS
                     PTRHQKLTISQELKNKESMHDFLIRLGQKLKVDGRTILAATIYLHRFYMRVPISQSKY
                     YVVSAALTISCKLNDNYRTPDKVALLSCNVKLPPNAKPIDEQNEMYWRWKDQLLFREE
                     LILRKLNFDLNLILPYEIRDHIFKNFVLFDQEDESVKLFSTHKLDILKMTTSLIESLS
                     SLPIILCYDMNIIFGTCLIITIIEGRKIIDEKLNIPPAFLHRFLNIDSETCLKCFHFI
                     KKLLKFSQDDPHTISNKASAKRLLELRSKLFHEIAKQGDSKQSQPQSQQHENETTNKE
                     KKPEESKNEECKTSENIKNGHGTTTTNIDPKIHDSKVDEVEKNEINKQEVDKIQTQGE
                     CTQEENTIGIAIEKKIPDTENNETKSETTNSTREKDDKINHKTVISNESMAEKNSDVH
                     GNDSNGNNGDSGNTSNSLKQGEDTKNEVSKKTADSKEVPTSTNNTSSNNATADLHDST
                     NGTNEKSIGEKRNLEPDSNDANVDSPSSKIARVE"
     gene            <626897..>627847
                     /locus_tag="CD36_52460"
                     /db_xref="GeneID:8048369"
     mRNA            <626897..>627847
                     /locus_tag="CD36_52460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420505.1"
                     /db_xref="GeneID:8048369"
     CDS             626897..627847
                     /locus_tag="CD36_52460"
                     /inference="similar to AA sequence:UniProt:Q5AGM9"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420550.1"
                     /db_xref="GeneID:8048369"
                     /db_xref="UniProtKB/TrEMBL:B9WHI7"
                     /translation="MDPNIDIDIFRDLDASFIELFHRAQLQTHLEHLPPTEREEQLNN
                     LLSQRDLLNSHHHQQTQYYHIHWIFSYVPFIILNFDQIWRDFSWRAFWARTVDVVTSA
                     MIMAVRALRFTTFIIGSGVYFQGVVRRLFVFCDVITFSDNFIRDMFTYILRDSQDILD
                     QCILLERHSRNVFYFLQYDEYNDLSSLQVLQLAYRNLLASLINVECITYSPNSTGTTT
                     TTSSSSSTATTTSCKILTDTLVFKLSSVFQDFFPALGSTGLKLITLWIYISYALIGDI
                     VCLNILLFVSYNLINRFMGYKQMFQGLKDILWNSLFKFIL"
     gene            <628153..>629277
                     /locus_tag="CD36_52470"
                     /db_xref="GeneID:8048370"
     mRNA            <628153..>629277
                     /locus_tag="CD36_52470"
                     /product="D-xylulose reductase, putative"
                     /transcript_id="XM_002420506.1"
                     /db_xref="GeneID:8048370"
     CDS             628153..629277
                     /locus_tag="CD36_52470"
                     /EC_number="1.1.1.9"
                     /inference="similar to AA sequence:UniProt:Q07993"
                     /inference="similar to AA sequence:UniProt:Q5AG92"
                     /note="Similar to S. cerevisiae XYL2;
                     In S. cerevisiae: converts xylitol to D-xylulose in the
                     endogenous xylose utilization pathway; xylitol
                     dehydrogenase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="D-xylulose reductase, putative"
                     /protein_id="XP_002420551.1"
                     /db_xref="GeneID:8048370"
                     /db_xref="GOA:B9WHI8"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B9WHI8"
                     /translation="MSIPASMKAIVFYAPYDVRTEERPTPKIKDPKDVIVKVRYSGLC
                     GTDLHSYRGHIKGPVGTILGHEFVGTVVAIGDNITKFSIGDDVISNFSIECGECWYCK
                     HGYSGQCNVTNTFGKIGLDGGQAEYVRVPYAETTLTKKPPTSSSTSSNNDIDDSVYVL
                     MADIFTTGYYGVKKIKDFLSIPAAEGIKPQSFEETTILQLGAGPVGLCALRILKYFGF
                     GKVVVVDNVPSRLEEAKRLGATKVINFDTEPDGINKYISEETDNVGFDAVLEVVGSAA
                     AHKTSFDAVRRNGFISSIGMGHEPFPFNGLDVYLKNINMSFGRCHSWSLFPESLAIFE
                     KMKGDLASFIDYKAKLEDSKEAFDMFDKHKVKKIVFDLTS"
     gene            <629744..>632398
                     /locus_tag="CD36_52480"
                     /db_xref="GeneID:8048358"
     mRNA            <629744..>632398
                     /locus_tag="CD36_52480"
                     /product="zinc finger-containing transcription factor,
                     putative"
                     /transcript_id="XM_002420507.1"
                     /db_xref="GeneID:8048358"
     CDS             629744..632398
                     /locus_tag="CD36_52480"
                     /inference="similar to AA sequence:UniProt:P50104"
                     /inference="similar to AA sequence:UniProt:Q5AG91"
                     /note="Similar to S. cerevisiae STB4"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc finger-containing transcription factor,
                     putative"
                     /protein_id="XP_002420552.1"
                     /db_xref="GeneID:8048358"
                     /db_xref="GOA:B9WHI9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:B9WHI9"
                     /translation="MSNTPSNTSQASRDNISHSTTSPETSRDEKEMKAKNNIKTESAE
                     SSAAATLGSMGTARDHLHSQFPPSTPGPIPTHLTSSFGGTARHAQPQGTPQVTAPAST
                     SFGYCQPLQQLHPIQQYQHLNQAPSQPQASSPSPIPPVAHSPTATNTSHTPDQNGASR
                     QRMRVVKACDRCRSHKIKCSGECPCATCLKQAKECTFSNKVFQKRTKGTELPEQKRAK
                     FAEPFGLPEVKKDDQQEYINHLENRVHYLESLLTNSTTDTFKTPLSNEPESEFVTETL
                     FCTSSKWRFSRRHQNLLIAELCRSMYSNLSEESKQLVTLPRYQYFGWNMSGVKYVTSE
                     ELPPLPDLGAKLDSKFLTKYYFEEINPLFAILHETVFKEQIGAYEKLLRDQIMLHKDD
                     HDSKGNQTRLFSAMLYLVYALAIRFSEISKPKNPSIEMLQLEEKLFKYGYKVISILSF
                     EWESFELIQGWLLITLYLRVTHRQTSCSHALGQAMDMVKSMGLGFAHDNAKFYSSTAY
                     ERLKAKRIFWCVFTFDRVFGLQTGRYCGIRDEDFNNEFPGFDFKHETEKDDWLTLPAL
                     GLIHIARVSNFVHTASTDNPHLIKYQQVNAELVKLHEWFNANGFRNDLFFNKKNDSSS
                     LVKAQVKLHYYDLVLCIHSKILFNYIGRRIASHGLKVEMVIDACNGVIEVLDKTNKAG
                     LLYTPWYSVLLLLFNVGVNAITLINGGAFVEQAREVLKNTMRLLTILRKSPIRNEQNK
                     LVFRERFKMVRECIWALKMANRILTLRLQEDISVLNSIGVDHGSSDVNKQTFTQLGIA
                     SESTEGSSTQPKTNEFNQVFEKHLHRNSDIRQSITNDVDSPVSVNSDSTSNVQSIEPV
                     DTYSSAEIDNLLGNIQWFDQWTDFNIDF"
     gene            <633346..>634308
                     /locus_tag="CD36_52490"
                     /db_xref="GeneID:8048429"
     mRNA            <633346..>634308
                     /locus_tag="CD36_52490"
                     /product="thioredoxin reductase, putative"
                     /transcript_id="XM_002420508.1"
                     /db_xref="GeneID:8048429"
     CDS             633346..634308
                     /locus_tag="CD36_52490"
                     /EC_number="1.8.1.9"
                     /inference="similar to AA sequence:UniProt:P29509"
                     /inference="similar to AA sequence:UniProt:Q5AG89"
                     /note="Similar to S. cerevisiae TRR1;
                     In S. cerevisiae: cytoplasmic thioredoxin reductase, key
                     regulatory enzyme that determines the redox state of the
                     thioredoxin system, which acts as a disulfide reductase
                     system and protects cells against both oxidative and
                     reductive stress"
                     /codon_start=1
                     /transl_table=12
                     /product="thioredoxin reductase, putative"
                     /protein_id="XP_002420553.1"
                     /db_xref="GeneID:8048429"
                     /db_xref="GOA:B9WHJ0"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005982"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:B9WHJ0"
                     /translation="MVHHKVTIIGSGPAAHTAAIYLARAEIKPTLYEGMLANGIAAGG
                     QLTTTTDIENFPGFPNGIGGSELMEKMKEQSQRFGTEIITETISKVDFSKRPFKLWTE
                     WNEDAEPITTDAVIIATGASAKRMHLPGEETYWQQGISACAVCDGAVPIFRNNPLAVI
                     GGGDSACEEAIFLTKYASKVFLLVRRDVLRASTIMQKRVTNNDKIEVLWNTEALEAKG
                     DGKLLKSLRVVNNKTKEEKDLQVNGLFYAIGHIPATKIFADQLKTDEAGYIQTTPGTA
                     STSIEGVFAAGDVQDKIYRQAITSAGSGCMAALECEKFISEQEA"
     gene            <634634..>635473
                     /locus_tag="CD36_52500"
                     /db_xref="GeneID:8048430"
     mRNA            <634634..>635473
                     /locus_tag="CD36_52500"
                     /product="syntaxin, putative"
                     /transcript_id="XM_002420509.1"
                     /db_xref="GeneID:8048430"
     CDS             634634..635473
                     /locus_tag="CD36_52500"
                     /inference="similar to AA sequence:UniProt:P32854"
                     /inference="similar to AA sequence:UniProt:Q5AG87"
                     /note="Similar to S. cerevisiae PEP12;
                     In S. cerevisiae: target membrane receptor (t-SNARE) for
                     vesicular intermediates traveling between the Golgi
                     apparatus and the vacuole; controls entry of biosynthetic,
                     endocytic, and retrograde traffic into the prevacuolar
                     compartment; vacuolar protein sorting-associated protein,
                     putative; vacuolar protein-targeting protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="syntaxin, putative"
                     /protein_id="XP_002420554.1"
                     /db_xref="GeneID:8048430"
                     /db_xref="GOA:B9WHJ1"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:B9WHJ1"
                     /translation="MSFNTPFSEDLERTATNNSHRYKDYPEFDSLSTTIENQLHFINS
                     ELLSSIRSDLAKLEKDKTDTTLSESLSGQFRKTTDAFKKVNKFVKQLNASIVATEREH
                     EDVETVNYLKQKEAIQIKLIRDSLANFNNFQKRFESCQTTQLPEDGSNLSEAEPGTAQ
                     QQQQQQQQVQITYEPINAEELEQQTLLIQEREREIHQIQQDTQEINDIFSNLSSIVNE
                     QQFQIDSIENNIFSYNSNAREASNELRRAERYQKSSSGRLLCCFLILVGIVSFIILIG
                     LIF"
     gene            complement(<635525..>636667)
                     /locus_tag="CD36_52510"
                     /db_xref="GeneID:8048431"
     mRNA            complement(<635525..>636667)
                     /locus_tag="CD36_52510"
                     /product="cytosolic iron-sulfur protein assembly protein,
                     putative"
                     /transcript_id="XM_002420510.1"
                     /db_xref="GeneID:8048431"
     CDS             complement(635525..636667)
                     /locus_tag="CD36_52510"
                     /inference="similar to AA sequence:UniProt:Q05583"
                     /inference="similar to AA sequence:UniProt:Q5AG86"
                     /note="Similar to S. cerevisiae CIA1;
                     In S. cerevisiae: involved in assembly of cytosolic and
                     nuclear iron-sulfur proteins"
                     /codon_start=1
                     /transl_table=12
                     /product="cytosolic iron-sulfur protein assembly protein,
                     putative"
                     /protein_id="XP_002420555.1"
                     /db_xref="GeneID:8048431"
                     /db_xref="GOA:B9WHJ2"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR028608"
                     /translation="MVELLHSIKAHNDKAWSVSVHPTLPIIATASTDKSTKLYKLSTK
                     QKFPLVAELEDTHKRSIRSVAFKPPLGGVDAPKLDFLDLPALAAGSFDSTISVWGIDE
                     PDVEYDIDEVVANQKEILTSPNNEWNLMAIIEGHENEVKAVDWNFQGQYLASCSRDKT
                     VWIWETDPETLEEFECVAVLNDHSQDVKNVSWHPSMNILASSSYDDTIRIYQQDIAGD
                     EWSCVGILNGHEGTVWCSKFESFKSPTADSSILRLVSASDDLSVRIWVAKREEEEDKP
                     ELPSSIKHTKEMVWEVESVLPAVHKYPVYSVAWSSLTGKIASAGSDGKIVVYSEAEKG
                     KWVIDSVHEGSHGVHEINCVIWAQLDDENEILVSAGDDGYVNLWNV"
     gene            <636868..>638490
                     /locus_tag="CD36_52520"
                     /db_xref="GeneID:8048432"
     mRNA            <636868..>638490
                     /locus_tag="CD36_52520"
                     /product="cytochrome c assembly flavoprotein, putative"
                     /transcript_id="XM_002420511.1"
                     /db_xref="GeneID:8048432"
     CDS             636868..638490
                     /locus_tag="CD36_52520"
                     /EC_number="1.-.-.-"
                     /inference="similar to AA sequence:UniProt:P38909"
                     /inference="similar to AA sequence:UniProt:Q5AG85"
                     /note="Similar to S. cerevisiae CYC2;
                     In S. cerevisiae: mitochondrial peripheral inner membrane
                     protein, contains a FAD cofactor in a domain exposed in
                     the intermembrane space; exhibits redox activity in vitro;
                     likely participates in ligation of heme to acytochromes c
                     and c1; cytochrome c mitochondrial import factor,
                     mitochondrial precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cytochrome c assembly flavoprotein, putative"
                     /protein_id="XP_002420556.1"
                     /db_xref="GeneID:8048432"
                     /db_xref="GOA:B9WHJ3"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:B9WHJ3"
                     /translation="MLGLRQIRQYPIHRSRLINFRRFNSTNSKKPEQEEENSQSSEHK
                     NIPSKQDDKTDVGSFNIKPTTSRSAPAPMENTGIEQLMHKDNKPYIPKLKHKRVSFEY
                     PNLPNQDEYTNLIEKPKSITRWTRYVPKILTVIVLVWSGYAYHVWMTDTEEGEDSSDL
                     LNPEEFHKFIVTHKEKIDDDHYIIEITPKFFHWEYSHGTDPEGKSLWKGDKFWSVEIK
                     QPDINVVRSYTPLPLYYLKSEYTRSGEKEPLLKVINPEIDEYDRHGTMCLYVKRYNDG
                     EVSKYITDRNVGEELELRGPNIEYKFPYHPLHKLHKRPIFKDLPSKVEADNMIETVKR
                     VNNLPDVDNIVFYAAGTGIAPILQVLFSKKPYLGHVDIHYSARHPGELGILQRFLLFL
                     DKLDRINITYHYDDQPKTVLNAKDIKPPGIPNYITPKTLEEKSKFLTGDEIEQLRLQK
                     EQQGKSFDSDMTTKLVQKPEDRGEVFESGLHQASKTIQLPKKTASLAIVCGPEGFVDY
                     VAGSKDLVRNKQGPISGLLGDKNWDNSNVYKL"
     gene            complement(<638563..>641538)
                     /locus_tag="CD36_52530"
                     /db_xref="GeneID:8048433"
     mRNA            complement(<638563..>641538)
                     /locus_tag="CD36_52530"
                     /product="histone transcription regulator, putative"
                     /transcript_id="XM_002420512.1"
                     /db_xref="GeneID:8048433"
     CDS             complement(638563..641538)
                     /locus_tag="CD36_52530"
                     /inference="similar to AA sequence:UniProt:P32480"
                     /inference="similar to AA sequence:UniProt:Q5AGM0"
                     /note="Similar to S. cerevisiae HIR2;
                     In S. cerevisiae: non-essential transcriptional
                     corepressor involved in the cell cycle-regulated
                     transcription of histone H2A, H2B, H3, and H4 genes;
                     recruits Swi-Snf complexes to histone gene promoters;
                     promotes heterochromatic gene silencing with Asf1p"
                     /codon_start=1
                     /transl_table=12
                     /product="histone transcription regulator, putative"
                     /protein_id="XP_002420557.1"
                     /db_xref="GeneID:8048433"
                     /db_xref="GOA:B9WHJ4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011494"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019015"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:B9WHJ4"
                     /translation="MKFLKLPQSYHKGGIHSIDVNQDNTILVSGGVDKKIGVWDLKKL
                     IELSKLVSVNNSPEVRLKLKSLEPKQNITCHESLVNVVRFFKGDNKRFVSSDVDGNVF
                     FHVLHEQLETETKQLFPFKGSKTQVKTPVVDLSISADNRLVAWSTNDGKVYLYDVVKD
                     TFQELTSICHEKPIIQRSIAFDPSNNYLITVGDDTQINVFQYSYEKDDNNTYKFRLIY
                     KISKLFSQNPLNVRYKRISWSPDGNLVSIPTASKNQTMLISLISRSEKWTNIESLVGH
                     DFACDVVKFNPKIFSSREHDTSKVHSVIASGGSDRTMAIWNTSKSTPITVLQDAVQGE
                     ILDITWTTDGTSLLFCTSQGKLCIGNFEPNELGYAFSQETMERFVQLQNNLVEPMNFR
                     YPHEQTVGNRKQLPPIEFLNQKNAISTTSSSSITENDEKKSEENVSMSSQSKSTTAKG
                     GVITPEVIAPPKLQSLDDDVDDNDEEDDGKGSMLDSVMNDRAEASPRKSNKQKNIASA
                     VSEPTGQSLSFNKQKVTTKNGKRRIQPMLISSGNSASSVLPRSNSVVKPVANNIKSSM
                     EFDKPSYSVSEEFYKQNKRPRTEDTTGGGINKKLKREMEPVKFIGSVILNPNTSFSKI
                     RLATPKVRLFFQLKSKTDDGMFILDIKNGSGNESKPSRLTYLKKDKEIWCDFVPKYIQ
                     LATEGSNFWAVTTSDGTILTYSHVSGKRLLPSIVLGSPVSFLESYEKYMMAVTCIGEL
                     YVWDMEAKKNVLKCSISPLLELYNKEGLVKSDNITLCAVTSFGIPLITLSNGSGYLFN
                     KDLGVWQTITESWWCFGSHYWDSTETSTTKQPQTMNMFNDEQSIIELLEHKTNEEILR
                     KTRTGRGKYFNKISKNMLMKEGFESLENTISISHLENRILCCELLGENKDFHKFFTTY
                     VQRICELGFKAKLFEVCDELLGPIDAPSNESDWDPKICGFDKRELLKEVITSCSQFRD
                     AQRVLVHFGKKIGVVVDEL"
     gene            <641971..>642783
                     /locus_tag="CD36_52540"
                     /db_xref="GeneID:8048434"
     mRNA            <641971..>642783
                     /locus_tag="CD36_52540"
                     /product="beta' regulatory subunit of casein kinase 2,
                     putative"
                     /transcript_id="XM_002420513.1"
                     /db_xref="GeneID:8048434"
     CDS             641971..642783
                     /locus_tag="CD36_52540"
                     /inference="similar to AA sequence:UniProt:P38930"
                     /inference="similar to AA sequence:UniProt:Q5AG82"
                     /note="Similar to S. cerevisiae CKB2;
                     In S. cerevisiae: a Ser/Thr protein kinase with roles in
                     cell growth and proliferation; the holoenzyme also
                     contains CKA1, CKA2 and CKB1, the many substrates include
                     transcription factors and all RNA polymerases; casein
                     kinase II regulatory subunit, putative; casein kinase II
                     subunit beta', putative"
                     /codon_start=1
                     /transl_table=12
                     /product="beta' regulatory subunit of casein kinase 2,
                     putative"
                     /protein_id="XP_002420558.1"
                     /db_xref="GeneID:8048434"
                     /db_xref="GOA:B9WHJ5"
                     /db_xref="InterPro:IPR000704"
                     /db_xref="InterPro:IPR016149"
                     /db_xref="InterPro:IPR016150"
                     /db_xref="UniProtKB/TrEMBL:B9WHJ5"
                     /translation="MANEEYVTDSSSDFTEYWIDLFLGIKGNEYFCDIDDEYIRDRFN
                     LTGLNSEVSKLPTLIDIITDVIDIESQPEEHKDSLEHNARILYGLIHARYILTTRGLN
                     KMFEKFRSGDFGYCPRVHCQLNPLLPIGLNDQPRMASVKLYCSKCEDLYNPKSGRHSV
                     IDGAYFGTSFPAMFFQNFPNTVPIHAKDTYVPRVFGFKLHEYSKLNRWRELQRLKLEN
                     RLRKNGIQIDNVVGGFITNGDDEETQDNNNNSNNKQLQNVSSQYKSSSPNQK"
     gene            <643064..>644260
                     /locus_tag="CD36_52550"
                     /db_xref="GeneID:8048435"
     mRNA            <643064..>644260
                     /locus_tag="CD36_52550"
                     /product="mitochondrial tryptophanyl-tRNA synthetase,
                     putative"
                     /transcript_id="XM_002420514.1"
                     /db_xref="GeneID:8048435"
     CDS             643064..644260
                     /locus_tag="CD36_52550"
                     /EC_number="6.1.1.2"
                     /inference="similar to AA sequence:UniProt:P04803"
                     /inference="similar to AA sequence:UniProt:Q5AG80"
                     /note="Similar to S. cerevisiae MSW1"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial tryptophanyl-tRNA synthetase,
                     putative"
                     /protein_id="XP_002420559.1"
                     /db_xref="GeneID:8048435"
                     /db_xref="GOA:B9WHJ6"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:B9WHJ6"
                     /translation="MTKTVALVSTQPPSLQMSLKSIHTLRRCCRPLTTTTRGTNTVQE
                     VSQNKLVIPSNSTVFSMIQPTGRIHLGNYLGAVKSWRTLSESNTDPTNKFIYGIADLH
                     AITIPKDPIEFKEYRYAAIASLIASGLDTSKCTLFFQSSVPEHSELNWYLTCMTSMGA
                     LNRMTQWKSKAQQSDDSSILEDNVLEKTKAGLFCYPALQAADILLYKSTHVPVGDDQS
                     QHLELCRNIAKTFNSTYKTNVFPLPKTLLTPAKKILSLKNPKKKMSKSDPIATSCVYV
                     TDSPEDIQLKIRKATTDSVQGSIYYDPIERPGVSNLINIVSGISNKPVDEVVKDMSDF
                     VDHKQLKDYVTEVIISEFDDKRQLYEELMKDKAYLDTICSQGRDKAREMASVNLHQVK
                     QIIGMD"
     gene            <645214..>647589
                     /locus_tag="CD36_52560"
                     /db_xref="GeneID:8048436"
     mRNA            <645214..>647589
                     /locus_tag="CD36_52560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420515.1"
                     /db_xref="GeneID:8048436"
     CDS             645214..647589
                     /locus_tag="CD36_52560"
                     /inference="similar to AA sequence:UniProt:Q5AG78"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420560.1"
                     /db_xref="GeneID:8048436"
                     /db_xref="GOA:B9WHJ7"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:B9WHJ7"
                     /translation="MATEDPSSIRSMQIKILYSLDNQPNVYLSRSENTLPVQIVQISL
                     GMNDDELITLGGLELKDCVKQVVRSAPDTFNLSFRDFEVYYQDISEQPDEPFVANGVI
                     SKLLNSNESCLVPGRVCQSLGAGSIFGKKSKMASETLEIRMQLRTIEIPVTKEKTPAP
                     EQQSHSHSRKYSHSSLAKRSNSQIIMERKRNHESSSHYGSNYPPVKATRTLSLPSFVN
                     PPVTTPRHKRDKVEDRFKNAPFYSNSDKVTYTTTSTTTSNRPGPQRRYQSPSTSTSLQ
                     PQRAARTRSMFTSNIPSISSPINEEPYSDDPDYNANEDNFHNEDEVSSGGNSPVTSPY
                     TPQQPPYKPPTPTQLPDDLDSIRSHTIQSSKLSENHGLVCINECCRTTSSINWRYFET
                     EYRPEYSKILTAHKFDKRNYEGMLGPLCNACFLFYKNKGFMRPEHVVRKYIHQQRYTA
                     KLRKKQKEDESNRTTLDAIAMKKFVSGTSVSLNAGSSPAGSFPAPSHTPSAINQVIQN
                     KALTSHGNNGNNNNLNYDPTPPGFTPDYNDLLHQINIYGGPSTDIDPLPGATPPMVAT
                     KSNTRVINVDAGGAEGAEGAEGEEYKKATKLNTRIIGVPVESNIEEDDNNKENLPPKI
                     NKNHNDYDAMISSFQENNNDWMSFFSSPKHHVSPNSKTPVDNPNEIQKSPLKNNVNKK
                     TIVNMPSSPYQSTLDAASENGHYDQQNVLNDEISKMINMSPFKSSPNRANRLDTGNSI
                     MSNQNKDEDKKNQASTPNTEFYSNDDDSEGHKNITETGSTVLEKENQLVSH"
     gene            complement(<647726..>649477)
                     /locus_tag="CD36_52570"
                     /db_xref="GeneID:8048437"
     mRNA            complement(<647726..>649477)
                     /locus_tag="CD36_52570"
                     /product="amino acid transporter, putative"
                     /transcript_id="XM_002420516.1"
                     /db_xref="GeneID:8048437"
     CDS             complement(647726..649477)
                     /locus_tag="CD36_52570"
                     /inference="similar to AA sequence:UniProt:P19145"
                     /inference="similar to AA sequence:UniProt:Q5AG77"
                     /note="Similar to S. cerevisiae GAP1; general amino-acid
                     permease, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="amino acid transporter, putative"
                     /protein_id="XP_002420561.1"
                     /db_xref="GeneID:8048437"
                     /db_xref="GOA:B9WHJ8"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:B9WHJ8"
                     /translation="MLHKKETNDTFVQLNRSPSTEQGQPSSNIWSSIKDSFKPALPQE
                     KLTGVDDIPDRELTDIERININAANSNLQRKLKTRHLQMIAIGSSIGTGLFVGTGGAL
                     STGGPAAIVLAWAISAISVFMTMQGLGELAVAFPVSGGFNLYASKFLEPGIGFAVGWN
                     YFLQFFVLLPLELVAGAITIKYWNASINSDVFVIIFWFVVLVITMLGVRWYGEAELMF
                     CTIKVIAVIGFIILGIVLICGGGPNHEFIGGKYWREPGPFANSFKGFASSLITAAFSF
                     GGTEMIALTASESSNVRHALPKAIKQVFWRIVIFYLGSIIMIATLVPYNDKRLLGSSS
                     VDVTASPFTIAIVNGGIKGLPSVINAVILISVLSVGNASVYATSRTLNSLAEQGMAPK
                     WTGYIDRAGRPLFAILITNVFGLFALIAADNEKQVVAFNWLLALSGLSSIFTWMSINL
                     SHIRFRRAMKVQNRSLTELPFVAQSGVWGSYFGLTLNILYLIAQFYIGLFPVGAKPNA
                     YDFFLSYLGVPVILASWIGYKIWKRDWTLFIRAKDIDLDTGRINVDLDVLQQEIAEEK
                     AQLAEKPFYIRIYKFWC"
     gene            complement(<650087..>650833)
                     /locus_tag="CD36_52590"
                     /db_xref="GeneID:8048438"
     mRNA            complement(<650087..>650833)
                     /locus_tag="CD36_52590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420517.1"
                     /db_xref="GeneID:8048438"
     CDS             complement(650087..650833)
                     /locus_tag="CD36_52590"
                     /inference="similar to AA sequence:UniProt:Q5AG74"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420562.1"
                     /db_xref="GeneID:8048438"
                     /db_xref="UniProtKB/TrEMBL:B9WHJ9"
                     /translation="MSHHQPTTQTQDTDYSSDFDSFAATFNNFKPKEFKPSIETSNLI
                     SSAARLELESMTLKQTMSETMKSFSKLPGKKLTETLSQIKQIQKDIQELKLITNKRQS
                     CNQDIKEELLETKDLVSNKQDESFLQIEELLSNHWKIIEKGFQEQTNQFSEIIQNNQH
                     LLEASSQQYHSNLQEKIEHQLIEYNNKLTTQLTRQDKDIQEIKQFLKLLVPRVVGIEA
                     SYRVLSTENPIMGKTKAKSKPKPIKRKKQS"
     gene            <651064..>651442
                     /locus_tag="CD36_52600"
                     /db_xref="GeneID:8048439"
     mRNA            join(<651064..651091,651162..>651442)
                     /locus_tag="CD36_52600"
                     /product="U6 snRNA-associated Sm-like protein, putative"
                     /transcript_id="XM_002420518.1"
                     /db_xref="GeneID:8048439"
     CDS             join(651064..651091,651162..651442)
                     /locus_tag="CD36_52600"
                     /inference="similar to AA sequence:UniProt:A5E3E4"
                     /inference="similar to AA sequence:UniProt:O74483"
                     /inference="similar to AA sequence:UniProt:P47017"
                     /note="Similar to S. cerevisiae LSM1;
                     In S. cerevisiae: involved in degradation of cytoplasmic
                     mRNAs;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="U6 snRNA-associated Sm-like protein, putative"
                     /protein_id="XP_002420563.1"
                     /db_xref="GeneID:8048439"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:B9WHK0"
                     /translation="MSELSSFLEKRVHVITSDARFFEGKLEGYDKSTNIILSNCIERI
                     IYSKDDEGEENEEISLGVYIMRGNEIVCVGEIDDELYKSINWETLKGHALKTTKNSLK
                     "
     gene            complement(<651513..>652328)
                     /locus_tag="CD36_52610"
                     /db_xref="GeneID:8048440"
     mRNA            complement(<651513..>652328)
                     /locus_tag="CD36_52610"
                     /product="class II aldolase, putative"
                     /transcript_id="XM_002420519.1"
                     /db_xref="GeneID:8048440"
     CDS             complement(651513..652328)
                     /locus_tag="CD36_52610"
                     /inference="similar to AA sequence:UniProt:P47095"
                     /inference="similar to AA sequence:UniProt:Q5AG73"
                     /note="Similar to S. cerevisiae MDE1;
                     In S. cerevisiae: acts in the methionine salvage pathway;
                     methylthio-ribulose-1-phosphate dehydratase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="class II aldolase, putative"
                     /protein_id="XP_002420564.1"
                     /db_xref="GeneID:8048440"
                     /db_xref="GOA:B9WHK1"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="InterPro:IPR017714"
                     /db_xref="InterPro:IPR027514"
                     /translation="MSAPCHCQHADDDYSSIKKLSVLSPELQQEFKDPNHPANLICEL
                     CRLFYDNNWVTGTGGGISIRDVDGPNPNLVYIAPSGVQKERIQPWEMFLVELPQEKIL
                     RTPNDIPKELTKSYKYKPSACTPLFISCYTLRNAGACIHTHSQHAVMVTLFFENEKEF
                     VISHIEQIKALPKLKYNQETGKIEKIGSMEYYDKLVIPIIENTPHEEDLTDSLQEAIK
                     NYPGASAVLVRRHGIYVWGETVWKAKVYNEAIDYLLELAVKMKLAGIPLVKEE"
     mobile_element  complement(652689..652986)
                     /mobile_element_type="retrotransposon:solo LTR, nu H"
     gene            <653190..>653798
                     /locus_tag="CD36_52620"
                     /db_xref="GeneID:8048441"
     mRNA            <653190..>653798
                     /locus_tag="CD36_52620"
                     /product="vacuolar protein-sorting-associated protein,
                     putative"
                     /transcript_id="XM_002420520.1"
                     /db_xref="GeneID:8048441"
     CDS             653190..653798
                     /locus_tag="CD36_52620"
                     /inference="similar to AA sequence:UniProt:P69771"
                     /inference="similar to AA sequence:UniProt:Q5AG72"
                     /note="Similar to S. cerevisiae DID2;
                     In S. cerevisiae: class E protein of the vacuolar
                     protein-sorting (Vps) pathway, associates reversibly with
                     the late endosome, has human ortholog that may be altered
                     in breast tumors; vacuolar-protein sorting and endocytosis
                     factor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="vacuolar protein-sorting-associated protein,
                     putative"
                     /protein_id="XP_002420565.1"
                     /db_xref="GeneID:8048441"
                     /db_xref="GOA:B9WHK2"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:B9WHK2"
                     /translation="MSGLEQSLFQLKFTAKQLNRQATKASKEELQEKAKIKKALSQGN
                     NDIAQLYAQNAIRKSNERINLLRLASRIDAVASRVQTAVTMRSVTGNMTQVIRGMDKA
                     LQTMNLERISLVMDKFETQFEDLDASTNYYETTTNNVNALTTPQDQVDELLNQVADEA
                     GIEMKQGLNATKVEITNPIVSPNSISEEKEDKLAERLRALRN"
     gene            complement(<653925..>658382)
                     /locus_tag="CD36_52630"
                     /db_xref="GeneID:8048442"
     mRNA            complement(<653925..>658382)
                     /locus_tag="CD36_52630"
                     /product="serine/threonine protein kinase, bud growth and
                     assembly of the septin ring, putative"
                     /transcript_id="XM_002420521.1"
                     /db_xref="GeneID:8048442"
     CDS             complement(653925..658382)
                     /locus_tag="CD36_52630"
                     /EC_number="2.7.11.1"
                     /inference="similar to AA sequence:UniProt:P34244"
                     /inference="similar to AA sequence:UniProt:Q5AG71"
                     /note="Similar to S. cerevisiae HLS1;
                     In S. cerevisiae: protein kinase that regulates the
                     morphogenesis and septin checkpoints; associates with the
                     assembled septin filament; required along with Hsl7p for
                     bud neck recruitment, phosphorylation, and degradation of
                     Swe1p; serine/threonine-protein kinase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="serine/threonine protein kinase, bud growth and
                     assembly of the septin ring, putative"
                     /protein_id="XP_002420566.1"
                     /db_xref="GeneID:8048442"
                     /db_xref="GOA:B9WHK3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:B9WHK3"
                     /translation="MSTVVNRKSSHQFDSPNNLLDHSSSMNVDKVVQSVTNATKRLSQ
                     ISTNTNNSNKKRKTQNKIGPWKLGRTLGRGSTGRVRLAKNTTTGQLAAVKIVPKSNFK
                     KLENPKYKRSKEDATRLPYGIEREIIIMKLISHPNIMGLYDVWENKNDLYLILEYIEG
                     GELFDYLIKRGKLQEYEAINYFKQIINGINYLHQFNICHRDLKPENLLLDFNKNIKIA
                     DFGMAALEVKEKLLETSCGSPHYASPEIVAGKNYHGAPSDIWSCGIILFALLTGHLPF
                     DDENIRKLLLKVQSGKFNMPPELSFEAKDLITKMLKVNPRERITIDAILTHPLLAKYP
                     EPSVSYSSTTTLDINSINIKQIESIDKIDKEILKNLSVLFHNCDEKTIISRLLSPNRC
                     PEKMFYYLLMKYRNEHLSNSNSFNSSNDLDSTKSLPRSTSYVKTTVTDHATGEKHTTV
                     KKIQQSSSIYSNRSLLKKSTSAKGNVLSNITNRPNTPKQFSASNSFNKKKAHHSKTQI
                     YASRSRNTSSRSLKSNSSAGRNGVNASATSVNKIPEISGATVLQPIPSMALNRGEEQQ
                     SNKIKKNLTDTFGNNKSLLNFQLICEEVFENDKENSKPPPPPPSAPVPSLPPPPIEAP
                     TLRTNSVKRGKTWSLARRERELAEQVRQRNEARENKLKAEELARKELEQEKKRIAEEK
                     RRLEQQERELDEKQKLQEKQKAALEKLKKHQSANDFEGLFATNRRSVTDMPTGLSSLD
                     PRAHMVSRANTIGSSNLSSSSVNIDENASKVLHKFGIDVAPSPKRFSRASKTSTSKNL
                     SAFLAPTVSRNLSSQLKTSSSKNLAGYLHAATDTNGSSGATNKKDASTNEALTIEEFN
                     AKERTAMSPSISKTSVNKRNSNQSSYYRSMFSDNDEVTKVRTRDSRLPVPSVQEEQQQ
                     EQEEEMDMENSIDDDNISLIPNPRFSRFSFGGLLGSNTVANEEGDWTIMNSTLNHSNT
                     VVRRTHNKSSTMLGLGIKMRDTTTIKEDEEFEDDEKPFISVPSSEDDEEANAQKNKHG
                     GLRDSGNYDFDEEHSVASTANTEYSDASQGQIPGSHTIHQMETELSNFDLLSYRVADV
                     GKVNTHKPSIVDSKETLLKNQSSEEATIEVNEEDNGNHDRREDHGFNGRDDENYDDNS
                     EEDDDEEDDDDDDDARSSFEARPHSHNYSLAEITSESPVGGGYESPSIANDFKKSRHS
                     TGIFSTTQFPRSPYIVNNNNEASNKDEIGQQQQQQQQQQQQQQIKHVLNDDHKELITS
                     PVQDTFDTKKPAESNSLFRRLSLNPNRAAPKAPKAPASASSPITTAAKANISQPLSSP
                     IKGHNRFSRISVGSKNILQTEDKTTKSSNWFKKFFHSLTTTPSSKEAQSGKSSNKVAS
                     KDIKIIDTSLTASQLIRVIKYQLELKKIEGSISKVDIDEEFGLISGIIPSKFANGRKL
                     KFKIEIIDLINSSSLHVIKIKGNDKGFQSLVNIVSFIIKKEEQDKISTK"
     mobile_element  complement(660240..660989)
                     /note="3' end of copia-like Pol ORF"
                     /mobile_element_type="other:novel LTR element 4"
     gene            complement(<661273..>662298)
                     /locus_tag="CD36_52640"
                     /db_xref="GeneID:8048443"
     mRNA            complement(<661273..>662298)
                     /locus_tag="CD36_52640"
                     /product="D-lactaldehyde dehydrogenase, putative"
                     /transcript_id="XM_002420522.1"
                     /db_xref="GeneID:8048443"
     CDS             complement(661273..662298)
                     /locus_tag="CD36_52640"
                     /EC_number="1.1.1.283"
                     /inference="similar to AA sequence:UniProt:Q12068"
                     /inference="similar to AA sequence:UniProt:Q5AG70"
                     /note="Similar to S. cerevisiae GRE2;
                     induced by stress (osmotic, ionic, oxidative, heat shock
                     and heavy metals) in S. cerevisiae; NADPH-dependent
                     methylglyoxal reductase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="D-lactaldehyde dehydrogenase, putative"
                     /protein_id="XP_002420567.1"
                     /db_xref="GeneID:8048443"
                     /db_xref="GOA:B9WHK4"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B9WHK4"
                     /translation="MSSSTTVFVSGASGFVAQTLVKQLIEKDYKVVGTVRSNEKGDSL
                     KENLKAAKLASENFTYEIVKDISVKGAFDDALKKHPEVTVFLHTASPFHFNITDIEKE
                     LLTPAVEGTNNALQAIKTYGPQVKRVVVTSSYAAIGRFGDLADPSIPANEESWNPITW
                     EQSLADPLSGYVASKKFAEKAAWDFVEKEKPNFTLSVINPVYIFGPQAFEIKNKSQLN
                     TSSEIINGLLNSKPNDTFTNLTGYFIDVRDVAKAHIVAFEKDSIQGKRLILAESPFTT
                     QSILDLIHKDFPQLNSKLPKGDPSQADAWKKGESRIDNEKTRELLGFKFIDFKKSIDD
                     SVVQIIG"
     gene            <663958..>664413
                     /locus_tag="CD36_52650"
                     /db_xref="GeneID:8048444"
     mRNA            <663958..>664413
                     /locus_tag="CD36_52650"
                     /product="nucleoside diphosphate kinase, putative"
                     /transcript_id="XM_002420523.1"
                     /db_xref="GeneID:8048444"
     CDS             663958..664413
                     /locus_tag="CD36_52650"
                     /EC_number="2.7.4.6"
                     /inference="similar to AA sequence:UniProt:P36010"
                     /inference="similar to AA sequence:UniProt:Q5AG68"
                     /note="Similar to S. cerevisiae NDK1;
                     In S. cerevisiae: catalyzes the transfer of gamma
                     phosphates from nucleoside triphosphates, usually ATP, to
                     nucleoside diphosphates by a mechanism that involves
                     formation of an autophosphorylated enzyme intermediate"
                     /codon_start=1
                     /transl_table=12
                     /product="nucleoside diphosphate kinase, putative"
                     /protein_id="XP_002420568.1"
                     /db_xref="GeneID:8048444"
                     /db_xref="GOA:B9WHK5"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR023005"
                     /db_xref="UniProtKB/TrEMBL:B9WHK5"
                     /translation="MSDERTFIAIKPDGVQRGLISSILGRFEQRGFKLVGIKLVQPTE
                     SLLRTHYEDLQSKPFFPSLLSYMLSGPVLATVWEGKDVVKQGRAILGATNPLQSAPGT
                     IRGDFAIDMGRNVCHGSDSVESANKEINLWFKKEELVEYKPALFGWIYE"
     gene            <664853..>667249
                     /locus_tag="CD36_52660"
                     /db_xref="GeneID:8048445"
     mRNA            <664853..>667249
                     /locus_tag="CD36_52660"
                     /product="subunit of the SAGA transcriptional regulatory
                     complex, putative"
                     /transcript_id="XM_002420524.1"
                     /db_xref="GeneID:8048445"
     CDS             664853..667249
                     /locus_tag="CD36_52660"
                     /inference="similar to AA sequence:UniProt:P38915"
                     /inference="similar to AA sequence:UniProt:Q5AGK4"
                     /note="Similar to S. cerevisiae SPT8;
                     In S. cerevisiae: subunit of the SAGA transcriptional
                     regulatory complex but not present in SAGA-like complex
                     SLIK/SALSA, required for SAGA-mediated inhibition at some
                     promoters; transcription factor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="subunit of the SAGA transcriptional regulatory
                     complex, putative"
                     /protein_id="XP_002420569.1"
                     /db_xref="GeneID:8048445"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:B9WHK6"
                     /translation="MASIEQDDLFNVQDDEEEDMEEEEEEDENVEDEVEIEEVGENAD
                     ASQQEEEEEEDYQMDIDTEDQQQQNDDEGEEEEEEEEEEEEEENEEDDEDEEMADEDA
                     ENEEEENGEEEEEEEEEEEEDNKDEKDNKVVEKAIETGPEKKTTDNDKEKDEIKSTSE
                     SQLPSAAIDQSKDNDEDIFLGDDTTKNSDNPTPKDSSKDANIDNTLSKDDKSPKDDSK
                     KKPPIDQSNNNNNTNKSQSQQSENTKLEKSKNKEHLIEDNEKNQIQPEELETNLSFRE
                     QTIRKARKATEFDIIPQVAIPYANQCHALAFTNGPKWILTGGEDGFIRKYDFIASIQG
                     KSPLTMAQKHNLFSDSLTNAGVICSYWENEQPLTRKQLMTQNPKLKDSDFSTGSVSYE
                     PKINPVYALDAEKNGYWCLSGLLSGGISLYTMRYNEGAIHHYFHQGNKENKSRGHTDA
                     VSVIKLNQEQDKFLSGSWDKTIRQWDLNTGRTVLEYTGNSGQISNIEFRPDGLSDITF
                     VVSQDEEEEKKEEKSIGGSGGSGGGGGGNSGETLINSNDDIDSLFGDSDKDKDEEMTD
                     TTKKDKEKEKEKEIPRIVIESIDESKSNKNNNRGAHNKPHLNSNIFMSSTIDGTINIW
                     DIRTNSPVIRLGVSEGTPPWCMSSTWSNNGDFIYAGRRNGTVEEISIKMPHKRSKSGH
                     HQDTMIPNISKLLQFPKISGPVSAISTMPNDDFLLCGSNDNIRLYNLKLYDELNNISI
                     NSKKQATPFLIVPGHHGGMLSQLYVDETGRFMVSASGYRGWGHGNYTDTVLIYEIDFQ
                     "
     gene            complement(<667483..>669741)
                     /locus_tag="CD36_52670"
                     /db_xref="GeneID:8048446"
     mRNA            complement(<667483..>669741)
                     /locus_tag="CD36_52670"
                     /product="GTPase-activating protein, putative"
                     /transcript_id="XM_002420525.1"
                     /db_xref="GeneID:8048446"
     CDS             complement(667483..669741)
                     /locus_tag="CD36_52670"
                     /inference="similar to AA sequence:UniProt:P43570"
                     /inference="similar to AA sequence:UniProt:Q5AGK1"
                     /note="Similar to S. cerevisiae GYP8;
                     In S. cerevisiae: GTPase-activating protein for yeast Rab
                     family members; involved in the regulation of ER to Golgi
                     vesicle transport"
                     /codon_start=1
                     /transl_table=12
                     /product="GTPase-activating protein, putative"
                     /protein_id="XP_002420570.1"
                     /db_xref="GeneID:8048446"
                     /db_xref="GOA:B9WHK7"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:B9WHK7"
                     /translation="MSVITSEISYQPSSSMDIDFLGESLYRSNEDNLPLNDHIKNLKV
                     KTIYNTITKTNDKQEVLKLLTDLARSTDGLINNELRCKIWPILLGIDDNSNIHNKDVT
                     IKNDNHLPPSILSNNKFSTDLFLQDLQCVELPPHKDEDQVKLDIQRSITILNHIQSLS
                     YSGSSSYTTILTTNEIDHLKGKLSNLIIKLLRKYPSLNYYQGFHDIASIILLVCYIPN
                     DKSDDYNININGSKHNDGSNNTYEDGNDYQIDEELAFKMLEKLAIYHLRDYLITDINL
                     SINHLRLIPTILQIVDNQLFELIKQTSNSFIQSQGLNYDYKFYQALSSILTIYSHDLI
                     NLSQILTLWDFSLSYNSVLINMYIYVATLITFKSKIWQTLNIPQEENDDISIDFSNID
                     PDIVHSTISSSNLFDGLTDSQLVTILNKSKELLEMFPIDELTNNETTWNKWFQQYNVD
                     SVLCNTSKLVDNGNDNSKLEKFNQYRYLISQDQNEKLEEYVDELSNLIAKQDNQILKQ
                     VKDEQIEEEKIFQELLAKQQQQQQQQEEEEELSQSIQSIQYDEDDGNSLSSSSGNSLS
                     SSLTLANSITSSSIHRIKSTLLFRKFFHNNDVEESQEINDTTITTTTNNNNNNNNNSN
                     DDDDADERVIRNKNWILSLLNNNNNNNNNNNIYKISITIGFIGFILHFFLIKPNNNSN
                     FLITMIINPIKQLLQYEPLFTLSTIGTTFINDLEESFNSITNGGITTNNIGNFFGNIG
                     IGNIRNTIYGFN"
     gene            <670917..>672119
                     /locus_tag="CD36_52680"
                     /db_xref="GeneID:8048447"
     mRNA            <670917..>672119
                     /locus_tag="CD36_52680"
                     /product="TauD/TfdA-family taurine catabolism dioxygenase,
                     putative"
                     /transcript_id="XM_002420526.1"
                     /db_xref="GeneID:8048447"
     CDS             670917..672119
                     /locus_tag="CD36_52680"
                     /EC_number="1.14.11.-"
                     /inference="similar to AA sequence:UniProt:P23180"
                     /inference="similar to AA sequence:UniProt:Q4WJF3"
                     /inference="similar to AA sequence:UniProt:Q5AG63"
                     /note="Similar to S. cerevisiae FMP12; trimethyllysine
                     dioxygenase, mitochondrial precursor, putative;
                     uncharacterized oxidoreductase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="TauD/TfdA-family taurine catabolism dioxygenase,
                     putative"
                     /protein_id="XP_002420571.1"
                     /db_xref="GeneID:8048447"
                     /db_xref="GOA:B9WHK8"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="InterPro:IPR010376"
                     /db_xref="InterPro:IPR012776"
                     /db_xref="UniProtKB/TrEMBL:B9WHK8"
                     /translation="MSVTLATPIEDSIELKWSDNAISKYHNIWLRDNCHCDKCHYSLT
                     KQRLLNSATINPNIKPKSIDCKQDQLYIVWDQDNHASNYDFNWLRLHSYQPRLIPIDE
                     KLKNGKKLLNRELWQVKDIENNLPKVDYNKIMQSTNDDDDDKDEDVIKDWVLKIWKYG
                     FCLIDNVPITPEDTEKLCEKLNYIRPTHYGGFWDFTSDLAKADTAYTNFDISSHTDGT
                     YWSDTPGLQLFHLLYHDGIGGTTSLVDAFKCAEILKQKYPESYEIFCRIPVPAHSAGE
                     EKVCIQPDEFNPIFKLNDQGQLLQVRWNQSDRSTMDNWENPNEDIPKFYQAIRNWVEI
                     ITSPENEMWYQMKPGQCLIFDNWRVFHSRSEFTGKRRLCGAYFERDDFVSKLKLLVLG
                     RQAVLDAI"
     gene            complement(<672235..>673230)
                     /gene="XYRA"
                     /locus_tag="CD36_52690"
                     /db_xref="GeneID:8048448"
     mRNA            complement(<672235..>673230)
                     /gene="XYRA"
                     /locus_tag="CD36_52690"
                     /product="NAD(P)H-dependent D-xylose reductase I,II,
                     putative"
                     /transcript_id="XM_002420527.1"
                     /db_xref="GeneID:8048448"
     CDS             complement(672235..673230)
                     /gene="XYRA"
                     /locus_tag="CD36_52690"
                     /EC_number="1.1.1.-"
                     /inference="similar to AA sequence:UniProt:O13283"
                     /inference="similar to AA sequence:UniProt:P38715"
                     /inference="similar to AA sequence:UniProt:P87039"
                     /inference="similar to AA sequence:UniProt:Q5AG62"
                     /codon_start=1
                     /transl_table=12
                     /product="NAD(P)H-dependent D-xylose reductase I,II,
                     putative"
                     /protein_id="XP_002420572.1"
                     /db_xref="GeneID:8048448"
                     /db_xref="GOA:B9WHK9"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:B9WHK9"
                     /translation="MSTTTPTTPTTPTIKLNSGYEMPIVGFGCWKVTNATAADQIYNA
                     IKTGYRLFDGAEDYGNEKEVGEGINRAIKEGLVKREELFIVSKLWNNYHSPENVEKAL
                     NKTLNDLNLDYLDLFLIHFPIAFKFVPLEEKYPPGFYCGGDGGDNKFHYENVPLLDTW
                     KALEKLVNLGKIKSIGISNFNGGLIYDLIRGATIKPAVLQIEHHPYLQQPRLIEFVQN
                     QGIAITAYSSFGPQSFLELQSKKALDTPTLFEHEIIKSIADKHGKSSAQILLRWATQR
                     NIAVIPKSNNPDRLAQNLAVVDFDLTDEDLQAISKLDIGLRFNDPWDWDKIPIFV"
     mobile_element  complement(673906..680155)
                     /mobile_element_type="retrotransposon:kotuku E, Tcd32,
                     LTR"
     gene            complement(<674230..>678465)
                     /locus_tag="CD36_52710"
                     /db_xref="GeneID:8048063"
     mRNA            complement(<674230..>678465)
                     /locus_tag="CD36_52710"
                     /product="retrotransposon Tca2 polyprotein, putative"
                     /transcript_id="XM_002420528.1"
                     /db_xref="GeneID:8048063"
     CDS             complement(674230..678465)
                     /locus_tag="CD36_52710"
                     /inference="similar to AA sequence:UniProt:Q59K39"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="retrotransposon Tca2 polyprotein, putative"
                     /protein_id="XP_002420573.1"
                     /db_xref="GeneID:8048063"
                     /db_xref="GOA:B9WHL0"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:B9WHL0"
                     /translation="MLLCVNFNEKHVIFAKQSLNTNLFTGPSRGKVYSNGKMFMDNNS
                     FIEDEGEEKGYLNSINAMTKLVDPRIDQVVANPDGRKDLYYYHLITGHMSIRSLIRLH
                     EQGRIKCSIDDQDAKDQIKGCKQCILVNAKQHSHNKTTQSPPERSLYRFHCDTMGPYH
                     VGHVKYYITLITDHYSGFSFAIVKTEKRFTKEILDLFEHLHADLYPKKIARFRSDNAK
                     EFPTEAELGTLRIKKEVLPPYSPEMNGMAESHNNVLKRRMLYVVLNFPNRYKELLIFF
                     CEIVAYAVFIKNHTPSERVETHKGWTPHELFYGRRYRPNYHQFGVDVFVILSNKQEAD
                     ALGVQFIKGFHRGVPGIFLGYGNDSNVYLIQLVDGNYTRRLFVNVRFLGSMNNINTFL
                     DTFGEKMRKNMDESGNFPFFEDSSRNELLNGRYVPYEDHLPTQGTSSQDVSSDRPTTI
                     EPTATNINMDELIAEVPDEFLQNNIAGDFLTQQGFTFPSLQVTGKLLEHQSEQSLAPY
                     NWMSKDNMEYSKMGSDHKYLGQNDTENIEPNKNQQVNISEPSFQSSMANKPNESDLGV
                     LPTADGIRHGVPNARGETTQDGTVSSNIDMHQPYSTIPTHRPPPPVGKNVQFSGVNND
                     STTLLPSEWGLPPQQHLSNGGAYESSPVSNVTTSVRLSASTMNIDVGNKNSIKRTKID
                     RHPLLPNKETVNEISVRIEALKNEHNLNKTLDTIADSYLFTRTSELKNENMAYYKGNG
                     RVSKPPMLLNNLKIIDELIPPTKHISSIEARLETSTGDLNDIENDIDFSVYGVEKYVD
                     YNDENWRRSMDNEMKKFKEMNVYQVVKKKKNFRMIPAKWVHSYKPNDPKGEFFRSRCV
                     VQGFRQIPGLDFDKNCVSSPVTDLTTIRVLTAIAVESKAQIHHIDIKSAYLNATLPKD
                     TPIFVKPPPGYDDGIHCWRLVKAVYGLKQSGFEWHSHVSKTLKKMGLYQCENVEGLFM
                     LEKGNEKIYIALYVDDLFVVASSNQFFNKFMDDLEAKFSLNYIGEISEYLGIEFQKNA
                     FGYELHQNKFVKRLIEAFPTEIMKGADLPRTPDNIFKNGKYKIIDDNTGKPLKNQKDI
                     PIPDEYIYEDSNSPRLDKEHHDLYRSIVGMLLWLTNNTMPSISYGTNALAAKCHEPTE
                     NDYKHLMQMIKYLYKNNNERLIMRRNQTKDISEDSNVIYAYSDASFAADLDRHSVSGF
                     AIYLNGNLVSWGTKKQRSITKSSMACELIALGETVDRSMIIRQIVQSIGYSAPKIIIF
                     EDNQPVIMNSYNRKSSAIRRSVDICLKTIRQLILEYKLLSVVYINTKLNVADLLTKAV
                     NNNTMKTLKPLLYDKGNLDGVRKLIKDNFTSHGPVEMGQHSLVYNIITPTEEIKESYY
                     VAPDNVQSKVESRNNKHPEISGGIAHIKRLSMP"
     gene            complement(<680804..>682540)
                     /gene="MIG1"
                     /locus_tag="CD36_52720"
                     /db_xref="GeneID:8048449"
     mRNA            complement(<680804..>682540)
                     /gene="MIG1"
                     /locus_tag="CD36_52720"
                     /product="transcription factor, catabolite repression,
                     putative"
                     /transcript_id="XM_002420529.1"
                     /db_xref="GeneID:8048449"
     CDS             complement(680804..682540)
                     /gene="MIG1"
                     /locus_tag="CD36_52720"
                     /inference="similar to AA sequence:UniProt:P27705"
                     /inference="similar to AA sequence:UniProt:Q9Y7G2"
                     /note="In C. albicans: regulates genes for utilization of
                     carbon sources;
                     In S. cerevisiae: transcription factor involved in glucose
                     repression; transcriptional repressor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="transcription factor, catabolite repression,
                     putative"
                     /protein_id="XP_002420574.1"
                     /db_xref="GeneID:8048449"
                     /db_xref="GOA:B9WHL1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:B9WHL1"
                     /translation="MSMSTPMPSPTPTPTPLDSKKMAPKEKKNKDDRPYKCTFCDKAF
                     HRLEHQTRHIRTHTGEKPHACTFPGCVKRFSRSDELTRHLRIHTNPSSRKRKNKNQNM
                     MINTTNGTNTTTTTPAGMAISPNNLPPGSYAIPNTAIPFSIDRNGNHVYHQPYPVYFV
                     PHANGYMQPMVQTQGVTVVPNSDPQQQQQQQQQQQQQQQQYHQQFQYQERPQQQTNIR
                     SNNHLQQHGSAIFSLPSSPTMSSAQTPNSGTSSSCESIKLAPLSIPNNLSRPQQQQQQ
                     QQQIPKSESSTSLYSDGNRLFSRPNSTLHSLGSSPENNNSSGQLSGVPTPSFSNLNDY
                     FQQKNNNNNNNNNSRLFNASSSSLSSLSGKIRSSSSTNLAGLQRLTPLTSTTTTNTSL
                     SNNNNMTRLNIIPKQPSSTSLNLEFYNGNNQQQQQNYHATKKSRPNSPSQTPIHLSSS
                     RKSANNSFIISPNETPLQTPLQSPQLKPYQDQPIGNNINNTSDTLIGSVVNEKLNNIS
                     IATNGTQLPPIRSVLSFTSLVDYPPDSKQKIVAPPIVDTTTIIRGETNGNNGTNNDNS
                     NAKPMSLTNLLS"
     gene            <685983..>688502
                     /locus_tag="CD36_52730"
                     /db_xref="GeneID:8048046"
     mRNA            <685983..>688502
                     /locus_tag="CD36_52730"
                     /product="dipeptidyl aminopeptidase, putative"
                     /transcript_id="XM_002420530.1"
                     /db_xref="GeneID:8048046"
     CDS             685983..688502
                     /locus_tag="CD36_52730"
                     /EC_number="3.4.14.-"
                     /inference="similar to AA sequence:UniProt:P18962"
                     /inference="similar to AA sequence:UniProt:Q5AG57"
                     /note="Similar to S. cerevisiae DAP2"
                     /codon_start=1
                     /transl_table=12
                     /product="dipeptidyl aminopeptidase, putative"
                     /protein_id="XP_002420575.1"
                     /db_xref="GeneID:8048046"
                     /db_xref="GOA:B9WHL2"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR002471"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WHL2"
                     /translation="MTSIIRYDYFKESGRGNENMPSRTILSYKRFIYFGTLLAILLYG
                     SSFLITTIENFTLKFESQSISSIDNFKGERPDYASPSSKSTDFKGKIPLSKEVYDKHI
                     LSPKLHSIQWIRAPESIHNDRGTYVIKEDKHDKGFRVVVKSIADEEYEKELIGNSTFK
                     YKGQEHEIIDYFASPDLQKVILKTDVTSLWRYSSIAQYWVLDINNGDIKPVFNEVDKI
                     STASWSPDSLKIAFIYENNLYYKSLQSNEIIQITFDGSTEIFNGKPDWVYEEEVYGSD
                     HVFWWSPESDKVAFLRSNNTQVPEFIIPFYAQSTHQDYPEIVKIKYPKAGYPNPIVDI
                     LTYDLNTKNLHKHNLKSEKINLENRLITEVVWIADSLKVKTSNRHSDLLEIFLVDKHE
                     KVKLIRTLTASDSWFEATSSTFYIPANETLGRKYDGYLDIVVENGYNHLGYFSPPDNS
                     QYELLTKGNWEVTGGVAFDFTSNTVYFTSTVKSPVERHIHAINLLDRSDDGLPYIKDI
                     TTKEGWYDSSFSSGARFLFLSELGPGIPTQRVNDLKLHKNVKTIEDNSELIETLRNYV
                     IPEVKYSQVELNDETGGQPFLVTAMETLPLNFDKKKKYPVLFYIYGGPGSQTVTKKWA
                     ISFSSLIAAELDAIVVTIDGRGTGFNNLNYKLGSKFKFIVRDRLGQYEPIDVISAANK
                     WAEKSYVDHERIAIWGWSYGGFLTLKTLETDIDNPIFNYAVAIAPVTRWRLYDSIYTE
                     RYLNTPQENPKGYEIGSIHNVSNFKHVKKFFIGHGSGDDNVHVQNSLQLLDEFNLAKV
                     ENFEFMIFPDSNHGMNYHNGFTVVYDRILDFFKRAFDWEFV"
     gene            complement(<688663..>689166)
                     /locus_tag="CD36_52740"
                     /db_xref="GeneID:8048450"
     mRNA            complement(<688663..>689166)
                     /locus_tag="CD36_52740"
                     /product="endosomal protein, putative"
                     /transcript_id="XM_002420531.1"
                     /db_xref="GeneID:8048450"
     CDS             complement(688663..689166)
                     /locus_tag="CD36_52740"
                     /inference="similar to AA sequence:UniProt:P38815"
                     /inference="similar to AA sequence:UniProt:Q5AG56"
                     /note="Similar to S. cerevisiae YPT35;
                     In S. cerevisiae: binds to both
                     phosphatidylinositol-3-phosphate (PtdIns(3)P) and proteins
                     involved in ER-Golgi or vesicular transport;
                     phosphoinositide-binding protein, putative; vesicular
                     transport protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="endosomal protein, putative"
                     /protein_id="XP_002420576.1"
                     /db_xref="GeneID:8048450"
                     /db_xref="GOA:B9WHL3"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:B9WHL3"
                     /translation="MNNITPNRNKSDSISQLNKVLPIPIELHNGESLEQHQHNHLNHI
                     TNVIVGEYHLISGEFGKSYMTWQIKITINDLDHSSIILYKRYNEIYQLRQDLLKIFPN
                     TINNNNNNNNNVPSLPPKDNLSLDRLLMSKNWLEERRKGLQWFLSNVLLDPVFQNCNV
                     VKQFVLS"
     gene            <689394..>689942
                     /locus_tag="CD36_52750"
                     /db_xref="GeneID:8048451"
     mRNA            <689394..>689942
                     /locus_tag="CD36_52750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420532.1"
                     /db_xref="GeneID:8048451"
     CDS             689394..689942
                     /locus_tag="CD36_52750"
                     /inference="similar to AA sequence:UniProt:Q5AG55"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420577.1"
                     /db_xref="GeneID:8048451"
                     /db_xref="UniProtKB/TrEMBL:B9WHL4"
                     /translation="MDIIKNKYSFWKRLLHKWQSRKDIPFRKKFFVGYDLYGNTYWEF
                     TIDGNMSRLRRKLQPFRKELFEVDYFKTIPPQWLQWLRRTRDHPPSLNELIKDQLRQE
                     KIKILAQKVDENWKLEKLRLENQQQLKLSNELNKVKLENEKFIEKQKAMGNKSIENPW
                     KQVEQELKNENPIESAIIKPRS"
     gene            complement(<690061..>693564)
                     /locus_tag="CD36_52760"
                     /db_xref="GeneID:8048452"
     mRNA            complement(<690061..>693564)
                     /locus_tag="CD36_52760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420533.1"
                     /db_xref="GeneID:8048452"
     CDS             complement(690061..693564)
                     /locus_tag="CD36_52760"
                     /inference="similar to AA sequence:UniProt:Q5AG54"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420578.1"
                     /db_xref="GeneID:8048452"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:B9WHL5"
                     /translation="MNSDIDIHNNLNINHNFFNLNIKKIIGTSAKTSHQFFIQDDLIA
                     YTASGGVVVCTIDIETNEVITQRFFCANISYTNNYNHNGMKKRGGGGNGGGTSSANAY
                     LNMIKNYDYSEKELKRDLYGYPINSEPIEIFGTSIDNFDDNYNNSTNNDINIGGGGGS
                     GTTGNTSPSKLKDKVRSINCITISPDKKLLAIGEIGYQPRILIFSLAENSNNNPIWSI
                     YEHSFGINSLVFSPNSKILCSLGLINDGFINLWKIGIGSTNTNNINLIASNRCSNIIH
                     KLIWHENLIITLGLRFIKLWQFDDEELNNFKKPLILKGKNAILGNLINENFIDGNILN
                     NDELLIITDTNQLLLLLKLNFENPKIIILKSPDYEFNSIVVDYHHEKIWFSTGNEYII
                     KSLSFNELIPINSNNNNNNNNNSITIPLNLKKSITTTFTAKDDTTIISRPIIQIYDFS
                     KTHLVFLTNQEEIKFINKNNDDSNSSTNSSTNNKVLTSSLLKNFAGIKYTYSKEFLAF
                     SHNGMIKKFIDSSELQDIIKFNVIDMDIIPVSNNVTAIEKNDKNSLFIGDKYGTLTIL
                     ELLESNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNVYDYDYKILYQVKAHSSTINEI
                     IYFTFANYQIVCSISRDRMIQIFTSPINKTNWDLLQTLPIHNGNLLQIIHFQDKIYVC
                     SSDRTISIHNLVINKQAEEEENNLRLYQEKIITLKSTPLCMKIFDNDLVVSTNDKSIL
                     IFDIGNNFELKRTLKLINDKINETILVESFIKYRNLIIVWSNDKSLRAFNYHNGKEVG
                     VAWGHSESVLELYLFNDHEIISIGNDACLFCWEVIENLKSSTSISSAGSIISQDNNGK
                     EIYEKQISGSGSGSGSSSAPLYTKVTRKILPTIPIKPIEKEGQITPTKTNSVTTTAIN
                     SPIPKLTAATLKRLEAKQNGGHISYTSRSTSPNRSNSSSIINSAPVKLSVRTSNSNFS
                     KLQSPLKTPVINTTFPKRTTSPSRVETNKVKPPPPPTTTTTTKTTNNISNSSPTPSSR
                     PILKKQERNKTLLDNTMGKLDDVANVISKCNENEKQIIKQKLQSILSLVNNSNPNLKA
                     NPKAKLNTINIDEENQDKELLEKYSDKLMKMIEKKFSMTSLNQNNTSTSSLISASSSS
                     SSSSSSSCSSSPSSPTPEAQN"
     gene            <694034..>696121
                     /locus_tag="CD36_52770"
                     /db_xref="GeneID:8048453"
     mRNA            <694034..>696121
                     /locus_tag="CD36_52770"
                     /product="U4/U6.U5 small nuclear ribonucleoprotein
                     component, putative"
                     /transcript_id="XM_002420534.1"
                     /db_xref="GeneID:8048453"
     CDS             694034..696121
                     /locus_tag="CD36_52770"
                     /inference="similar to AA sequence:UniProt:Q12420"
                     /inference="similar to AA sequence:UniProt:Q5AG53"
                     /note="Similar to S. cerevisiae SNU66;
                     In S. cerevisiae: component of the U4/U6.U5 snRNP complex
                     involved in pre-mRNA splicing via spliceosome;
                     contains the SART-1 domain (Pfam:PF03343); SART-1 is a
                     protein involved in cell cycle arrest and pre-mRNA
                     splicing [1][2]. It has been shown to be a component of
                     U4/U6 x U5 tri-snRNP complex in human, Schizosaccharomyces
                     pombe and Saccharomyces cerevisiae [3]. SART-1 is a known
                     tumour antigen in a range of cancers recognised by T
                     cells"
                     /codon_start=1
                     /transl_table=12
                     /product="U4/U6.U5 small nuclear ribonucleoprotein
                     component, putative"
                     /protein_id="XP_002420579.1"
                     /db_xref="GeneID:8048453"
                     /db_xref="GOA:B9WHL6"
                     /db_xref="InterPro:IPR005011"
                     /db_xref="UniProtKB/TrEMBL:B9WHL6"
                     /translation="MSEEISLSLEETNKLRINAGLPPIPTPQPNNDAEEEDKVISLSI
                     EETNKLRQQIGLPLLPITTITNLFGDDIEYKNYENYEKKQLQELENNQLLERINNAKF
                     NTNKRKFLTNNTLIDDNDNEKDLDLDLDTDDWLNNLGKTDSIPKSSKNKKQKVVTGIA
                     KPNKYNESSEIIIGHSIKELRSLGNNEILTLKDSNILNDEEREREREREREPEDILIN
                     QDLSNKATLKRNLTERKEAENIKFNGRHYRRNNNDNDNEEEEKEEEEEDFDDNGLLIN
                     DKVIMSGSTIDLSKPIVSVKDKKKNMMTITNLFEDLDNDDDDDNNVKSNVPIKMKKIK
                     KKKDNIKKKLTKYKLLDVTIKPNNNDDNDNNDNIDDDIDDIENQLSNSISSLRTKKLQ
                     TRSEFTPEQLAEEISTNKRWEFEKNLEQENLKNNVLYNDTIGFLNNLESNILSESGEV
                     EMITNTNESDNEQQEQEQEQDHAQEQDHSQEQDLKQIIDKLDSNVVEEKQKNDEIPKF
                     NGGLAETLKFLKSHNIFESTRGISTITNQELRQQELAREEVIKKSELLKMKISIEERI
                     LKEELNKDKSYIRMPKIERSRYFEKLLDIRLKQKGIIIDNDNNNKRNSSGMVQNNLKI
                     YNPKVELTYKDELGNVLNTKQAYKQLSHKYHGTGLDKTKKKQEQMKKKKMQKGKNSTT
                     TTTTTTVTERIIN"
     gene            <697531..>701250
                     /locus_tag="CD36_52780"
                     /db_xref="GeneID:8048454"
     mRNA            <697531..>701250
                     /locus_tag="CD36_52780"
                     /product="cation-transporting ATPase, putative"
                     /transcript_id="XM_002420535.1"
                     /db_xref="GeneID:8048454"
     CDS             697531..701250
                     /locus_tag="CD36_52780"
                     /inference="similar to AA sequence:UniProt:P38995"
                     /inference="similar to AA sequence:UniProt:Q96WX2"
                     /note="Similar to S. cerevisiae CCC2;
                     In S. cerevisiae: Cu(+2)-transporting P-type ATPase,
                     required for export of copper from the cytosol into an
                     extracytosolic compartment; has similarity to human
                     proteins involved in Menkes and Wilsons diseases;
                     copper-transporting ATPase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cation-transporting ATPase, putative"
                     /protein_id="XP_002420580.1"
                     /db_xref="GeneID:8048454"
                     /db_xref="GOA:B9WHL7"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR017969"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR027256"
                     /db_xref="UniProtKB/TrEMBL:B9WHL7"
                     /translation="MPSSSSIFESNSNENNITVVLEILDLHTTKDITDITTILNKLFP
                     KLISKDFHHQQLTIIYDSYDYDDISILNAISEIGFPVKILSSTAPQYKTTVNIQGMTC
                     GACSASITEALEKTPGVYKASISLITENGLIIHSPKLSIENIITIIEDCGFDAQIESS
                     KTKHTQSQSQSLPKTSQPQRFKTTIGIIGMTCGACSASITNVIEKLPGVENVSVSLIT
                     EEASIIHDSTITIQQLKQTIEDCGFTATFTKSINLNQYSSNNNNNEDDSNEQVTLKIV
                     GVNHTTDLIGLRYNIEAYLRSISGIQKFDLTLRGMNASSDIMPTQVGTLITEEDTITD
                     VKNLVNELVFQYDSDNVGIRDIIDGLNSIDHGNNNNNNIEFMVINSLDQSSTTQLKLL
                     SKIKDINYWKNIFIQSLIFGIPVLFLNHTKNWPIWETTMIFPGLYLVSLLELILSSYI
                     QLCLGAIFIRKFSSFLRKGFKGATMDVLVCISTMCSYIFSLTTIIVSVWNGKKDGAPP
                     VLFDTLVMLISFVSFGKLLENKAKGATSTALSSLLSLTPSICTIINDIPEYEKFINIQ
                     QNQSIEKSENKIKNKNSSFIQDFPTRVISIDLIQPNDIAIVLPGGKIPADGEIVFGET
                     EIDESLITGEPLPVYKKFKDKVIGGSINGPHLIHIKVIHTGKKSQLQQIINLVKESQI
                     NKAPVQKFSDYIAARFVPFVLLLAIFTFIFWMIICFTIHQDKLPKIFQNEINGKFFVC
                     LKLSISVIVVACPCALGLAAPTAVMVGTGIGAINGVLIKGAKVLEKITAINIILFDKT
                     GTLTTGEMSLVNFQPLLSSLSKSQSKSQSKSKSQLKSQLKISDWWKLVGSVECHSEHP
                     IGRALTKSAKSNLNLNFDDDHFDTIVNDINVLIGLGIQANVTLTGATTVGTETNQYNV
                     YVGNDKLIEEKFPNLLNNIDEKLLHSTNTVSHVIIDGEYSGYIELTDALKPGSWEVVN
                     YLKNQGYIIGMVTGDNRGAALKIAQEVGIPFDNVFYEVSPIHKDNVITDLHNRLGGIT
                     NNGNVNVAFIGDGINDAPALAKADIGMAISSGTDIAIESADIVLIGGRNNQTDLYGVI
                     NALKISTTTFNRIKINFLWAIIYNVFMLPFAMGCFLPLNIVLPPVAAGAAMMFSSLSV
                     VFSSLLLKRWTPPKIEIKETFINDDLEMGNNTFDGFSLKNGTLEQFNNVKRKSAINFS
                     SLFAKMTRRRRGGGGGGGRRNNNNQSYELVSNRFS"
     gene            <702115..>705243
                     /locus_tag="CD36_52790"
                     /db_xref="GeneID:8048455"
     mRNA            <702115..>705243
                     /locus_tag="CD36_52790"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420536.1"
                     /db_xref="GeneID:8048455"
     CDS             702115..705243
                     /locus_tag="CD36_52790"
                     /inference="similar to AA sequence:UniProt:Q5AGI7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420581.1"
                     /db_xref="GeneID:8048455"
                     /db_xref="UniProtKB/TrEMBL:B9WHL8"
                     /translation="MKVYNLFLIANLANGLTINPASAQPSNDVSSQVDAADAAAANGN
                     GGGDGMKTKHSFSKGISIRKDLAQDSEKQQQQQQQQQPSLEDLSQFSFDASSLKNVMG
                     EDGGPKVELAARGFGEIFWQLLTLGKELTMEKVAILKDILSLLDKLKQFKKDGYKALV
                     PEWDGIYQPVAPAPGPGPSPGPGPGSAPKGDVVNVENWSFNPDQQQVESLSKNDNDNE
                     SETLDKRDAEDDEEVTAAIDLGKWKSKLGGMKGGMNKGGGKSGMGKGGGKSGGKGGAK
                     KGGLNKGGKGGKGGGKVKPSKPSFEEECSEEETYSSSSEEECDEFNNGKFKGKNTVYG
                     NKKNQLDKRDAEDDEEVTAAIDIGKWKSKLGGMKGGMNKGGGTGGMNKGGKGGKGGMN
                     KGGKGGKTTQPVEEECSEEEYSTEEEECDEFNNGKGNTGKGGKGGKGGKSGKNNKGSS
                     WKAKREEDEVTAAIDIGKWKSKLGGMKGGMNKGGGKGGMNKGGKGGMNKGGKGGKTTQ
                     PVEEECSEEEYSTEEEECDEFNNGKGGKGGKGGKSGKSGKNNKGSSWKAKREEDEVTA
                     AIDIGKWKAKLGGMKGGMNKGGGTGGMKGGKGGKGGMNKGGKGGKTTQPVEEECSEEE
                     YSTEEEECDEFNNGKGNAGKGGKGGNGGKGVKGGKGGNGKGWKVKRGENHSDGNKHDG
                     HHKGNKEDNHHDSDCECGYSSSDDEHEKPKVIDRKKQDHERKKQEDHERKKQEDHERK
                     KQEDHERKKQEDHERKKQEDHERKKQEDHEHEKQKEHERKKQEDHEHEKQKEHERKKQ
                     EDHEHEKQKEHERKKQEDHEREKEDHEHEKQKEHEKEKDHGKEKDHGKEKDHEKENNH
                     EKEKPKDHGKKKEHDGFKYEDCDEFFGDHKKGKHGNDKRESNNEDEDEVTASIKIGKL
                     KGFLEKGEKNTKDNQETKKTKEIDCEDEKENKGGLKPELGKGGPKAGPKAGPKAGPKT
                     GPKGNKGNKSGAEKPYESGSESESESECECFEEEEGNFKKGKDGGIKGGYARGYGKDG
                     NASNRKSKGGKF"
     gene            <705077..>706660
                     /locus_tag="CD36_52800"
                     /db_xref="GeneID:8048456"
     mRNA            <705077..>706660
                     /locus_tag="CD36_52800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420537.1"
                     /db_xref="GeneID:8048456"
     CDS             705077..706660
                     /locus_tag="CD36_52800"
                     /inference="similar to AA sequence:UniProt:Q5AG47"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420582.1"
                     /db_xref="GeneID:8048456"
                     /db_xref="UniProtKB/TrEMBL:B9WHL9"
                     /translation="MNSGSNRNSNSNVNVLKKKKEILRKEKMVVSKVDMQEVMVKMEM
                     RAIAKAKVGSFDVVSQGSNKQQDKMMIAKLNKDYVAKENEIFGMDDEIKMLEKRAGKL
                     WNWKSESKEKGYSGFKEEDYIENDKVSKKQAIKDKLIGKFKNQGDNEFGLSADDDPDD
                     ERDMVDELLLRVFNSLKGSGFINDIIRMSLTDPRVRSGMIDMTIRLLNAEVIPWDDIF
                     IALKRHGLAIDVIKFTFTDAQTRVGLAAFVVELLPALVNSGALNLRQILETVPRLQEE
                     SIKMYNGKHNSSDPVDSGNTNHGFEDSVGSIIDSENQAEGGINNPVIPEKNSTSTLVD
                     VPAKSPSSDAAPKVIIPSEKNSSGNYNGGNESKSSLNDNKEKTISQPEALDENKNDQL
                     IGKQKNWDDKTLEEKVEEYKKLKEKYDEARRKLVTNENSDLIRDHTYFNNPEKLKNVK
                     PLFPKTGVKYSNNTSNSTIGDHVAPYPKVRIFYDGTFIPNYPVDFKPPIAGGPPTNFD
                     PNSNPIKPNATEPTVGVAT"
     gene            complement(<707207..>708040)
                     /locus_tag="CD36_52810"
                     /db_xref="GeneID:8048457"
     mRNA            complement(<707207..>708040)
                     /locus_tag="CD36_52810"
                     /product="hydroxyproline-rich glycoprotein, putative"
                     /transcript_id="XM_002420538.1"
                     /db_xref="GeneID:8048457"
     CDS             complement(707207..708040)
                     /locus_tag="CD36_52810"
                     /inference="similar to AA sequence:UniProt:Q5AG46"
                     /inference="similar to AA sequence:UniProt:Q6SSE6"
                     /inference="similar to AA sequence:UniProt:Q9FPQ6"
                     /note="Similar to Chlamydomonas reinhardtii GP1;
                     vegetative cell wall protein precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="hydroxyproline-rich glycoprotein, putative"
                     /protein_id="XP_002420583.1"
                     /db_xref="GeneID:8048457"
                     /db_xref="UniProtKB/TrEMBL:B9WHM0"
                     /translation="MQFSTLVSLAAVIVSTNAAALLTQTVESSTVVTITSCGTEATNC
                     PAASPAPSGSAPAPPAPEQPESAPAPAPSAPAPEQPEQPATPATPATPAAPAPSAPAP
                     EQPEQPATPATPDTPAAPAPSAPAPEQPAGPAPSAPAPGPEQPAAPASPAPAPSASAP
                     EQPAGPAPSGPAPSASAPEQPAGPAPSGPAPGPEQPAAPTSKEAESTPAPAPSAPAGP
                     EQPESAPAPGPSAPAGPEQPASSVSNSTSPSSVPTFEGAAAKQYITGSVAVIAAALLA
                     L"
     mobile_element  709990..711534
                     /note="two inverted LTRs flanking remnants of ORFs and
                     PBS"
                     /mobile_element_type="retrotransposon:iota W (truncated)
                     and G, Tcd23, LTR"
     gene            <710363..>711280
                     /locus_tag="CD36_52830"
                     /db_xref="GeneID:8048458"
     mRNA            <710363..>711280
                     /locus_tag="CD36_52830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002420539.1"
                     /db_xref="GeneID:8048458"
     CDS             710363..711280
                     /locus_tag="CD36_52830"
                     /inference="similar to AA sequence:UniProt:Q5AJB4"
                     /note="Tca3/gypsy-like retrotransposon relic, putative;
                     transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_002420584.1"
                     /db_xref="GeneID:8048458"
                     /db_xref="UniProtKB/TrEMBL:B9WHM1"
                     /translation="MRFKSTNLEKTNNLLTGTTSTAPAISHILMLTTIAITISPMPIK
                     TTTTRNQISPESLKPIIKRQEIRESNSTNYQSPTTTTTMSILPISMLSKPYSRLHTNQ
                     TMTQSSNPFNQTIQRGNPTIRNVAAIDISQGLPHVLLDSRADANFIPPQLSTQGKVTP
                     LDKPIIATTATNKRHAITHRVEFTITQPFHLKFSAYVLPGVKRIILDKPTLRHLQYQI
                     IPHAEFITLAGKRYNCSLKRFANSISISVSSISTLNHESLLTAIKTKYPSLTDTTPRK
                     PKNRALQIRHHNNHHYTSDFKTIFHQCPR"
     gene            complement(<711719..>713254)
                     /locus_tag="CD36_52840"
                     /db_xref="GeneID:8048459"
     mRNA            complement(<711719..>713254)
                     /locus_tag="CD36_52840"
                     /product="high-affinity nicotinic acid transporter,
                     putative"
                     /transcript_id="XM_002420540.1"
                     /db_xref="GeneID:8048459"
     CDS             complement(711719..713254)
                     /locus_tag="CD36_52840"
                     /inference="similar to AA sequence:UniProt:P53322"
                     /inference="similar to AA sequence:UniProt:Q5AG44"
                     /note="Similar to S. cerevisiae TNA1; nicotinic acid
                     permease, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="high-affinity nicotinic acid transporter,
                     putative"
                     /protein_id="XP_002420585.1"
                     /db_xref="GeneID:8048459"
                     /db_xref="GOA:B9WHM2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WHM2"
                     /translation="MTTLEEEKHTTTDMSKDPEYVSSDDSFPEHNIDSKLDPETEVEQ
                     LAQELGINQKKLMWKIDLWVVPPFCLLYFLSFLDRVNISNANLYGLTTDLKLTGNQYN
                     TALTVFFVPYIVFEVLANYCIKFVKPHIWLSTLVLLFGGISIGMGFVQNFGGLIACRF
                     LIGVTEASTFPSIFYLLSTYYSKAESQRRFSAFFSCTALSGAASGAIAYRINDLNMVH
                     GLESWRWVFIIEGAITAGCAILLFFIIADFPEESRFLNSNERTFLKRKLEILAGTKSA
                     FEIKNTLKDVGKCFKDWLIWLPALSYFGLIIPSYGYAYFAATIIKQLGYTAVSAQQHS
                     VYPWVCAFGVINVVAFVSDRFKKRLPFAIGTCIMAIIGLAMILGATHSPNVRYAGCFL
                     TASGLYTAMPMVVCWAALNNGSHIRKSVGTAWQIGFGNIGGIIATFIFLAKDAPVYKP
                     GLATSIAGVCFSILCSIAYFFVCYRMNKIKHTDAYKQEFNAMPEREQINAGDRNPNFV
                     YLY"
     gene            <715233..>715910
                     /locus_tag="CD36_52860"
                     /db_xref="GeneID:8048460"
     mRNA            <715233..>715910
                     /locus_tag="CD36_52860"
                     /product="40S ribosomal protein S5"
                     /transcript_id="XM_002420541.1"
                     /db_xref="GeneID:8048460"
     CDS             715233..715910
                     /locus_tag="CD36_52860"
                     /inference="similar to AA sequence:UniProt:P26783"
                     /inference="similar to AA sequence:UniProt:Q5AG43"
                     /note="Similar to S. cerevisiae RPS5"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S5"
                     /protein_id="XP_002420586.1"
                     /db_xref="GeneID:8048460"
                     /db_xref="GOA:B9WHM3"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005716"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:B9WHM3"
                     /translation="MSDVEEQYQEEQQPVVQEELQVVELATAIPLDVQEAQREVKLFN
                     KWSFEDVEVKDVSLVDYIQIRNPVFVSHTAGKYASKRFRKAQCPIVERLTNSLMMNGR
                     NNGKKLKAVRIVKHALEIIHVLTEQNPIQVVVDAIVNSGAREDSTRIGSSGTVRRQAV
                     DVSPLRRVNQAIALLTIGAREASFRNIKTIAECLAEELINAAKGSSTSYAIKKKDELE
                     RVAKSNR"
     gene            complement(<716222..>718288)
                     /locus_tag="CD36_52870"
                     /db_xref="GeneID:8048461"
     mRNA            complement(<716222..>718288)
                     /locus_tag="CD36_52870"
                     /product="transporter of the Major Facilitator Superfamily
                     (MFS), putative"
                     /transcript_id="XM_002420542.1"
                     /db_xref="GeneID:8048461"
     CDS             complement(716222..718288)
                     /locus_tag="CD36_52870"
                     /inference="similar to AA sequence:UniProt:P53918"
                     /inference="similar to AA sequence:UniProt:Q5AGH8"
                     /note="Similar to S. cerevisiae ESBP6"
                     /codon_start=1
                     /transl_table=12
                     /product="transporter of the Major Facilitator Superfamily
                     (MFS), putative"
                     /protein_id="XP_002420587.1"
                     /db_xref="GeneID:8048461"
                     /db_xref="GOA:B9WHM4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:B9WHM4"
                     /translation="MAHTPEEAEEENGPTKSSISSDMSHDDDDDDDDGLEDVEEINTN
                     QVEEYQIHPIQSQQTTYSRLSRTRTNHSELSRIISGIKDDQQIDEQNKNNYKQTGDAE
                     YILTNEIDRVTTNIIDSRQHSTTDLESQRRHLHLQQQQQQQQELNENSKPSSRSSPIS
                     GDSQRDNLSINEEKKKDFVDDEDEDEEKEKDSDYKPDGGMAWIMAICAMMAMFSTWGA
                     NSGYGVFLNYYLESNTFPEATKYDYALIGGIVVFMANILSPLSALLYKMLGFKFVCCL
                     GIVFQTLGWICASFAKKIWHLYLTQGVSVGISFSLIFIPATLVLPTWFEKKKATSMGI
                     CVSGAGLGGLIFSLSVNKVIQDTGDQRWALRMVGFVTLFSTLLSALIMRPRNYKQPPL
                     KESLSKTFIIESIKAIFDVHVFKNRGIILIALWFSIALIGYILMLFTMSSYATSVGLS
                     HYQGSILTSVMNAAQMVGRPSMGLTADRIGRANFTTSACLVITILLYAFWINATTFGS
                     LIAFVVIVGLLIGVGSSLAQPLAADVLDPHMEQMPAAWSGINITVSFFCLVSEVIALA
                     LVVPGSKRPYLHTQIFAGACFFACFLLMILIREFLIKKQLTLRLEFTKNKLLEISGTT
                     KGGYLRCQDNEQHVKKDGEKEQEEEEEEEEEEESILIERVERYENLLNNTLTGFFIRA
                     LYPIKV"
     gene            <719944..>721257
                     /locus_tag="CD36_52880"
                     /db_xref="GeneID:8048462"
     mRNA            <719944..>721257
                     /locus_tag="CD36_52880"
                     /product="AAA ATPase involved in endosome to vacuole
                     transport, putative"
                     /transcript_id="XM_002420543.1"
                     /db_xref="GeneID:8048462"
     CDS             719944..721257
                     /locus_tag="CD36_52880"
                     /inference="similar to AA sequence:UniProt:P52917"
                     /inference="similar to AA sequence:UniProt:Q5AG40"
                     /note="Similar to S. cerevisiae VPS4;
                     In S. cerevisiae: required for efficient late endosome to
                     vacuole transport; vacuolar protein sorting-associated
                     protein, putative; vacuolar protein-targeting protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="AAA ATPase involved in endosome to vacuole
                     transport, putative"
                     /protein_id="XP_002420588.1"
                     /db_xref="GeneID:8048462"
                     /db_xref="GOA:B9WHM5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WHM5"
                     /translation="MSGASDFLSKGIDLVQKAIDADTATRYEEAYKLYYNGLDYLMLA
                     IKYEKNPKSKELVKSKFTEYLTRAEQLKDHLEKQAQNKSTAESSVNGSTKAKKSNSNG
                     DGDDNDDADTKKLRGALAGAILSEKPNVKWSDIAGLDGAKEALKEAVILPVKFPQLFV
                     GNRKPTSGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESERLVKQLF
                     TMARENKPSIIFIDEVDALCGPRGEGESEASRRIKTELLVQMNGVGNDSQGVLVLGAT
                     NIPWQLDAAVRRRFERRIYIALPDVEARTRMFEINIGEVPCECTPHDYRILAEMTDGY
                     SGHDIAVVVRDALMQPIRKIQQATHFKPVIDEIDGKEKLTPCSPGDEGAQEMNWMDLG
                     TDELKEPPLTIKDFIKAIKNNRPTVNEADIAQHVKFTEDFGQEGN"
     gene            complement(<721409..>722413)
                     /locus_tag="CD36_52890"
                     /db_xref="GeneID:8048463"
     mRNA            complement(<721409..>722413)
                     /locus_tag="CD36_52890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420544.1"
                     /db_xref="GeneID:8048463"
     CDS             complement(721409..722413)
                     /locus_tag="CD36_52890"
                     /inference="similar to AA sequence:UniProt:Q5AG39"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420589.1"
                     /db_xref="GeneID:8048463"
                     /db_xref="InterPro:IPR019416"
                     /db_xref="UniProtKB/TrEMBL:B9WHM6"
                     /translation="MMTEPEVAPYGGFLIKSLEDESENLKQLQQQSIEITTNQGTIEI
                     IRPEAIKIIGVDNLSTNDIQNYIDYYINYITTIINPETNELKYELIPFDQSIEFKIEW
                     IDDNSVNIVFQTINDCYKSFQKISESPILEKLGSQEYINQSIIERKGKSYNPIIDFKK
                     HQNLANRLKLANEATNNNNNNQIKVEDAGDMEEDEVFVELIIRQSFQSDRKIKNASQY
                     SRYYLIHGEPERRSRPRKHLDPQRRNKYPAGYRSRKNNNDNNIGDDQEDLFADKLKGE
                     RKSRSDNRNVNEDHNHGNDDGNDDYDDDLFADKLKQSKRDRSRSPMRIDNEDISYRQR
                     "
     gene            complement(<723065..>723545)
                     /locus_tag="CD36_52900"
                     /db_xref="GeneID:8048464"
     mRNA            complement(join(<723065..723451,723537..>723545))
                     /locus_tag="CD36_52900"
                     /product="small nuclear ribonucleoprotein, putative"
                     /transcript_id="XM_002420545.1"
                     /db_xref="GeneID:8048464"
     CDS             complement(join(723065..723451,723537..723545))
                     /locus_tag="CD36_52900"
                     /inference="similar to AA sequence:UniProt:P54999"
                     /note="Similar to S. cerevisiae SMX3;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="small nuclear ribonucleoprotein, putative"
                     /protein_id="XP_002420590.1"
                     /db_xref="GeneID:8048464"
                     /db_xref="GOA:B9WHM7"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:B9WHM7"
                     /translation="MSNFQPINPTPFLKSLIGKSIIVRLKWNKTQYKGILISIDNYMN
                     LQLDQTYEIISDDINTTKEELIGEIFIRCNNVLFIREYKEIEQQNQQTDSKPIENDDN
                     NNNNGNINEEENVEDEKVTNNEDIEIDKE"
     gene            <723874..>725331
                     /locus_tag="CD36_52910"
                     /db_xref="GeneID:8048465"
     mRNA            <723874..>725331
                     /locus_tag="CD36_52910"
                     /product="GPI transamidase subunit, putative"
                     /transcript_id="XM_002420546.1"
                     /db_xref="GeneID:8048465"
     CDS             723874..725331
                     /locus_tag="CD36_52910"
                     /inference="similar to AA sequence:UniProt:P41733"
                     /inference="similar to AA sequence:UniProt:Q5AGH5"
                     /note="Similar to S. cerevisiae GAB1;
                     In S. cerevisiae: involved in attachment of
                     glycosylphosphatidylinositol (GPI) anchors to proteins;
                     may have a role in recognition of the attachment signal or
                     of the lipid portion of GPI"
                     /codon_start=1
                     /transl_table=12
                     /product="GPI transamidase subunit, putative"
                     /protein_id="XP_002420591.1"
                     /db_xref="GeneID:8048465"
                     /db_xref="GOA:B9WHM8"
                     /db_xref="InterPro:IPR009600"
                     /db_xref="UniProtKB/TrEMBL:B9WHM8"
                     /translation="MDKSTIRVFIIGGLIRFLLPTIIFPQLTSILDSSILLSTPITSF
                     KSIQESIFYFFHNIELYNGGINHSPPILIILLSFLGNINELNMDNNLNKIGYDLLYTI
                     IDLIIAYKIIIINRWYNNYQQQKRQQKRNKKKEEEEVEVEEEEEELQKNSLGKFDDYL
                     IGCFYLFNPLIILTNLSHSSIIFSWYFIIESIIQIIQYENISRSMISLAIASYLSYSP
                     IYLLPSILALGHVIIRDKTNLQQQQQQQQQQPPKKNVKDLIMKLYVEGLAIFLICEIL
                     LIMISFIITASWEFLDNVYLTIILFKNPRPNIGLWWYIFIEMFENYSSFYLIVFNIYT
                     WIFILPFTIRFFQYKNNNNNKFFLPIGDSFLAIILCLCWISFIKPYPILGDLGLILSL
                     LPILNNTIIQYCKLKNIIGIILIIGLLLAPIFYYIWIVLGTGNANFFYSITLIWGSIH
                     GLILMDLIWTKLTLDYYIDNEIEIDMNDGISLAQI"
     gene            <730631..>731812
                     /locus_tag="CD36_52920"
                     /db_xref="GeneID:8048466"
     mRNA            <730631..>731812
                     /locus_tag="CD36_52920"
                     /product="sterol uptake protein, putative"
                     /transcript_id="XM_002420547.1"
                     /db_xref="GeneID:8048466"
     CDS             730631..731812
                     /locus_tag="CD36_52920"
                     /inference="similar to AA sequence:UniProt:P53032"
                     /inference="similar to AA sequence:UniProt:Q5AGH4"
                     /note="Similar to S. cerevisiae SUT1;
                     In S. cerevisiae: involved in induction of hypoxic gene
                     expression; transcription factor of the Zn[II]2Cys6 family
                     involved in sterol uptake, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="sterol uptake protein, putative"
                     /protein_id="XP_002420592.1"
                     /db_xref="GeneID:8048466"
                     /db_xref="GOA:B9WHM9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:B9WHM9"
                     /translation="MSDLLSYSIMNNNTTTTTSTNNKYHSNHTKTVLPPISSITNQLP
                     PLGSIITSPIRPSTINNNSNINLPTLNQYYDRSYTTTTSTTTTNNGLTTPSPPPLKYS
                     YSNNNLTEANLSKFETSRNCHGLGLLSSAVLYQQQNNCSTSSSSSSSSPNGLTLVTPP
                     PSLTSRTSSISSISTPSSPHINDISITKTSTITPTTSKTSKTSTIIPTSKNQCQVPTK
                     RRQRLGPSCDSCRIRKVKCDAEIQIINEETIINEYCLQVDEINEIKSGKKKLLLSSSS
                     STTTSSTSSNCLENGGTTTTTNNNNKAIKIELIYSHGKFIKFKSCQNCIYKLNVDCCF
                     KNGYTKEDILHNKKLKIFHPVTTTNTNTNTTTINSNSNSNSNSGGGGGSKRIMKKKLQ
                     K"
     mobile_element  732978..733184
                     /mobile_element_type="retrotransposon:solo LTR, phi K"
     gene            complement(<733368..>739868)
                     /locus_tag="CD36_52930"
                     /db_xref="GeneID:8048467"
     mRNA            complement(<733368..>739868)
                     /locus_tag="CD36_52930"
                     /product="COPII coat assembly protein, putative"
                     /transcript_id="XM_002420548.1"
                     /db_xref="GeneID:8048467"
     CDS             complement(733368..739868)
                     /locus_tag="CD36_52930"
                     /inference="similar to AA sequence:UniProt:P48415"
                     /inference="similar to AA sequence:UniProt:Q5AGH1"
                     /note="Similar to S. cerevisiae SEC16;
                     In S. cerevisiae: required for ER transport vesicle
                     budding and autophagosome formation"
                     /codon_start=1
                     /transl_table=12
                     /product="COPII coat assembly protein, putative"
                     /protein_id="XP_002420593.1"
                     /db_xref="GeneID:8048467"
                     /db_xref="InterPro:IPR024340"
                     /db_xref="UniProtKB/TrEMBL:B9WHN0"
                     /translation="MSESSNENILESQESASQVTNDKTVTNDSHDLFGDDDQNTSNQQ
                     DDFFSNIQHPDQPDQPDQPDQPVIVTDDGVETVHKPNEEESPQEIPLEQEQISSQQPQ
                     QENVIDDLFGSSTHDDDFFSNHNQDGLNSVEIKSEENIEVPVEPVSEQRQDLQPQTAT
                     IPIDSKEEDPVVESLTNETDVIHHDQESTNKAVGISSESELTEEKSIVEKEQSIVEDI
                     PGVANQSPGAKTLPTEQINHIDESEATAPNAEQSHNSSKLDQLFTESNEGDFFESISK
                     DNLEQNASETNQKLEDLFVGSANKDGEDLGFLQQSQPHVTDAKSNDPISEAVVATGSA
                     NLDLFGDDDTNFLEELNPKEHQQQEEVKLSSATTVNAEDKLAALDLDDDLLLDDDFLE
                     EGSAPPKVESSLPETKPIKHHYSYIPSSHSTNQKSVYAPPQVSGVDKNEFIKNLEQSK
                     KKHDAYDFPDTLLVNKSRPAARHAPSSNKYGPASVSQTSIPSISSTSTLPPARDIKPS
                     SSAPAAPTGAPPTSASILKVTKKSFFEDFPDEEEIPKPKRAGRAAAPVKAVNQIHSPQ
                     VLNQQVQQQKQQQQQSQQNTAPPPPSKTNKQPPVNPYMPKSGTSPILQQQTPVVHKSG
                     IAAPNVNVPNSNAYAPQLNSFAFPPHQPNQKTNDYSPQLQSSAAAAAAPPPPTSLQPF
                     PLIGQSQSAPVHHNRQPSNSINTNVNKVPSINSPYVPNAGPYAPSTHHRSHSRASSLV
                     GGKGKEINPYAPALETVASGDIGQQQQQHQQQQQQQQQQQHLSPATAVLPPARARGFS
                     NSKSNIYKSAPKVVNPEQLVFRQYPIFSFSINSNCSMIIPNTGYNQGTSINIGPISNL
                     LKDKDIYATFPGPLSKNKTKKKDVEKWLESSSGYLRSLGKNDEFILNDILLQLIKYDG
                     DVKNKEFLRSACSILNPNVNFDVNNFPTSGLTIGATNAHKLDNSGVNTVFTLIQSGNL
                     EKALEYCVSRGDWALALIISGPENFSKIAAEYARNTFPFAKTNNKVLHIMPIILKVLG
                     GNVSSVIEDLTAVVNEGEYANLHWREIISTIAICGSLKAIEFLIEFGKFLNKQGNFIG
                     SEIAYIMAGLPFGHQNFMVLASGHNSMYTEVYEYALNLHKTMHFPHLLSLKLKHALTL
                     ADYGLINESQKYIDHINSSIKTLGNKSPFVTPNLLHEFQNLIMRITEAGSGDDQNNWF
                     SGKISRVNLDKIWGQIDKFIVGGDESKNGNNNDGNTSGNASGSVFNKFSPSVSRNASS
                     VNLHNYSQPSMIRQPLHAPYQPQPLSQLQQPQQQQQLLDQVYIERKPTTGFTPQPPPL
                     VGHPSTTSVNKYSPSVKSSPRQAQQNKFEKYAPSTNSSHHNLSLVEERTSAVTSADGP
                     EHPPNHSNHQQSINASAIPVPLPFPPPTPTPTPPVGVTRHTSRSPRNHHQSHQPSALP
                     PQHPQHVQPVRDRSPLATRVYPYSNSVGGQFSTTSIGSIPSQIPLGGQTQTQTQTQTH
                     GKQPSISSVISGDSIAAIGLGEQENVLPPSTGQIGQTGQAGQTGSSQVNKNEESYEFG
                     DDHHYGHHDQPETIKESPELRGLQQSSTNEAPITKDITDDVVELNNPMVSETSHSPEK
                     ETDKSSSIVPIAPPRKSKSSRSNPYAPTTDNEAINDTKSSTVLTPGVDKLNVKKSKSG
                     SRTRTRTNKYGPPSEVNNNQSTIDISPPSVTNNVGNEDSIDMFSYGGYQNDSNPQMKQ
                     SSQSSEFNQSVGTSVNIPPPLQPQLAVPERVPTKNITNIDDSFDESSLVADTSINYTT
                     TNNNNNNNNNDSSSSSMINKPYGHTNIGSGSVNSTPLILNQGNTNMKLSNISTISVSG
                     TAPGTSGAFDGFPIPGSPDETTRPNSIFGGHSRGLFSSRLSESQSVLYQQYAIVDDTV
                     GDYVPIMEEDEDEENEEVKQQQKQKQKEKEQELRRKQEQEQQQKAMAKNNNNSSGSGG
                     GGSGGGKFFNLFGGGGGIGGKNNKKQDNDTKVYKAHLGQKNTFVYDEKLKRWIDKSKP
                     LEEQLQANLPPPPPPSMKKKPNPVGNNNGNNNGNGGPPPPPPPPMVTPNSTPTPGGND
                     SSTIATGGLSTPIPASAPPSRMSNNSKPTPINRPKSSLATVSGLDDLLSLTEDNIPNG
                     RLGAKGAGGGSGTTGGGSRRNKPKRRGYVNVMEK"
     gene            <743865..>745787
                     /locus_tag="CD36_52940"
                     /db_xref="GeneID:8048468"
     mRNA            <743865..>745787
                     /locus_tag="CD36_52940"
                     /product="serine/threonine-protein kinase, putative"
                     /transcript_id="XM_002420549.1"
                     /db_xref="GeneID:8048468"
     CDS             743865..745787
                     /locus_tag="CD36_52940"
                     /EC_number="2.7.11.1"
                     /inference="similar to AA sequence:UniProt:P28708"
                     /inference="similar to AA sequence:UniProt:Q5AG32"
                     /note="Similar to S. cerevisiae PRR1;
                     In S. cerevisiae: inhibits pheromone induced signalling
                     downstream of MAPK, possibly at the level of the Ste12p
                     transcription factor"
                     /codon_start=1
                     /transl_table=12
                     /product="serine/threonine-protein kinase, putative"
                     /protein_id="XP_002420594.1"
                     /db_xref="GeneID:8048468"
                     /db_xref="GOA:B9WHN1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:B9WHN1"
                     /translation="MTTKSRNQPLSLNTNQSSTGAGTGANSIPPGTAITDNNQSFLLP
                     GLASPPTISNSPIFQNPAPHSNRKMDLSIEVPSHQFETNEQTTTPIDINMNMLKYYEI
                     LQLPTPIFNTGSFANYNQPLSSLSSNSSNASISMSPPAFRSISRVCSLKQPKRYVSEP
                     IPISSSTSENKVTTSPITPSSSPPTLQQEEIAKKEKQKTFYSKRLGLSFNFVEEIGKG
                     NFSHVVLAKTNIYHNDSNGNSVSNNNHNQDVVDLAVAVKIISVPMESKQQVHNFKSFI
                     RRELNILYHISHHPCITSLIDYEISLDIPIEQIESDVIIDDDEIYQKNSPQNLSMQPH
                     SDIDKSSSPDQFIFMNYCNGGNLLHFLQKNNSKHHYLHHHHHHHHHHNHQQDHHDTIH
                     YWQFLKRIVCELIATTAFLHKNLVIHRDLKLENILLLHDFESLVSLSSSVSFDELLMS
                     NAISNLSDFGLSKKLSTQDQLLSTRCGSQDYIAPEILMGLKYNGKLTDTWSIGVIIYS
                     ILENRLPFDIPPPPPSSSATPHYNSSTSPNKGSPTVIKRRRSKTNSTAYRIAMIDWEW
                     SKLDNANIEHYQESVKDNGNDTIPTEVLTIWKQLKSVVDTVLFRKEKRINVEQMLQLD
                     EFKWITDCLPDFIVNV"
     gene            <746819..>750643
                     /locus_tag="CD36_52950"
                     /db_xref="GeneID:8048469"
     mRNA            <746819..>750643
                     /locus_tag="CD36_52950"
                     /product="subunit of the RNA polymerase II mediator
                     complex, putative"
                     /transcript_id="XM_002420550.1"
                     /db_xref="GeneID:8048469"
     CDS             746819..750643
                     /locus_tag="CD36_52950"
                     /inference="similar to AA sequence:UniProt:P19263"
                     /inference="similar to AA sequence:UniProt:Q5AGG6"
                     /note="Similar to S. cerevisiae RGR1;
                     In S. cerevisiae: associates with core polymerase subunits
                     to form the RNA polymerase II holoenzyme; required for
                     glucose repression, HO repression, RME1 repression and
                     sporulation"
                     /codon_start=1
                     /transl_table=12
                     /product="subunit of the RNA polymerase II mediator
                     complex, putative"
                     /protein_id="XP_002420595.1"
                     /db_xref="GeneID:8048469"
                     /db_xref="GOA:B9WHN2"
                     /db_xref="InterPro:IPR013947"
                     /db_xref="UniProtKB/TrEMBL:B9WHN2"
                     /translation="MNTQDQSSMPNGKQQHEVAELSSPPEIPHITANMIPLSNIIKYY
                     TQEAYKQLTTAIENLSMNVNEESDIKRKKYFLNVIINLRQDFIKVYTLIKWASISKDV
                     SKFIDLLNWFRMQEFHFENLLFQLNALTGYNAAKLPNSDIVTALEVLYHGRPKLPSYN
                     YIKSDNLSPQKILETLNDLNLVLMTRFALMDNIPKRFDYEIKDGRAYIRVSNEFEVSI
                     TVGNDLIVENPEEYYKSPFYFIDFKFLFGANPESGLITFNDDKISTKLPTSSHKKLEK
                     IVNQTLLTRGLQGLYELLHKYSNSFKIYLLAKQFQTLLINSRWRGNFQINYQTNKSLI
                     VINYWSQHYLSRNWKSFIELGIDSNSNLNYRWFKNGEYCFGDQGNNELDKIFHLQRRN
                     SNNGLTGSASININGSMIATMGRSAELSNEIATVDDNGNDNDDTTTNNGDTENEDLNV
                     DLILNVVVNQHAKSIMSAIYSQLLTRFSETDVSMVSPHQLLLQISPKKSTVFAINPLT
                     GFFYFIDPTPIQTYITKKVNLPPPSQVSNKQLFIPESNMVSYVIDQIIQLRLEVFNKE
                     VNTKLATTAWINNGIIKLNDHELSKLTQFLIQNDESNNDEDDISGTRLDSVLQSFKLQ
                     FYRRKNWPSSWFLINMISGVTTKSFWWVARIKSINGDWKIQWAQIIKFHGENNAKQEL
                     PPNEGKIFVKPRRTVDCSIDSEQLNYEFFKTLSTLSSNLILDHMILEELQVRNIRFIK
                     LDWETIDDNKIFSRFKQNHDISLKRKSSSNINIDVNVDIADSSNSTTNGKHIRGPKLK
                     YESMFLIYNDKLLPIYNSATILFLKIELVESNKMYLKLFGNLRNLQIKNSSEDIHKLH
                     LNIDEANQYFEIDNTVDLSTVINEPKTLLLNLIFNTLNKLNSLIKILDQLNKSNVEVL
                     DNSMDNITIKIKDSYNDNNDKLIVIKLPEQATDPIQLLMKNTTTDKIDLKKNNILEFE
                     SILKFLNEYLQESKSKNNSHHQISIIKIIQYLTEINPILQSTKLINEQLAELKRKNNN
                     NNNNDNDKSNKSNIGKLSNGLYKLYFNLNIISLTHLQLIFFMNSNIVSNSKKIQKDKI
                     LINLNLIKFNRFSQPNGNLNDDNNTNSNCHLIRISFKNSLIKENLKFKKLFEIIFKNI
                     NELLITKSKQIKSLHQTNNKQQSQQSQQQGNNENTIVKKESQSIEDDLLDFGEYDNDN
                     KSQQQQQQQNEKDQLSNNEKENTKENKTVRPDDVLIKLNYDYLLSMNNLPLLINQITK
                     SFIQYLQQQQQE"
     gene            complement(<750777..>753173)
                     /locus_tag="CD36_52960"
                     /db_xref="GeneID:8048470"
     mRNA            complement(<750777..>753173)
                     /locus_tag="CD36_52960"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420551.1"
                     /db_xref="GeneID:8048470"
     CDS             complement(750777..753173)
                     /locus_tag="CD36_52960"
                     /inference="similar to AA sequence:UniProt:Q5AG30"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420596.1"
                     /db_xref="GeneID:8048470"
                     /db_xref="UniProtKB/TrEMBL:B9WHN3"
                     /translation="MSSFKTNKIISKPNLQPVNSPTTSEQSPATTIDQHAQMDRIPTS
                     ESFLPPSNLTDIESFDQNHDVSPKSRRTESSSIYEDPGDSTYQYLQQQSPQQPPSVIS
                     KNSSSEAIPVSIKLSQLPNNSSSSLFINNRTRQPNSPSVNSQRGNSKSPSKSSHFSSK
                     DEPIIENLKPSLESSSASTHSLESPITPLVRKTKSSSQSIQQQQQQQKTPSSSMVSPG
                     FLIMQQESSHSPHQPSPALSHSSVSTFGHKKRESMLSTYSGAVEYDAVPMTVKRSSSS
                     KIKYVGNASQMNANNNYNNMVSSRTHHRKKSSLSSTTSNKYSDHNTVSDTKSVETSQL
                     LAGDSSNSNNSKHNRSYFDDDDDEEEDDSSILMGKLPTRSSKEDELKAQQPDKTVTTN
                     IEGSIPARSPRRPASVMSPNFSSIDMINSSSISNNTTGSKDQSRRKSYVEDNKRRSIQ
                     INDGLEKLMLDATSFTSQDENDEGKQEGEEKVEHDNTKFIKDVTPNHLNIHRKNGTDE
                     YNEDDDITPKFDPALMTGLHDGVDIDELDNNVPISSRNSSYESWSRHESKRKSPIKPL
                     NLPPRPTKDNITKARTISNNLQQQHLREQYETPDGNPDNININEGEEIMPSKNNLVDD
                     EEYEQRGTTNNHIDDNDDDDDDGFYDITGEPVTVQPPLVRARSVKNSIKRPGRHTKSS
                     KDNQISGDTERHHNSKKHRGRGSGGGGNKKHHSQRGKNGLKPFSYTTLISLLESMNGT
                     IIGEEFNQLNIPIKEKQLIEKIIDSLSRLTSDMILDQQRYEIGIDRLEKCLRVLEGFM
                     "
     mobile_element  755194..755664
                     /mobile_element_type="retrotransposon:solo LTR, zeta A"
     repeat_region   759101..782819
                     /note="core RPS block consists of five complete RPS units
                     of 2106bp each, plus one partial RPS unit of 1535bp;
                     orientation = sense"
                     /rpt_family="MRS, major repeat sequence"
     repeat_region   759101..765685
                     /note="HOK region"
                     /rpt_family="MRS, major repeat sequence"
     gene            complement(763532..763833)
                     /locus_tag="CD36_52970"
                     /pseudo
                     /db_xref="GeneID:8048471"
     misc_feature    complement(763532..763833)
                     /locus_tag="CD36_52970"
                     /inference="similar to AA sequence:UniProt:A5DSZ4"
                     /note="fragment pseudogene;
                     incomplete ORF"
                     /pseudo
                     /db_xref="GeneID:8048471"
     repeat_region   765686..777750
                     /note="RPS (RePeat Sequence) domain; last RPS unit is
                     partial"
                     /rpt_family="MRS, major repeat sequence"
                     /rpt_type=TANDEM
                     /rpt_unit_range=765686..767791
     repeat_region   777751..782819
                     /note="RB2 region"
                     /rpt_family="MRS, major repeat sequence"
     gene            780040..781127
                     /locus_tag="CD36_52975"
                     /pseudo
                     /db_xref="GeneID:8048472"
     misc_feature    780040..781127
                     /locus_tag="CD36_52975"
                     /inference="similar to AA sequence:UniProt:Q59L28"
                     /inference="similar to AA sequence:UniProt:Q8TGW0"
                     /note="incomplete ORF"
                     /pseudo
                     /db_xref="GeneID:8048472"
                     /db_xref="PSEUDO:CAX41677.1"
     gene            <784410..>785531
                     /locus_tag="CD36_52990"
                     /db_xref="GeneID:8048473"
     mRNA            <784410..>785531
                     /locus_tag="CD36_52990"
                     /product="cell cycle arrest protein, putative"
                     /transcript_id="XM_002420552.1"
                     /db_xref="GeneID:8048473"
     CDS             784410..785531
                     /locus_tag="CD36_52990"
                     /inference="similar to AA sequence:UniProt:P26449"
                     /inference="similar to AA sequence:UniProt:Q59QR8"
                     /note="Similar to S. cerevisiae BUB3;
                     In S. cerevisiae: localizes to kinetochores during
                     prophase and metaphase, delays anaphase in the presence of
                     unattached kinetochores; kinetochore checkpoint WD40
                     repeat protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cell cycle arrest protein, putative"
                     /protein_id="XP_002420597.1"
                     /db_xref="GeneID:8048473"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:B9WHN5"
                     /translation="MTTSFVELQAPKNLDIISDVCFMDNTDQHRLLVSNWNSEILLFS
                     CDSLLHEHQPPHLQPINTFTTPDIPLCLLYDNKQNISPLVGLLDGSIRELDFENGKLG
                     DNIGDAVDDNDEIDSGINNLKNVTINGQNSNTIVASSFNGKFQLIDTRQSQRQQQKLS
                     PQIFHNQRKIFTMDTSDQYLILGLQNNIIEIYDFKNLHHPLETRQVGLKYQIKDLKTF
                     PDNQGFALSTIDGRVSMEYFNSDPQFQLQNRFTFKCHRHPDPNPESTGDLVYPVNSLE
                     FNHKYGTLFTAGSDGYVCLWDCKKRKRMRQYPRFLSAENEPESIVKLKINRQDNLMVV
                     ATSDDNYKRRRRLSESENSKTPSRVYVKQLAENECKPKS"
     gene            <787278..>788906
                     /locus_tag="CD36_53000"
                     /db_xref="GeneID:8048474"
     mRNA            <787278..>788906
                     /locus_tag="CD36_53000"
                     /product="SET domain-containing protein, putative"
                     /transcript_id="XM_002420553.1"
                     /db_xref="GeneID:8048474"
     CDS             787278..788906
                     /locus_tag="CD36_53000"
                     /inference="similar to AA sequence:UniProt:Q12504"
                     /inference="similar to AA sequence:UniProt:Q59QR9"
                     /note="Similar to S. cerevisiae SET7; RMS1; lysine
                     methyltransferase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="SET domain-containing protein, putative"
                     /protein_id="XP_002420598.1"
                     /db_xref="GeneID:8048474"
                     /db_xref="GOA:B9WHN6"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR011383"
                     /db_xref="UniProtKB/TrEMBL:B9WHN6"
                     /translation="MDEFNKKSKLFQDWLIKNNVEISPKIAIHDYRDTNQGRGIIALQ
                     NINPDEMIFKLPRSIVLNIDNNSLIKQYPSALKKLRLLDQWIGLIIVLSFEMKFKFNP
                     SDNDDNNNSFWYEYLNILPNDFNQLIYWNDEELNHLQPSCILDRIGKENNLNMYNQII
                     SIINQDLSIIEEFKSSPLTFEEYNKVATIIMSYSFDVEVPKSKPNKEMTENGTNEEDD
                     EDDYEEEEDHEYYKSMVPFADTLNADTHLNNAILIYSTDQLIMTCIKVIAKGEQVYNT
                     YSDHPNSELLRRYGYVELNGSKYDFGEIPLSIIKTVFIDQFNNSSTNQNSTNSNSFMT
                     NQKFDELLEFINKLQIKKSIEQDGLDEDETEELILDSYDCFNSGDVIIELIFLIQILS
                     TILVIYQDEQQQQNQEKDTSKTKGFEIDQLLINRIFNKIYQLIESKKITTKCFEIYQY
                     IINARMNQYPDVAKKPFNDNAGTNSEDKTINSIRIDMAEVVLKSEYQSLEKCTSLIKD
                     FKIINDSKLNKNILKKRNNDTNSVDVANNKKSKH"
     gene            complement(789097..791245)
                     /locus_tag="CD36_53010"
                     /pseudo
                     /db_xref="GeneID:8048475"
     misc_feature    complement(789097..791245)
                     /locus_tag="CD36_53010"
                     /inference="similar to AA sequence:UniProt:Q5A5E2"
                     /note="in-frame stop codons; frameshift;
                     Similar to C. albicans LPF34"
                     /pseudo
                     /db_xref="GeneID:8048475"
     mobile_element  complement(791314..791496)
                     /mobile_element_type="retrotransposon:solo LTR, kappa J,
                     partial"
     mobile_element  791498..791800
                     /mobile_element_type="retrotransposon:solo LTR, vau H"
     mobile_element  791806..791939
                     /mobile_element_type="retrotransposon:solo LTR, tara D,
                     truncated"
     gene            complement(<792220..>795522)
                     /locus_tag="CD36_53040"
                     /db_xref="GeneID:8048476"
     mRNA            complement(<792220..>795522)
                     /locus_tag="CD36_53040"
                     /product="transient receptor potential (TRP) ion channel,
                     putative"
                     /transcript_id="XM_002420554.1"
                     /db_xref="GeneID:8048476"
     CDS             complement(792220..795522)
                     /locus_tag="CD36_53040"
                     /inference="similar to AA sequence:UniProt:Q4WAK3"
                     /inference="similar to AA sequence:UniProt:Q59QS0"
                     /note="this class of proteins are essential for cellular
                     viability and are involved in cell growth and cell wall
                     synthesis; homologous to polycystic kidney disease related
                     ion channel genes;
                     no apparent orthologue in S. cerevisiae"
                     /codon_start=1
                     /transl_table=12
                     /product="transient receptor potential (TRP) ion channel,
                     putative"
                     /protein_id="XP_002420599.1"
                     /db_xref="GeneID:8048476"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="UniProtKB/TrEMBL:B9WHN7"
                     /translation="MHTSGSGISLLLLLLLLLTCFIQPTYSTFVGNQHCNLNITNYKL
                     RPFVIDVALDNKDKKLKFFMNSQVANFAQNSTNDDPSIIINDVNTTTNKYTTLHVEIG
                     FMDKVIVKENVRFCDMIAVKNTTAFQSSPRFIHDTSSSNSSHNFTTISNKNKNYHSFE
                     TLSSKLTTANNLDDGLISKSPLSFPGHIFNNSLAATNTTIDRIFSNSTGQLVQCPLYY
                     NDSIVLYYEVDVNDHFHKLGSYSVQFNVISNEEDSKIIGCSKAYVTPVQPRVISNVVA
                     YGVLVLLIVTLVLNVVTIAYSTYQESSNPFLFKASAICNQELLKQIDTSLPGIITYLQ
                     YALFMGGLDLAYPGFFQPIIGQIKWCALVGFSLVFKNANHSHNHVDNVYATLESGGLP
                     NLTRYISSDLIINNWANFIVTLIVVIAIHVVSNQLFIMSKLLLDKIELGNFRSKKFFM
                     KGGDFNGFSIFSKKNLYLIIGQVLHLFLLVFAMPFLVLSSFQFLAASDILGKRRYGTN
                     YEQLRKDAYSMIVPYNELSIPSSIFAFATKMGDGSQYSSTKYPPIFDSGHLSDEAERF
                     RRSYESPQSSQDRMSLFANGNATLFHSTYHNANYTQKVDASFMRISEPCLVFSGILFA
                     LWVILCLYFAFHYLISIKRYFRVKQSSNISRLYTSLRTILIWGYLYVEYRPERVEYVL
                     YEFFTMFFKSMVIGLLQRHGIAQVVCLTLISILDLIILFIIHPHYVKISWWSSKFMFP
                     IARFLTAILCIAFIRDLEINVTSKIYVAYTQLLIHAIVGILFCIQLIYWFTRTMISIF
                     RNLKNDHMNNGDVNQSLAVYDSLDDFQRQFEYKPLQPLPTYQIYSAATTTLLSPIDQM
                     EDPFIYAESSSSCIVKQTGASNKMIPGKATYDKNDKDEMEQLEEEEYLDSDYYYRSKS
                     EQVLKNIVDHELETRSSNNSDVTSFEQQQYESNMRKLKNDYKVREGDYIYRKYFTDDL
                     IDPEVKELWENRKNNTNKVVIEKAEQHQKHKGPQVYHGQGTHDPSHSSNSMIDKLKHA
                     FHNNTNRRHPRKTGATQDAVELQRFVVNRPKKLVVKTVDQIRQEQQQKRKEQDDLLSN
                     NSTESSSTSHLI"
     gene            <796518..>797447
                     /locus_tag="CD36_53050"
                     /db_xref="GeneID:8048477"
     mRNA            <796518..>797447
                     /locus_tag="CD36_53050"
                     /product="proteasome regulatory subunit, putative"
                     /transcript_id="XM_002420555.1"
                     /db_xref="GeneID:8048477"
     CDS             796518..797447
                     /locus_tag="CD36_53050"
                     /inference="similar to AA sequence:UniProt:P43588"
                     /inference="similar to AA sequence:UniProt:Q59ZS7"
                     /note="Similar to S. cerevisiae RPN11;
                     no apparent positional orthologue at this locus on C.
                     albicans chromosome 5"
                     /codon_start=1
                     /transl_table=12
                     /product="proteasome regulatory subunit, putative"
                     /protein_id="XP_002420600.1"
                     /db_xref="GeneID:8048477"
                     /db_xref="GOA:B9WHN8"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:B9WHN8"
                     /translation="MERLQRLLGQGAGAVPTQSDGPAIDNSETVYISSLALLKMLKHG
                     RAGVPMEVMGLMLGEFVDEFTIHVHDVFAMPQSGTGVSVEAVDDVFQTKMMDMLRQTG
                     RDQMVVGWYHSHPGFGCWLSSVDVNTQQSFEQLNKRAVAVVIDPIQSVKGKVVIDAFR
                     TIDTTTLMMGQEPRQSTSNVGHLNKPSIQALIHGLNRHYYSLNIDYHKTEYETNMLLN
                     LHKKNWQSGLKLVDYNCKEVENLDNTEKMVGIAKLYNQRVQEEKDLSEEQLKTRYVGK
                     QDPKKHLGDTAEKLIDENVSSLLKGCVDVVAIQ"
     gene            <798404..>799048
                     /locus_tag="CD36_53060"
                     /db_xref="GeneID:8048478"
     mRNA            <798404..>799048
                     /locus_tag="CD36_53060"
                     /product="translation elongation factor, putative"
                     /transcript_id="XM_002420556.1"
                     /db_xref="GeneID:8048478"
     CDS             798404..799048
                     /locus_tag="CD36_53060"
                     /inference="similar to AA sequence:UniProt:P29547"
                     /inference="similar to AA sequence:UniProt:P36008"
                     /inference="similar to AA sequence:UniProt:Q59QS1"
                     /note="Similar to S. cerevisiae CAM1"
                     /codon_start=1
                     /transl_table=12
                     /product="translation elongation factor, putative"
                     /protein_id="XP_002420601.1"
                     /db_xref="GeneID:8048478"
                     /db_xref="GOA:B9WHN9"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:B9WHN9"
                     /translation="MSQGILYVLKFSPRSTVLTDLIKYYKLDIEISTDTESDSFIKQF
                     PLRKTPTFIGNDGFQLTETIAIGIYFLSMIPIHNLLGDNDQEYASIIRFLSMLNQEGA
                     MSWAGAFFRLSGRLPYNKEIIDEHLIMLNTIGQILDTRFIDGSDYLVGDKISYADLYG
                     VKLFGIALYTLLGEPFLKKYPNFAKWFKRASNHEFFRGQYKDIKFPEQQLTYPG"
     gene            <799519..>800760
                     /locus_tag="CD36_53070"
                     /db_xref="GeneID:8048479"
     mRNA            <799519..>800760
                     /locus_tag="CD36_53070"
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /transcript_id="XM_002420557.1"
                     /db_xref="GeneID:8048479"
     CDS             799519..800760
                     /locus_tag="CD36_53070"
                     /inference="similar to AA sequence:UniProt:P29547"
                     /inference="similar to AA sequence:UniProt:P36008"
                     /inference="similar to AA sequence:UniProt:Q59QS2"
                     /note="Similar to S. cerevisiae TEF4"
                     /codon_start=1
                     /transl_table=12
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /protein_id="XP_002420602.1"
                     /db_xref="GeneID:8048479"
                     /db_xref="GOA:B9WHP0"
                     /db_xref="InterPro:IPR001662"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:B9WHP0"
                     /translation="MSQGTLYIMEVSPRSSILVDLIKYFKLDIEINADTQSESFIKKF
                     PLGKTPAFVGAKGFKLTETIAIANYILSLIPNQKLLGKNNQEYASIIKYVSLLNQEGI
                     NSWVGAFFKLNGRFPYNKKEVDENLKTFNIIGEVLEKRLNDFTYLVGERISYADLFAV
                     KVVISAVATVFGKPFLTKYPNVARWIKTISQNEIFQGQFKDLKFPEQQLAFIPPKKEK
                     KKDAAPKKDAAAPKKKEATPAAASEEPAPAPKPKHPLEALGKPKNPLDEWKRTYSNEE
                     TREVAIPWFWKNQYDPEEWSLWKVDYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFG
                     CMVVYGENNNNGITGAFLVRGQDYVPAFDVAPDWESYEFTKLDGSNEDDKKFINNMFA
                     WDEPVVVNGEKREIADGKVFK"
     gene            complement(<800968..>801255)
                     /locus_tag="CD36_53080"
                     /db_xref="GeneID:8048480"
     mRNA            complement(<800968..>801255)
                     /locus_tag="CD36_53080"
                     /product="mitochondrial 37S ribosomal protein YmS-T"
                     /transcript_id="XM_002420558.1"
                     /db_xref="GeneID:8048480"
     CDS             complement(800968..801255)
                     /locus_tag="CD36_53080"
                     /inference="similar to AA sequence:UniProt:O75012"
                     /note="Similar to S. cerevisiae MRP10"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 37S ribosomal protein YmS-T"
                     /protein_id="XP_002420603.1"
                     /db_xref="GeneID:8048480"
                     /db_xref="GOA:B9WHP1"
                     /db_xref="InterPro:IPR017264"
                     /db_xref="UniProtKB/TrEMBL:B9WHP1"
                     /translation="MPFKKVGPPPKNLPPLPRLKVRKPVIGKSTNQCFVFMSSLLNCW
                     ASNGEGNQICNGFENDLKNCMETFKPQQESLSTINYHAQRLYPKLRGKVHD"
     gene            complement(<801692..>803887)
                     /locus_tag="CD36_53090"
                     /db_xref="GeneID:8048481"
     mRNA            complement(<801692..>803887)
                     /locus_tag="CD36_53090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420559.1"
                     /db_xref="GeneID:8048481"
     CDS             complement(801692..803887)
                     /locus_tag="CD36_53090"
                     /inference="similar to AA sequence:UniProt:Q59QU5"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420604.1"
                     /db_xref="GeneID:8048481"
                     /db_xref="UniProtKB/TrEMBL:B9WHP2"
                     /translation="MYLLRSSTRNLLRHSYCLGHYRINQRSFHQSTTLLKDEKTKELL
                     KNLGLNLQKGTINRSNKTKDNKTNSSSIKDEKINDTENEKDESVTRITENDNEEDKTD
                     NQLVTTTTTTTTTDIPPDQQEVELKSTIPNDANTKTNSHGNNGQTDSNGVNNNNKKKN
                     SEPIKNKKSGKNKPTTTTTNDENIIHEQLKNAFVTVALMTNKEFLEQIALDGRNFPFK
                     HFKSEYLIDRQEILRQIPDMINIFNMKDMEKVEEIYQQLSQLDNDKSMHLQFLKQSFI
                     DYKNDLLYLDQFLRGINSKFKQYRRGEVRYFFVYPTVFEHVHDKILHQYNVVGYDRSL
                     FGMPLHQQQQKNKDRLVLPREFIQDLPQFDNIIELNKIDAALGFKLVEEKQSGKLVDS
                     LWDPRMVKPLKELQKEYQERFNEQKKNQTSKQQKQQPLKSKGKFDGKTPKKYIVIKKG
                     GYRQIKLKETSLQYSPVIRRIEEEIEMMINDLNKQIKTTLESDNIKVLIPNDNDKQMV
                     SNFASSPSKIKTNHHEIVFKEKMYQGYIVSVERIISKNFNILPNYAVFYHGTNYPPII
                     KRKLLNHIFKIFLININEKFDYLQKIKYLTQRQQLEFQRKLIKQIKYIIKFKLSRYFD
                     NNTLNQTTNSLRLNNWNVFNHEENNSYDNNNQSNEGKSCRDNANNDDDGVHAVIFNPY
                     TDNCFKRIYWISSPFPSSIMKRQNMNLKRKFTKIKFKTIDERYITTTIA"
     gene            complement(<805193..>806290)
                     /locus_tag="CD36_53100"
                     /db_xref="GeneID:8048482"
     mRNA            complement(<805193..>806290)
                     /locus_tag="CD36_53100"
                     /product="G1/S-specific cyclin, putative"
                     /transcript_id="XM_002420560.1"
                     /db_xref="GeneID:8048482"
     CDS             complement(805193..806290)
                     /locus_tag="CD36_53100"
                     /inference="similar to AA sequence:UniProt:P24867"
                     /inference="similar to AA sequence:UniProt:Q59QU7"
                     /note="Similar to S. cerevisiae PCL1;
                     In S. cerevisiae: Pho85 cyclin of the Pcl1,2-like
                     subfamily, involved in entry into the mitotic cell cycle
                     and regulation of morphogenesis, localizes to sites of
                     polarized cell growth; cyclin, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="G1/S-specific cyclin, putative"
                     /protein_id="XP_002420605.1"
                     /db_xref="GeneID:8048482"
                     /db_xref="GOA:B9WHP3"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR012104"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:B9WHP3"
                     /translation="MVSSIDLQALKVFLNGPITHDMIHKIVVATLQVIPCEDTKSKTY
                     TASNNTIKQLPSLMTFLTKLVKYTNVYTGTLMATLIYLQKLKSRLPKNAHGLPCTRHR
                     ILLSCLILSSKFHNDSSPKNKHWAKYTDGLFNVKDINLMERQLIFLLNWDLKVSNEEM
                     CQSLQSFLEPIKSGLIKQEKFQKYLQQKNQEAKQMANAAVAVSITTPVTLSRSSTTSS
                     TSSLASSSSTTTSSGRSSRSSSISPDHLSPIHYNNNNHYRQDSSSSISSFGSNNSPSS
                     VYSISPKHTHQNIITKNNHNSNNSACQIIDPIIELTAQKEELELKNFLSRKLTTTSNT
                     SNTTTTTTTTSNNNYGYGYHAAYGYNVANNF"
     gene            complement(<810231..>811946)
                     /locus_tag="CD36_53110"
                     /db_xref="GeneID:8048483"
     mRNA            complement(<810231..>811946)
                     /locus_tag="CD36_53110"
                     /product="fungus-specific zinc cluster transcription
                     factor, putative"
                     /transcript_id="XM_002420561.1"
                     /db_xref="GeneID:8048483"
     CDS             complement(810231..811946)
                     /locus_tag="CD36_53110"
                     /inference="similar to AA sequence:UniProt:Q59QS6"
                     /note="possibly fungus-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="fungus-specific zinc cluster transcription
                     factor, putative"
                     /protein_id="XP_002420606.1"
                     /db_xref="GeneID:8048483"
                     /db_xref="GOA:B9WHP4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:B9WHP4"
                     /translation="MSIPNNNIFIASSNSSGNSNLTQKNSKKKRNRLSLNCFNCKTRK
                     IKCNRQRPCLSCIKKKLKCEYQRQQWLASPNNENNGIFQIQQLNSHNENSKITTSHEI
                     SNEDKNYQIQQQQQQQQQQTSELSQIQLLNDILKDSIKNQFHGNRNRDRNGNIENIEL
                     KKYIITDLFQYFIKYYYHKNFLKNLKSNLGLSDRPQEISKFESLLLEFEIYIDEKYSI
                     INEYEIKMKFKDYINMKMILYMIYFYYYLYYEKKKKQLQLQLQLQQSLSYSYLKKILG
                     SCINEFIPYLFELIINQNHNKLNDLQQTLGDTDKHTDKDHIVNPMIIIFKTVIPKVMM
                     INFEILIRLNSSIYKLRYLNPHHNENLRDDFEYRLKFAKLNKLTQIYKKILEISLLII
                     AIIIIFKLNQKYDYQQKIKESYNINYILKQVFTDNTIPSNQTEYYYNNCMFNELSNDE
                     INEITKILEVGLKKYTELKNKLGINTNFEDEHEDEHEDKHEHKHEEFHEAMRNHCLIE
                     LTSLIPVSNSSNLQQQQSLSFDDEEQDFNIMNNMDIDKFWSLMVQIKNKNKNNINDER
                     STNTN"
     gene            complement(<812262..>815903)
                     /locus_tag="CD36_53120"
                     /db_xref="GeneID:8048484"
     mRNA            complement(<812262..>815903)
                     /locus_tag="CD36_53120"
                     /product="fungus-specific transcription factor, putative"
                     /transcript_id="XM_002420562.1"
                     /db_xref="GeneID:8048484"
     CDS             complement(812262..815903)
                     /locus_tag="CD36_53120"
                     /inference="similar to AA sequence:UniProt:Q59QU9"
                     /note="possibly fungus-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="fungus-specific transcription factor, putative"
                     /protein_id="XP_002420607.1"
                     /db_xref="GeneID:8048484"
                     /db_xref="GOA:B9WHP5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:B9WHP5"
                     /translation="MDKKSNPDKKDSRSSSSPQIPKKRSRVRQPLSCSVCRKRKSKCD
                     RARPCGTCIKKSIVHLCHYEDDNRPPINHFLPPQQQLHQHIDNNGYILTDHPLPPPLV
                     HYQEQYNNQHHLHPHNNNSNFDPSLSHIQGNGNNQFQHQPLSSQSPSGNHQYLPIPPP
                     PPPQQQQQPEQQPPSISPVGYTSSTKSSQTQISIPTPPPPLPPPAAPKSSNSTSNHSS
                     PNRPPATSGQNSYNTSNYSNFNPTSISDANSKPKLNSISLPLPPPPPPPSVTTPSLPI
                     PSTTKSSISGMSLTHDNPFGQLSIPSPIPPINELSPSLSRLKSLGTNSEGVLSPTTIG
                     VNDLLNPSGSNGGYNQVENNVSSVQDKSNPTVQSVLSDQTASSLKSISSPQESESFSS
                     NSLVSIPLGANSSLQINASDTMDVFTNGVFSLHSTGNEWQQSGTLSYLGLTKSDPFIT
                     ILRNFTVHLFRSDEFLNVIRNDATRKRRNSNGSLISIRSSRTGDEGLSPVATKRPKLD
                     NNGNNNSNASIPMNRSNSSDSNYLSHNVNFNDAFDMISENGKPSTNTPLDTFSPSVQQ
                     YESPKKTPGDMAFMQSFYNGGQKRHEYYRFVEEEVLKVLPDKTNSFQLFCRFFRFVNP
                     FIQIIDEHALLFDINPILPKFLKFNHEKITEIKIKNENDLRTLGIFMLVLKLGYQTMI
                     HNDNEHNNYNEQELSIIDSMQQLDNPTFNRIINLCIADGLITARSSFKLVQLLALLYH
                     YKGMSPDDSHGLSSTDSQILLGTIIRHAFSIGLNRDPTCYTTFDNLAKNQVLIKTWRH
                     LWWFLVATDAMSALNTGCNLNLASLDGCDVEYPHVADDPTGEMNKIYGVLAKICEHYR
                     NIVNKINNLRQKPKVVEILKETNQMERIFFDFFGKDFFKDVVCKPAKEPTNINGFEEA
                     SKEHMERVVKVFKYCLFVQLRTNLSGMYYKIAIHYENEYDKSKTPSMKAGIELFKIYI
                     KSVVQLVYIMSYVLDNSVYLFGKNFDYMLTASNERYMIKTHSFLTSFFVRLLHQKKEL
                     SFKVFKEISYMSRLECINNLFDIVLEDVELFVGDFRRLSKTYINSYRLYIITFIVLRQ
                     SIDNSDAFFEKAASDQSFFHQGTNMIEFFSQQELNHLCRLCRDWRNIKEAQKKYKDAK
                     KNKNDTKDDGFDPLKELESKLFGSSFFDDDNIFSNLNNLSDEILDPVACKEDLIRLFN
                     IYGDFNDLL"
     gene            <818045..>819169
                     /locus_tag="CD36_53130"
                     /db_xref="GeneID:8048485"
     mRNA            <818045..>819169
                     /locus_tag="CD36_53130"
                     /product="component of the mitochondrial inner membrane
                     electron transport chain, putative"
                     /transcript_id="XM_002420563.1"
                     /db_xref="GeneID:8048485"
     CDS             818045..819169
                     /locus_tag="CD36_53130"
                     /inference="similar to AA sequence:UniProt:P07257"
                     /inference="similar to AA sequence:UniProt:Q59QS9"
                     /note="Similar to S. cerevisiae QCR2;
                     In S. cerevisiae: subunit 2 of the ubiquinol cytochrome-c
                     reductase complex, which is a component of the
                     mitochondrial inner membrane electron transport chain;
                     subunit of the ubiquinol-cytochrome-c reductase complex,
                     mitochondrial precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="component of the mitochondrial inner membrane
                     electron transport chain, putative"
                     /protein_id="XP_002420608.1"
                     /db_xref="GeneID:8048485"
                     /db_xref="GOA:B9WHP6"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:B9WHP6"
                     /translation="MLSRASIRAYSSIPNSVKIAAKESATDLTKLSVIINNAGSKTGK
                     SGVSHLLSKFTFLNNGAKSALRFTRESELLGGTFEAKVTRDALILNTSFLKQDLPYYV
                     EALGNVVSNTQFTPHEFNEVVLPTANVEAKLADANPAFKGVEKLHEITFRRGLGNPLF
                     YNESTPIKVEEVAQFSKDQFSGENISIVAEGANEEDLTKFVSESAFCYLPSTSSNGAK
                     ALPTNTFTGQEARVSSAGASSALIGIPVKPADFGKYEVLSAAIGTSTLPSTSTPLAQI
                     PGATSHLYKYQDAGLFVISVSGEASQVAQGIKQAKSVAESVSSAALSDAVKAAELSVA
                     LQSTVDSPLNVKAVAEKAPISKFNYVAVGNLDVLPYADEL"
     gene            <819554..>820027
                     /locus_tag="CD36_53140"
                     /db_xref="GeneID:8048486"
     mRNA            <819554..>820027
                     /locus_tag="CD36_53140"
                     /product="RNA polymerase subunit common to RNA polymerases
                     I, II, and III, putative"
                     /transcript_id="XM_002420564.1"
                     /db_xref="GeneID:8048486"
     CDS             819554..820027
                     /locus_tag="CD36_53140"
                     /inference="similar to AA sequence:UniProt:P20435"
                     /inference="similar to AA sequence:UniProt:Q59QT0"
                     /note="Similar to S. cerevisiae RPO26;
                     In S. cerevisiae: RNA polymerase subunit ABC23, common to
                     RNA polymerases I, II, and III; part of central core;
                     similar to bacterial omega subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase subunit common to RNA polymerases
                     I, II, and III, putative"
                     /protein_id="XP_002420609.1"
                     /db_xref="GeneID:8048486"
                     /db_xref="GOA:B9WHP7"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="InterPro:IPR006111"
                     /db_xref="InterPro:IPR012293"
                     /db_xref="InterPro:IPR020708"
                     /db_xref="InterPro:IPR028363"
                     /db_xref="UniProtKB/TrEMBL:B9WHP7"
                     /translation="MSDYEDNAFNEVAENFEDFDAPDHFSDNEYDDPSANGGDAALKT
                     TDGRTIINGGFGPDDAQSASQPRKKTTKELAIPKEKRTTTPYMTKYERARILGTRALQ
                     ISLNAPVLVDIEGETDPLQIAMKELAQRKIPLVIRRYLPDGSYEDWGCDELIVDQ"
     gene            complement(<820213..>820728)
                     /locus_tag="CD36_53150"
                     /db_xref="GeneID:8048487"
     mRNA            complement(<820213..>820728)
                     /locus_tag="CD36_53150"
                     /product="myosin light chain 2, putative"
                     /transcript_id="XM_002420565.1"
                     /db_xref="GeneID:8048487"
     CDS             complement(820213..820728)
                     /locus_tag="CD36_53150"
                     /inference="similar to AA sequence:UniProt:Q06580"
                     /inference="similar to AA sequence:UniProt:Q59QT1"
                     /note="Similar to S. cerevisiae MLC2; regulatory light
                     chain for the type II myosin, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="myosin light chain 2, putative"
                     /protein_id="XP_002420610.1"
                     /db_xref="GeneID:8048487"
                     /db_xref="GOA:B9WHP8"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:B9WHP8"
                     /translation="MSHLTSLSSTQKGQIRNAFTLIDGESRDSTITKDDLVKLYSTLG
                     LPSPSESQLTEMLTVDGQDKSQTGINFTQFSNIMAKELSKFEDQSIIYNALKVYSDKE
                     NLKTFKDELQIDVNKLKDACCSVQLGEIGSGDHRLSRAKFDKLVEGFVQEQMDGTQIF
                     LASKWIDAYID"
     gene            <820949..>822193
                     /locus_tag="CD36_53160"
                     /db_xref="GeneID:8048488"
     mRNA            <820949..>822193
                     /locus_tag="CD36_53160"
                     /product="actin-like protein, putative"
                     /transcript_id="XM_002420566.1"
                     /db_xref="GeneID:8048488"
     CDS             820949..822193
                     /locus_tag="CD36_53160"
                     /inference="similar to AA sequence:UniProt:P38696"
                     /inference="similar to AA sequence:UniProt:Q59QT2"
                     /note="Similar to S. cerevisiae ARP1;
                     In S. cerevisiae: involved in cell polarization,
                     endocytosis, and other cytoskeletal functions; centractin,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="actin-like protein, putative"
                     /protein_id="XP_002420611.1"
                     /db_xref="GeneID:8048488"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:B9WHP9"
                     /translation="MAEILYNQPVVIDNGSGNLKAGFAGEDKPKSYASAIIGRPKYQK
                     IMAAGSTSLVSEQQSHDQLFIGNAAQDNRGLLKLSYPIEHGIVNNWSDMEKLWYHTYT
                     QDLKTQSEDHPLLITEAPLNPRTNRNKMCQILFENFNIPCIYISIQAVLSLYASGRTT
                     GVVIDSGDGVTHVVPVYEGFSLPPSIKRMDIAGRDITESLAFNIRRMTGVALQSSSEL
                     EIVRLIKEQNCFISKDPVRDEKKYGSHYSRNNPNNELMSTYKLPDGHEIQLGVERFRA
                     TEILFNPQLIGHESSGIHELASLAIAKTDLDLRSILYQNIILSGGNTLLKNFGDRMLK
                     ELKDLQQPLQEDQKMSIWNKNVQNDVYNTKMKVKIYAPPERKYSTWIGGSILAGLSTF
                     KKMWVTSEEYHENPDIVHVKCM"
     gene            complement(<822315..>822971)
                     /locus_tag="CD36_53170"
                     /db_xref="GeneID:8048489"
     mRNA            complement(<822315..>822971)
                     /locus_tag="CD36_53170"
                     /product="uracil phosphoribosyltransferase, putative"
                     /transcript_id="XM_002420567.1"
                     /db_xref="GeneID:8048489"
     CDS             complement(822315..822971)
                     /locus_tag="CD36_53170"
                     /EC_number="2.4.2.9"
                     /inference="similar to AA sequence:UniProt:P18562"
                     /inference="similar to AA sequence:UniProt:Q59QT3"
                     /note="Similar to S. cerevisiae FUR1;
                     In S. cerevisiae: synthesizes UMP from uracil; involved in
                     the pyrimidine salvage pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="uracil phosphoribosyltransferase, putative"
                     /protein_id="XP_002420612.1"
                     /db_xref="GeneID:8048489"
                     /db_xref="GOA:B9WHQ0"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:B9WHQ0"
                     /translation="MSVAKAVSKNVILLPQTNQLIGLYSIIRDQRTKRGDFVFYSDRI
                     IRLLVEEGLNQLPVEEAIIKCHGGYEYKGAKFLGKICGVSIVRAGESMEMGLRDCCRS
                     VRIGKILIQRDEETALPKLFYEKLPEDISERYVFLLDPMLATGGSAMMAVEVLLARGV
                     KMDRILFLNLLAAPEGIKAFHEKYPDVKIITGGIDEKLDEDKYIVPGLGDFGDRYYCI
                     "
     gene            complement(<823256..>823789)
                     /locus_tag="CD36_53180"
                     /db_xref="GeneID:8048490"
     mRNA            complement(join(<823256..823395,823473..823692,
                     823781..>823789))
                     /locus_tag="CD36_53180"
                     /product="U6 snRNA-associated Sm-like protein, putative"
                     /transcript_id="XM_002420568.1"
                     /db_xref="GeneID:8048490"
     CDS             complement(join(823256..823395,823473..823692,
                     823781..823789))
                     /locus_tag="CD36_53180"
                     /inference="similar to AA sequence:UniProt:O74499"
                     /inference="similar to AA sequence:UniProt:P53905"
                     /note="Similar to S. cerevisiae LSM7;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="U6 snRNA-associated Sm-like protein, putative"
                     /protein_id="XP_002420613.1"
                     /db_xref="GeneID:8048490"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR017132"
                     /db_xref="UniProtKB/TrEMBL:B9WHQ1"
                     /translation="MSDERRPRQQQYRRRNNNSNAPKQEGPKREAILDLNKYKDQKIR
                     VKFIGGREIVGILKGFDQLMNLVLENVTETLRDPEDDEILTDKTRDFGLVVVRCTSLL
                     TISPVDGSEIIDNPFIQPEQ"
     gene            complement(<824099..>824620)
                     /locus_tag="CD36_53190"
                     /db_xref="GeneID:8048491"
     mRNA            complement(<824099..>824620)
                     /locus_tag="CD36_53190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420569.1"
                     /db_xref="GeneID:8048491"
     CDS             complement(824099..824620)
                     /locus_tag="CD36_53190"
                     /inference="similar to AA sequence:UniProt:Q59QT4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420614.1"
                     /db_xref="GeneID:8048491"
                     /db_xref="InterPro:IPR024388"
                     /db_xref="UniProtKB/TrEMBL:B9WHQ2"
                     /translation="MIRTTIRRVSTKSIPYEPIPKNKYNQVRSAYNFKPAKNNGFVYS
                     PPAAIIKPQMITPYIFLPENDPRRELAKQHRIDPKIVSEMPIIRQIKAPHEREYNVDA
                     DTINKIKELRAADPERWTIKEISKEFNIEMNKLHFFLRSQFPKKTTEPVKVVSKKSLD
                     RQKRKQLWLRNQY"
     gene            825453..825546
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CD36_tRNA_0083"
                     /db_xref="GeneID:8048492"
     tRNA            825453..825546
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CD36_tRNA_0083"
                     /product="tRNA-Glu"
                     /anticodon=(pos:825486..825488,aa:Glu,seq:ttc)
                     /db_xref="GeneID:8048492"
     gene            <827771..>828598
                     /locus_tag="CD36_53200"
                     /db_xref="GeneID:8048060"
     mRNA            <827771..>828598
                     /locus_tag="CD36_53200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420570.1"
                     /db_xref="GeneID:8048060"
     CDS             827771..828598
                     /locus_tag="CD36_53200"
                     /inference="similar to AA sequence:UniProt:Q59QT5"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420615.1"
                     /db_xref="GeneID:8048060"
                     /db_xref="UniProtKB/TrEMBL:B9WHQ3"
                     /translation="MSAFLLVNEHTNTQVVKKKKRHNVTPTSSTKSIISGSDTSSHYR
                     KKVFDINSNRYVDTTSSFEISVDDIEEERNDLSHPSIRGHQIVKNKKPFFPLEEYIIL
                     RHTYFDQIKNNNNNSFACNNIQTLLSSNQFWNNVYQEMKDDSLQSTFDYFPLLPNRAV
                     LAQFYQTVINKILEENNIEADYEDYKMQHNHLYSSHYKLSVQEKLADTMIINLKIFLR
                     GEADSTFQQWRRFLRFLILGFLQTPEPFSSSLKTIQSTGPKKPKKISFFKKLIGSKH"
     gene            complement(<832841..>833854)
                     /locus_tag="CD36_53210"
                     /db_xref="GeneID:8048493"
     mRNA            complement(<832841..>833854)
                     /locus_tag="CD36_53210"
                     /product="ER protein involved in lipid remodelling of
                     GPI-anchored proteins, putative"
                     /transcript_id="XM_002420571.1"
                     /db_xref="GeneID:8048493"
     CDS             complement(832841..833854)
                     /locus_tag="CD36_53210"
                     /inference="similar to AA sequence:UniProt:P25625"
                     /inference="similar to AA sequence:UniProt:Q59QT6"
                     /note="Similar to S. cerevisiae PER1;
                     In S. cerevisiae: required for GPI-phospholipase A2
                     activity that remodels the GPI anchor as a prerequisite
                     for association of GPI-anchored proteins with lipid rafts;
                     functionally complemented by human ortholog PERLD1; ER
                     protein processing protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ER protein involved in lipid remodelling of
                     GPI-anchored proteins, putative"
                     /protein_id="XP_002420616.1"
                     /db_xref="GeneID:8048493"
                     /db_xref="InterPro:IPR007217"
                     /db_xref="UniProtKB/TrEMBL:B9WHQ4"
                     /translation="MRILYSFVMLFVVAFASLGDNLPEFQSCLYQCDCHAIPQSIIWS
                     CLANCNYFCQQLITDQLESSNVPMVQFYGKWPFKRVLGVQEFFAMVFSLGNLYVNYKN
                     LRIIYRQFRRNESEYKTMYVQYLVLLIVTCIGWSFSAIFHFKDTKMSETLDYFGAFAI
                     ILCNLNVIVVRVFQLFRHKKNLILWHIALVVLYLYHVIRLERNWDYSYNTLINIIVGV
                     SAMILWCFHSWRVYRVYNQKRIIYNNSIQLLPYETKLLQKLSYIGMSLSNLIPLIPIF
                     NNVILLLGISLELNDFPPIGRLVDAHALWHLVTIFPSIIWFDWNVWDIEMLKITNSSE
                     SKV"
     gene            complement(<834281..>835777)
                     /locus_tag="CD36_53220"
                     /db_xref="GeneID:8048494"
     mRNA            complement(<834281..>835777)
                     /locus_tag="CD36_53220"
                     /product="uncharacterized mitochondrial protein, putative"
                     /transcript_id="XM_002420572.1"
                     /db_xref="GeneID:8048494"
     CDS             complement(834281..835777)
                     /locus_tag="CD36_53220"
                     /inference="similar to AA sequence:UniProt:Q04991"
                     /inference="similar to AA sequence:UniProt:Q59P01"
                     /note="Similar to S. cerevisiae FMP42"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized mitochondrial protein, putative"
                     /protein_id="XP_002420617.1"
                     /db_xref="GeneID:8048494"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:B9WHQ5"
                     /translation="MLPSDVSFSKRLIQCTCAIFWCLLSGGPIFGFAALKPILIKEHV
                     YEYLCDIHTPVFSSFNSNHNNNDITAKCTDQDLKLNMMFTVAAMLTNVSALAIGRILD
                     VYGPKVCGLIGAFFLYLACFVFIYSKYLVGSIIDPYLLGYAFLALGGPFAFISSFQLS
                     NSFPKSSGTILALITGAFDASSAVFLLYRIGYNASFGSFTLEKFFTLYLFVPTFIAVV
                     QIFIMNSDSYQTEGTSKLCANDEENHAHVASPVSSNNQETTPLLNESGTRIRRDSMGD
                     AIKHPYEIEGEEFLVEHSSGVFGIMHGYSAQEQIKSWWFVLTTLLSIIMMLRLNYFMA
                     TIGTQYQYIFGSFELADQINKFFDVALPLGGLISVPFIGLFLDNCSTLMVLIIMMLLS
                     LTIGLLGLVSNYALAVLGICMFVVYRPLFYTVVSDFCAKVFGFQTFGTVYGAVMCLSG
                     IFNFGQSFLDDLTHTTFNMNPIPINVILLVLTVIIGCSTVGYVYKTAK"
     gene            complement(<836232..>837803)
                     /locus_tag="CD36_53230"
                     /db_xref="GeneID:8048495"
     mRNA            complement(<836232..>837803)
                     /locus_tag="CD36_53230"
                     /product="urea transporter, putative"
                     /transcript_id="XM_002420573.1"
                     /db_xref="GeneID:8048495"
     CDS             complement(836232..837803)
                     /locus_tag="CD36_53230"
                     /inference="similar to AA sequence:UniProt:O94469"
                     /inference="similar to AA sequence:UniProt:P33413"
                     /inference="similar to AA sequence:UniProt:Q4WJT4"
                     /inference="similar to AA sequence:UniProt:Q59P00"
                     /note="Similar to S. cerevisiae DUR3;
                     In S. cerevisiae: plasma membrane transporter for both
                     urea and polyamines; urea/polyamine transporter, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="urea transporter, putative"
                     /protein_id="XP_002420618.1"
                     /db_xref="GeneID:8048495"
                     /db_xref="GOA:B9WHQ6"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="UniProtKB/TrEMBL:B9WHQ6"
                     /translation="MAQLSSQGNNAIIYLSYAFMLATGLFLAWKFSSNKDFLSSNGTQ
                     RGIPLALNFIASAMGVGIITTYAQIANIAGLHGLLVYTICGAIPIVGFALVGPIIRRK
                     CPDGFILTEWVRHRFGMVTALYLSAFTCLTMFLFMVGELSALRSAVETLTGLNALGAV
                     IVECVVTTIYTFFGGFRVSFITDNFQGVCVLLLLIICAAGMGSYIEIDTSKIGPSGLL
                     KANKLGWQLIYILFVAIVTNDCFMSGFWLRTFASKTDKDLWIGTSIAAFVTFAICTLI
                     GTTGFLAVWSGDLTVGDENGYDAFFILLSKMPRWLVAFVLIFCIVLSTCTFDSLQSAM
                     VSTISNDVFRNKLHINYVRIMLVLIMVPIVVLAVKVANNILQIYLIADLVSAAIIPSV
                     FLGLADSWFWYLRGFDVMAGGLGALVGVFIFGTVYYHSAREGGKLLLIWNGLYDPSDW
                     GAFGAFVIAPVGGVVITLASAALRIAVLYAYSKVTGGEFTALDKPIAVEVDNEDQKYG
                     SIDDDDDESDTKKVV"
     gene            complement(<838294..>839925)
                     /locus_tag="CD36_53240"
                     /db_xref="GeneID:8048496"
     mRNA            complement(<838294..>839925)
                     /locus_tag="CD36_53240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420574.1"
                     /db_xref="GeneID:8048496"
     CDS             complement(838294..839925)
                     /locus_tag="CD36_53240"
                     /inference="similar to AA sequence:UniProt:Q59NZ8"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420619.1"
                     /db_xref="GeneID:8048496"
                     /db_xref="UniProtKB/TrEMBL:B9WHQ7"
                     /translation="MTLPANFKFKSTEDPKVIEQLYALCGTEWGGKLTPEQFGAAQVK
                     GNFKYVEEGGRILSYYIEDTTTGTIVATTSVKFCKAFYKPADRSSAISSIPDPSLFGV
                     NNATALLISFVFTHKDYRKLGLAGQCVSKAIETTEKLIIKEKVDSSDESVADNFKKMT
                     IADGTNETDLQLANYYLSKEYIWILYSGVNTYYERFGFKSFPMDFYEVPNTLLTSDVE
                     SAIEKLIKESKEEKQSPSGKTIRLLLRDNPADQEIVQFILQNKELNIVTEINKLQFHS
                     NLQSDRKSSTSLTNMTNILSMSKLGSSTGLSSVTETNAATASSSSQGSPGVRRKSSVH
                     HQTIPKFAIKPTYAHYQSNATVTKEMFDNFSEVSQKFANIQGAIVTNEVQQRSYYALW
                     SPLKGQFFITGMGEIQFQGIPSSLPANRPRRASSLSGINELGGYNFKDLEVLVFTALH
                     VAKNCDAQLDKVHISVNDLPEEIPDPVMYDFFINYLPASIHESGDAKEEVKADVKLLT
                     DAAHSIHVLPMVRKFGSRKPEFDLDWVADGMWCWG"
     gene            <841154..>842884
                     /locus_tag="CD36_53250"
                     /db_xref="GeneID:8048497"
     mRNA            <841154..>842884
                     /locus_tag="CD36_53250"
                     /product="amino acid transporter, putative"
                     /transcript_id="XM_002420575.1"
                     /db_xref="GeneID:8048497"
     CDS             841154..842884
                     /locus_tag="CD36_53250"
                     /inference="similar to AA sequence:UniProt:P19145"
                     /inference="similar to AA sequence:UniProt:Q59NZ6"
                     /note="Similar to S. cerevisiae GAP1; general amino-acid
                     permease, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="amino acid transporter, putative"
                     /protein_id="XP_002420620.1"
                     /db_xref="GeneID:8048497"
                     /db_xref="GOA:B9WHQ8"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:B9WHQ8"
                     /translation="MSRKSSIDMPKETSSPECYTSSTSSHEINEKPGKWQNFKDSFKP
                     PVPIEDIENGSISSAQLKGGQNVPLQQSLKKRQLQMIALGGCVGSGLLVASGAALRNG
                     PASLLIAWFIVSTFLYCTMQCLAELSSTFPVSGSFAVYSIKFIDPSWGTAMGYNYALF
                     WVIVMPLELVASSMTIKFWPSNINTSVWVAVFYVLIIGTNLFGGTRAFGETEFVASVI
                     KLLGVVGFNILAIVLICGGGDQGYIGGKNWHPPFTTGVKGVISVLLTATYSLAGTELV
                     GLTSAEAAGDARKVLPKAIKQVLWRILIFYLLTLTLVGFLVPASDPQLIGGGSGASAS
                     PFVIAIREGGIKGLPSVFNVVVLVALLAIANSAVYGFSRTILALAEQGVAPSIFKYVD
                     RQGRPLAGIATSAIVGLLSFVSASKQQEQVFDWLVALSGLSTFFTWGSINAAHIRFRI
                     AMKVQGRSLDELPYKANTGVLGAYYGLIMNIAVLALQFWLALWPVGGKPDVTYFFKQY
                     LAAVLVLAVYLIHKVVTRNWKFMVDYKDMDLDSGRSNIDIDMLKQELEEEREAYKTQP
                     WYYKFYQFWC"
     gene            complement(<843293..>844828)
                     /locus_tag="CD36_53260"
                     /db_xref="GeneID:8048498"
     mRNA            complement(<843293..>844828)
                     /locus_tag="CD36_53260"
                     /product="uncharacterized protein YNL144C, putative"
                     /transcript_id="XM_002420576.1"
                     /db_xref="GeneID:8048498"
     CDS             complement(843293..844828)
                     /locus_tag="CD36_53260"
                     /inference="similar to AA sequence:UniProt:P53907"
                     /inference="similar to AA sequence:UniProt:Q59NZ5"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein YNL144C, putative"
                     /protein_id="XP_002420621.1"
                     /db_xref="GeneID:8048498"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:B9WHQ9"
                     /translation="MNVESTISQKQIALPTTMHIQPLQPIPIANTRDIKYTWPEASRS
                     PSISSSTSDDEEEDDDDLSLEIVAERSSTPPTPCSSVCHDKFMYTSSCDNYLQYIEPN
                     PVSPPSYDTLPPGGCPRFPVSAPSIFPYSAETVCENSDLQPPAYKPAIYKIGVVARKM
                     EWINPNELSPHRSWKYYIIELNSTQLNFYNVPAKYEHQLVTFTPDSLTSQQSFPNYDT
                     NLNSLFTCSADHQFYDMVKKMGLIERNSGCSKKGKCLVRSYSLQNSKIGLATDYKKRA
                     NVLRMRVEEEQMLLNFGNVDEVITWNLSLNVGKDVALDLTERELPKYRTVPRRRRRNR
                     NTENNGSSSLLSAIHPNGSLARLRSASDPNKFRGRFSRLKSKLSSAKLSAYNNKHAVE
                     PAAMYSNNSLPHSTFYIQLPTPVSTSSSESIDATRSNSVSDFRNVSSTDISETEPHED
                     DDEDEEDEDGGEYDQASVNSVTNVHVEASPSYCYKWSPEKKFDKHKYHRDCLRCIKPL
                     LYN"
     gene            <846454..>847785
                     /locus_tag="CD36_53270"
                     /db_xref="GeneID:8048499"
     mRNA            <846454..>847785
                     /locus_tag="CD36_53270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420577.1"
                     /db_xref="GeneID:8048499"
     CDS             846454..847785
                     /locus_tag="CD36_53270"
                     /inference="similar to AA sequence:UniProt:Q59NZ4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420622.1"
                     /db_xref="GeneID:8048499"
                     /db_xref="UniProtKB/TrEMBL:B9WHR0"
                     /translation="MDFLYLSLDFATNIVCVGFFFFKRKPIFLTSSKPQKVYSFLFVL
                     NIYTSVYLKMYRKSFGENRRTSLEERLDSSMTNESSTTGPRNGEFKPNTNRKVSTEFN
                     SVDSKTQQDTFVPSLNQQNQLDDTQSDRFEHQSISPLRKRKSWFTGVLRRRKLSLVND
                     IQSAPPVQQQQNAKSKGWLFKSKAETDSTLILNTAQYSNIRSAESDQAELLSTGSVDR
                     NSKSNSIQFESRNLEYDDTIPIFFGKYSGSPMCTSVLKNSQIVYFQISAYNRFYDFDE
                     ATYHPWNIWEVDDDVKKLRGTIDGKDDFTDFAKEFEYCQVLLMRSWLVPNYEIFKNGY
                     LIQLKITHKKNDAEKAINLYLSCSRDSIFRKLPEQGVRISVCGIRYFRKTPQLSEVIF
                     WIHPIKNMSFSIVEQVVLLLKSFRISTGIHKTILVDLNNGSRSTIKSSYTH"
     gene            complement(<848192..>848737)
                     /locus_tag="CD36_53280"
                     /db_xref="GeneID:8048500"
     mRNA            complement(<848192..>848737)
                     /locus_tag="CD36_53280"
                     /product="coenzyme Q-binding protein, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_002420578.1"
                     /db_xref="GeneID:8048500"
     CDS             complement(848192..848737)
                     /locus_tag="CD36_53280"
                     /inference="similar to AA sequence:UniProt:Q08058"
                     /inference="similar to AA sequence:UniProt:Q59NZ3"
                     /note="Similar to S. cerevisiae COQ10;
                     In S. cerevisiae: required for function of coenzyme Q in
                     respiration by functioning in the delivery of Q6 to its
                     proper location for electron transport"
                     /codon_start=1
                     /transl_table=12
                     /product="coenzyme Q-binding protein, mitochondrial
                     precursor, putative"
                     /protein_id="XP_002420623.1"
                     /db_xref="GeneID:8048500"
                     /db_xref="InterPro:IPR005031"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:B9WHR1"
                     /translation="MFKRVMLGNVCRIPRRSFFGVSKPQSYEISKILNGTAKQVYDIV
                     SQVDQYKTFVPFVEDSFISQRTKDDLPMRAGLLVGWKDIVEKFECDLICVENKEVTAK
                     SLQLDLFDNLETIWKFQDHGGNKCKVDFKLAFKFKSPIYDKLSSLFAPQVSEIMIGAF
                     EKRLKQIKLNESMKKYQKAKL"
     gene            complement(<849140..>849457)
                     /locus_tag="CD36_53290"
                     /db_xref="GeneID:8048501"
     mRNA            complement(<849140..>849457)
                     /locus_tag="CD36_53290"
                     /product="40S ribosomal protein S25"
                     /transcript_id="XM_002420579.1"
                     /db_xref="GeneID:8048501"
     CDS             complement(849140..849457)
                     /locus_tag="CD36_53290"
                     /inference="similar to AA sequence:UniProt:P0C0T4"
                     /inference="similar to AA sequence:UniProt:Q3E792"
                     /inference="similar to AA sequence:UniProt:Q59NZ2"
                     /note="Similar to S. cerevisiae RPS25B; RPS25A;
                     In S. cerevisiae: RPS25A and RPS25B are almost identical"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S25"
                     /protein_id="XP_002420624.1"
                     /db_xref="GeneID:8048501"
                     /db_xref="GOA:B9WHR2"
                     /db_xref="InterPro:IPR004977"
                     /db_xref="UniProtKB/TrEMBL:B9WHR2"
                     /translation="MAPKVQQTKAAKAAAALAGGKKGKKKWNKGKVKDKAQHVVILDQ
                     EKYDRILKDVPTYKYVSVSVLVDRLKIGGSLARVALRQLEEDGIITPVLKHSKQAIYT
                     RAQ"
     gene            <850150..>852555
                     /locus_tag="CD36_53300"
                     /db_xref="GeneID:8048502"
     mRNA            <850150..>852555
                     /locus_tag="CD36_53300"
                     /product="RanGTP-binding protein, putative"
                     /transcript_id="XM_002420580.1"
                     /db_xref="GeneID:8048502"
     CDS             850150..852555
                     /locus_tag="CD36_53300"
                     /inference="similar to AA sequence:UniProt:P14907"
                     /inference="similar to AA sequence:UniProt:Q59NZ1"
                     /note="Similar to S. cerevisiae NSP1;
                     In S. cerevisiae: nucleoporin involved in
                     nucleocytoplasmic transport, binds to either the
                     nucleoplasmic or cytoplasmic faces of the nuclear pore
                     complex depending on Ran-GTP levels; also has a role in
                     chromatin organization; nuclear pore protein, putative;
                     nucleoporin, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RanGTP-binding protein, putative"
                     /protein_id="XP_002420625.1"
                     /db_xref="GeneID:8048502"
                     /db_xref="GOA:B9WHR3"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR015007"
                     /db_xref="UniProtKB/TrEMBL:B9WHR3"
                     /translation="MAKRVADEQITKDGMSNYSDNGPDAPAIASSDVLSRRKILKPKG
                     RLGSNSTGTGSNAFGALNGPQQPMFSFGGSGSNAASGITSSQPAQSSNPFNFAKKPES
                     STTDKDSKIKALNENFIRAITQLNVPNTIADFTPIAQKYIDYYKSISKNEPSLNIASK
                     EVKNPAQPPSASSFQFKPSTASAPSTTATATSFSFKPSAQPSESKLNGPVFSFKSNSQ
                     EQTTTKPAFSFNPPASSTTGSATTSTPSFTTKPISSSVQNEASKTENKRELINLDSDS
                     DSESDKEQPKAKEVKVQGPMFTLTANPTTKSSPFTFDPKKLAKKNAPDSDDSEDDVEI
                     KGPTFQFNKPIQDSVFKLTPNIANNTLKSDEKKEEAKSTPLFGATTQNKDQIATQTSL
                     FGSSQNKLEETKAPNVFGDSFGSNGKTTEQKPASSFSFGSFQPKTDASANTETKKPET
                     TLFSSGTTNSSSKPLFGSSNNETNAKPAFTFASTTDKKDESATATSSTTTTPSFLFGK
                     QPNQTDGAKEAQSDKPATSLFGNSSDNANKSATTGFLFGTQKQEEESQTPKFTFGSSE
                     AKPFAFGVPNKQGDSTTPPSFNFGSNSSNSAFSFGSKPAETFKFGEKQEDKKDEASST
                     LTTSSSSFGSTKPAFSFTFGSAKSEDKPEEEKNGDTVPEEETGGNFEPVAKLSNEQVD
                     SKSGEENETAKFTIRSKLMEYDSKNSENPYTNKGIGELKVLFNEQTKKSRILIRADGS
                     LRVLLNTLILSSVKYDSIGNGSLIRVPTIDADDSSRIITYVIKVKTPQDGEQLLKCIN
                     ELK"
     gene            <853128..>853634
                     /locus_tag="CD36_53310"
                     /db_xref="GeneID:8048503"
     mRNA            <853128..>853634
                     /locus_tag="CD36_53310"
                     /product="histone deacetylase complex subunit, putative"
                     /transcript_id="XM_002420581.1"
                     /db_xref="GeneID:8048503"
     CDS             853128..853634
                     /locus_tag="CD36_53310"
                     /inference="similar to AA sequence:UniProt:P38429"
                     /inference="similar to AA sequence:UniProt:Q59NY8"
                     /note="Similar to S. cerevisiae SAP30;
                     In S. cerevisiae: involved in silencing at telomeres,
                     rDNA, and silent mating-type loci; involved in telomere
                     maintenance"
                     /codon_start=1
                     /transl_table=12
                     /product="histone deacetylase complex subunit, putative"
                     /protein_id="XP_002420626.1"
                     /db_xref="GeneID:8048503"
                     /db_xref="InterPro:IPR024145"
                     /db_xref="InterPro:IPR025718"
                     /db_xref="UniProtKB/TrEMBL:B9WHR4"
                     /translation="MANRNSHKESASESESNTNTHTRHTTGSSSNSKISQKARNQLAL
                     QQQQQYLAKHINSNGPQDKPKLQPLDFTTYSDTALLKYSERYGFHNFSRIESLNSDIL
                     NSEIGKKTYSKRSNKNQKDTGRISKLEIANHVKNHFSSLPAKENDIITGFLYKVKHQD
                     KEFKLTFQ"
     gene            <854022..>854588
                     /locus_tag="CD36_53320"
                     /db_xref="GeneID:8048504"
     mRNA            <854022..>854588
                     /locus_tag="CD36_53320"
                     /product="coupling of ubiquitin conjugation to ER
                     degradation protein, putative"
                     /transcript_id="XM_002420582.1"
                     /db_xref="GeneID:8048504"
     CDS             854022..854588
                     /locus_tag="CD36_53320"
                     /inference="similar to AA sequence:UniProt:P38428"
                     /inference="similar to AA sequence:UniProt:Q59NY7"
                     /note="Similar to S. cerevisiae CUE1;
                     In S. cerevisiae: endoplasmic reticulum membrane protein
                     that recruits the ubiquitin-conjugating enzyme Ubc7p to
                     the ER where it functions in protein degradation; contains
                     a CUE domain that binds ubiquitin to facilitate
                     intramolecular monoubiquitination; ubiquitin-binding
                     protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="coupling of ubiquitin conjugation to ER
                     degradation protein, putative"
                     /protein_id="XP_002420627.1"
                     /db_xref="GeneID:8048504"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:B9WHR5"
                     /translation="MDSSTILFIGAVAVAFIFLKWMVSPIPQQNEFNIDRLSQDQSTG
                     STTSSNAQHNRDTHSISTQSHRNSRRAVTESMIEVVQSIAPMLTVEQIRYDLENTGNV
                     EATVNRFMELGDLPFPPGYVRPQQPSSSEEPKKQEVFGRRSVNLLEKYNIDAKNPKND
                     HNSLLHQRRQEMILGARKRLAAQLSNEL"
     gene            complement(<854667..>856061)
                     /locus_tag="CD36_53330"
                     /db_xref="GeneID:8048505"
     mRNA            complement(<854667..>856061)
                     /locus_tag="CD36_53330"
                     /product="chromatin assembly complex subunit, putative"
                     /transcript_id="XM_002420583.1"
                     /db_xref="GeneID:8048505"
     CDS             complement(854667..856061)
                     /locus_tag="CD36_53330"
                     /inference="similar to AA sequence:UniProt:Q04199"
                     /inference="similar to AA sequence:UniProt:Q59NY5"
                     /note="Similar to S. cerevisiae CAC2;
                     In S. cerevisiae: component of the chromatin assembly
                     complex (with Rlf2p and Msi1p) that assembles newly
                     synthesized histones onto recently replicated DNA,
                     required for building functional kinetochores, conserved
                     from yeast to humans; chromatin assembly factor (CAF)
                     subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="chromatin assembly complex subunit, putative"
                     /protein_id="XP_002420628.1"
                     /db_xref="GeneID:8048505"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:B9WHR6"
                     /translation="MEATILTVHWHNDNQPIYSVDFQPEQPELANSSTSMSTESTRLA
                     TGGGDNNIRIWRLTSSNSVEYMSTLQKHSQAVNAVRFNPRGDILASAGDDGTLLLWKK
                     SEAIVKTLESEDDEDLKESWQVVGTIRSSTAEIMDICWSPNGDQIVTGSMDNILRIYQ
                     LEFSSGKVSGTIIRSFSDHTHYIQGVFWDPLNKFIVSQSADRSVNVYLISQSESKSIE
                     INLKQKFQKFGNLYLYYPETLQSFFRRLAFSPDGSILVTPAGLEETSNNETLNNVLYI
                     YSRASLFTSPIYKITGLSKPAIAVSFNPIRYKLDGTSTLKLPYKLVFAVATQDGVVLY
                     STRDNFKPLGLVSNLHYSSITDLKWTIDGSRIIVSSTDGFCSTINFPDSAFGERYTDG
                     QVSVPHNNGILLEEISQAKTESNLESAVSSEIPNENSPNPKNENSQSSTPPIDLFFDK
                     NQKVKKRITPTLIS"
     gene            <856999..>858525
                     /locus_tag="CD36_53340"
                     /db_xref="GeneID:8048506"
     mRNA            <856999..>858525
                     /locus_tag="CD36_53340"
                     /product="leucine aminopeptidase, putative"
                     /transcript_id="XM_002420584.1"
                     /db_xref="GeneID:8048506"
     CDS             856999..858525
                     /locus_tag="CD36_53340"
                     /EC_number="3.4.11.22"
                     /inference="similar to AA sequence:UniProt:P14904"
                     /inference="similar to AA sequence:UniProt:Q59NY4"
                     /note="Similar to S. cerevisiae APE1; vacuolar
                     aminopeptidase precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="leucine aminopeptidase, putative"
                     /protein_id="XP_002420629.1"
                     /db_xref="GeneID:8048506"
                     /db_xref="GOA:B9WHR7"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="InterPro:IPR023358"
                     /db_xref="UniProtKB/TrEMBL:B9WHR7"
                     /translation="MDSIFRFQLPDMSATIPRLPSKQEAAPTKNDIFDNYYESYSEKY
                     IEFMNNNPTTYHTIGHFKSLLENNGFTFLPDNKPITDLSPGFYFTSKDDQCLVAFIIG
                     GNWEPEKGSCFVGSHCDALSVKINPRGSLRDSVNGYELLGVAPYSGSLNKLWLNRDLG
                     LAGSILVRDYKTGKIFRKLIKSHPDPIAFIPQLPEVFPGSPKEYNTQTEMVPIYGYTT
                     ENLVPTDEEKQSKFFNRHSLALLRYVSKLAEVPLASIVDLDLDLVDIQPSCRGGLGNE
                     FIYSGSLDDRLCAFASVYGLIEYSQRFYLDKDIETFDGLNGIYLANHEEIGSESRTGA
                     KGGFLIDILKSSVSDKHQTHTPEAIANLTTNTIFLSSDVTHALNPNFKNVYLENNFPV
                     PNTGPSIKFDSNYHVLSDSKGNEFLTRIIDDLSGIKLQHFHIRNDSRSGGTIGPIMSD
                     SRRGINGAKLIIDVGLPILSMHSIRSIAGYKDVGIGIRFFKEVFSKWKSTIDIMENRE
                     "
     gene            <858863..>860329
                     /locus_tag="CD36_53350"
                     /db_xref="GeneID:8047994"
     mRNA            <858863..>860329
                     /locus_tag="CD36_53350"
                     /product="DnaJ family chaperone protein, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_002420585.1"
                     /db_xref="GeneID:8047994"
     CDS             858863..860329
                     /locus_tag="CD36_53350"
                     /inference="similar to AA sequence:UniProt:P35191"
                     /inference="similar to AA sequence:UniProt:Q59NY3"
                     /note="Similar to S. cerevisiae MDJ1;
                     In S. cerevisiae: involved in folding of mitochondrially
                     synthesized proteins in the mitochondrial matrix;
                     localizes to the mitochondrial inner membrane; member of
                     the DnaJ family of molecular chaperones"
                     /codon_start=1
                     /transl_table=12
                     /product="DnaJ family chaperone protein, mitochondrial
                     precursor, putative"
                     /protein_id="XP_002420630.1"
                     /db_xref="GeneID:8047994"
                     /db_xref="GOA:B9WHR8"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:B9WHR8"
                     /translation="MRIASARFVRTGLRSFKPRTFASGRLPYTYVATRAFHSSRIRAI
                     DFDPYKTLGVDKSADDKQIKKAYYDLVKKYHPDVNKEKDAEKRFHKIQESYELLRDKE
                     KRAQYDQFGASAFDANGNANPFAGQRGNPFGGFGGASAGGNPFSSMGFDFEDLFREAF
                     AGGRGAGGGGRGGRSFVTEHVGDNIEVLKTIPFKDSIFGTSVTINYKAVDSCTTCSGS
                     GLKSGAKKNTCPTCHGAGQTTHVMGGFHMSSTCPTCQGAGVTISKSDECGTCHGHGVK
                     EIPKSKTVEIPAGVSDGTRIRIPGAGDAPMVTKDPYNQLVNGDLIIRINVQKDPIFSR
                     NKNDLVINEEILMTTAALGGEIVVPTLDGQKIKLKVRPGVQNGRKLTIPEKGVPINRN
                     LNNRGNLEVILNVKTVVPETPTQKALLEALADTFNDKNAKRTDADWSLDIEDDKNGKI
                     NETFDESDLHPSKLKRIGKVLGKFFNFEQNDKDTKNNK"
     gene            <861102..>862790
                     /gene="HEX1"
                     /locus_tag="CD36_53360"
                     /db_xref="GeneID:8048222"
     mRNA            <861102..>862790
                     /gene="HEX1"
                     /locus_tag="CD36_53360"
                     /product="N-acetyl-beta glucosaminidase, putative"
                     /transcript_id="XM_002420586.1"
                     /db_xref="GeneID:8048222"
     CDS             861102..862790
                     /gene="HEX1"
                     /locus_tag="CD36_53360"
                     /EC_number="3.2.1.52"
                     /inference="similar to AA sequence:UniProt:P43077"
                     /note="In C. albicans: highly glycosylated enzyme that is
                     secreted to the periplasm and to the culture medium;
                     required for full virulence; may have role in scavenging
                     for carbon or nitrogen;
                     No apparent orthologue in S. cerevisiae;
                     beta-N-acetylhexosaminidase, putative; beta-hexosaminidase
                     precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="N-acetyl-beta glucosaminidase, putative"
                     /protein_id="XP_002420631.1"
                     /db_xref="GeneID:8048222"
                     /db_xref="GOA:B9WHR9"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR015883"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR025705"
                     /db_xref="InterPro:IPR029018"
                     /db_xref="InterPro:IPR029019"
                     /db_xref="UniProtKB/TrEMBL:B9WHR9"
                     /translation="MVFDKMIVFHLLLWLCNAIIHAAKVDILPAPQSIIWENDTAIII
                     NPRLLRENTSCSLLEDAFSRTVSAIEKSKWRPFPIDDFENANGKDIKTSLVDIQVDDV
                     TVDLQLGVNESYTLKINSNGIKIHAATIWGALHGLVSLQQLIVYTCDDKYVVPSSVTI
                     SDFPKFKHRGLMIDSGRNFLTVDSILEQIDIMSLSKMNSLHWHLVDSQSWPVALESYP
                     HMIKDAYSNDEVYSKNDLKYIVDYARSRGVRVIPEIDMPGHARAGWKQVDPTIVECAD
                     AFWSDAAVEPPPGQLNIESEKTYEVISNVYNELSDIFVDDVFHVGNDELQEKCYSAQL
                     SPNNTVTDLLRRYLKKTLPIFNKINHRKLTMWDDVLLSDVSVDNIPSNITLQVWHEIG
                     GVKNLTSRGYDVVVSSSDFLYLDCGYAGWVTNDPRYVEIPENIDFNTGQGGSWCGPYK
                     SYQRIYNFDFTANLTEAEKEHVLGAEAALWSEQVDSTVLTTKIWPRTTALAELTWSGN
                     KDRKGHHRGYEFTQRILNFREYLIKLGYNVSPLVPKYCLLNPHACDLYKTPPVY"
     gene            <863457..>864455
                     /locus_tag="CD36_53370"
                     /db_xref="GeneID:8048040"
     mRNA            <863457..>864455
                     /locus_tag="CD36_53370"
                     /product="geranylgeranyl diphosphate synthase, putative"
                     /transcript_id="XM_002420587.1"
                     /db_xref="GeneID:8048040"
     CDS             863457..864455
                     /locus_tag="CD36_53370"
                     /EC_number="2.5.1.10"
                     /EC_number="2.5.1.29"
                     /inference="similar to AA sequence:UniProt:Q12051"
                     /inference="similar to AA sequence:UniProt:Q59NY1"
                     /note="Similar to S. cerevisiae BTS1;
                     In S. cerevisiae: increases the intracellular pool of
                     geranylgeranyl diphosphate, suppressor of bet2 mutation
                     that causes defective geranylgeranylation of small
                     GTP-binding proteins that mediate vesicular traffic;
                     geranylgeranyl pyrophosphate synthetase, putative;
                     [includes: dimethylallyltranstransferase (ec 2.5.1.1)
                     geranyltranstransferase (ec 2.5.1.10);
                     farnesyltranstransferas (ec 2.5.1.29)]"
                     /codon_start=1
                     /transl_table=12
                     /product="geranylgeranyl diphosphate synthase, putative"
                     /protein_id="XP_002420632.1"
                     /db_xref="GeneID:8048040"
                     /db_xref="GOA:B9WHS0"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR017446"
                     /db_xref="UniProtKB/TrEMBL:B9WHS0"
                     /translation="MQIDINKLIQPTEAYVPESSDPIVQPYTYISETPSNNQNVRTRF
                     LHAFNDLFYKISDESLLTKISEIISVFHNSSLLIDDIEDDSKYRRGVPVAHVKYGIPS
                     TLNCGNLMYFVALQQAQQLSGPHGSMEIKFKSSQILIDELLNLHRGQGLDIYWRDYLK
                     KLEKLPDVEEYLEMIKDKTGGLFRLAIKLLSLYSDIKENDQLISLANLMGILYQVRDD
                     YLNLVDAKYSAMKGTICEDLIEGKLSLPILHCLRTTKDSPVHKILYDYDSSSDRMSQN
                     TLIDLSLSFMKNESKSLEYTLNLIKVLEKKLRHLILKYPESENSALLKIVERLCDL"
     gene            complement(<864452..>865075)
                     /locus_tag="CD36_53380"
                     /db_xref="GeneID:8048223"
     mRNA            complement(<864452..>865075)
                     /locus_tag="CD36_53380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420588.1"
                     /db_xref="GeneID:8048223"
     CDS             complement(864452..865075)
                     /locus_tag="CD36_53380"
                     /inference="similar to AA sequence:UniProt:Q59NY0"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420633.1"
                     /db_xref="GeneID:8048223"
                     /db_xref="UniProtKB/TrEMBL:B9WHS1"
                     /translation="MFSSSSARPPTNMTTRSGKRTNNTIIRKSLRIQAKLQKKNAEHD
                     LDVKRYQELLKKNLENDIPPKRVKGKKKASGKPDDQNVSAPLMLPQRPKFTSTQKANE
                     EIKSNYSNTDALPPSLMQARTKSFENRVQLQYTYPELIKLINDNLSRNTIDISLVHNF
                     APKNLELEQQRFAIPSNFYKQTNYSSSITDEIEFFFCETIKNELPLV"
     gene            <865174..>866073
                     /locus_tag="CD36_53390"
                     /db_xref="GeneID:8048224"
     mRNA            <865174..>866073
                     /locus_tag="CD36_53390"
                     /product="diphthamide biosynthesis methyltransferase,
                     putative"
                     /transcript_id="XM_002420589.1"
                     /db_xref="GeneID:8048224"
     CDS             865174..866073
                     /locus_tag="CD36_53390"
                     /EC_number="2.1.1.98"
                     /inference="similar to AA sequence:UniProt:P32469"
                     /inference="similar to AA sequence:UniProt:Q59NX9"
                     /note="Similar to S. cerevisiae DPH5;
                     In S. cerevisiae: methyltransferase required for synthesis
                     of diphthamide, which is a modified histidine residue of
                     translation elongation factor 2 (Eft1p or Eft2p);
                     diphthine synthase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="diphthamide biosynthesis methyltransferase,
                     putative"
                     /protein_id="XP_002420634.1"
                     /db_xref="GeneID:8048224"
                     /db_xref="GOA:B9WHS2"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR004551"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="UniProtKB/TrEMBL:B9WHS2"
                     /translation="MLYLIGLGLSYETDITVRGLETVKKCKRVYLEAYTSILMAANQE
                     SLEKFYGREIILADRELVETGSDDILKDADKEDVAFLVVGDPFGATTHTDLVIRAREL
                     GIKVESIHNASVMNAVGACGLQLYQFGQTVSLVFFTDTWKPDSFYGKIMENRKIGLHT
                     LLLLDIKVKEQSIENMARGRLIYEPPRYMDIATAAQQLLEIESMRQEQAYTPNTPCVA
                     ISRLGSPTQTFKAGTLQELSEYESGEPLHSLVMLGRQVHELELEYLYQFVDDKEKFKK
                     VVEEDQEYFKPAPYVPPEDVDCE"
     gene            complement(<866225..>867469)
                     /locus_tag="CD36_53400"
                     /db_xref="GeneID:8048225"
     mRNA            complement(<866225..>867469)
                     /locus_tag="CD36_53400"
                     /product="esterase/lipase, putative"
                     /transcript_id="XM_002420590.1"
                     /db_xref="GeneID:8048225"
     CDS             complement(866225..867469)
                     /locus_tag="CD36_53400"
                     /inference="similar to AA sequence:UniProt:P53324"
                     /inference="similar to AA sequence:UniProt:Q59NX4"
                     /inference="similar to AA sequence:UniProt:Q9HDV1"
                     /note="Similar to S. cerevisiae SAY1"
                     /codon_start=1
                     /transl_table=12
                     /product="esterase/lipase, putative"
                     /protein_id="XP_002420635.1"
                     /db_xref="GeneID:8048225"
                     /db_xref="InterPro:IPR019436"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WHS3"
                     /translation="MLSFKGWKILLSIPIKLLSVLLKYPFSGGVNKKFQYDLLNSLKL
                     ILYRTALHMPVRESALLSIMSNHFILNILIKTLYPTLTKLPNYGKKYDKQSYWLVKSR
                     DRKPSDPILIFLHGGGYFFETMPCQIESLLSIYHVLDAPKKSNLSILVLDYKLASRGY
                     KIPYQLTQLIETYINLVNDGNTNMMLMGDSAGGNLALTFLQHLRLDHVNLPYPTSTIL
                     ISPWVKLAPDAIQNTPGYSYYDNTPVDMIQVDFFRDVEKQNAILGDIEHTELTISPGN
                     CLYRHEDWEDIPSLVEPGHSVFVIVGEHECFRDDVLEWCHFALKSPLISQRDDSKGIF
                     NPKIHEYIRNTDNFAYVEVVVEPWGVHDSVLYFENTIISKVKKNPKLKVNSLNSHEYF
                     GFIKLANFLNNVLPGSSQPKSV"
     gene            complement(<868421..>870793)
                     /locus_tag="CD36_53410"
                     /db_xref="GeneID:8048226"
     mRNA            complement(<868421..>870793)
                     /locus_tag="CD36_53410"
                     /product="zinc cluster transcription factor, putative"
                     /transcript_id="XM_002420591.1"
                     /db_xref="GeneID:8048226"
     CDS             complement(868421..870793)
                     /locus_tag="CD36_53410"
                     /inference="similar to AA sequence:UniProt:Q45U13"
                     /inference="similar to AA sequence:UniProt:Q59NX5"
                     /note="possibly fungus-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc cluster transcription factor, putative"
                     /protein_id="XP_002420636.1"
                     /db_xref="GeneID:8048226"
                     /db_xref="GOA:B9WHS4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:B9WHS4"
                     /translation="MSAPAVEIIKVPKKRNRRIPDDQRQKVSSACDNCKKRKFKCSGE
                     KPCFECSKKGYDCTYTIIDKRSLRGERMAKLKQKKDNDEKQRESLNEQFTQSSNVQPH
                     INPALPISEYANLVYQSSRHSPVSGNDGHYSMYHLPSQSSIPQSLPTIVLPDPIKDAR
                     SRGILTPGSTPNSVSSESSASSVCVPKSLQPLLSFPLENNNNLRHKSEEPEMDNNAIN
                     VSKKGGISNQDGKSAILLVDKSGIFRYMGETSPLSVLYEARGIFYEYVGSTKLTEDLR
                     GCPVIDKPLKITLKEVVPLPPPNERDVYIEQFKVNINGAYFMFDIDRFYEDIVDKVYQ
                     NPNSEAVQESRVLLYFVLAIGSTYKDFSEKNPQAEKGALYFQSGRLILRDLVEDSAMW
                     CVLCHYLQFHYYESILKKSTALSHLSMAINYAQSLGLHRNFVNEQFSKITSEYEYRKK
                     LFRSLYISDRISSVFIGRPLIINDYDWDDPARFKRSDASGVPVDFNSKCHIELTRICT
                     LVGRIVANFYQDKMIDVKKTKNLAIQLRLWLKSLDPDLAFNNILKPSELSNNEDNANT
                     VILLGIHVLHLWAIMLLSRPFFMFEAVSKLNPEMRKSFEEEELSKQLCQAATKASILA
                     IKLMTHYINTTFHEMKRMECYVIITCCFYASIILGITILSGTSEDAGYTENDLMNSLK
                     DAQYIMSQFSVCNKGAERYSEINRDLISALINRHKSKELKPVLDNWSCDLFTDFSFMD
                     RSGQNDVQTMMEFQQFFVSSDLIQFEEINDGSSCLPFDYNNYNLFFGDKL"
     gene            <872945..>873805
                     /locus_tag="CD36_53420"
                     /db_xref="GeneID:8048227"
     mRNA            <872945..>873805
                     /locus_tag="CD36_53420"
                     /product="aldolase, putative"
                     /transcript_id="XM_002420592.1"
                     /db_xref="GeneID:8048227"
     CDS             872945..873805
                     /locus_tag="CD36_53420"
                     /EC_number="4.1.2.17"
                     /inference="similar to AA sequence:UniProt:A3LVJ4"
                     /inference="similar to AA sequence:UniProt:Q4WXK2"
                     /inference="similar to AA sequence:UniProt:Q59NX6"
                     /inference="similar to AA sequence:UniProt:Q9P5M9"
                     /note="class II aldolase/adducin domain protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="aldolase, putative"
                     /protein_id="XP_002420637.1"
                     /db_xref="GeneID:8048227"
                     /db_xref="GOA:B9WHS5"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="UniProtKB/TrEMBL:B9WHS5"
                     /translation="MSPTSTTQQPVTSRGYEIGTRGSHNIAKGGKHPYQIPKFTDKKE
                     ERKWMLQHMAGAFRVFARKGYTEGTAGHISIRDPIDPNTFWINPLGKHFGLLKASDMV
                     HVDHEGNILPDGSQIAINAAGFSIHSALHHARPDVHAACHTHSVYGKAWSAMGKPLEM
                     INQDVCTFYKSHAVYEDFGGVALEAEEGTHIAEALGDGKGVILQNHGLLTVGNTVDEA
                     AYLFTLLEKSCQVQLAAQAALVPGEKFKIIGDEEAAYCERNDGDPETLYTEFQPDFEM
                     EVYLNDDFLK"
     gene            <874594..>875991
                     /locus_tag="CD36_53430"
                     /db_xref="GeneID:8048228"
     mRNA            <874594..>875991
                     /locus_tag="CD36_53430"
                     /product="esterase/lipase, putative"
                     /transcript_id="XM_002420593.1"
                     /db_xref="GeneID:8048228"
     CDS             874594..875991
                     /locus_tag="CD36_53430"
                     /inference="similar to AA sequence:UniProt:P53324"
                     /inference="similar to AA sequence:UniProt:Q59NX8"
                     /inference="similar to AA sequence:UniProt:Q9HDV1"
                     /note="Similar to S. cerevisiae SAY1"
                     /codon_start=1
                     /transl_table=12
                     /product="esterase/lipase, putative"
                     /protein_id="XP_002420638.1"
                     /db_xref="GeneID:8048228"
                     /db_xref="InterPro:IPR019436"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WHS6"
                     /translation="MSLSRYTYKTNASSFGIVSKPNFYSKSNDYFFYAIAFSLSLIRE
                     FIVKKMISIQGLVILLSIPIKLLIVLLKYPFVGGINPKFRNSLIGSFKMTVYKTALSI
                     PVKDSGFLSIMSNYFIINKLIKTLYPTLTTLPNYGKKYDKQSYWLVESKDRKPSDPVL
                     IFLHGGGYFIQTMPSQIESLLSIYHLLEEPQKKKLSILVLDYKLASHGHKIPYQLTEL
                     IDTYTNLVKDGSKNILLMGDSAGGNLALIFLQALKIDKLNLPYPSSVLLISPWVKLAA
                     DNIQNTPGHSYYDNAAYDMIPFNSHASEVLEYLLEDSRVYSLTISPGNCPYHETDWKD
                     IPTLNHPGYSVFVIAGEHECFRDDVLEWANHALQSPLTPQKGDSQGRFNPKTHEYIRD
                     IPETAYAEVVVEPWGVHDSVLYFENSIISLLKNNPRLNVKSLNKVEYFGITKIVGFLN
                     KTLSSEEKKGVKPLL"
     gene            complement(<876396..>877295)
                     /locus_tag="CD36_53440"
                     /db_xref="GeneID:8048229"
     mRNA            complement(<876396..>877295)
                     /locus_tag="CD36_53440"
                     /product="diphthamide biosynthesis methyltransferase,
                     putative"
                     /transcript_id="XM_002420594.1"
                     /db_xref="GeneID:8048229"
     CDS             complement(876396..877295)
                     /locus_tag="CD36_53440"
                     /EC_number="2.1.1.98"
                     /inference="similar to AA sequence:UniProt:P32469"
                     /inference="similar to AA sequence:UniProt:Q59NX9"
                     /note="Similar to S. cerevisiae DPH5;
                     In S. cerevisiae: methyltransferase required for synthesis
                     of diphthamide, which is a modified histidine residue of
                     translation elongation factor 2 (Eft1p or Eft2p);
                     diphthine synthase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="diphthamide biosynthesis methyltransferase,
                     putative"
                     /protein_id="XP_002420639.1"
                     /db_xref="GeneID:8048229"
                     /db_xref="GOA:B9WHS2"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR004551"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="UniProtKB/TrEMBL:B9WHS2"
                     /translation="MLYLIGLGLSYETDITVRGLETVKKCKRVYLEAYTSILMAANQE
                     SLEKFYGREIILADRELVETGSDDILKDADKEDVAFLVVGDPFGATTHTDLVIRAREL
                     GIKVESIHNASVMNAVGACGLQLYQFGQTVSLVFFTDTWKPDSFYGKIMENRKIGLHT
                     LLLLDIKVKEQSIENMARGRLIYEPPRYMDIATAAQQLLEIESMRQEQAYTPNTPCVA
                     ISRLGSPTQTFKAGTLQELSEYESGEPLHSLVMLGRQVHELELEYLYQFVDDKEKFKK
                     VVEEDQEYFKPAPYVPPEDVDCE"
     gene            complement(<877641..>878525)
                     /locus_tag="CD36_53450"
                     /db_xref="GeneID:8048230"
     mRNA            complement(<877641..>878525)
                     /locus_tag="CD36_53450"
                     /product="phytanoyl-CoA dioxygenase family protein,
                     putative"
                     /transcript_id="XM_002420595.1"
                     /db_xref="GeneID:8048230"
     CDS             complement(877641..878525)
                     /locus_tag="CD36_53450"
                     /inference="similar to AA sequence:UniProt:Q4WZT3"
                     /inference="similar to AA sequence:UniProt:Q59N64"
                     /note="phytanoyl-CoA dioxygenase is a peroxisomal enzyme
                     that catalyses the first step of phytanic acid
                     alpha-oxidation"
                     /codon_start=1
                     /transl_table=12
                     /product="phytanoyl-CoA dioxygenase family protein,
                     putative"
                     /protein_id="XP_002420640.1"
                     /db_xref="GeneID:8048230"
                     /db_xref="GOA:B9WHS8"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="UniProtKB/TrEMBL:B9WHS8"
                     /translation="MPAKLSNKYHDEIEQNGFTVVRNFLSPQEIEKYTKASEALVQYA
                     RDGNWPHVRTRGKQFPPWPKNFSPDIWGVSGLLHPDLGELSKPFHDLYSDEKLLDVVC
                     DILLIEKTDLSMELLNMLINPLTDFELDWHRDTIKPEVTVEEEAQDLLKFPYAGAQFN
                     LALTEDDCLIAIPGSHNRVRTTEEREKTIDPNRRKEFITGEIRVELHPGDLVFYNNNI
                     LHRAAYSSKNKRLTLHGSYGNVNQGRSRAKGILQHGVAEWLPRLQTDNANLKMLQEKL
                     LKLAKEFEGVELGYALDG"
     gene            <879332..>880174
                     /locus_tag="CD36_53460"
                     /db_xref="GeneID:8048231"
     mRNA            <879332..>880174
                     /locus_tag="CD36_53460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420596.1"
                     /db_xref="GeneID:8048231"
     CDS             879332..880174
                     /locus_tag="CD36_53460"
                     /inference="similar to AA sequence:UniProt:Q59N86"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420641.1"
                     /db_xref="GeneID:8048231"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:B9WHS9"
                     /translation="MSNESLSKASIRKINDNAVTISTPYTVFRILNFGSRMSLINFDG
                     NIVIYSPIKYDQEVFDKAIKILFENQENPQYEVKYVIAANDEHNLWAHVYKEKFGSKI
                     IAGENCKLKNNCKADYIVTPQIYNKVIKGSMWQEELNVSDPFMQNLELIGLGNHVIHD
                     LELFDTTTKTLYVGDSVYNLGVPGTTSGNVILEQYSPELGYAKGYNPHGWFSFLTRYL
                     QPDSAVCRYLANYAAGTKTEQGRQAIQSVYNWDFDKLVMIHGNVIEKDGKDAWKKLFS
                     TSLV"
     gene            <880711..>881532
                     /locus_tag="CD36_53470"
                     /db_xref="GeneID:8048232"
     mRNA            <880711..>881532
                     /locus_tag="CD36_53470"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420597.1"
                     /db_xref="GeneID:8048232"
     CDS             880711..881532
                     /locus_tag="CD36_53470"
                     /inference="similar to AA sequence:UniProt:Q59N67"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420642.1"
                     /db_xref="GeneID:8048232"
                     /db_xref="UniProtKB/TrEMBL:B9WHT0"
                     /translation="MGYPSPLKVVTKKISANVLTVSSPFSILNKLNVGARMVIFHYHG
                     DIIIWSPLPYDKEILENAIAQLTTKEYTVKYIFVINIEHNLCAEKYKEIYPTVKLIGP
                     ENTSRCEISIPLTEDNALKIIKGTAGWGNLGISNKSIVDNFELIYNNAHKNRELVIYE
                     KNDKLLLLADMIMNLGIHGTTTGEYVLEQYSPELGFPEGFNPHGGWSFLSRYLQPNSI
                     VGKFLMNRLQKTRQTPEKTKKVMELINSWDYTTIIMVHGDLITKEAKQTLSNVHL"
     gene            <884801..>885223
                     /locus_tag="CD36_53480"
                     /db_xref="GeneID:8048233"
     mRNA            <884801..>885223
                     /locus_tag="CD36_53480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420598.1"
                     /db_xref="GeneID:8048233"
     CDS             884801..885223
                     /locus_tag="CD36_53480"
                     /inference="similar to AA sequence:UniProt:Q59N68"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420643.1"
                     /db_xref="GeneID:8048233"
                     /db_xref="UniProtKB/TrEMBL:B9WHT1"
                     /translation="MSSSSSALPSELVLDATASTTATVTPSLTDLQLATGIRAEKNSQ
                     ATIASDSVQTISASVTSQLVYASVSSQLTNAIGSFTASSDVKALTLSSASSSSKSSGS
                     SNASASVNSNSGNSIDLKKIKYGIILSSITVLSFVCSF"
     gene            complement(<885902..>888778)
                     /locus_tag="CD36_53490"
                     /db_xref="GeneID:8048234"
     mRNA            complement(<885902..>888778)
                     /locus_tag="CD36_53490"
                     /product="mRNA transport regulator, putative"
                     /transcript_id="XM_002420599.1"
                     /db_xref="GeneID:8048234"
     CDS             complement(885902..888778)
                     /locus_tag="CD36_53490"
                     /inference="similar to AA sequence:UniProt:Q59N69"
                     /inference="similar to AA sequence:UniProt:Q99189"
                     /note="Similar to S. cerevisiae MTR10;
                     In S. cerevisiae: mediates the nuclear localization of
                     proteins involved in mRNA-nucleus export; promotes
                     dissociation of mRNAs from the nucleus-cytoplasm mRNA
                     shuttling protein Npl3p; nuclear import/export receptor,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="mRNA transport regulator, putative"
                     /protein_id="XP_002420644.1"
                     /db_xref="GeneID:8048234"
                     /db_xref="GOA:B9WHT2"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B9WHT2"
                     /translation="MSSGTIAQLNSALVTMYSNVPQQEKMTATHYLEEFQKSQQAWDI
                     VHQILNNDDDNANIQLKVFAAQTLRSKIIYDLSAQFPESNFENLKNSLLDILGKYTAP
                     NQKLIRTQLSIALSHFALQYLSWRNALSEIINKLSSSETLLPVLLEFLKILPEELSDV
                     KKTNLTDSEFNQRTQELISDNVEQVMMILKNLTESNTSNNASLNSSILDCLNGWIKEC
                     AVEQVLQVNSLVSLVFQSLSNDQTFEKAIECLVTIIRETRDIDNYEIIDALYQQVLQL
                     NKYMHENTPEKLEDPDYMDGLTRLYVECGESWHVLIGKNPAHFKPLVLIILECTKYEE
                     DLDIVKYTFQFWYQLKQLITLPKFQESKVEFSDIYLQLITVIIKHLTYPISSNDNDLF
                     NGDKEQEDKFKEFRYEMGDVLKDCCAVAGATKALQVPFEQIQNIISNSQGQWQYLEAP
                     LFSMRTMAKEVPLKEKTILPTIMSYLVQLPEHPKIRYAATLVLGRYTEWTSKHPEFLE
                     PQLNYITKGFEVADKNNDIIMATSHALMYFCQDCSALLVNYLEQLYMLYGQVKDQMDL
                     ESNYELADGLAHVIAKVPEANLYKTTEMFIEPTMNYLTKVLTETATDEINKLIADQIE
                     VISIFIEVLKCPDSDWEKPKYPVADLFVDKIWPLTTQILSKFGSSVIVSERCMKLLKN
                     AIKSFGLFLSGILPDLANLLHQGLQSTQFGCYIWVTGVLIREFGDEYSTEAIKNAVYE
                     FGLQQSLTVFDLLFSKNEQQLKQIPDVIEDFFHMINDLLMFYPFQLIPKFDILKNIFK
                     VVDLTLSYVNEFEPIISCIHFMIDLISWGLPHPPISLFDMGDTTSLREAVQQFLLIDN
                     QGGELLRVTLNGILFKFHNDIQQDANDLILKILIVVPNNDIALGWLKQVVEALPNVNE
                     KETGRLLNTVKVALPNKDNRRVRSALRDFINWYSRRNVTPRSEF"
     gene            complement(<889185..>890324)
                     /locus_tag="CD36_53500"
                     /db_xref="GeneID:8048235"
     mRNA            complement(<889185..>890324)
                     /locus_tag="CD36_53500"
                     /product="NAD(+)-dependent formate dehydrogenase,
                     putative"
                     /transcript_id="XM_002420600.1"
                     /db_xref="GeneID:8048235"
     CDS             complement(889185..890324)
                     /locus_tag="CD36_53500"
                     /EC_number="1.2.1.2"
                     /inference="similar to AA sequence:UniProt:Q08911"
                     /inference="similar to AA sequence:UniProt:Q59N71"
                     /note="Similar to S. cerevisiae FDH1; formate
                     dehydrogenase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="NAD(+)-dependent formate dehydrogenase,
                     putative"
                     /protein_id="XP_002420645.1"
                     /db_xref="GeneID:8048235"
                     /db_xref="GOA:B9WHT3"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:B9WHT3"
                     /translation="MGKPKVLMALYSGGKHAKEEPRLLGTVENELGIRKLVEEHGYEL
                     VTTADKDPFPSSTFDKNLPDAEIIITTPFFPAYVTKERIAKAPKLKLCVTAGVGSDHY
                     DLNALNERGIAVLEVTGSNVQSVAEHAIMTMLILLRNYGEGHAQATQGTWDIAAVAKD
                     EFDMEDKVFATIGAGRIGYRILERLIAFNPKKLLYYDYQPLPEEAINKLNAASKLFNG
                     VDNIIERVENLEDLVSQADVVTLNCPLYEKSKGMFNKELISKMKKGSYVINTARGALT
                     DPQAIADAVNSGHIAYGGDVWPVQPAPKDMPWRTMHNPYGKDYGNAMTVHVSGTSLDA
                     QARYANGVKQILTEYFDKTYKYRPQDVICIDGHYATKAYGQRTTK"
     gene            complement(<891601..>892107)
                     /locus_tag="CD36_53510"
                     /db_xref="GeneID:8048236"
     mRNA            complement(<891601..>892107)
                     /locus_tag="CD36_53510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420601.1"
                     /db_xref="GeneID:8048236"
     CDS             complement(891601..>892107)
                     /locus_tag="CD36_53510"
                     /inference="similar to AA sequence:UniProt:Q59N72"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420646.1"
                     /db_xref="GeneID:8048236"
                     /db_xref="UniProtKB/TrEMBL:B9WHT4"
                     /translation="IPISSLLDASPVNEITDNSDSIDEIGLLPDHVRYEILYYFNIKD
                     GEPTLRDGYSRKNNGYVEINFLTGDHYDPSLDTYVAETSGYNKRTNVGLSRTRFNKHR
                     IGYQYNRSGFDDISKCKTMDTGPITIKMADLLPSLTDMSETPSNVSSSSYRETHKRKR
                     EEDTLENN"
     gene            <892728..>893300
                     /locus_tag="CD36_53520"
                     /db_xref="GeneID:8048237"
     mRNA            <892728..>893300
                     /locus_tag="CD36_53520"
                     /product="guanylate kinase, putative"
                     /transcript_id="XM_002420602.1"
                     /db_xref="GeneID:8048237"
     CDS             892728..893300
                     /locus_tag="CD36_53520"
                     /EC_number="2.7.4.8"
                     /inference="similar to AA sequence:UniProt:P15454"
                     /inference="similar to AA sequence:UniProt:Q59N73"
                     /note="Similar to S. cerevisiae GUK1;
                     In S. cerevisiae: converts GMP to GDP; required for growth
                     and mannose outer chain elongation of cell wall N-linked
                     glycoproteins"
                     /codon_start=1
                     /transl_table=12
                     /product="guanylate kinase, putative"
                     /protein_id="XP_002420647.1"
                     /db_xref="GeneID:8048237"
                     /db_xref="GOA:B9WHT5"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="InterPro:IPR017665"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WHT5"
                     /translation="MSSSANRPIVISGPSGTGKSTLLKKLFAEYPDRFGFSVSNTTRK
                     PRPGEVDGKDYNFSTVEEFKKLIDENKFIEWAQFSGNYYGTTIKAVKDVAEQGRTCLL
                     DIDMQGVKSVKKTDLNARYLFISPPSIEELKSRLTGRGTETEDSLQKRIAAASDEMEY
                     AQTGAHDKIIVNDDLDKAYAEFKKFIVDEQ"
     gene            <893665..>894248
                     /locus_tag="CD36_53530"
                     /db_xref="GeneID:8048238"
     mRNA            join(<893665..893708,893825..>894248)
                     /locus_tag="CD36_53530"
                     /product="hypoxia-induced protein, putative"
                     /transcript_id="XM_002420603.1"
                     /db_xref="GeneID:8048238"
     CDS             join(893665..893708,893825..894248)
                     /locus_tag="CD36_53530"
                     /inference="similar to AA sequence:UniProt:Q03713"
                     /inference="similar to AA sequence:UniProt:Q59N74"
                     /note="contains hypoxia induced protein conserved region
                     (Pfam:PF04588);
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="hypoxia-induced protein, putative"
                     /protein_id="XP_002420648.1"
                     /db_xref="GeneID:8048238"
                     /db_xref="GOA:B9WHT6"
                     /db_xref="InterPro:IPR007667"
                     /translation="MSVRLPSSMSYGEEEEPDVLQKMWEKSKQQPFVPLGSLLTAGAV
                     LLAARSMKRGEKLKTQRYFRYRIGFQLATLVALVGGGFYYGTETSEHKQIREDKLREK
                     AKQREKLWIEELERRDSIIQARKQRLEESKKELRELAKQGFIEEKESNDEKED"
     gene            complement(<894416..>895108)
                     /locus_tag="CD36_53540"
                     /db_xref="GeneID:8048239"
     mRNA            complement(<894416..>895108)
                     /locus_tag="CD36_53540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420604.1"
                     /db_xref="GeneID:8048239"
     CDS             complement(894416..895108)
                     /locus_tag="CD36_53540"
                     /inference="similar to AA sequence:UniProt:Q59N75"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420649.1"
                     /db_xref="GeneID:8048239"
                     /db_xref="UniProtKB/TrEMBL:B9WHT7"
                     /translation="MYANQRLSMFQSHLDHKQKRTIPSFPFSSIEEQEKYEVSKSLNH
                     VTTLKSTNLRVLPSPSPSVYSLGIGSNFSTDSVQQQERPSPPPPRRLISKLPITPISP
                     TPEPDAVETKLVLNDVVKDFHNGKVLCLSKDDDEEKIEIDNDSVIYDTINEISEDKFT
                     TNYDAIILNKLGQESSYEISTYLKNLHNDTVVVIRDEFEIDNDNNNNEKLDFDFYVDL
                     ENSVIVDITKRK"
     gene            complement(<895599..>897845)
                     /locus_tag="CD36_53550"
                     /db_xref="GeneID:8048240"
     mRNA            complement(<895599..>897845)
                     /locus_tag="CD36_53550"
                     /product="bud site selection protein, putative"
                     /transcript_id="XM_002420605.1"
                     /db_xref="GeneID:8048240"
     CDS             complement(895599..897845)
                     /locus_tag="CD36_53550"
                     /inference="similar to AA sequence:UniProt:Q08754"
                     /inference="similar to AA sequence:UniProt:Q4WYF0"
                     /inference="similar to AA sequence:UniProt:Q59N76"
                     /note="Similar to S. cerevisiae BUD7; cargo-proteins
                     export protein, ChAPs family member, putative;
                     clathrin-coated vesicle protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="bud site selection protein, putative"
                     /protein_id="XP_002420650.1"
                     /db_xref="GeneID:8048240"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR015374"
                     /db_xref="UniProtKB/TrEMBL:B9WHT8"
                     /translation="MLPPTLSSIPEVKEEYPGACLIERTARLPQFIELGPPDLCNIHK
                     YSVNAKRENEIGTFLYFTGVDTSNTASIAAHLQNIANLMTNKSQYWFGEKKHWKVPEL
                     TYCTFNAFSKIDLRVTVHIPGKFEMQIIGQDGKLINDKLTDEELDKLWSETFLTSIVR
                     AVLESEDGDEVNKVGGLVEVRKINPFNNGITSKELLNNFLLAFEQLFFQGVKLGCNVE
                     IPQPTIINNYLVDGFIKVIQLTQSYDRGIEVLQKLHKVEPSVISLIAKLQLLKQDEIE
                     AVKTMNQGIQENRRDSDLLVLQAEFCLEKKKPELALELAKQAVKSSPSDFKTWAILVQ
                     IYTKLGDFENALLTLNSCPMNSHKEKYFLKRVVPIKSNDDLHLPSPTDVTLDQVSNLQ
                     SNEISYEQRNLDPSLVNLPAGNLKSTFAKAYDLLTEIVVKTGWESLLKYRAKVFVMEE
                     EYRKDRQSSATGVGVGVNGSQTRKNSTTSTANNGTEAPPTTSATANTTSPPDSDAAST
                     VAIKSPGPSNDTEDTTSNVSYDDEFRKKRLCERWLDNLFMLLYEDLRAYTMWQAESLH
                     FQAQQMEYKKTTLEWEILGSIAFRLKHFKEGSIAFANALSGRFSAKSQRELLKYYLME
                     RSKLLSKNSSNQSSTFIHSYTKMMNQLNEKILESIIKLLVWNHRWYSDFSSFLLLTLS
                     DLVAWEGSVKINSSVTALYSEAKTSSSSTSTSNTSNDHISNHGIIEMMTDLDNDYIKL
                     YNLHNADE"
     gene            complement(<898177..>898878)
                     /locus_tag="CD36_53560"
                     /db_xref="GeneID:8048241"
     mRNA            complement(<898177..>898878)
                     /locus_tag="CD36_53560"
                     /product="subunit of TFIID and SAGA complexes, putative"
                     /transcript_id="XM_002420606.1"
                     /db_xref="GeneID:8048241"
     CDS             complement(898177..898878)
                     /locus_tag="CD36_53560"
                     /inference="similar to AA sequence:UniProt:Q05027"
                     /inference="similar to AA sequence:UniProt:Q59N98"
                     /note="Similar to S. cerevisiae TAF9;
                     In S. cerevisiae: involved in RNA polymerase II
                     transcription initiation and in chromatin modification;
                     transcription initiation factor TFIID subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="subunit of TFIID and SAGA complexes, putative"
                     /protein_id="XP_002420651.1"
                     /db_xref="GeneID:8048241"
                     /db_xref="GOA:B9WHT9"
                     /db_xref="InterPro:IPR003162"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:B9WHT9"
                     /translation="MSVPAPEDIRPSTSNGDQSIKDTNKPAASTSVSTNAPPPPPTSS
                     TTNNNNNNNNNNNNNNNNDNTQASQQPQEKKEKIIPRDVRLLHLIFATHAVHNYQDHV
                     PLQLMDFAHRYTKSVLKDALVYNDHSKPINTNTNLNSNTNATVNTDDIRLAIAARSNY
                     QFKPVPPKELLLELAQERNSRPLPPVIPRWGLNLPPEKYCLTAKDWDSIYDEPDEDNV
                     NNQSSQQKNKKLKTK"
     gene            <899104..>900093
                     /locus_tag="CD36_53570"
                     /db_xref="GeneID:8048242"
     mRNA            <899104..>900093
                     /locus_tag="CD36_53570"
                     /product="thiamine pyrophosphokinase, putative"
                     /transcript_id="XM_002420607.1"
                     /db_xref="GeneID:8048242"
     CDS             899104..900093
                     /locus_tag="CD36_53570"
                     /EC_number="2.7.6.2"
                     /inference="similar to AA sequence:UniProt:P35202"
                     /inference="similar to AA sequence:UniProt:Q59N99"
                     /note="Similar to S. cerevisiae THI80;
                     In S. cerevisiae: phosphorylates thiamine to produce the
                     coenzyme thiamine pyrophosphate (thiamine diphosphate)"
                     /codon_start=1
                     /transl_table=12
                     /product="thiamine pyrophosphokinase, putative"
                     /protein_id="XP_002420652.1"
                     /db_xref="GeneID:8048242"
                     /db_xref="GOA:B9WHU0"
                     /db_xref="InterPro:IPR006282"
                     /db_xref="InterPro:IPR007371"
                     /db_xref="InterPro:IPR007373"
                     /db_xref="InterPro:IPR016966"
                     /db_xref="UniProtKB/TrEMBL:B9WHU0"
                     /translation="MGTMSQESALIEQVIEQPDSLVISPPSDLSSYNHIQPFVYLEGD
                     NDNDSKTTTSQTNHNVLLILNQKITIDLISLWNKCEIIVCADGGADSLYEYFSNNNNN
                     HHHPNLQRSDYIPDYIVGDFDSISPDVKAYYQSHGSKTIRQSSEYYNDFTKSIHCIQL
                     HYQLNHENGNWFESVNNVDGLAKLWDSLDHTNRGIDITIYVLNAIGGRFDQTVQSINQ
                     LYIMNKIYPTVTVFFITVNDIIFLLKKGVNYVSFTNRLTFHKDDGLPPTCGLLPLSNS
                     TPIVLTSYGLKYDMRNWKTEMSGKVSSSNRISGETGFIVECSDDIVMNIEIDV"
     gene            <900452..>900820
                     /locus_tag="CD36_53580"
                     /db_xref="GeneID:8048243"
     mRNA            <900452..>900820
                     /locus_tag="CD36_53580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420608.1"
                     /db_xref="GeneID:8048243"
     CDS             900452..900820
                     /locus_tag="CD36_53580"
                     /inference="similar to AA sequence:UniProt:Q59N79"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420653.1"
                     /db_xref="GeneID:8048243"
                     /db_xref="InterPro:IPR013177"
                     /db_xref="UniProtKB/TrEMBL:B9WHU1"
                     /translation="MLRSILRFPPKLTIGVSVFKQFASTTTTATTTISRTVFQRPTIL
                     ASTSTTSNSLLFQYNRPHTVNFQSFIEQKEYDLDTVEDDDSNTMHALSVLRKRRLKMK
                     KHKYKKRRKAQRALRKRLGK"
     gene            <901164..>901769
                     /locus_tag="CD36_53590"
                     /db_xref="GeneID:8048244"
     mRNA            <901164..>901769
                     /locus_tag="CD36_53590"
                     /product="deoxyribonucleoside triphosphate
                     pyrophosphohydrolase, putative"
                     /transcript_id="XM_002420609.1"
                     /db_xref="GeneID:8048244"
     CDS             901164..901769
                     /locus_tag="CD36_53590"
                     /inference="similar to AA sequence:UniProt:P47119"
                     /inference="similar to AA sequence:UniProt:Q59N80"
                     /note="Similar to S. cerevisiae HAM1;
                     In S. cerevisiae: mediates exclusion of noncanonical
                     purines from deoxyribonucleoside triphosphate pools;
                     controls 6-N-hydroxylaminopurine (HAP) sensitivity and
                     mutagenesis; the HAM1 protein protects the cell from HAP
                     either on the level of deoxynucleoside triphosphate, or
                     the DNA level by a yet unidentified set of reactions"
                     /codon_start=1
                     /transl_table=12
                     /product="deoxyribonucleoside triphosphate
                     pyrophosphohydrolase, putative"
                     /protein_id="XP_002420654.1"
                     /db_xref="GeneID:8048244"
                     /db_xref="GOA:B9WHU2"
                     /db_xref="InterPro:IPR002637"
                     /db_xref="InterPro:IPR027502"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:B9WHU2"
                     /translation="MSTITFVTGNANKLKEVIAILATSGTDSSSSSSSESSNKVGKFT
                     ITNQSVDLDEVQGTIEQVTIHKAQAAAKVINGPVLVEDTCLGFNAYNDLPGPYIKWFV
                     QSIGLSGLVKMLIGFEDKSAKAICTFGYCEGPGNEVKIFQGITKGKIVESRGPTNFGW
                     DSVFQPNGFEQTYAEMDKKVKNSISHRYKALDKVRDYLLSQ"
     gene            complement(<901925..>902674)
                     /locus_tag="CD36_53600"
                     /db_xref="GeneID:8048245"
     mRNA            complement(<901925..>902674)
                     /locus_tag="CD36_53600"
                     /product="uncharacterized protein ydl173w homologue,
                     putative"
                     /transcript_id="XM_002420610.1"
                     /db_xref="GeneID:8048245"
     CDS             complement(901925..902674)
                     /locus_tag="CD36_53600"
                     /inference="similar to AA sequence:UniProt:Q12515"
                     /inference="similar to AA sequence:UniProt:Q59N81"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein ydl173w homologue,
                     putative"
                     /protein_id="XP_002420655.1"
                     /db_xref="GeneID:8048245"
                     /db_xref="InterPro:IPR022024"
                     /db_xref="UniProtKB/TrEMBL:B9WHU3"
                     /translation="MPFTTHLPTVFIILFFSFPKSSFPSFLSFLFTTSLLYHHISISF
                     SIMAYSTGRGGAGNIHSNKNKTSENNVLTPQKSKTFSPQQSNDDGTPLQKVTSQNKRV
                     YYSTGRGGAGNIKTSDQLPSPTLIPQGSNTPHLHTAKVSTGRGGYGNMVNNDDPELTR
                     KLQDVDGEPASPKDDLYAITSNKSFSVGRGGFGNVISKSRSTDSQKDGNGGGSGGNGA
                     IVPELYTVTSQPEKKVKKKHGFLGKIKEIFT"
     gene            complement(<903472..>905982)
                     /locus_tag="CD36_53610"
                     /db_xref="GeneID:8048246"
     mRNA            complement(<903472..>905982)
                     /locus_tag="CD36_53610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420611.1"
                     /db_xref="GeneID:8048246"
     CDS             complement(903472..905982)
                     /locus_tag="CD36_53610"
                     /inference="similar to AA sequence:UniProt:Q59N82"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420656.1"
                     /db_xref="GeneID:8048246"
                     /db_xref="UniProtKB/TrEMBL:B9WHU4"
                     /translation="MSTTTNKLIYKSINQDQKIQSNEIKRNGKLSLPISSTIHPYLSK
                     QSRTCPSQLHDKMSLIPKIPRNKQLLSSSSSSSYQNPQSLHKISQDDSFSFINFNEFE
                     FSQRGTLLKSKTRTSNQFFLTKNPNPNHIYNNPNFHNQNNDNNNNNSGSSDTINNDIT
                     TTSNNNNNFETNDCSIFSTLEENQKRIDTTTSTTTINNNNNISNELVDTLSIVSSNLI
                     VDDKYRLNIISDDASFQPSHGNFFHTATTTSTNNNNNNNNNNNNINNGTITTTISTAG
                     GNVGNSMITPTESTKVVVGKKLIDRLHHSLIDYTSDHVSIEQGSIDSSIESRESYDCK
                     FNIHHHHNYKEKEEEEEEEEEEGGEFGNNKCYQNIIHHNGIQYNNTGNNIVDNEIPPS
                     PSISSPSSSYMQDQPSLDLLLLSPQKSPIITSHHHHQQQKYKRKLPTTTATTTTTTTP
                     RVSKLSLLDSPNPMIPTISSKFSSTILIDDPMTINNNLMTNAIYQSKLIDHQHHQHHH
                     QQQQEEDCQWEPFQESSATTTTSSSTRTISIASKHGSLTNVIQLMKKKVRHLYNNVVH
                     NKVSKKKELISEISKIDDKSNTSRKDKTEIFEMKSVISDDDHEMKSNIGTIITTTTQN
                     KKKKKKKIKNNNTINIENHYTTTTTNNSNNNNNNPKLTEFRSSSSFNTTLNRNIITGI
                     NHDNMSSNGSIINEGYDKDEQLTGALLYIISEYPQEEEEEEEEEEEVGEVQQNHTIKS
                     KETLPHDEDRLMGKLEESSNDGDDEQSNSNLHSIESFHNQQQQQPQEVREQMMREEEN
                     DTEKEQQEDFYDNNDSNTSLENFYGLDNEFLFNSITIK"
     gene            <911591..>911848
                     /gene="CSU51"
                     /locus_tag="CD36_53620"
                     /db_xref="GeneID:8048247"
     mRNA            <911591..>911848
                     /gene="CSU51"
                     /locus_tag="CD36_53620"
                     /product="growth [negative] regulator, putative"
                     /transcript_id="XM_002420612.1"
                     /db_xref="GeneID:8048247"
     CDS             911591..911848
                     /gene="CSU51"
                     /locus_tag="CD36_53620"
                     /inference="similar to AA sequence:UniProt:Q460N1"
                     /note="regulator of sorbose utilization, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="growth [negative] regulator, putative"
                     /protein_id="XP_002420657.1"
                     /db_xref="GeneID:8048247"
                     /db_xref="UniProtKB/TrEMBL:B9WHU5"
                     /translation="MQFTKVIASLALVASINAKFHNTTGAAAGNGTVAGGSNSTGGGA
                     ASNHSGAAANGSSSKTSGSGAAVNSVTGLAALAAVGAALLY"
     gene            complement(<912606..>913112)
                     /locus_tag="CD36_53630"
                     /db_xref="GeneID:8048031"
     mRNA            complement(<912606..>913112)
                     /locus_tag="CD36_53630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420613.1"
                     /db_xref="GeneID:8048031"
     CDS             complement(912606..913112)
                     /locus_tag="CD36_53630"
                     /inference="similar to AA sequence:UniProt:Q59N83"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420658.1"
                     /db_xref="GeneID:8048031"
                     /db_xref="UniProtKB/TrEMBL:B9WHU6"
                     /translation="MYRVKPTLSCTMNDNLNSSIYSSFKQSSTLLTNTNEQLDKLWNL
                     LVKFDKISISSIDINIEENDDTTNTTTTTTRVDQFISIEKFYKLLINYHKLIELITIK
                     NNELTIMKFQCFQIIRNVQQQEQLNSKNNNFDTLSTTTSTISSSLNETGKKLQDIFNP
                     KEEFDSTL"
     gene            complement(<913328..>913921)
                     /locus_tag="CD36_53640"
                     /db_xref="GeneID:8048248"
     mRNA            complement(<913328..>913921)
                     /locus_tag="CD36_53640"
                     /product="nucleolar protein, processome small subunit
                     component, putative"
                     /transcript_id="XM_002420614.1"
                     /db_xref="GeneID:8048248"
     CDS             complement(913328..913921)
                     /locus_tag="CD36_53640"
                     /inference="similar to AA sequence:UniProt:Q05498"
                     /inference="similar to AA sequence:UniProt:Q59MK3"
                     /note="Similar to S. cerevisiae FCF1;
                     In S. cerevisiae: essential nucleolar protein that is a
                     component of the SSU (small subunit) processome involved
                     in the pre-rRNA processing steps of 40S ribosomal subunit
                     biogenesis; rRNA-processing protein,putative; ribosome
                     biogenesis protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="nucleolar protein, processome small subunit
                     component, putative"
                     /protein_id="XP_002420659.1"
                     /db_xref="GeneID:8048248"
                     /db_xref="GOA:B9WHU7"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:B9WHU7"
                     /translation="MGKAKKTRKFAAVKRTLNTKKDQRLTQNNNNNNNNNNTTTKKSD
                     DPELTRSIPQVSSALFFKYNESIKPPYQILIDTNFINFSIQKKIDIIRGLMDCLMAKC
                     IPIITDCVIGELEKLGSKYKIALKLAKDPRIQRLKCSHKGIYADDCLVNRVIQHKCYI
                     VATNDADLKRRIRKIPGIPIMSVGGHSYVIERLPDVF"
     gene            complement(<914336..>916138)
                     /locus_tag="CD36_53650"
                     /db_xref="GeneID:8048249"
     mRNA            complement(<914336..>916138)
                     /locus_tag="CD36_53650"
                     /product="calcineurin-like phosphoesterase, putative"
                     /transcript_id="XM_002420615.1"
                     /db_xref="GeneID:8048249"
     CDS             complement(914336..916138)
                     /locus_tag="CD36_53650"
                     /EC_number="3.1.-.-"
                     /inference="similar to AA sequence:UniProt:Q05924"
                     /inference="similar to AA sequence:UniProt:Q59MK4"
                     /note="Similar to S. cerevisiae DCR2;
                     In S. cerevisiae: involved in downregulation of the
                     unfolded protein response, at least in part via
                     dephosphorylation of Ire1p; dosage-dependent positive
                     regulator of the G1/S phase transition through control of
                     the timing of START; metallo-phosphoesterase, putative;
                     phosphatase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="calcineurin-like phosphoesterase, putative"
                     /protein_id="XP_002420660.1"
                     /db_xref="GeneID:8048249"
                     /db_xref="GOA:B9WHU8"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:B9WHU8"
                     /translation="MSSIKQSRPKSIFNILMMFNKQYKKLILLLIGFITLTFMIHIFN
                     STSSTISPDLSLFQAQQLQSHGFLPTSNKKSIQIISDFTILKCNIYSKCNVPKGYIQL
                     FPSLNYYHNSKIKNDYYLIIKLSSIDQTTKIITDISINKNDDESESSFYEEVVIEPGK
                     LSLYKKIQLINIDQPINDKLPILRSIDILFGNNDLIDSRPHHKSLHLSNSESIHTILS
                     LNMMTLIDQNELQEIHQQTMNLRNSQLIEITNNKYKIMQLSDLHFGQDLGRCDESNSN
                     TNENVIIDEIKCSSDLKTLKFIENSIQQENPDLIIITGDLIDINRSIDFKSILLKSLQ
                     PILAHKIKFIYTFGDEIKNHLTKISIINFLSTLPNCLNIIPDDYKYDNNNNNNNNNNN
                     NNNNNYDLKGNKMHGVTNYNFQIKQKQSSTSSSSSSSSISVTVLDSEDHLIDDSQMTY
                     LYRINNQLINDYKLLFFHYPLPQFRPKGKFKLVGSYNEKHELDDKTKLKVHDDIINCG
                     YNVISVGHEHENDACLLSKSTFDDSNKSSIWLCYNSVTGDSGITKLDKQYVRKLRLFE
                     IDFEKNRILSWKRQEKDNKPFEYQAIYEKPQLKK"
     gene            complement(<918404..>919804)
                     /locus_tag="CD36_53660"
                     /db_xref="GeneID:8048250"
     mRNA            complement(<918404..>919804)
                     /locus_tag="CD36_53660"
                     /product="MFS family transporter, putative"
                     /transcript_id="XM_002420616.1"
                     /db_xref="GeneID:8048250"
     CDS             complement(918404..919804)
                     /locus_tag="CD36_53660"
                     /inference="similar to AA sequence:UniProt:Q4WEZ5"
                     /inference="similar to AA sequence:UniProt:Q59MK5"
                     /inference="similar to AA sequence:UniProt:Q6Q5M7"
                     /note="transporter protein of the Major Facilitator
                     Superfamily (MFS), putative"
                     /codon_start=1
                     /transl_table=12
                     /product="MFS family transporter, putative"
                     /protein_id="XP_002420661.1"
                     /db_xref="GeneID:8048250"
                     /db_xref="GOA:B9WHU9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:B9WHU9"
                     /translation="MHLWKSLLQSNKDIRILWGSVFFRMANYGLTNQVLTLYLKSLNI
                     NEIKIGLFMTLTLIGDIIISYYLTWNADEKIGRRNVMIMGTIMMFFSGVIFGINIEIN
                     NETIHFYILLIAAIFGVISPSGDETGPFKSVEEASIAHLTPHNHRPEIFAFYGLFATA
                     GAAIGSLLCGILIDYWNLSLGLDIVQCYRYVFFVYSGIALIKFSLMMGLSEKCEINNK
                     YHIPTTTTTSSSSNNEDSPLLTEGNESSDDLDNTSILSTGTKISKLSNISKYYLPRLL
                     CIFMLDSLGYGFMPNAWIVYYLKITFKLTASSLGLLFFITNSMDSISSLPSAYLSKLI
                     GPVKAILFTQIPSAIFFGLTIIPKDYYFMVAILLILYFTTSSMDVVPRQVLLTSIMPK
                     QDITKVMGIVNIGKTLARCIGPIITGELASINRLYWGFIINSCCVLLADMILAINFLH
                     LDQEILLKQSIIQEIE"
     gene            <923322..>925781
                     /locus_tag="CD36_53670"
                     /db_xref="GeneID:8048251"
     mRNA            <923322..>925781
                     /locus_tag="CD36_53670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420617.1"
                     /db_xref="GeneID:8048251"
     CDS             923322..925781
                     /locus_tag="CD36_53670"
                     /inference="similar to AA sequence:UniProt:Q59MK7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420662.1"
                     /db_xref="GeneID:8048251"
                     /db_xref="GOA:B9WHV0"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:B9WHV0"
                     /translation="MMIHQRTLSTDSFSFHNKHNNNNNNMLHSNKQININDTNFEEIS
                     IPSKKRYSEISIKQQQQQQQHQQVFQTPKNYCPSPLQQQLTRSSSIRSNGSMNTILQQ
                     QLQQQSPMAILQQQQQQQSAPNTPPSQYIINVNRTPTNLTPSQRLNLRKSNINNSISQ
                     YKSDQTNIFKYKQQPLPPPPPAAAAILQQRGGAPPIIDDADELIDDNVIFNVPFSQSV
                     LSLNQHEKFLFDNQSRNMSFVTDDSTRTSSIISHVSINDSASSIGGTTTNGNDSIEEE
                     MHNITTSTMKNNIMTNITNEQFSSISKDAQELTVLCNKDEFAQIYDESFQKRKMLSNF
                     KKIQSILPGRTTSSGTSSGTSSGGIDTKYYTFTRPTWLPPKSSYEKAKHQKESEDILY
                     NALYQESQLQQKRIIELDTTLKQRNQDIKTWERSLLNIKTLQELSFKDITELYWRGIA
                     NDIRSNVWWKINLLKKPGKFNESFCDFYFDKYLIIQSKLCHLDKISRESKGSAHSGSN
                     SNDDDDDDEQTLLNSKVFDVKLLQWAKLYNQIYKDLMINVYPDANYFQDHQVISKINK
                     IVISVILYLCDQSEATTTTTTTNSNCDIDIFKFYFPGMINFAAIYYYNFKNTYKSFVS
                     MCQFYNLRLPSMMITYLNCSTNDLKLQSILKSSLNSYMIYKFEKILKFKLNRISVHFK
                     IHNINSFDYLPQLILSLGLNLFNFEISQRIIDLILFDPNYDEIIINLIINYMMKIQHK
                     LFGNKQEILSALLGENNYTTTATTTTTSTNSSPSSSSSGSSSGSGSTSNHKYITGSNT
                     YRYVNVGYEIEFINSLRELCK"
     gene            <926677..>927042
                     /locus_tag="CD36_53680"
                     /db_xref="GeneID:8048252"
     mRNA            <926677..>927042
                     /locus_tag="CD36_53680"
                     /product="hydrophilin-like plasma membrane protein,
                     putative"
                     /transcript_id="XM_002420618.1"
                     /db_xref="GeneID:8048252"
     CDS             926677..927042
                     /locus_tag="CD36_53680"
                     /inference="similar to AA sequence:UniProt:P38216"
                     /inference="similar to AA sequence:UniProt:Q59MK8"
                     /note="uncharacterised plasma membrane protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="hydrophilin-like plasma membrane protein,
                     putative"
                     /protein_id="XP_002420663.1"
                     /db_xref="GeneID:8048252"
                     /db_xref="InterPro:IPR028144"
                     /db_xref="UniProtKB/TrEMBL:B9WHV1"
                     /translation="MSKDEYFNKPNGPPPNYNNNQQSQPQQSYVPQSQPNYSQQTQDR
                     GMFSGGGGHHQQQQGYNAYGPPPPQGGYYQQQPGGGGYYQQQQPMYVQQQPRSGGNDS
                     CLMGCLAALCVCCTLDMLF"
     gene            <928316..>929701
                     /locus_tag="CD36_53690"
                     /db_xref="GeneID:8048253"
     mRNA            <928316..>929701
                     /locus_tag="CD36_53690"
                     /product="esterase/lipase, putative"
                     /transcript_id="XM_002420619.1"
                     /db_xref="GeneID:8048253"
     CDS             928316..929701
                     /locus_tag="CD36_53690"
                     /inference="similar to AA sequence:UniProt:P53324"
                     /inference="similar to AA sequence:UniProt:Q59MK9"
                     /inference="similar to AA sequence:UniProt:Q9HDV1"
                     /note="Similar to S. cerevisiae SAY1"
                     /codon_start=1
                     /transl_table=12
                     /product="esterase/lipase, putative"
                     /protein_id="XP_002420664.1"
                     /db_xref="GeneID:8048253"
                     /db_xref="InterPro:IPR019436"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WHV2"
                     /translation="MITFKGFFLILLLPTRLLSFIIKYPFIKGIPGKYQNNFSKSLFI
                     KLCRLIQLLPISDKGTLNFISTNFLLNKIMKYLYHTRYFIKDLNNFGEKFDDQSYWIH
                     ESINRCKNDPIIIYLHGGSYYFDNSLNQMESLLGIYQLLKNSSSQLKDNNNNNNDDDD
                     DVNKDKMKRKNNLSILVLDYKLASKGYKMPYQLNQLISTYKNLIYQENTNIILMGDSA
                     GGNLAITFLQHLRITNCKNLPYPKSLILISPWCKIVPELSDYTKGHSMYDNNKYDIIE
                     WKAVKELIQDTTPLMGDLSPANLTISPGNLPYNHQDWESIDTLKQSGYSTFVIMGEYE
                     TLRDDILNWCQYALNSNLSSPIKHTQGIFDNNIHQFVSNHNNNNNNNNNNNNNNNNNN
                     NNNTDTDTDTDGAYIKCIIEPNGIHDGSMIFENDILKEFQKNPTMNLQTINKEKYFGI
                     YQIVQFLNEIL"
     gene            <931123..>933678
                     /locus_tag="CD36_53700"
                     /db_xref="GeneID:8048254"
     mRNA            <931123..>933678
                     /locus_tag="CD36_53700"
                     /product="Jumonji-interacting protein 4 orthologue,
                     putative"
                     /transcript_id="XM_002420620.1"
                     /db_xref="GeneID:8048254"
     CDS             931123..933678
                     /locus_tag="CD36_53700"
                     /inference="similar to AA sequence:UniProt:Q03361"
                     /inference="similar to AA sequence:UniProt:Q59ML0"
                     /note="Similar to S. cerevisiae JIP4; uncharacterized
                     protein"
                     /codon_start=1
                     /transl_table=12
                     /product="Jumonji-interacting protein 4 orthologue,
                     putative"
                     /protein_id="XP_002420665.1"
                     /db_xref="GeneID:8048254"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:B9WHV3"
                     /translation="MNSTTSPTSPTSPTTKSKLPPPLTHLNTAPQLTQIHSDTELITD
                     KDRSGHHIINNNNNNNSTTTTTNTTTNNKSTLMNNSSTTTTTTTTNGDSTNKSKRQQA
                     NDLYNSLRNKQSDNYRFVEFTDKKPTPGAQPQLQPQPRQYVKQVSFDDINIQYDMDDI
                     PDPDDDFGWELYKLKNRDRLSGTNNNNPNNSLPGYSVGSSIGRGRGLGRGRDTLRTPS
                     PLGNVGSSRLSPSPNRTSLNYEDLDLETRLDIAQMIQYPSTPITTKRFCTLKKSHKKF
                     DQLYKDQSYRIIRPMFRTILVYISGRIHTWVALDWILSKFIEDGDHIIIIASIDPCLL
                     NTKDYKDRSRRSTSRTRMSLSPAKIGSQSSLIRGNTLSPQRSRTDESQPFQPTSDIYD
                     PFIRLKEKSRPENIVKIANNLMDYIMKVINPKIITRITVELVEGDTKGVLQDMYRLYE
                     PSLVCTGAKPNARVGAPLRSWQSSKLTDRLIKNFPLPVIAVPAVNMCEFEYDLQNKLN
                     GTINAKTIDQQNELNVSNNILENGNTNNEEEDDSELGEENDDNNNDNNNDNDNDDDND
                     DDDENDVRSIQSSVSMSSEDSYDSFIEVADVYLEHKRDLQKDLQHLEQTQSINNENYY
                     ADMVKLISDESVALCTEIISIQPNFIGNGAKLAREITGSNSFGNVPYKTKSMLDPSAP
                     GGGGGSGINGNKPSLSFKELKEQLKLNKIKTESAVNTPISGSTSSFGTPIVSTSSSSP
                     QKQDPPSIKIDDISSPTTTTTTATTSSTTTSSELPETSLRFGNLEKPSIQSRRKKPSM
                     LHKCLSHSDDSVDRPKLEARKSHPDVLEHIRDEIKPRDNNNNKKKKKKFLGIF"
     gene            <934165..>935850
                     /locus_tag="CD36_53710"
                     /db_xref="GeneID:8048255"
     mRNA            <934165..>935850
                     /locus_tag="CD36_53710"
                     /product="component of the high affinity calcium uptake
                     system, putative"
                     /transcript_id="XM_002420621.1"
                     /db_xref="GeneID:8048255"
     CDS             934165..935850
                     /locus_tag="CD36_53710"
                     /inference="similar to AA sequence:UniProt:P41821"
                     /inference="similar to AA sequence:UniProt:Q59MM2"
                     /note="Similar to S. cerevisiae MID1;
                     In S. cerevisiae: N-glycosylated integral membrane protein
                     of the ER membrane and plasma membrane, functions as a
                     stretch-activated Ca2+-permeable cation channel required
                     for Ca2+ influx stimulated by pheromone; stretch-activated
                     cation channel precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="component of the high affinity calcium uptake
                     system, putative"
                     /protein_id="XP_002420666.1"
                     /db_xref="GeneID:8048255"
                     /db_xref="InterPro:IPR024338"
                     /db_xref="UniProtKB/TrEMBL:B9WHV4"
                     /translation="MIPFILLLLLLPFLIINSSYCQHFDLFQDLQPSTNLTESIINNN
                     NNVFQVQNFDSKSSSSSSSSSSSSGEGLQEFTPIRDTILQSETKYYSFSVDTQSGIGD
                     FYELLIFLSGNICTQPPNLLENDTSLAVYYSFNSTMFTNNEIGQMQLFKNGFFQGLAD
                     LPLTDTANNDTTSTTSSTSTSNPVPEKILYIAVRAPENTNRTAQWTYQIGVSQHDLVF
                     QWDDRTWGSIVDVDDNSALIVTGNLTKLSTGNYSNLNATNSQFSLYLYSYDNKDYFQG
                     MNNSWCAVRSGPVLIKPENIETKFIARHGSIQQQFMVENLNASTKYIAYIVMDFEGVE
                     YGGAVLRPFEFETMDGTACELIYDLEFCDQVAYSVPAIGNSSLLNLNGGNVDNKTLTK
                     KLYDDYAKSLYTNFSKGLQQIACDTVPEAIYSNLKNCHDCAQSYKNWLCAVTIPRCSS
                     KNFTGYIQRNSTNQRNDFLKEIIQPIHDYYEVLPCVNVCQAIVRDCPADFGFLCPTKN
                     DSIKLSYYWDVHVSDQWPSCNYLGPLKIDKSGAMKLIVNWTIVVVSISLMVII"
     gene            <936045..>937126
                     /locus_tag="CD36_53720"
                     /db_xref="GeneID:8048256"
     mRNA            join(<936045..936076,936139..>937126)
                     /locus_tag="CD36_53720"
                     /product="AAA ATPase family member, putative"
                     /transcript_id="XM_002420622.1"
                     /db_xref="GeneID:8048256"
     CDS             join(936045..936076,936139..937126)
                     /locus_tag="CD36_53720"
                     /inference="similar to AA sequence:UniProt:P38629"
                     /inference="similar to AA sequence:UniProt:Q59MM3"
                     /note="Similar to S. cerevisiae RFC3;
                     In S. cerevisiae: DNA binding protein and ATPase that acts
                     as a clamp loader of the proliferating cell nuclear
                     antigen (PCNA) processivity factor for DNA polymerases
                     delta and epsilon;
                     spliced gene; replication factor C (RF-C) subunit,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="AAA ATPase family member, putative"
                     /protein_id="XP_002420667.1"
                     /db_xref="GeneID:8048256"
                     /db_xref="GOA:B9WHV5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WHV5"
                     /translation="MPVKSKDNLPWVEKYRPDNLEEVKGQQEIVDTVRKFVETRKLPH
                     LLFYGPPGTGKTSTIIALAKEIYGSINYKDMILELNASDDRGIDVVRNQIKNFASTRQ
                     IFTKNNSINNDQFKLIILDEADAMTNIAQNSLRRVIEKFTKNCRFCILANYSHKLNPA
                     LISRCTRFRFTPIDISAIKDRLNIVIIKENVNISSDAIDALLKLSNGDMRRALNVLQS
                     CKAALGDDENIEINVDMIYDCIGAPYPQDIETCLDSILKDDWTTAYLTLNKYKIIKGL
                     ALIDLITGFIEILNNYKLKSKTRLEILKGLSDIEYGISKGGNDKIQTSAIIGVIKDAM
                     EFEAK"
     gene            complement(<937162..>937923)
                     /locus_tag="CD36_53730"
                     /db_xref="GeneID:8048257"
     mRNA            complement(<937162..>937923)
                     /locus_tag="CD36_53730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420623.1"
                     /db_xref="GeneID:8048257"
     CDS             complement(937162..937923)
                     /locus_tag="CD36_53730"
                     /inference="similar to AA sequence:UniProt:Q55EH2"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420668.1"
                     /db_xref="GeneID:8048257"
                     /db_xref="UniProtKB/TrEMBL:B9WHV6"
                     /translation="MKQHNNRFKDLKKSKSLNFINSIVESKRIINDCSEKNSINTNST
                     TTNNNICITNNTNITTDNDDDLVKKFSLTRTINHENDSIDSSISKEFNNLNTTIKNDN
                     SNWIRNFIQSNNNNNNNNNNNKDNPNSFYSFNHELKNVVSVTPTSSSFSSSSSLSFSS
                     LNFSFYGDSIHDFTVKHKHSMTTTTKQQQQHQQNTYFTQKYNNNFFNINKKRNDNRNF
                     KNKFYNWLSIFNHQNVIDYDNDTIYYNTCGSSIYS"
     mobile_element  complement(942524..942792)
                     /mobile_element_type="retrotransposon:solo LTR, kotuku G"
     gene            complement(944829..944864)
                     /locus_tag="CD36_53735"
                     /pseudo
                     /db_xref="GeneID:8048258"
     misc_feature    complement(944829..944864)
                     /locus_tag="CD36_53735"
                     /inference="similar to AA sequence:UniProt:Q59ML4"
                     /note="Similar to C. albicans FGR42"
                     /pseudo
                     /db_xref="GeneID:8048258"
     gene            <947137..>948501
                     /locus_tag="CD36_53740"
                     /db_xref="GeneID:8048259"
     mRNA            <947137..>948501
                     /locus_tag="CD36_53740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420624.1"
                     /db_xref="GeneID:8048259"
     CDS             947137..948501
                     /locus_tag="CD36_53740"
                     /inference="similar to AA sequence:UniProt:Q59LP9"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420669.1"
                     /db_xref="GeneID:8048259"
                     /db_xref="UniProtKB/TrEMBL:B9WHV7"
                     /translation="MSQQQQQQQHIRKSKRTRILTEKAKAETNTISLVNNNDNDNDNN
                     NNNTTTTTTTTTRKNKKKSCNLPKTIKKRKISNIEEEEEKAGKLSDKIDPVEKLLNLI
                     NVNQDFLSDWEDNCHHHHHHHHHHHQHHHHHQHTSISSFTAVNNNDNINNNNLISTTS
                     STLHCGFSPKLGYHNSNSSSSSSSSSSISSSSLFSQNEESEIDEYESDNYDYDYDYDY
                     DYDEPNEIESVNFTKIIQDNIRQYYFKRRLENQYKDSFALLNKQKYPHEEENNNNNNN
                     NNHYQNNNNKLPSNNDKSIFKQYEVPFFKSVNFGNKPKEYTIEDYFQYEEAEEEEEES
                     QPKKDNNNNNNNNNNSTTTTSTTDSGISPITTPKSTIQSLYIPKINNTNNHNYRRPTT
                     IMMNNNNNGGTNNNNNNNNNNNNNNNNNLQDLSKILNKNSIITGNASEMISSGNFMLT
                     DFYL"
     gene            <954677..>957565
                     /locus_tag="CD36_53750"
                     /db_xref="GeneID:8048260"
     mRNA            <954677..>957565
                     /locus_tag="CD36_53750"
                     /product="uncharacterized protein ypr091c homologue,
                     putative"
                     /transcript_id="XM_002420625.1"
                     /db_xref="GeneID:8048260"
     CDS             954677..957565
                     /locus_tag="CD36_53750"
                     /inference="similar to AA sequence:UniProt:Q06833"
                     /inference="similar to AA sequence:UniProt:Q59LQ1"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein ypr091c homologue,
                     putative"
                     /protein_id="XP_002420670.1"
                     /db_xref="GeneID:8048260"
                     /db_xref="GOA:B9WHV8"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="UniProtKB/TrEMBL:B9WHV8"
                     /translation="MGLVYFLFVYILGGLTFLPGLVILYFYLAPETTLSKNNNELDEE
                     KPSGELEENHQSGLEAYKSGWIFVTRDYIESPDEINSNTQSITESNDNKSAYSALYKL
                     VKDSATKKFKDNSQSIKNQEDKKFLDHNDNDNNDLDELNKDTFVLPKDTNNSKSYNHH
                     QRHDPQPQHNHQSQNQPQQQIRSSQKKHRYFAVLKHGNLFLYKDQTLKDVKHVIVLAH
                     HFVSIWPRDLTDAQLFTKYSALALINPSKLTDTPFPTNDTFNSNVNTSNGTEISSSTR
                     SSLSSRTTDQQQQNLQQQQQQSNNNAPPGTFFIYCENNCDKEDWYFALIRAMKLEKSE
                     LPDILSPENFAQTSHFQTKEMINLIQTLYSSEGQLQTKWLNAIIGRWFLAMKNTKHFE
                     DYFYKKLSKKLNKIKKPGFFNQFEITDIQPGKSAPFFTYPKLKEINPDGTVVASCYVT
                     YNGGLSVTIETKVDLTFGTKFTNREVDLVLKITLSKLEGPMLFKLKPPPSGRFWYCYE
                     LDPIVNFKIEPLLSSRTLNFNFITNSIEKKFKEAIKESLVYPFWDDIVFFDSSDQLYR
                     AGIWKQPKIDKDEVTTNISETTNIEKNQGQIDNGLVGTDENNSTNSTNSTNSTNKFDD
                     IDAKSELSTSSRSIRNAKFSNTLTDLTKRIKKKSSPSLSNTEESLSKTPSISSGHNTN
                     ITKTPSKSDLTVSQQQQQQQQQQPQNTNSTLVSNTFKRIGKWYFKDDVSTKKQPDEKP
                     GYTPPEMISSRRAPRKSSSSMTLGSDSTHYTLSTEDNKGSNSLVSESINAPISSTTTT
                     TTTTTGSISGTSSEFPNKSTTTTTAPVNVTSLSNNSTIPSIAIGTGTGKDSTMTSPLT
                     AIPLENQTPSYNFSRLDNNNEDLSIFSVAYQNAAQMIPSSTPPPLPPREISDNLSIKS
                     GSLVGEPTISLSQPSTPIRSKTLTRKPPPPSKSPLLQANSSNQHIKDL"
     gene            complement(<957666..>964646)
                     /locus_tag="CD36_53760"
                     /db_xref="GeneID:8048261"
     mRNA            complement(<957666..>964646)
                     /locus_tag="CD36_53760"
                     /product="DNA-damage checkpoint kinase, ATR homologue,
                     putative"
                     /transcript_id="XM_002420626.1"
                     /db_xref="GeneID:8048261"
     CDS             complement(957666..964646)
                     /locus_tag="CD36_53760"
                     /EC_number="2.7.11.1"
                     /inference="similar to AA sequence:UniProt:P38111"
                     /inference="similar to AA sequence:UniProt:Q59LR2"
                     /note="Similar to S. cerevisiae MEC1;
                     In S. cerevisiae: genome integrity checkpoint protein and
                     PI kinase superfamily member; signal transducer required
                     for cell cycle arrest and transcriptional responses
                     prompted by damaged or unreplicated DNA; monitors and
                     participates in meiotic recombination; mitosis entry
                     checkpoint protein, putative; serine/threonine-protein
                     kinase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-damage checkpoint kinase, ATR homologue,
                     putative"
                     /protein_id="XP_002420671.1"
                     /db_xref="GeneID:8048261"
                     /db_xref="GOA:B9WHV9"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012993"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:B9WHV9"
                     /translation="MTSNQSISTNELLQFLTDIETNINDHETDFRKLLLYLLRFTNEK
                     LILIAQEEINTPTEVQLLIKLIDSIELVLSKKTNLLSTLLTIEDVNIIHATGSGSLVY
                     EVPLHEWCISFALSHIPNFVSHTTGLNQLKRLVFLIVNFVCTQLHSFKVIKSTRIYLL
                     KTLDDNLNFCLENLASANTFLFKSKLTTAVNLFSIVHDYDISQKLSLNLNNYQLKFES
                     YGRKIWFILNEISLVSEIDNLNFLDCLKSVFILDQSSSLTLNVSVGWNQFGFLLTCIV
                     EHLRQDFKTLDSNTNNFEFVNLNRSISLSLLNTFMLCLEKDLLENFMSFSNIKGLLWK
                     LIYDESIPYLIRKSLNIVQYIYQSKSNPDGDKLKIYNTPVYNDYVSKTFVDPELESFR
                     TRLLNLQGDYEVSRKEQLLSFAIDETHKLTKSANLLNYHDERAWIHIVKKLTGTNKDV
                     LEDETTLYTLVTALGHYPCILKGDYDYTINECTRCGFGPLSKNNYSSIDPKRLPLNYD
                     TEATVLEDIIQSFLVPKLERQPDPLLCCNTLLLIFNFYATFSPVTDMKMPYVLDFLLG
                     LLATNDNRDVRMLVARILPLYLIQSNDDKLLDETFKYIFQKVTSIDFSSQHRLHFGES
                     TIRAVVELATVSTGERLCAIYFKLVDWLGEQNEQHSNYVYCGILNLASAKSLPPHKLL
                     SPYLPSVAEIIIKKPQLFERIIKVSMITKNYFLNRTKEYTVPRILEYYKDPTLLTQIA
                     NAAGLEVGKLLANCLPRILATYLTKESVNERYIMKVLSSVCPDYKMVHTEELFTRIGD
                     ITWYILLEIQMDEFGNIRNLTNILRALDCVCKNVSLRKNGSETTKNNSINDLIEDQVL
                     LLIQKFSDVTHSSRGAKPYLELKNSFYAIEFLIKRHIDAITSALGQLSTCLQATLEEP
                     DFHVLSLRCWNELIKKVPPSHLISLIDIIISIILQKFESFGSEAKSIAIEILRKIYEE
                     IKDKYNRYSLYFLSLPFLSYMEDYQMVKEFRNMKSPSRAMIFSEFTRRLQTSNMYVVK
                     HALFDLSNYFDKYQINCQRDLFKDPGLTPAITSLVRTLLDTAAKFKNKDTTVSTACAK
                     ALAIIGALDSNRFQFKTVKQLIIIASDFENSEENSTFLVDLIENHLLKIFWASNDPHK
                     QLFAAYVMQSFLAVMGLDEHVLQTKDNRVWNKFTDVAKSTLTPFLKSKYAASKPKLDN
                     IKFPFFKLGMKYETWLIDVTLFLLKRASIDNGKGNQKAKTRKLIFQSCAVLIQKEHDI
                     PLCEHLLRYVALSHVINEGVPEELHKEFLHILKIDSKSTSPDRAEQLKLCYQAIFSVL
                     DYFNQWSSNMRVVTNNSQIESTSDDIRHKMDAVAKFSSFPQDLLTIRSAECDAYERTI
                     MYLENCYRDSHSEKSFKLSNLNGAATLQDMYAHIDDYDALNGTLKMFSTNNLNEKLIT
                     FQYSDSWSLAHESFEALGSTKDSVSNNTKLLQSLNEHGLYNEVLSTLSARTDPNDLKS
                     IPLDWSLMGLHAAVYKGDSKQLEKWLQVTNSIGKPHDMETMINYELAKALSFLFQSKI
                     DMFKSSMDKLYNIIGCSLVPSVSSNFTRNITLMNQLHAIYDVSLIVSSQDSENTLDLR
                     IGNVDQDFDTQRSILTLHNVANTAMKNPAMISKNLLRESSLARKYNRLDISTRSIVQA
                     MSLEDDQAIIEFAKLQWAQGKQSEAIKCLFDILKDHKFHQDDTKKAQIQLQYANWLDE
                     SNHLSAHQIIKEYTKAFHLNMRDEKCNFDIGKYYNKLMESSNDPSGEYEHLTVRNYIR
                     AVSVGTTFIFEALPKLLTIWLDFADKPKKSKTAEKKLNQIIEDLYNGLANVPNYAWYT
                     VLTQMLSRIVHHHEPSFQVLRTIISNVMLEYPNHCVWYIFSHAKSSDKERKTRTQKLI
                     TKVCEENTRHPLTRSIFATGGLFEKLIKIAELKIPKTNRKRQMSLLKDFNMDLSDPID
                     DLVIPVQSNLQIQIPSQLGSKYKGFSRSSSITFDGFDDTVNIFFSLQMPRQLTVRGSD
                     GNAYRLMVKSDDTRKDAKVVEFTTMVNRILSTSTEARKRGLQIANYSVVPLSDHFGII
                     EFVMNVQTMKGVIIEQRKRQGISINERKIFMHIGGLQKAKQKDNKKLDKLMVDFRHIM
                     DQCPPVLHNWFVEQFSDPNAWYMARNSFTRSSAVMSMVGYIMGLGDRHCENILIFKNT
                     GAILHIDFDCLFEKGTTLPTPEIVPFRLTQNMVDAMGITGVDGIYRITCEVIGTLLRE
                     NEQILMNILETLIYDPLIDWRNHNPREDLSKVRKKIRGLINEDEGLPMNIHGQVDVLI
                     QEATSLERLSQMYAGWAAYM"
     gene            complement(<965074..>965382)
                     /locus_tag="CD36_53770"
                     /db_xref="GeneID:8048262"
     mRNA            complement(<965074..>965382)
                     /locus_tag="CD36_53770"
                     /product="cyclin-dependent protein kinase regulatory
                     subunit and adaptor, putative"
                     /transcript_id="XM_002420627.1"
                     /db_xref="GeneID:8048262"
     CDS             complement(965074..965382)
                     /locus_tag="CD36_53770"
                     /inference="similar to AA sequence:UniProt:P20486"
                     /inference="similar to AA sequence:UniProt:Q59LQ4"
                     /note="Similar to S. cerevisiae CKS1;
                     In S. cerevisiae: modulates proteolysis of M-phase targets
                     through interactions with the proteasome; role in
                     transcriptional regulation, recruiting proteasomal
                     subunits to target gene promoters"
                     /codon_start=1
                     /transl_table=12
                     /product="cyclin-dependent protein kinase regulatory
                     subunit and adaptor, putative"
                     /protein_id="XP_002420672.1"
                     /db_xref="GeneID:8048262"
                     /db_xref="GOA:B9WHW0"
                     /db_xref="InterPro:IPR000789"
                     /db_xref="UniProtKB/TrEMBL:B9WHW0"
                     /translation="MSKPRFLTDLERAKVLEFQDMIHYSPRYSDDSYEYRHVMLPKNM
                     LKAIPQDYFNAETGTLRILTEEEWRGLGITQSLGWAHYETHAPEPHILLFKRPLNPGQ
                     "
     gene            complement(<966265..>966930)
                     /locus_tag="CD36_53780"
                     /db_xref="GeneID:8048263"
     mRNA            complement(<966265..>966930)
                     /locus_tag="CD36_53780"
                     /product="pre-mRNA-splicing factor, putative"
                     /transcript_id="XM_002420628.1"
                     /db_xref="GeneID:8048263"
     CDS             complement(966265..966930)
                     /locus_tag="CD36_53780"
                     /inference="similar to AA sequence:UniProt:P53854"
                     /inference="similar to AA sequence:UniProt:Q59LQ5"
                     /note="Similar to S. cerevisiae CWC25"
                     /codon_start=1
                     /transl_table=12
                     /product="pre-mRNA-splicing factor, putative"
                     /protein_id="XP_002420673.1"
                     /db_xref="GeneID:8048263"
                     /db_xref="InterPro:IPR019339"
                     /db_xref="InterPro:IPR022209"
                     /db_xref="UniProtKB/TrEMBL:B9WHW1"
                     /translation="MAGDLNLKKSWNPALVKNQQKVWEEEQQKLDELKRIKERNQEYK
                     QEQEYLELLKLQHGDRFQIKDLNKQQKLKLSKLNWMYDDVPFESNEKVEENSSGFIES
                     SVEFTDGKTKVENLLKGNHAVGKKRDGSDTSDRINKIIGVGMSKSSKTSYSDDPLLRI
                     KQQQQQAQRVSKKPHNNDKHSHRFSHSSKSSSDRVHKSHEHERSRKHNSSHTRRRDRS
                     PNR"
     gene            complement(<967419..>967748)
                     /locus_tag="CD36_53790"
                     /db_xref="GeneID:8048264"
     mRNA            complement(<967419..>967748)
                     /locus_tag="CD36_53790"
                     /product="eukaryotic translation initiation factor eIF-1,
                     putative"
                     /transcript_id="XM_002420629.1"
                     /db_xref="GeneID:8048264"
     CDS             complement(967419..967748)
                     /locus_tag="CD36_53790"
                     /inference="similar to AA sequence:UniProt:P32911"
                     /inference="similar to AA sequence:UniProt:Q59LQ6"
                     /note="Similar to S. cerevisiae SUI1;
                     eIF-1 is a component of a complex involved in recognition
                     of the initiator codon; modulates translation accuracy at
                     the initiation phase"
                     /codon_start=1
                     /transl_table=12
                     /product="eukaryotic translation initiation factor eIF-1,
                     putative"
                     /protein_id="XP_002420674.1"
                     /db_xref="GeneID:8048264"
                     /db_xref="GOA:B9WHW2"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR005874"
                     /db_xref="UniProtKB/TrEMBL:B9WHW2"
                     /translation="MSTIQNLNAFDPFADTGDSEAQPTNYIHIRIQQRNGRKTLTTVQ
                     GVPNEYDLKKILKVLKKDFACNGNIVKDEELGEVIQLQGDQRVKVSEFLTAQLQLPKK
                     NIKIHGF"
     gene            <969232..>970590
                     /locus_tag="CD36_53800"
                     /db_xref="GeneID:8048265"
     mRNA            <969232..>970590
                     /locus_tag="CD36_53800"
                     /product="CDP-diacylglycerol synthase, putative"
                     /transcript_id="XM_002420630.1"
                     /db_xref="GeneID:8048265"
     CDS             969232..970590
                     /locus_tag="CD36_53800"
                     /EC_number="2.7.7.41"
                     /inference="similar to AA sequence:UniProt:P38221"
                     /inference="similar to AA sequence:UniProt:Q59LQ7"
                     /note="Similar to S. cerevisiae CDS1;
                     In S. cerevisiae: catalyzes the conversion of CTP +
                     phosphate into diphosphate + CDP-diaclglyerol, a critical
                     step in the synthesis of all major yeast phospholipids;
                     CTP:phosphatidate cytidylyltransferase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="CDP-diacylglycerol synthase, putative"
                     /protein_id="XP_002420675.1"
                     /db_xref="GeneID:8048265"
                     /db_xref="GOA:B9WHW3"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="InterPro:IPR016720"
                     /db_xref="UniProtKB/TrEMBL:B9WHW3"
                     /translation="MTSSTKDTSLKQVETEVSSSKSTSITPTNNELSNSTSKSTPSNN
                     KSVEQTKEQPVVNEKEKKKQAFVTRTIWTFVMIGGFFAILASGHLALIIMVSVFQMLT
                     FKEVIALTSEPARDKKIPWNRSLNWYFLGTTWYYLDFPALFDFFQESVYSSKFLTLLV
                     KNHKFISYSLYIAGFVFFVWTLKKGYYRFQFAQLCVTHMTLLLVVFQAHLIIDNILQG
                     IIWFFLPATLVIVNDIFAYLCGITFGRTQLIEISPKKTVEGFVGAWICTGIAGVIASH
                     ILSKSDYMICPAENLSTHLYNFPHCDLNPIYIPQVYQLPAKIVEITGYELITFKPFYF
                     HAAVLATFASLIAPFGGFFASGLKRAFGIKDFGDTIPGHGGITDRFDCQFLMGSFTYL
                     YYHTFVSNQNVNLGHVLQLAIMNLSVPQLIQLVKSLLKYLNREEVLSGEQLSLIFDIL
                     EN"
     gene            <972317..>973786
                     /locus_tag="CD36_53810"
                     /db_xref="GeneID:8048266"
     mRNA            <972317..>973786
                     /locus_tag="CD36_53810"
                     /product="glucosidase precursor, putative"
                     /transcript_id="XM_002420631.1"
                     /db_xref="GeneID:8048266"
     CDS             972317..973786
                     /locus_tag="CD36_53810"
                     /EC_number="3.2.1.-"
                     /inference="similar to AA sequence:UniProt:P53189"
                     /inference="similar to AA sequence:UniProt:Q5AKC7"
                     /note="Similar to S. cerevisiae SCW11;
                     In S. cerevisiae: may play a role in conjugation during
                     mating based on its regulation by Ste12p; glycosyl
                     hydrolase, putative; soluble cell wall protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="glucosidase precursor, putative"
                     /protein_id="XP_002420676.1"
                     /db_xref="GeneID:8048266"
                     /db_xref="GOA:B9WHW4"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:B9WHW4"
                     /translation="MFSNIISTLALLQLLNAAPILLTRYHVAAPTTEIKTVTTGTTTV
                     WLPPVGIYISDGQTSTSTITDGQWNTYPVTFTSIINRDQAAPAPVPTQQTTEAQPQPP
                     QQPTTTTSSTSPAQPTTTEQQQQPTTTEQQQQQQQPTSTEQAQPNTTSTEQTPQAPQS
                     TEQGQQQQQPTTTELAPQSTEQNETTIQSPSTTSINYTSSSSSSYSPTSTSTSSSSSS
                     PSSSGDISAPSAIVYSPYADDRSCKSADTIKSDLQLINSKGIKQIRSYGTDCGSLTTV
                     LETCRELGITVNQGVWMSNAGVDSIDDQVSDVVNYGKSNGWDVFNLITIGNEAIVAGY
                     VSPSDLVSKIKSVKSQLQSAGYNGKVTTSEPPATYLKYPSFCTDADIDVVGINPHSYF
                     NANISPENAGSYIVHQQQQVADICGGKSILITETGYPSKGSTLGVNVPSPENQKIAVS
                     SIIKETGGDCTILTTYNDFWKDPGPYGIEQYFGVIELFQ"
     gene            complement(<973895..>974917)
                     /locus_tag="CD36_53820"
                     /db_xref="GeneID:8048267"
     mRNA            complement(<973895..>974917)
                     /locus_tag="CD36_53820"
                     /product="inositol oxygenase, putative"
                     /transcript_id="XM_002420632.1"
                     /db_xref="GeneID:8048267"
     CDS             complement(973895..974917)
                     /locus_tag="CD36_53820"
                     /EC_number="1.13.99.1"
                     /inference="similar to AA sequence:UniProt:Q4X1E7"
                     /inference="similar to AA sequence:UniProt:Q5AKC6"
                     /codon_start=1
                     /transl_table=12
                     /product="inositol oxygenase, putative"
                     /protein_id="XP_002420677.1"
                     /db_xref="GeneID:8048267"
                     /db_xref="GOA:B9WHW5"
                     /db_xref="InterPro:IPR007828"
                     /db_xref="UniProtKB/TrEMBL:B9WHW5"
                     /translation="MVNKVSKPTHDKTNNLDKSQTNILDKIDDDILNVNRIRGSLTNK
                     TPTSKTHSIDDELKLEEQSETAADENWQIASEYYKNIDTKAFRQYELACDRVKQFYEE
                     QHEKQTVAYNIQARINFKTKTRARMTVWEGLEKLNKLLDDSDPDTELSQIDHALQTAE
                     AIRRDGKPRWFQLVGLIHDLGKLLYFFDSRGQWDVVGDTFPVGCKFSKRIIFPDSFKN
                     NPDFLNPLYNTKYGIYSKHCGLDKVMLSWGHDEYMYHVAKKNSTLPPEALAMIRYHSF
                     YPWHQELAYSYLMDEHDKEMLKAVKAFNSYDLYSKIDQQYDVEELKPYYLELIDEFFP
                     NKVIDF"
     gene            complement(<975205..>976815)
                     /gene="CHT2"
                     /locus_tag="CD36_53830"
                     /db_xref="GeneID:8048268"
     mRNA            complement(<975205..>976815)
                     /gene="CHT2"
                     /locus_tag="CD36_53830"
                     /product="chitinase precursor, putative"
                     /transcript_id="XM_002420633.1"
                     /db_xref="GeneID:8048268"
     CDS             complement(975205..976815)
                     /gene="CHT2"
                     /locus_tag="CD36_53830"
                     /EC_number="3.2.1.14"
                     /inference="similar to AA sequence:UniProt:P29029"
                     /inference="similar to AA sequence:UniProt:P40953"
                     /note="In S. cerevisiae: required for cell separation
                     after mitosis; endochitinase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="chitinase precursor, putative"
                     /protein_id="XP_002420678.1"
                     /db_xref="GeneID:8048268"
                     /db_xref="GOA:B9WHW6"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="UniProtKB/TrEMBL:B9WHW6"
                     /translation="MLSIKTLLAAAVVASSAFASASNQVALYWGQNGAGGQERLAQYC
                     QETDVDIVLLSFLNLFPDPLNVNFANQCGNTFESGLLHCSQIGADIKTCQSLGKTVLL
                     SLGGGVGDYGFNDVASATKFADTLWNKFGAGQDAERPFDDAIVDGFDFDIEHGSTTGY
                     PELATALRSKFAQDTSKNYFLSAAPQCPYPDASLGDLLSKVPLDFAFIQFYNNYCSVD
                     GQFNYDTWSKFADSAPNKNIKLFVGVPATGNVAGYVDANKLSTTIEEIKCDPHFAGVS
                     LWDASGAWLNTDDQGNNFVVQVKNVLNQNTCVAPTTSATTTSTAAITTKSDEIVTSSS
                     SSSSIFYGNSTTESSSGIASGTVLPTGSGSGSSNTKSYELAISTVTDVQKTVVTITSC
                     SAHKCVATPVTTGVVVVTDIDTVYTTYCPLTNSQVYVPVKTVICSEEKCVANPTSTAL
                     KPKASTSTQGVKKIVTTSAQTVGSSTQYVTIDITSTITPVPLPTSVTSNGTNGTVPVF
                     TFEGGAAVANSLNSVWFTVPFLLAAFAF"
     gene            <979925..>981190
                     /locus_tag="CD36_53840"
                     /db_xref="GeneID:8048027"
     mRNA            <979925..>981190
                     /locus_tag="CD36_53840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420634.1"
                     /db_xref="GeneID:8048027"
     CDS             979925..981190
                     /locus_tag="CD36_53840"
                     /inference="similar to AA sequence:UniProt:Q5AKC3"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420679.1"
                     /db_xref="GeneID:8048027"
                     /db_xref="UniProtKB/TrEMBL:B9WHW7"
                     /translation="MKIFEALLELQNTLLKYYSATIQYLYQELLTLFENKVSIDVEKP
                     DLERISFYTSLIEKYQYQIIQLTDFNKGHTIYITLQQIINSGIQDVLGSITALRNSEQ
                     KLIRASSEALLIQPGIEEKLKWIIDENNHLHKFQNDQDEYQTFLARLKNEINNVPPPQ
                     YTCQTLNKFVEDIVHEYSLNIPILEIVIEKLNRNYNEEELFLEKLQNSILQLILEQEV
                     DTSSVSFTEQEIKVIDIMEILTAHIDFFKRLSKIYIKFDKLLLQKLKLDNLPAPESVD
                     LKTHVTKKLDNFIKNLVAGGTVGLSTEQTYLLVFSFIQNIAFQFQTFNENYIGYIPDN
                     RPGRYGDDESFWTLVKEYIASLHRVTKFLEDPNGCGHDVNIIMGNAKEEFEQLESEAR
                     EYFFALLPFERIFECDEKIVNYQLGEKSV"
     gene            complement(<981844..>982524)
                     /locus_tag="CD36_53850"
                     /db_xref="GeneID:8048269"
     mRNA            complement(<981844..>982524)
                     /locus_tag="CD36_53850"
                     /product="T-SNARE protein, putative"
                     /transcript_id="XM_002420635.1"
                     /db_xref="GeneID:8048269"
     CDS             complement(981844..982524)
                     /locus_tag="CD36_53850"
                     /inference="similar to AA sequence:UniProt:Q03322"
                     /inference="similar to AA sequence:UniProt:Q5AKC2"
                     /note="Similar to S. cerevisiae TLG1;
                     In S. cerevisiae: mediates fusion of endosome-derived
                     vesicles with the late Golgi; t-SNARE syntaxin protein,
                     vesicular/late Golgi fusion, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="T-SNARE protein, putative"
                     /protein_id="XP_002420680.1"
                     /db_xref="GeneID:8048269"
                     /db_xref="GOA:B9WHW8"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="InterPro:IPR015260"
                     /db_xref="UniProtKB/TrEMBL:B9WHW8"
                     /translation="MDPFNEVKEDAYSSIRALEDIINSRPNGNPPTNEQQQDFENSFQ
                     ELQEIYRDLQQALTISESQPSKFNLSDIDISNRKSILSDLNNQIQHLEKKWNQKQYRD
                     VTTMSNRISQDGQDEDIDPFSGDSAMTSYQQQELIQEQDLQLDDIHRTMMNLNQQAAI
                     MGDELEEQGFMLDELDYEMDNVDNKLQRGMKRINIFLERNKETASNWCIGILVVVLCV
                     LLVLLLIA"
     gene            <982754..>983140
                     /locus_tag="CD36_53860"
                     /db_xref="GeneID:8048270"
     mRNA            <982754..>983140
                     /locus_tag="CD36_53860"
                     /product="COMPASS/SET1C histone methyltransferase complex
                     subunit, putative"
                     /transcript_id="XM_002420636.1"
                     /db_xref="GeneID:8048270"
     CDS             982754..983140
                     /locus_tag="CD36_53860"
                     /inference="similar to AA sequence:UniProt:Q03323"
                     /inference="similar to AA sequence:UniProt:Q5AKT5"
                     /note="Similar to S. cerevisiae SDC1;
                     In S. cerevisiae: subunit of the COMPASS (Set1C) complex,
                     which methylates histone H3 on lysine 4 and is required in
                     transcriptional silencing near telomeres"
                     /codon_start=1
                     /transl_table=12
                     /product="COMPASS/SET1C histone methyltransferase complex
                     subunit, putative"
                     /protein_id="XP_002420681.1"
                     /db_xref="GeneID:8048270"
                     /db_xref="GOA:B9WHW9"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="UniProtKB/TrEMBL:B9WHW9"
                     /translation="METPIPNHDSIKETIEASVNESIDNSNQTEDKPTNGSVDQNQQS
                     SSPMEIDTKEDSTKPEINTPTPNENSQLPMHEIVGGSSVRRYLNQHLTKTLLEGLKEV
                     AQIKPEDPLKYLGEFLISKSNESKKE"
     gene            <983491..>985098
                     /locus_tag="CD36_53870"
                     /db_xref="GeneID:8048271"
     mRNA            <983491..>985098
                     /locus_tag="CD36_53870"
                     /product="mitochondrial fusion machinery protein,
                     putative"
                     /transcript_id="XM_002420637.1"
                     /db_xref="GeneID:8048271"
     CDS             983491..985098
                     /locus_tag="CD36_53870"
                     /inference="similar to AA sequence:UniProt:Q03327"
                     /inference="similar to AA sequence:UniProt:Q5AKT4"
                     /note="Similar to S. cerevisiae UGO1;
                     In S. cerevisiae: Ugo1p binds directly to Fzo1p and Mgm1p
                     and thereby link these two GTPases during mitochondrial
                     fusion"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial fusion machinery protein,
                     putative"
                     /protein_id="XP_002420682.1"
                     /db_xref="GeneID:8048271"
                     /db_xref="GOA:B9WHX0"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:B9WHX0"
                     /translation="MSSSHPDTQVLRPYYDHDTFNAGYSVIYKKGVGIIDPKTNRPVT
                     SNISEKLINQSLNENQGIIRNSFKHGGPVGINATSDKNYVYDLEFNEYFESNNLIEVF
                     KNLLWNFVRSYIKVLLTQPLEIVRLVLQVGKFNFSETVSKTTKKLDLSKSKRLLSETE
                     DDTEATTEQDEDEYPRPQRSSIYDNVRDDDEDDEDEEPINYFQSQNEQQVWSGHEVGG
                     FNTTATPIKQEKKSYRDGKKRIRNNKIKPKSLHTADILTAIINKDGPFAVFRGINASF
                     IYQTLSHTIEAWITGFASPFLGIPDPFFLDLTHSNDPFKSLWLSVTACVLTGIVLMPL
                     DLIRVKFMITQFNSKPLNENDTLEEAAEEIVQSTRSVRESIRNFPVYYLLHPSTPIVF
                     LTTLHQLSTSIFRKMAPYILFIKFNIDSYSSPNIYTFVNLLSLILEFFIKLPVENLLR
                     KQQVQFLLTPKREDTKKVITIEDPKKSLIVEFNDSTEDNQDSTFWERLKQLGLFNGWR
                     IGVLNVIGFWGYNIIKSDGSELKEERL"
     gene            <985692..>987209
                     /locus_tag="CD36_53880"
                     /db_xref="GeneID:8048272"
     mRNA            <985692..>987209
                     /locus_tag="CD36_53880"
                     /product="monooxygenase, putative"
                     /transcript_id="XM_002420638.1"
                     /db_xref="GeneID:8048272"
     CDS             985692..987209
                     /locus_tag="CD36_53880"
                     /inference="similar to AA sequence:UniProt:Q4WZ21"
                     /inference="similar to AA sequence:UniProt:Q5AKB9"
                     /note="pathogenesis/stress-related protein, thaumatin
                     family member, putative; xenobiotic compound
                     monooxygenase, DszA family, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="monooxygenase, putative"
                     /protein_id="XP_002420683.1"
                     /db_xref="GeneID:8048272"
                     /db_xref="GOA:B9WHX1"
                     /db_xref="InterPro:IPR011251"
                     /db_xref="InterPro:IPR016215"
                     /db_xref="UniProtKB/TrEMBL:B9WHX1"
                     /translation="MTASTNSSNDQKNRTPLILNSFCMGCSGLQCPGLWSHPDDKSRD
                     FNTIEYWVNLAQLLEKGKFNALFIADVLGPYDVYDGPGNFRSVAKSGAQFPTTEPSAV
                     VSAMAAVTKNISFGVTFSTISENPYHFARRLATLDHLTKGRVGWNVVSSYLDSAARNL
                     LNGESLPPHAERYERAQEYIDVVYKLFLSSWSDDAVELKNRVFTNPDKVREINHKGKF
                     FTVPGPSITEPTPQRLPVIIQAGTSKAGKEFAARNAEVVFITTFSPEELGKQIKAIKT
                     LAKEKYGRPEGSIKFLQLITPVVADTHELAEEKFKELQSYGDLDGAQALFSGWTGIDI
                     GKYDYEDNITDKGTNAVKSFLELWNKTSPGEPANVKKTRRDIARQITVGGLGPVFYGT
                     PEEVTDEIERWVDISGVDGFNVTYAISPGTFEDFVEKVIPLLQERGLAQEDYPQDLDH
                     PLTFREQLFGSERKEPYYLLESHPAYDLRWRAGESKDEFERRLNKKRKSEAQEIA"
     gene            <989088..>989834
                     /locus_tag="CD36_53890"
                     /db_xref="GeneID:8048273"
     mRNA            <989088..>989834
                     /locus_tag="CD36_53890"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420639.1"
                     /db_xref="GeneID:8048273"
     CDS             989088..989834
                     /locus_tag="CD36_53890"
                     /inference="similar to AA sequence:UniProt:Q5AKB8"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420684.1"
                     /db_xref="GeneID:8048273"
                     /db_xref="GOA:B9WHX2"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:B9WHX2"
                     /translation="MSWKPIVTYIFRGLQTVFCIVVLGLSAGFLADVGYNYDRVTFAL
                     VVSILNLLYFGYILILMPIFFKNFTFSILIFAAEFIFFVFYLSAMGAIADVVPSGSCG
                     DYGSYSSACSILKALIPFTLFNWLLFATTFGLFLGYSFIPQVSSRGFKSIFLPVRFEY
                     GAIFTNFLLPFGKRYAVTDPVTDAAVADAEITGNDIENNAPKGASVGDDEATAGLASS
                     EEDKYTEPLSGNIDEVTATQEATNQSKPYP"
     gene            complement(<990746..>991492)
                     /locus_tag="CD36_53900"
                     /db_xref="GeneID:8048274"
     mRNA            complement(<990746..>991492)
                     /locus_tag="CD36_53900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420640.1"
                     /db_xref="GeneID:8048274"
     CDS             complement(990746..991492)
                     /locus_tag="CD36_53900"
                     /inference="similar to AA sequence:UniProt:Q5AKB6"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420685.1"
                     /db_xref="GeneID:8048274"
                     /db_xref="GOA:B9WHX3"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:B9WHX3"
                     /translation="MSKKVIAASIIRGAQTIFALIVLGLSIQELVTLEFYYDKSVYII
                     VVAAINIIYFFCTLLLIPFIFKNWSPSIIPVAGEFILCIFYLAAMAISATDAPTVSCD
                     YLYYSEYVSFCHILKALIPFTLFNWLLFAASFVLVLCFTFIPEIKRHGFKHTLFPSQF
                     DFGLIFGNDTPASKEIVASYDYRDANAYNESEVGIAPTVHGTNNNGGSDNHQTSVGVN
                     LGESSEEEKSIQATPSNFQNENINHSKPYA"
     gene            <992825..>993466
                     /locus_tag="CD36_53910"
                     /db_xref="GeneID:8048275"
     mRNA            <992825..>993466
                     /locus_tag="CD36_53910"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420641.1"
                     /db_xref="GeneID:8048275"
     CDS             992825..993466
                     /locus_tag="CD36_53910"
                     /inference="similar to AA sequence:UniProt:Q5AKB5"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420686.1"
                     /db_xref="GeneID:8048275"
                     /db_xref="GOA:B9WHX4"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:B9WHX4"
                     /translation="MGFIGFFRIVQFFFNIICFALCASHFRSAKAFALGVSSANMIYN
                     IYTLFIVPQMHQKTLAFLIFVAELAFPILYLISCIILVVQINTEYVTSYTVNFTSQYD
                     KYKDAPYSTVAMASGIFGLVCSFWFGFTCFAFFKYTFFPIYRNGKGFKSLFEVYVFKF
                     GCVVYNKDKSDRDRNSRDLEKNVPQKSIDQEKTLGTVILSSIDTLKVESKSPV"
     mobile_element  complement(994058..994315)
                     /mobile_element_type="retrotransposon:solo LTR, iota F"
     gene            <994507..>995043
                     /locus_tag="CD36_53920"
                     /db_xref="GeneID:8048276"
     mRNA            <994507..>995043
                     /locus_tag="CD36_53920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420642.1"
                     /db_xref="GeneID:8048276"
     CDS             994507..995043
                     /locus_tag="CD36_53920"
                     /inference="similar to AA sequence:UniProt:Q5AKB2"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420687.1"
                     /db_xref="GeneID:8048276"
                     /db_xref="UniProtKB/TrEMBL:B9WHX5"
                     /translation="MSTGRVCVGVFFRLLQFVGDIACFATSLRTYRPYNSFIITVTVL
                     NFIYNCYIWFGVPILAGKRAYNGILFGGDIMFFLLYIGSSIFQLFTAYTYYWNEYDSG
                     LSFSFECYYASWCIGVTCAALYYITFIMYVCWGVIPASKHGFWKRSFEKQPFKFGCLV
                     FDNSQVCYESKRDDEIDL"
     gene            <995653..>996894
                     /locus_tag="CD36_53930"
                     /db_xref="GeneID:8048277"
     mRNA            <995653..>996894
                     /locus_tag="CD36_53930"
                     /product="ribonuclease T2-like precursor, putative"
                     /transcript_id="XM_002420643.1"
                     /db_xref="GeneID:8048277"
     CDS             995653..996894
                     /locus_tag="CD36_53930"
                     /EC_number="3.1.27.1"
                     /inference="similar to AA sequence:UniProt:Q02933"
                     /inference="similar to AA sequence:UniProt:Q5AKB1"
                     /note="Similar to S. cerevisiae RNY1"
                     /codon_start=1
                     /transl_table=12
                     /product="ribonuclease T2-like precursor, putative"
                     /protein_id="XP_002420688.1"
                     /db_xref="GeneID:8048277"
                     /db_xref="GOA:B9WHX6"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="InterPro:IPR018188"
                     /db_xref="UniProtKB/TrEMBL:B9WHX6"
                     /translation="MKYKLLVILAHLLTSIKATQEVFDLSDLPPDSCPIDSPISCSRN
                     SQELDNINSCCYESPAGVILLTQFWDYNPATGPENLFTQHGLWGNMCSYGYPQFCDPS
                     LEINPNGDVIRSIIVDQFGDEELYNNMSYSWKDYHGKDSSFWAHEYNKHGTCFSTIKP
                     SCYLSNTPKNRNLYDFFKIAIGLFNKLPTYDWLAEAGIVPSNSKTYSLSEIQSALNDK
                     FGANVFIKCDYNHAINEIWYYHHVKGSLLQQNFLPIDSVAYTNCPSTGIKYPPKGKVA
                     HPTLTTKTATGTSTSIHNPTGVPARSYVHLSGKSGCLISNGKWYTSGTCATYHFKQTT
                     EESNIEIRSSKGICGINGNKEFTCSRAVSGGADFQIKDGKIGYQDTFDWCFGSTTGSG
                     STAQTSVKLADGSCDPFQLLI"
     gene            complement(<997365..>998717)
                     /locus_tag="CD36_53940"
                     /db_xref="GeneID:8048278"
     mRNA            complement(<997365..>998717)
                     /locus_tag="CD36_53940"
                     /product="S-adenosyl-L-homocysteine hydrolase, putative"
                     /transcript_id="XM_002420644.1"
                     /db_xref="GeneID:8048278"
     CDS             complement(997365..998717)
                     /locus_tag="CD36_53940"
                     /EC_number="3.3.1.1"
                     /inference="similar to AA sequence:UniProt:P39954"
                     /inference="similar to AA sequence:UniProt:Q5AKA9"
                     /note="Similar to S. cerevisiae SAH1;
                     In S. cerevisiae: catabolizes S-adenosyl-L-homocysteine
                     which is formed after donation of the activated methyl
                     group of S-adenosyl-L-methionine to an acceptor;
                     adenosylhomocysteinase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="S-adenosyl-L-homocysteine hydrolase, putative"
                     /protein_id="XP_002420689.1"
                     /db_xref="GeneID:8048278"
                     /db_xref="GOA:B9WHX7"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020082"
                     /db_xref="UniProtKB/TrEMBL:B9WHX7"
                     /translation="MSSAPATNYKVADISLAAFGRKDIELSENEMPGLMYIRKKYGPS
                     QPLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIFSTQDHAAAAIAAAGVPVF
                     AWKGETEEEYQWCIEQQLFAFKDGKKLNLILDDGGDLTSLVHEKYPEMLEDCYGLSEE
                     TTTGVHHLYKSLRDGKLKVPAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGK
                     VAVVAGFGDVGKGCAMALHGMGARVIVTEIDPINALQAAVSGYQVAPMDEVASIGQIF
                     VTTTGCRDIITGKHFEQMPEDAIVCNIGHFDIEIDVAWLKANAESVVNIKPQVDRYLM
                     KNGRHVILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFNADNKEFREKFPEFA
                     KTGPFDVGVHLLPKILDETVARCHLDHLGAKLTTLTETQAEYLGIPEEGPYKADIYRY
                     "
     gene            complement(<999225..>1001237)
                     /locus_tag="CD36_53950"
                     /db_xref="GeneID:8048279"
     mRNA            complement(<999225..>1001237)
                     /locus_tag="CD36_53950"
                     /product="transcriptional activator of nitrogen-regulated
                     genes, putative"
                     /transcript_id="XM_002420645.1"
                     /db_xref="GeneID:8048279"
     CDS             complement(999225..1001237)
                     /locus_tag="CD36_53950"
                     /inference="similar to AA sequence:UniProt:P43574"
                     /inference="similar to AA sequence:UniProt:Q5AKA8"
                     /note="Similar to S. cerevisiae GAT1;
                     In S. cerevisiae: transcriptional activator of genes
                     regulated by nitrogen catabolite repression;
                     transcriptional activator, nitrogen catabolite repression,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="transcriptional activator of nitrogen-regulated
                     genes, putative"
                     /protein_id="XP_002420690.1"
                     /db_xref="GeneID:8048279"
                     /db_xref="GOA:B9WHX8"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:B9WHX8"
                     /translation="MTTSNSQSKQFETVPSIVDLLYSAKKLLNLQPRIDNLHLRRSSS
                     RTQLVMQSQAISANNGKENNQSFSISPVNNQTLGSAHDKVLDLLSPLSIDDLKNNTIT
                     TTTTTTTSYHQNKLNQRLNGTTNNNPSHITGNNSSTRSTLFKPSSPHSENTSPKNISS
                     SSSSSLAPSTKANNLSHNNTTNNHGPSSEIKSSSSSLPPKKVTRCFNCNTTATPLWRR
                     DADGNTLCNACGLFLKLHGTCRPLSLKSDVIKKRNSRKANTSSKVGTPTNQFINTSVK
                     GNDASIRMKQTPIAIAPSPSSNSLYGGGGGSANSLPSSQRFKNVLILPKPPSGTNLTA
                     SARTKSIPIPANNAPSPDGSFSPSLKRKKSEVDVGPRTPTSLSASASASFSMRNRVPS
                     SSSLTGTSFSNSIKRNNSFSNRKSSLTSLMQRKNTVGTTPTTTNSLTSSNINILNQRF
                     PQPTYFENFGSSTGPQSPAISRHNSTTTLMNSNQVILENVNTPGSYNSTNSFPSYVPH
                     ETPNSIPETPLNVNDLLPSSFNRRSSQMSTKQERILEDYRASKPQTMPHKGIDDEMII
                     MDALNDFPGLEAIDMGGNINGMSADDYNNDYGDIFRKFTSLENESFVDQTANSIQDNN
                     FGFQQIPTENNFYKVGNNNSGNKNNSNNANNNSGDYKDLDWLKFDI"
     gene            complement(<1003101..>1004369)
                     /locus_tag="CD36_53960"
                     /db_xref="GeneID:8048280"
     mRNA            complement(<1003101..>1004369)
                     /locus_tag="CD36_53960"
                     /product="eukaryotic translation initiation factor 4E
                     (eIF-4E), putative"
                     /transcript_id="XM_002420646.1"
                     /db_xref="GeneID:8048280"
     CDS             complement(1003101..1004369)
                     /locus_tag="CD36_53960"
                     /inference="similar to AA sequence:UniProt:P07260"
                     /inference="similar to AA sequence:UniProt:Q5AKA7"
                     /note="Similar to S. cerevisiae TIF45;
                     In S. cerevisiae: the eIF4E-cap complex is responsible for
                     mediating cap-dependent mRNA translation via interactions
                     with the translation initiation factor eIF4G; mRNA
                     cap-binding protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="eukaryotic translation initiation factor 4E
                     (eIF-4E), putative"
                     /protein_id="XP_002420691.1"
                     /db_xref="GeneID:8048280"
                     /db_xref="GOA:B9WHX9"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR019770"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:B9WHX9"
                     /translation="MSENLKRAESLFNRIMNQTTNNDSSTSSFASQSSTPTTPISESS
                     PTSSTTTTNPNSTISGSRKFNSSSYSVPTIPSNIPKLDIEKLTREALASVPESHHTLP
                     YCWTIWYHSRNKKKEQGQKVSEELQESIEDQQPEQQQQQQQQQQSAEVDSYLQTTNEL
                     EFIDFSTGNPIHHIASLEQLWSSFSSIKKTYTLNIGTEFLIFKTGVNPVWEDPINSKG
                     GRWVFRFNRKIMDGHNSNNDKKSSKQELFRKRTSLIWERLVLKTLTGSLIPDSNSSEI
                     QELLLNDICGLVLSVRKDEDIISLWNSNLNFFGKKDQTKKLTSFQARRIICDSILRVI
                     RECDLINQGGDCIQTIDIGSNERVFGVSFDYRVHADNEREREKSITSNGANGSTAGGS
                     TGNSSGQTYGSHYNRRYNKYNTSKTDSTAK"
     gene            complement(<1005157..>1006614)
                     /locus_tag="CD36_53970"
                     /db_xref="GeneID:8048281"
     mRNA            complement(<1005157..>1006614)
                     /locus_tag="CD36_53970"
                     /product="di-and tri-peptidase, putative"
                     /transcript_id="XM_002420647.1"
                     /db_xref="GeneID:8048281"
     CDS             complement(1005157..1006614)
                     /locus_tag="CD36_53970"
                     /inference="similar to AA sequence:UniProt:P43616"
                     /inference="similar to AA sequence:UniProt:Q5AKA5"
                     /note="Similar to S. cerevisiae DUG1; glutamate
                     carboxypeptidase-like protein, putative; metallopeptidase,
                     putative; peptidase, M20 family member, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="di-and tri-peptidase, putative"
                     /protein_id="XP_002420692.1"
                     /db_xref="GeneID:8048281"
                     /db_xref="GOA:B9WHY0"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017153"
                     /db_xref="UniProtKB/TrEMBL:B9WHY0"
                     /translation="MSTSTTYEKLPLQPLFDTIEELKPKFIERLQKAISIPSVSSDES
                     LRPKVVEMANFLVGELKTLGFTDIQLKELGTQPPPVQDTNLQLPPIVLGRFGNDPSKK
                     TVLVYGHYDVQPALKDDGWNTEPFTMHYDKEKEILYGRGSTDDKGPVVGWLNVIEAHN
                     KLGWELPVNLVVCFEGMEESGSLGLDELVAKEAQNYFKKVDQVTISDNYWLGTTKPVL
                     TYGLRGCNYYQIIIEGPGADLHSGIFGGIIAEPMTDLVKVMSTLVDGSGKILIPGVSD
                     MVAPVTDKEDQLYDSIDFSVEELNAASGSKTSLHDNKKDILKHRWRFPSLSLHGIEGA
                     FSGAGAKTVIPAKVIGKFSIRTVPDIESKKLDELVFQHITSEFKKLNSPNKFKVELIH
                     DGNYWVSDPFNDSFTAAAKATQDVWNVVPDFTREGGSIPITLTFEKELGVDVLLLPMG
                     RGDDGAHSINEKLDVVNYINGCKTLGGYLHYYGKA"
     gene            <1007308..>1008903
                     /locus_tag="CD36_53980"
                     /db_xref="GeneID:8048282"
     mRNA            <1007308..>1008903
                     /locus_tag="CD36_53980"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420648.1"
                     /db_xref="GeneID:8048282"
     CDS             1007308..1008903
                     /locus_tag="CD36_53980"
                     /inference="similar to AA sequence:UniProt:Q5AKR7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420693.1"
                     /db_xref="GeneID:8048282"
                     /db_xref="UniProtKB/TrEMBL:B9WHY1"
                     /translation="MAYIPDNVSVISLSSDSSDEDDMDIMTVISGRKTEGITTYKSTR
                     RSSRIHQMNTSNTIPNNTYPSKLSDSKKPFDIQIPSVFKYEANKIHKINTRNENIKQE
                     INKEEKELKEKYEKLQQIKAKLVIELNDNGSDGLLRYDANENSSYIDSLIKQEINDMD
                     KVRRNFYFLKNVEDVIFDFEGENFEYIPQSLLFLITADPIKAYNTSPIIKTDLRYFIM
                     RALSTVLNPQHLISIIEMIKNVQGNVFTFDELIKFTNKFGGETKLLQNNKMSLKINMF
                     NNHLRMQLLRLTLLFNCYLIGDNNDEQNLVGILKLFTYIVSDYNANKREYTTLEYFTV
                     TVFTKLIKKYHKPDNNNEFVSQLFEYISGIEVVNYGNLQETDTTKSLELCFNFVRLLN
                     VAFARNNDRNITDVIYKLNIMIILNGIPIFDRSVPELVNSLVSYIKLTEIDLKFCYKI
                     KTLNFILNGQYMVNQTRDTLNQIKDDIVELKKIFYSSMEKLTTSTEGLDLVMMVQDVF
                     HQLEYLNNLIESFQHEDLFYNDI"
     gene            complement(1009068..1011157)
                     /locus_tag="CD36_53990"
                     /pseudo
                     /db_xref="GeneID:8048283"
     misc_feature    complement(1009068..1011157)
                     /locus_tag="CD36_53990"
                     /inference="similar to AA sequence:UniProt:Q5AKA2"
                     /note="apparent genome rearrangement; in-frame stop
                     codons;
                     not a pseudogene in C. albicans"
                     /pseudo
                     /db_xref="GeneID:8048283"
     gene            <1012362..>1013261
                     /locus_tag="CD36_54000"
                     /db_xref="GeneID:8048284"
     mRNA            <1012362..>1013261
                     /locus_tag="CD36_54000"
                     /product="member of the protein disulfide-isomerase
                     family, putative"
                     /transcript_id="XM_002420649.1"
                     /db_xref="GeneID:8048284"
     CDS             1012362..1013261
                     /locus_tag="CD36_54000"
                     /EC_number="5.3.4.1"
                     /inference="similar to AA sequence:UniProt:Q12404"
                     /inference="similar to AA sequence:UniProt:Q5AKA0"
                     /note="Similar to S. cerevisiae MPD1; thioredoxin,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="member of the protein disulfide-isomerase
                     family, putative"
                     /protein_id="XP_002420694.1"
                     /db_xref="GeneID:8048284"
                     /db_xref="GOA:B9WHY2"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:B9WHY2"
                     /translation="MFFNHLLALVHILILVSAGSQADEYASDPNIFELTPSNFDKVVH
                     KSNYTTLVKFYAPWCGYCQKLQPVYHKLGKYINKDAKYSINIASVNCDKDYNKQLCSQ
                     YQVRGFPTLMVFRPPKYEKGKQVKLQKHASEVYQGERSVKSITKFLTSRLKNYVKKFH
                     NIKSDGVAEWLAEDKPSVLLISNANSVSPLLKSLAIDFLDRVKVGMISKFNDEPHKLV
                     IGDKEIEVPSTSKSMLFYFNKEKGELVAYTKSEKLNDKVKITEWIIEQTQQQPAEGPL
                     SKKENKYYYKYRTGKKKIEHDEL"
     gene            complement(<1013297..>1014148)
                     /locus_tag="CD36_54010"
                     /db_xref="GeneID:8048285"
     mRNA            complement(<1013297..>1014148)
                     /locus_tag="CD36_54010"
                     /product="serine hydrolase, putative"
                     /transcript_id="XM_002420650.1"
                     /db_xref="GeneID:8048285"
     CDS             complement(1013297..1014148)
                     /locus_tag="CD36_54010"
                     /EC_number="3.1.-.-"
                     /inference="similar to AA sequence:UniProt:Q5AKR2"
                     /inference="similar to AA sequence:UniProt:Q99369"
                     /note="Similar to S. cerevisiae FSH3"
                     /codon_start=1
                     /transl_table=12
                     /product="serine hydrolase, putative"
                     /protein_id="XP_002420695.1"
                     /db_xref="GeneID:8048285"
                     /db_xref="GOA:B9WHY3"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WHY3"
                     /translation="MAPKKNITYKGKILFLHGYTQSSSLFYAKTSALRKKLIKLGYKC
                     VYLNGPYVLTPADLPTTDSLSKFGSATTDTEDVTYRAWWVKKDKTNDAIDLDESIATV
                     KDYIQKGEIIADNDLEVEEETDEEKKLPIVGILGFSQGAAFGGLIAHKFPQWFETDPL
                     KFVVLYSGFKLDTSKKTGNDKYNEYYPQTEDDVKNGGFKYLHVLGELDTVVAEDRGYS
                     LYELTKSSSDILKHPGGHFVPNSKIYVDNVANWIESHQNGSQVKSEKPEDDIDSLLDM
                     MDNFGKA"
     gene            complement(<1014310..>1015173)
                     /locus_tag="CD36_54020"
                     /db_xref="GeneID:8048286"
     mRNA            complement(<1014310..>1015173)
                     /locus_tag="CD36_54020"
                     /product="haloacid dehalogenase-like hydrolase, putative"
                     /transcript_id="XM_002420651.1"
                     /db_xref="GeneID:8048286"
     CDS             complement(1014310..1015173)
                     /locus_tag="CD36_54020"
                     /inference="similar to AA sequence:UniProt:P53078"
                     /inference="similar to AA sequence:UniProt:Q5AK98"
                     /note="Similar to S. cerevisiae SSM1;
                     In S. cerevisiae: overexpression suppresses the 6-AU
                     sensitivity of transcription elongation factor S-II, as
                     well as resistance to other pyrimidine derivatives;
                     pyrimidine nucleotidase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="haloacid dehalogenase-like hydrolase, putative"
                     /protein_id="XP_002420696.1"
                     /db_xref="GeneID:8048286"
                     /db_xref="InterPro:IPR010237"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:B9WHY4"
                     /translation="MTVSNSQTVNYINPELTEAENAKPGRHVSLPFGYGPIPKQFQNK
                     RIFFFDIDNCLYPRSTRIFEMMQVKIHDYFKKSLSLNDEDARNLHMNYYKTYGLAIEG
                     LVRNHQVDALEYNSKVDDALDLHSVLRYDSDLRNTLMAIKESRKFDYFWLVTNAYKNH
                     ALRVISFLGIGDLFDGLTYCDYSKDPIICKPMPEYFYNCFQITQLDYQNAEVLSEQYF
                     IDDSELNVKEAKRLGVGHVIHYVELPSDIEKLKAKPDFEEFYGTGDNSDPSKIWILDK
                     IQNLPTLIGCT"
     gene            complement(<1015828..>1016361)
                     /locus_tag="CD36_54030"
                     /db_xref="GeneID:8048287"
     mRNA            complement(<1015828..>1016361)
                     /locus_tag="CD36_54030"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420652.1"
                     /db_xref="GeneID:8048287"
     CDS             complement(1015828..1016361)
                     /locus_tag="CD36_54030"
                     /inference="similar to AA sequence:UniProt:Q5AK97"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420697.1"
                     /db_xref="GeneID:8048287"
                     /db_xref="UniProtKB/TrEMBL:B9WHY5"
                     /translation="MLLTQLIILFTLVSQVLSVSISDLNNIVSLQLTKRLGGSSGGRS
                     GGGSSGSSSSGRSGGSSSSGSSSGSKGGSSSGSSSSGSKGGGSNSGSSSGTRNWGSNQ
                     YHCSGNTCGYGNYFAPSAAAAAAGYGSASYYAQHHNSTSTDNSTSTRTFSGSSSLNIP
                     STHFYIIGLAAAYSIKL"
     gene            complement(<1017403..>1017858)
                     /locus_tag="CD36_54040"
                     /db_xref="GeneID:8048288"
     mRNA            complement(<1017403..>1017858)
                     /locus_tag="CD36_54040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420653.1"
                     /db_xref="GeneID:8048288"
     CDS             complement(1017403..1017858)
                     /locus_tag="CD36_54040"
                     /inference="similar to AA sequence:UniProt:Q5AK95"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420698.1"
                     /db_xref="GeneID:8048288"
                     /db_xref="UniProtKB/TrEMBL:B9WHY6"
                     /translation="MSLDRSEIFLNYVENFNKRIGALHKTEEYFRQSSIIEAVSIPTN
                     KLGKFLDRKIEEFNNTITQIDRDFLDSLNPDLAHRADYSAARKEIGRELGVQRTELFA
                     FVYRAIDNMIEKRSKIEKNYHEDLAAIESEFMDGNIDQTEYINTILGDF"
     gene            <1018823..>1020022
                     /locus_tag="CD36_54050"
                     /db_xref="GeneID:8048289"
     mRNA            <1018823..>1020022
                     /locus_tag="CD36_54050"
                     /product="ribonuclease T2-like precursor, putative"
                     /transcript_id="XM_002420654.1"
                     /db_xref="GeneID:8048289"
     CDS             1018823..1020022
                     /locus_tag="CD36_54050"
                     /EC_number="3.1.27.1"
                     /inference="similar to AA sequence:UniProt:Q02933"
                     /inference="similar to AA sequence:UniProt:Q5AK94"
                     /note="Similar to S. cerevisiae RNY1"
                     /codon_start=1
                     /transl_table=12
                     /product="ribonuclease T2-like precursor, putative"
                     /protein_id="XP_002420699.1"
                     /db_xref="GeneID:8048289"
                     /db_xref="GOA:B9WHY7"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="InterPro:IPR018188"
                     /db_xref="UniProtKB/TrEMBL:B9WHY7"
                     /translation="MLSILSTATLFVATVQAADFSSSCPLDSPISCSNSGDTSNSCCY
                     ENPGGIILFTQFWDYNPASGPADSFTIHSIWNDYCSGGYPQFCDTSLEIDSTGSTIKS
                     IVVDQFGDQTLYDNMNKYWTDINGNNPKFWAHEFNKHGTCLNTLNPSCYSNYKQNENV
                     YDYYSLVYQLFQKLPTYQWLASAGIKPSTTATYTLSQIQNALKGKFGAEVYIACDSNN
                     AINEVWYFYHIKGSILQQNYLPIDTVSKTNCPSSGIKFPPKGESAGNTLTTKTTGTTT
                     SGSGSTSVPATSYINLTGKSGCLISNGKYYTSGTCATYHFTAGSSGNTQITSSKGNCG
                     VDSSNQFVCSSSTSATDFQVSGGNIGYNGNFDWCLGAVAGSGSTAQTSVKLSDGSCSS
                     FQLTLSS"
     gene            complement(<1020304..>1021467)
                     /locus_tag="CD36_54060"
                     /db_xref="GeneID:8048290"
     mRNA            complement(<1020304..>1021467)
                     /locus_tag="CD36_54060"
                     /product="zinc finger transcription factor, putative"
                     /transcript_id="XM_002420655.1"
                     /db_xref="GeneID:8048290"
     CDS             complement(1020304..1021467)
                     /locus_tag="CD36_54060"
                     /inference="similar to AA sequence:UniProt:P41696"
                     /inference="similar to AA sequence:UniProt:Q5AK93"
                     /note="Similar to S. cerevisiae AZF1;
                     In S. cerevisiae: genetic and physical interactions
                     indicate a possible role in mitochondrial transcription or
                     genome maintenance"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc finger transcription factor, putative"
                     /protein_id="XP_002420700.1"
                     /db_xref="GeneID:8048290"
                     /db_xref="GOA:B9WHY8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:B9WHY8"
                     /translation="MTLSSRRRELRASIRENIRQAENVDKEEDTDKHIDQELRHLQHS
                     HPQEHEATTNHDATKSNNTIKKEHDGLEDHNNTYDTTNVKREFDGTQNEDDQEEVEVE
                     EEEEEEEYHEENEHREEPRRRGTRSKRQKTGAPNITVAPQTRTIFKQIDNPDSTICEH
                     CGLVFRNVIDKRNHRRTHSQPKRHECKTCGKKFSQKANLEIHKTHVHHDLILDGDNVE
                     LQNQPAEDNSANVFSNDSNSKPTVNLKDVRVFHCNALQCGKGFISYDKLMDHVTTEHP
                     NFVPEVKKETKREKKKTQLPKVHQCTFEGCDKSFAKISDYKRHYRIHTGERPYVCEHC
                     GASFNQRYRLTTHTRIHTGEKPFQCKYCGKTFARGDAVQSHIFSIHRAKGEAF"
     gene            <1021903..>1022940
                     /locus_tag="CD36_54070"
                     /db_xref="GeneID:8048291"
     mRNA            <1021903..>1022940
                     /locus_tag="CD36_54070"
                     /product="scramblase, putative"
                     /transcript_id="XM_002420656.1"
                     /db_xref="GeneID:8048291"
     CDS             1021903..1022940
                     /locus_tag="CD36_54070"
                     /inference="similar to AA sequence:UniProt:P47140"
                     /inference="similar to AA sequence:UniProt:Q5AK91"
                     /note="involved in the redistribution of phospholipids
                     after cell activation or injury (Pfam: PF03803)"
                     /codon_start=1
                     /transl_table=12
                     /product="scramblase, putative"
                     /protein_id="XP_002420701.1"
                     /db_xref="GeneID:8048291"
                     /db_xref="InterPro:IPR005552"
                     /db_xref="InterPro:IPR025659"
                     /db_xref="UniProtKB/TrEMBL:B9WHY9"
                     /translation="MFSIRGCHNLASRALVRRNLHTATLLQSPRFVNHNFNNRTRVTK
                     EISPEEVRQFQEAQARAREQGQAPRNPYSRQFNNDPCYSFHLPDNTNGIITPHDPIYD
                     ILKEPTLVIERQIEFMNLFIGFEQANRYVIMNASGETIGYMEEKDVGFGKMLGRQFFR
                     LHRPFDIDVFNARGELALSIKRPFSWINSHIKALLPGYDHNNEIMYEVVGESVQSWHL
                     WRRKYNLFKLEDETTDEYEQFGAVDAPFLSFDFPVKNAAGEVIASIDRNWVGLGREMF
                     TDTGVYILRYDPKSFEGMEDAYGTISKQGITLDQRAVILSCFTSIDFDYFSRHSGGHG
                     LFPFGGSYDDV"
     gene            complement(<1022964..>1023973)
                     /locus_tag="CD36_54080"
                     /db_xref="GeneID:8048292"
     mRNA            complement(join(<1022964..1023866,1023935..>1023973))
                     /locus_tag="CD36_54080"
                     /product="ubiquitin carboxyl-terminal hydrolase, putative"
                     /transcript_id="XM_002420657.1"
                     /db_xref="GeneID:8048292"
     CDS             complement(join(1022964..1023866,1023935..1023973))
                     /locus_tag="CD36_54080"
                     /EC_number="3.4.19.12"
                     /inference="similar to AA sequence:UniProt:P35127"
                     /inference="similar to AA sequence:UniProt:Q4WRL2"
                     /inference="similar to AA sequence:UniProt:Q5AK90"
                     /note="Similar to S. cerevisiae YUH1;
                     In S. cerevisiae: cleaves ubiquitin-protein fusions to
                     generate monomeric ubiquitin; hydrolyzes the peptide bond
                     at the C-terminus of ubiquitin;
                     spliced gene; ubiquitin thioesterase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ubiquitin carboxyl-terminal hydrolase, putative"
                     /protein_id="XP_002420702.1"
                     /db_xref="GeneID:8048292"
                     /db_xref="GOA:B9WHZ0"
                     /db_xref="InterPro:IPR001578"
                     /db_xref="InterPro:IPR017390"
                     /db_xref="UniProtKB/TrEMBL:B9WHZ0"
                     /translation="MSQSGWNTIDSDAGVFTELVEKLGVENIEINDLYSIDSDTLRAL
                     QPIHGLIFLFKYSKIDREFANSNQPITGEYDGDYLDHDIFFAHQTIQNACATQAVLNI
                     LFNLQDVSLGEELNNFKSFVTGFDSEMIGETISNSDLIRSIHNSFSTPHSFVDEDKPA
                     PPPDRDDKDDGLFHFVGYIFKRGKIYELDGLKQYPISHGACNGQDEFIQKLPAIVQER
                     ISKYGNELRFSLLAVTNNKLEQAQAMGDQEEIAHQLHKRELWKKENELRKHDYTGLIV
                     QLLKNISKEKSDKEWDEFLQKGRDKTQHLIAQSIKKT"
     gene            complement(<1024278..>1025189)
                     /locus_tag="CD36_54090"
                     /db_xref="GeneID:8048293"
     mRNA            complement(<1024278..>1025189)
                     /locus_tag="CD36_54090"
                     /product="regulator of acetyl-co synthetase activity,
                     putative"
                     /transcript_id="XM_002420658.1"
                     /db_xref="GeneID:8048293"
     CDS             complement(1024278..1025189)
                     /locus_tag="CD36_54090"
                     /inference="similar to AA sequence:UniProt:P33303"
                     /inference="similar to AA sequence:UniProt:Q5AK89"
                     /note="Similar to S. cerevisiae SFC1;
                     In S. cerevisiae: transports succinate into and fumarate
                     out of the mitochondrion; required for ethanol and acetate
                     utilization; succinate/fumarate mitochondrial transporter,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="regulator of acetyl-co synthetase activity,
                     putative"
                     /protein_id="XP_002420703.1"
                     /db_xref="GeneID:8048293"
                     /db_xref="GOA:B9WHZ1"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:B9WHZ1"
                     /translation="MSTAQKQKKGAVDFVAGGVAGLFEALCCHPLDTIKVRMQLYRKS
                     GQKPPGFIKTGINIVQKEGFLSLYKGLGAVVIGIVPKMAIRFSSYEFYRSFFLDENGK
                     ITTGKTFLAGVGAGITESIMVVNPMEVVKIRLQAQHHSMKDPLDIPKYRNAPHAAYLI
                     VKEEGFSTLYRGVSLTCARQATNQGANFATYSTIKAYLQKKQNSELLPAWQTSIIGLI
                     SGAVGPLTNAPLDTIKTRLQKSKFTTKENGLVRIVKIGKQLVKEEGVGALYKGITPRI
                     MRVAPGQAVVFTVYEAVKHYLTNETTA"
     gene            complement(<1026217..>1026762)
                     /locus_tag="CD36_54100"
                     /db_xref="GeneID:8048294"
     mRNA            complement(join(<1026217..1026514,1026599..>1026762))
                     /locus_tag="CD36_54100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420659.1"
                     /db_xref="GeneID:8048294"
     CDS             complement(join(1026217..1026514,1026599..1026762))
                     /locus_tag="CD36_54100"
                     /inference="similar to AA sequence:UniProt:A5E370"
                     /note="spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420704.1"
                     /db_xref="GeneID:8048294"
                     /db_xref="UniProtKB/TrEMBL:B9WHZ2"
                     /translation="MNGSLENRYFKTSNTSLRDNYRRRFLLGHELYIRLCLLDDIFTY
                     EILDIGTVADIHCKLKKYFTNYREIQFFTIISFDSTIDIILRKYLEFFKVIKPVQNKN
                     NYAYTNDESVISIPYLLGDHIRSLVLVGDMYLECVLNTACYRNFNVNLYMV"
     gene            complement(<1027120..>1027938)
                     /locus_tag="CD36_54110"
                     /db_xref="GeneID:8048295"
     mRNA            complement(<1027120..>1027938)
                     /locus_tag="CD36_54110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420660.1"
                     /db_xref="GeneID:8048295"
     CDS             complement(1027120..1027938)
                     /locus_tag="CD36_54110"
                     /inference="similar to AA sequence:UniProt:Q5AK88"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420705.1"
                     /db_xref="GeneID:8048295"
                     /db_xref="GOA:B9WHZ3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:B9WHZ3"
                     /translation="MSSVIASNIPSDVSPAKVKEFFSFCGKITDLKPLGDNGKVKKYE
                     VVFASPKAVSTALLLSDAELENSFIKVEEVPEITEGETGLAPEQGGAAAAAAATTTTA
                     KDIKEEAVLTGDKTYDEVDQEEKPKYAIFAQLLADGYVISDQVIAKGIEFDKKNGVSS
                     RFNDFIAELDKKYVHSHDPKSTVNQQLQRAQASYEKSGIDQKLRKYFEDAAKSPLGLK
                     IHEYYKSFAKDVADVHQEAVRLANIKKRELEEKKHAESGSTAAETKDTSIPQVQ"
     gene            complement(<1028356..>1028622)
                     /locus_tag="CD36_54120"
                     /db_xref="GeneID:8048296"
     mRNA            complement(<1028356..>1028622)
                     /locus_tag="CD36_54120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420661.1"
                     /db_xref="GeneID:8048296"
     CDS             complement(1028356..1028622)
                     /locus_tag="CD36_54120"
                     /inference="similar to AA sequence:UniProt:A5E371"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420706.1"
                     /db_xref="GeneID:8048296"
                     /db_xref="GOA:B9WHZ4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:B9WHZ4"
                     /translation="MSSVLASNIPSKTTPAQVKEFFQSQAGEVSDLIPLADNGKVQKF
                     EVLFKDPKSVSAALDLSDAYIDGVAIRVDEVPELTDGQVGKAPQ"
     gene            complement(<1029040..>1029993)
                     /locus_tag="CD36_54130"
                     /db_xref="GeneID:8048297"
     mRNA            complement(<1029040..>1029993)
                     /locus_tag="CD36_54130"
                     /product="arginase, putative"
                     /transcript_id="XM_002420662.1"
                     /db_xref="GeneID:8048297"
     CDS             complement(1029040..1029993)
                     /locus_tag="CD36_54130"
                     /EC_number="3.5.3.1"
                     /inference="similar to AA sequence:UniProt:P00812"
                     /inference="similar to AA sequence:UniProt:Q5AK86"
                     /note="Similar to S. cerevisiae CAR1;
                     In S. cerevisiae: responsible for arginine degradation;
                     expression responds to both induction by arginine and
                     nitrogen catabolite repression; disruption enhances freeze
                     tolerance"
                     /codon_start=1
                     /transl_table=12
                     /product="arginase, putative"
                     /protein_id="XP_002420707.1"
                     /db_xref="GeneID:8048297"
                     /db_xref="GOA:B9WHZ5"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR014033"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:B9WHZ5"
                     /translation="MSSIQYKYHPDKKASIITAPFSGGQPKGGVELGPDYILKAGFQK
                     QIESLGWTTELKEPLEGTEYEKMKTNDKDEFGVKNSRIVSESCQKIHDAVKGSLAEGK
                     LPITIGGDHSIGTATVSASLVHDPSTCVIWVDAHADINTPKTTDSGNLHGCPLSFIMG
                     IDRDSYPPEFSWVPQVLKSNKLVYIGLRDVDDGEKEILRKHNIAAFSMYHVDKYGIGK
                     VVEMALDKVNPNRDCPVHLSYDVDAIDPSFVPATGTRVEGGLSLREGLFIAEEIAQSG
                     LLQSLDIVETNPMLAETEEHVLDTVSAACAIGRCALGQTLL"
     gene            1030267..1030496
                     /locus_tag="CD36_54135"
                     /pseudo
                     /db_xref="GeneID:8048298"
     misc_feature    1030267..1030496
                     /locus_tag="CD36_54135"
                     /inference="similar to AA sequence:UniProt:Q5AK85"
                     /pseudo
                     /db_xref="GeneID:8048298"
     gene            <1031301..>1034789
                     /locus_tag="CD36_54140"
                     /db_xref="GeneID:8048299"
     mRNA            <1031301..>1034789
                     /locus_tag="CD36_54140"
                     /product="glycerophosphocholine phosphodiesterase,
                     putative"
                     /transcript_id="XM_002420663.1"
                     /db_xref="GeneID:8048299"
     CDS             1031301..1034789
                     /locus_tag="CD36_54140"
                     /EC_number="3.1.4.46"
                     /inference="similar to AA sequence:UniProt:Q02979"
                     /inference="similar to AA sequence:UniProt:Q5AKP7"
                     /note="Similar to S. cerevisiae GDE1;
                     In S. cerevisiae: hydrolyzes GroPCho to choline and
                     glycerolphosphate, for use as a phosphate source and as a
                     precursor for phosphocholine synthesis;
                     glycerophosphodiester phosphodiesterase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="glycerophosphocholine phosphodiesterase,
                     putative"
                     /protein_id="XP_002420708.1"
                     /db_xref="GeneID:8048299"
                     /db_xref="GOA:B9WHZ6"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:B9WHZ6"
                     /translation="MKFGKTYVTHQIPEWSIYYMNYKQLKKIIKSIDSVANTNVDESK
                     YPEIISDTLGSFFYDLDRDIEKVDSFYNTKFKEYNRRLNKIFQVLGYQDGQITHNIDS
                     NEELDEIINILIELRGLFRNLKWFAELNHKGFIKILKKLDKKLTSILQQDGGVTVGDV
                     SNHNQEAYMGSRINALPFANGTESTNCLDSIHNILSRIETRNNVVQETIPVKNNENSM
                     SALIKNDDFEGLKKHITIKSSQKFLISTLNKAALANSTKCIDVIWSQLDMLYDDSDFN
                     GRNFFHQHIISLGKAQFIREEQIVPGEVTNRLIGGDNGPDNSNKNDNPVGLLYILNKL
                     KHKRLILAEDHYHRTPLHYSSQYGLVEVTRYLVEFGIKWGLINTSISIDDVSIWGDQE
                     GLTPLHLSIIGKHPKTTETLLSFNKAQTLTCPNLLLLAVRLNSPQILNSLIVEGNIDV
                     NYTDIDHRNETALYIASKLNHPDLVEFLLESNANTEIGENVFGWTPIFIAASEGFMTI
                     VKLLKEYGALYDIVDDSGWLPIEHACLRGHLDVTDLLLPKNEKLLLYDMYHPENNLPR
                     IPSLAASPVLTGSDDGTVSTSSIDKLPEPQKNTVNQFYKQLKNNSSNNVSRSTSPKRN
                     KRYKPVKSFGHRYLNEDESLILLTLGTTDLRDTNVPVELNKVSLARSFATELDTALSL
                     SITCRHKSTNNPVEPPVVVDLPLEDFHGSATDPISFKLSNNLTVNDVIITFDIIPTYQ
                     VNKKVIGRAIALLKDAYTKVGPNLRSLNNSIAIPIIESTNLDILGTIRFEYLQVLPFK
                     HRAMSIARSDTYWKQLVSTRVIGHRGLGKNLSGKKSLQLGENTVESFIAAASLGASYV
                     EFDVQLTKDHVPVVYHDFTVAESGVDIPMHLLTLEQFMGFNRPTEKPTHTVDDEVLTR
                     GKQRAQSSYQLSNNHNDDIDKEFTNQTDERMKFTKTWKNQGYKGNLRGSSVASNFVTL
                     RELFRKVPKNVGFNIEVKYPMLDEAQLEDMGEIGVDLNFFVDTILKVIYDENTTGRDI
                     VFSSFHPDICLLLSLKQPTMPVLFLTEAGTAPMYDIRASSLQNAVRFSKKWNLLGIVS
                     NALALIKTPRLAQVVKSMGLVCVTYGTENNEPELAKIQMRAGVDAVIVDSVLAVREGL
                     REHNETMNELEDSPTE"
     gene            <1035012..>1036199
                     /locus_tag="CD36_54150"
                     /db_xref="GeneID:8048300"
     mRNA            <1035012..>1036199
                     /locus_tag="CD36_54150"
                     /product="negative regulator of the TOR signalling
                     pathway, putative"
                     /transcript_id="XM_002420664.1"
                     /db_xref="GeneID:8048300"
     CDS             1035012..1036199
                     /locus_tag="CD36_54150"
                     /inference="similar to AA sequence:UniProt:Q12199"
                     /inference="similar to AA sequence:UniProt:Q5AKP6"
                     /note="Similar to S. cerevisiae TIP41;
                     In S. cerevisiae: component of the TOR (target of
                     rapamycin) signaling pathway, which controls nuclear
                     localization of nutrient-regulated transcription factors;
                     TIP41 interacts with TAP42 and negatively regulates the
                     TOR signaling pathway; type 2A phosphatase activator,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="negative regulator of the TOR signalling
                     pathway, putative"
                     /protein_id="XP_002420709.1"
                     /db_xref="GeneID:8048300"
                     /db_xref="InterPro:IPR007303"
                     /db_xref="UniProtKB/TrEMBL:B9WHZ7"
                     /translation="MSETNNPTSSNEKKPVVFAVPSSSSSSTRRGINAVHVNSAREMV
                     RLHTQGRNPPARQDNVISLPSGAGAPSHVSRIGTTELMSSNFPKIQIPLHHDETECKN
                     PQCQHCGQIIIPSPQSSYPIQDKPSITVNGWSIFTTKKPILNSLELDHLAETKFDFPL
                     PEMIFGNNNVRIRNDVTGGTIEFNAIDALSSLDPNCPLKVSCHEEWLKSRRSKHASLK
                     QEQSLKKDLSEFTENLDGLKPYDWTYSTNYKGTVHNLDLKPSELHEIPINKLTKPDPI
                     LFFDEAILFEDELADNGISILSYKIRVMPTCLLLLCRFFLRIDDVIFRVRDTRCYIDF
                     DTNELIREYKVQEQEYDQVMSLVKVKNNKDPKKLFRDSNWVSQNIHVLSKEIDISVVD
                     IQK"
     gene            <1036429..>1037217
                     /locus_tag="CD36_54160"
                     /db_xref="GeneID:8048301"
     mRNA            <1036429..>1037217
                     /locus_tag="CD36_54160"
                     /product="mitochondrial 37S ribosomal protein RSM26"
                     /transcript_id="XM_002420665.1"
                     /db_xref="GeneID:8048301"
     CDS             1036429..1037217
                     /locus_tag="CD36_54160"
                     /EC_number="1.15.1.1"
                     /inference="similar to AA sequence:UniProt:O42919"
                     /inference="similar to AA sequence:UniProt:P47141"
                     /inference="similar to AA sequence:UniProt:Q4WN88"
                     /inference="similar to AA sequence:UniProt:Q5AK82"
                     /note="Similar to S. cerevisiae RSM26"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 37S ribosomal protein RSM26"
                     /protein_id="XP_002420710.1"
                     /db_xref="GeneID:8048301"
                     /db_xref="GOA:B9WHZ8"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:B9WHZ8"
                     /translation="MFNSISRGVFASSTRFARVARFLHQVPKLESHEAWTQEGIPGLL
                     SPKGYNLAWTDYQNYLLTNLTLLTNGTSSEYKTPYQTLLHTAKQTTQQHVFHYASMAH
                     NNHFFFQQLDTKENASKTKPSRFLMEKLMHEDILDLDQLRNKLLTMAENTYGQGWIFL
                     VETEDKNLKFINCHNDGTPYYYAKQQLLDLNGGIDEGNFSYLENLKSRALNNEKDYTL
                     PILAINYWDYMYIPDYGVTGKSDYLNKLWDHINWDVVNKRLFQI"
     gene            complement(<1037293..>1038195)
                     /locus_tag="CD36_54170"
                     /db_xref="GeneID:8048302"
     mRNA            complement(<1037293..>1038195)
                     /locus_tag="CD36_54170"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420666.1"
                     /db_xref="GeneID:8048302"
     CDS             complement(1037293..1038195)
                     /locus_tag="CD36_54170"
                     /inference="similar to AA sequence:UniProt:Q5AKP4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420711.1"
                     /db_xref="GeneID:8048302"
                     /db_xref="UniProtKB/TrEMBL:B9WHZ9"
                     /translation="MSDELGKVCDQILDETLLMSHKYGIPKVESSSQQSASNVKQLEH
                     KYYHLYKQLNHKLNHLIYLNKLQELNQKSTQAELDTQLKTIKDQMGIESNQELLDFLK
                     LQNNEIKTEKLLLQYLLMIEPILNSTHRSDLNQSEQRISKMLNELYNDDENDTGLVFQ
                     RIANRKNQNELQAGNYNLIKNVVKPIIDGLGELNKTLMTLNKQYVNKKQSQMEDDPEE
                     GVKRKQYYELVRKWKELQDMVIEIPSLISDLPINWYDDPTLLQIMQEVDEIQIKLNTY
                     QSIINEDTISAYTTTELLALEFPC"
     gene            <1038455..>1039363
                     /locus_tag="CD36_54180"
                     /db_xref="GeneID:8048371"
     mRNA            <1038455..>1039363
                     /locus_tag="CD36_54180"
                     /product="uncharacterized protein yjr088c homologue,
                     putative"
                     /transcript_id="XM_002420667.1"
                     /db_xref="GeneID:8048371"
     CDS             1038455..1039363
                     /locus_tag="CD36_54180"
                     /inference="similar to AA sequence:UniProt:P47133"
                     /inference="similar to AA sequence:UniProt:Q5AKP3"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein yjr088c homologue,
                     putative"
                     /protein_id="XP_002420712.1"
                     /db_xref="GeneID:8048371"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:B9WI00"
                     /translation="MSSDPILVKKKLLQIASTGKYATFTPEQSYTHYEELQDFLVLNQ
                     DSLLDSIELFNLYELQFYLSILTLHDIEAKNVLDKICDQFDFKDSNKNKGRSQRIKIL
                     QSVYAESKGEIETASKLLSEDPDELRLSRRLTTLSRHDKNLTKYINNLIYYLNLQPSD
                     LIAWAELSDQYQKLGNYDKSVYCLKEVVLQNPLAYPIFYKIGLLYYYLFLQQEGNLKT
                     DKKDKLFELMKILINSRDNYLYSLEINDKYEKNWVGLKTIVSLPFNDKLKKISESSKE
                     IKDYLNHNEKLKPIVDRKLKELNISI"
     gene            complement(<1039568..>1039669)
                     /gene="CUP1"
                     /locus_tag="CD36_54185"
                     /db_xref="GeneID:8048372"
     mRNA            complement(<1039568..>1039669)
                     /gene="CUP1"
                     /locus_tag="CD36_54185"
                     /product="copper resistance-associated metallothionein,
                     putative"
                     /transcript_id="XM_002420668.1"
                     /db_xref="GeneID:8048372"
     CDS             complement(1039568..1039669)
                     /gene="CUP1"
                     /locus_tag="CD36_54185"
                     /inference="similar to AA sequence:UniProt:Q9UVL5"
                     /note="In C. albicans: transcription is induced by copper"
                     /codon_start=1
                     /transl_table=12
                     /product="copper resistance-associated metallothionein,
                     putative"
                     /protein_id="XP_002420713.1"
                     /db_xref="GeneID:8048372"
                     /db_xref="UniProtKB/TrEMBL:B9WI01"
                     /translation="MSKFELVNYSSGCSCGADCKCASETECKCASKK"
     gene            complement(<1040861..>1042582)
                     /locus_tag="CD36_54190"
                     /db_xref="GeneID:8048032"
     mRNA            complement(<1040861..>1042582)
                     /locus_tag="CD36_54190"
                     /product="CTP synthase, putative"
                     /transcript_id="XM_002420669.1"
                     /db_xref="GeneID:8048032"
     CDS             complement(1040861..1042582)
                     /locus_tag="CD36_54190"
                     /EC_number="6.3.4.2"
                     /inference="similar to AA sequence:UniProt:P28274"
                     /inference="similar to AA sequence:UniProt:Q5AK79"
                     /note="Similar to S. cerevisiae URA7;
                     In S. cerevisiae: catalyzes the ATP-dependent transfer of
                     the amide nitrogen from glutamine to UTP, forming CTP, the
                     final step in de novo biosynthesis of pyrimidines;
                     involved in phospholipid biosynthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="CTP synthase, putative"
                     /protein_id="XP_002420714.1"
                     /db_xref="GeneID:8048032"
                     /db_xref="GOA:B9WI02"
                     /db_xref="InterPro:IPR004468"
                     /db_xref="InterPro:IPR017456"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:B9WI02"
                     /translation="MKYVVVSGGVISGIGKGVLASSTGLLFKTLGLRVTSIKIDPYMN
                     IDAGTMSPLEHGECFVLDDGGEVDLDLGNYERYLNITLTRNHNITTGKIYSHVIERER
                     KGDYLGKTVQVVPHITNAIQDWIERVARIPVDDTGLEPEVCIIELGGTVGDIESAPFV
                     EALRQFQFRVGNENFALIHVSLVPVIHGEQKTKPTQAAIKDLRSLGLTPDMIACRCQE
                     ELEHATIEKIGMFCHVGPEQVIAVHDVNSTYHVPLLLKQQKVMNYLTKRLTIGEIDKQ
                     SLAKGEALLSKWRHLTSSHDKSFETVTIALVGKYTHLHDSYLSVIKSLEHASMRCNRR
                     LKIEWVESSDLEEDTKKENLSKYHKAWHFVCQADGILVPGGFGSRGIEGMVSAAKYAR
                     ENNVPYLGVCLGLQIAVIEFVRSVLGVSHSTSMEFDSNIEEKDASVVYMPDVDQVKLG
                     GTMRLGIHQTKFVKDSEWSNLRKLYGGADAVYERHRHRYEVNPLLIDDIEKQGLKFIG
                     KDETGKRMEMIELKDHKFFVGTQYHPEYLSKVLDPSRPFLGLVAAAAGILEDVLSRDD
                     LNYKGEF"
     gene            complement(<1043296..>1043886)
                     /locus_tag="CD36_54200"
                     /db_xref="GeneID:8048373"
     mRNA            complement(<1043296..>1043886)
                     /locus_tag="CD36_54200"
                     /product="component of the ESCRT-II complex, putative"
                     /transcript_id="XM_002420670.1"
                     /db_xref="GeneID:8048373"
     CDS             complement(1043296..1043886)
                     /locus_tag="CD36_54200"
                     /inference="similar to AA sequence:UniProt:P47142"
                     /inference="similar to AA sequence:UniProt:Q5AK78"
                     /note="Similar to S. cerevisiae VPS25;
                     involved in ubiquitin-dependent sorting of proteins into
                     the endosome; vacuolar protein-sorting-associated protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="component of the ESCRT-II complex, putative"
                     /protein_id="XP_002420715.1"
                     /db_xref="GeneID:8048373"
                     /db_xref="InterPro:IPR008570"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014041"
                     /db_xref="UniProtKB/TrEMBL:B9WI03"
                     /translation="MTDPVPQFEFPKIYSFPPFYTQQPNTTVLNQQLDSWISIILHYC
                     EYYRITLLSIEGIPKHSQLEIPLSSLSSIFINKTINRQVNSDFQKLIIKHLIHNKKAE
                     FINPKKPELGVFIYWRSIVDWGDLLYQYVDDTGQKGTVLTIYELTKGEETTVPQDLHN
                     LDESFLVKIIKDYLIKQGKAQLLIDENNDIGGVKIV"
     gene            complement(<1044241..>1044891)
                     /locus_tag="CD36_54210"
                     /db_xref="GeneID:8048374"
     mRNA            complement(join(<1044241..1044517,1044890..>1044891))
                     /locus_tag="CD36_54210"
                     /product="60S ribosomal protein L43"
                     /transcript_id="XM_002420671.1"
                     /db_xref="GeneID:8048374"
     CDS             complement(join(1044241..1044517,1044890..1044891))
                     /locus_tag="CD36_54210"
                     /inference="similar to AA sequence:UniProt:P49631"
                     /note="Similar to S. cerevisiae RPL43B;
                     Rpl43Bp is described as being identical to Rpl43Ap;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L43"
                     /protein_id="XP_002420716.1"
                     /db_xref="GeneID:8048374"
                     /db_xref="GOA:B9WI04"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:B9WI04"
                     /translation="MTKRTKKVGITGKFGVRYGSSLRRQTKKLEVQQHAKYDCSFCGK
                     RTVQRGATGIWNCKSCKKTVAGGAYTVSTAAAATVRSTIRRLRELAEA"
     gene            complement(<1045350..>1047704)
                     /locus_tag="CD36_54220"
                     /db_xref="GeneID:8048375"
     mRNA            complement(<1045350..>1047704)
                     /locus_tag="CD36_54220"
                     /product="component of the SCF ubiquitin-ligase complex,
                     putative"
                     /transcript_id="XM_002420672.1"
                     /db_xref="GeneID:8048375"
     CDS             complement(1045350..1047704)
                     /locus_tag="CD36_54220"
                     /inference="similar to AA sequence:UniProt:P24814"
                     /inference="similar to AA sequence:UniProt:Q5AK77"
                     /note="Similar to S. cerevisiae GRR1;
                     In S. cerevisiae: involved in carbon catabolite
                     repression, glucose-dependent divalent cation transport,
                     high-affinity glucose transport, morphogenesis, and
                     sulfite detoxification"
                     /codon_start=1
                     /transl_table=12
                     /product="component of the SCF ubiquitin-ligase complex,
                     putative"
                     /protein_id="XP_002420717.1"
                     /db_xref="GeneID:8048375"
                     /db_xref="GOA:B9WI05"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR026940"
                     /db_xref="UniProtKB/TrEMBL:B9WI05"
                     /translation="MSSPTSLDDLSNIPETGNTIKTLHELKQESSPDSNNEMNIDGEI
                     SNDNSHHSDGNHKTHTYGADFVMDNEYNDYEELRKSLVNKRRLSSIKRPHGPFFDHNN
                     QIDKRSLLRLPTEILLQIFHYLERRDWYSLLTTCSEIADLIIEMLWFRPHMQNDSAFK
                     KIKEVMEINKSVTHWDYRQFIKRLNLSFMTKLVDDELLSLFIGCPRLERLTLVNCAKL
                     TRYPITQVLHGCERLQSIDLTGVTDIHDDIINALADNCPRLQGLYAPGCGNVTEEAII
                     KLLRSCPMLKRVKFNSSTNITDESILAMYENCKSLVEIDLHGCENVTDKYLKSIFLDL
                     TQLREFRISNAPGITDKLFESIPEGHILEKLRIIDITGCNAITDRLVEKLVSCAPRLR
                     NVVLSKCMQITDASLRALSQLGRSLHYIHLGHCGLITDYGVAALVRYCHRIQYIDLAC
                     CSQLTDWTLVELANLPKLRRIGLVKCSMITDSGILELVRRRGEQDCLERVHLSYCTNL
                     TIGPIYLLLKNCPKLTHLSLTGISSFLRREITQYCREPPSDFNEHQKSLFCVFSGHGV
                     NQLRNYLNQVVEERTYQIDQGDIHTLFNERRRRFLNGDFDMDEEEMNIWERRRGLGVT
                     ADLGHPDMAEINREIFRELNEGNMGPDEMREHFQRLIRNHHQQRLLEHQNRLNQQLVQ
                     QRQQQQQQEPQLEQANTQNRGQTETQAQDQLQNEVQLRLQPPLQQQQQQQRAQNTIIN
                     NPQNAPQIEQPAVFPNGGNQTLPLVLNEDEDVDMEPVDLFPRNT"
     gene            <1049231..>1050565
                     /locus_tag="CD36_54230"
                     /db_xref="GeneID:8048376"
     mRNA            <1049231..>1050565
                     /locus_tag="CD36_54230"
                     /product="Cop9 signalosome complex subunit, putative"
                     /transcript_id="XM_002420673.1"
                     /db_xref="GeneID:8048376"
     CDS             1049231..1050565
                     /locus_tag="CD36_54230"
                     /inference="similar to AA sequence:UniProt:P47130"
                     /inference="similar to AA sequence:UniProt:Q5AKN8"
                     /note="Similar to S. cerevisiae CSN12;
                     In S. cerevisiae: equired for deneddylation, or removal of
                     the ubiquitin-like protein Rub1p from Cdc53p (cullin);
                     involved in adaptation to pheromone signaling"
                     /codon_start=1
                     /transl_table=12
                     /product="Cop9 signalosome complex subunit, putative"
                     /protein_id="XP_002420718.1"
                     /db_xref="GeneID:8048376"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:B9WI06"
                     /translation="MSGLVNYVHEFGTALKEENSKALTKCLTISPTITIANTRKDFPE
                     PSDVDLFHIPEKFRPVLKCHIQLMKAVYNEKSLDKAFEVLNQLILNLIMASDFLTNWI
                     NHPLIKSLSELIAIYKTKESRNPEDLDSFIEDDTDAMDGTQSQKSCLETLVITFRKAC
                     QLSLGDKNLDWKLSKRNDVYYFLANFVKYCFKLGKLDLAKSVTKAVKNISDRLPALDS
                     SVKTKKYGVIYLYYQALMALDDGDYVESEKNLDYALKLMDDYQDLKSNQLGQILLVLI
                     PLKLYNHGQFPSKKIWLKYPVLRALYRDNFLKAILEGNIARFNQSLEKFQTILLKKHL
                     YVLIEMLRPLVHLQLIKKTYNLNMELNPDSKTKHVIPIRAFQLALEYSTFNKNYKCDF
                     NFAGDHLYTISKFETECIVGYLITKRRIKAYLSVSKEGCVIFAKTDVFPKPS"
     gene            complement(<1050703..>1051698)
                     /locus_tag="CD36_54240"
                     /db_xref="GeneID:8048377"
     mRNA            complement(<1050703..>1051698)
                     /locus_tag="CD36_54240"
                     /product="cytochrome c oxidase assembly protein, putative"
                     /transcript_id="XM_002420674.1"
                     /db_xref="GeneID:8048377"
     CDS             complement(1050703..1051698)
                     /locus_tag="CD36_54240"
                     /inference="similar to AA sequence:UniProt:Q45U24"
                     /inference="similar to AA sequence:UniProt:Q5AK74"
                     /note="Similar to S. cerevisiae COX18;
                     In S. cerevisiae: has a role in the assembly of cytochrome
                     c oxidase; required for export of the Cox2p C terminus
                     from the mitochondrial matrix to the intermembrane space
                     during its assembly into cytochrome c oxidase;
                     mitochondrial inner membrane protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cytochrome c oxidase assembly protein, putative"
                     /protein_id="XP_002420719.1"
                     /db_xref="GeneID:8048377"
                     /db_xref="GOA:B9WI07"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:B9WI07"
                     /translation="MFSNRINRLGPLVLRSSSYRHPGVRNFSIDHNAIVNTMTSTFQT
                     VHEFSGLPWWILIPLTTFTLRSVWTLPLAILQRKRIQKQSELRPLVSAMNPILKLNLA
                     RRVQSAKKKLENSPNNKEDVTSISASSTLSNMKYEQILLLSAKESRNRQKELFAKNGV
                     QLWKNFILPTFQVPLWIMMSITMRDLSGWSSWDNTHNKALDPSLYEEGILWFQDLSIA
                     DPMHIFPVILGITALCNIEWTLKTLELSRLTKKLKFRPTLTDAFGNLTKMSIVFMMAI
                     SLHAPAALTIYWISSQFYSLLQNVMMDLMLPISFTPKKRFNYAKIKNDDAVNVIN"
     gene            <1051925..>1052263
                     /locus_tag="CD36_54250"
                     /db_xref="GeneID:8048378"
     mRNA            <1051925..>1052263
                     /locus_tag="CD36_54250"
                     /product="RNA polymerase II elongation factor, putative"
                     /transcript_id="XM_002420675.1"
                     /db_xref="GeneID:8048378"
     CDS             1051925..1052263
                     /locus_tag="CD36_54250"
                     /inference="similar to AA sequence:UniProt:P32914"
                     /inference="similar to AA sequence:UniProt:Q5AK73"
                     /note="Similar to S. cerevisiae SPT4;
                     In S. cerevisiae: forms a complex with Spt5p and mediates
                     both activation and inhibition of transcription
                     elongation, and plays a role in pre-mRNA processing; in
                     addition, Spt4p is involved in kinetochore function and
                     gene silencing; transcription elongation factor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase II elongation factor, putative"
                     /protein_id="XP_002420720.1"
                     /db_xref="GeneID:8048378"
                     /db_xref="GOA:B9WI08"
                     /db_xref="InterPro:IPR016046"
                     /db_xref="InterPro:IPR022800"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:B9WI08"
                     /translation="MSSRSERACMLCGIIQPMKAFIDYGCPNCESLLHYQYNDNKQVQ
                     DCTSPSFEGLVALGEDNKGSWVARWLRIDSFTAGLYAVKVNGKLPPSIIAELEEQNVI
                     YRPRDGSAED"
     gene            complement(<1052382..>1056293)
                     /locus_tag="CD36_54260"
                     /db_xref="GeneID:8048379"
     mRNA            complement(<1052382..>1056293)
                     /locus_tag="CD36_54260"
                     /product="AAA family ATPase, putative"
                     /transcript_id="XM_002420676.1"
                     /db_xref="GeneID:8048379"
     CDS             complement(1052382..1056293)
                     /locus_tag="CD36_54260"
                     /inference="similar to AA sequence:UniProt:P40340"
                     /inference="similar to AA sequence:UniProt:Q4WCI8"
                     /inference="similar to AA sequence:UniProt:Q5AK72"
                     /note="Similar to S. cerevisiae YTA7; member of
                     CDC48/PAS1/SEC18 family of ATPases, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="AAA family ATPase, putative"
                     /protein_id="XP_002420721.1"
                     /db_xref="GeneID:8048379"
                     /db_xref="GOA:B9WI09"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WI09"
                     /translation="MGRRGRQRKVIHDEDDDLDHAYDELPSRRATKTVSYKETDEDED
                     VDEELDGIKGLPDGTVSQDNGMQATELNNEEALDDDAYGEEGQDDFPKSRGRRGRRKR
                     SHIESDDDEFKEDQVEESEDEDLVLSADDEEFIERKRTDNFIVKDDNEWGEDDEEDDG
                     EYGVKPKKRKTSRTRRTKSTSNSTGSRRATRSGRVLDDPDTTLADGTVESEGELDIQK
                     EIAELYDSSPIHGDVEQPHKLRQRTKVDYTIPPPITADFQLEREFRPATPTNVRSRRG
                     RTGAPKSEFRKILYPTAGPFGGSDVISLFGKNIPPGGIPIPGMTGAPNMTAIGQNFSD
                     SDSSEDEIAPINGEATISKKQPKAKKQNIGGPKLITGGSDDSSGKKKKSTLSDTDPLG
                     VDMNIDFSVVGGLDNYINQLKEMVALPLLYPELYQNFAITPPRGVLFHGPPGTGKTLM
                     ARALAASCSTSERKITFFMRKGADCLSKWVGEAERQLRLLFEEAKNQQPSIIFFDEID
                     GLAPVRSSKQEQIHASIVSTLLALMDGMDNRGQVIVIGATNRPDAIDPALRRPGRFDR
                     EFYFPLPDLGSRKEILKIHTRKWNPQLPDIFLDRLAQLTKGYGGADLRALCTEAALNS
                     IQRKYPQIYGTNEKLKVNPSKVKVVAKDFMKAIEKIVPSSARSTSSGSAPLSEHLKPL
                     LQSEYQEIIEKLNQLLPNTVGLDGKKKFTALDEAKYLDPTINDEDGGFAKQQLLKNLE
                     NSRICRPHLLISGNEGNGQQYLSAAVLNHLEGFQVQSLDLGTMFGEPTRTPESTIVQA
                     FIEARRHQPAILFIPNIDIWFNVLPDPARATLTSLLRGLKSNEKVLLLGISETPIEDL
                     SHEIKLVFGFQSATNNVILHNPQRSDRTEYFATLKKTLLMKPYEFVNDLENRPKRKLK
                     ELKVVQNSVDMSNDELNKKKLKEQEYKDTKLKNVLKLKLAGLMDLFKVRYKKFRKPII
                     DENLLAHLFEPSILENNPFNNYVVQYVRSEDPAHPNMIQELATGKYYYNMDLDLIEER
                     LWNGYYSEPKQFLKDLKMIVKDCIVSGDRERILKANEMMTNAQFGVDDFSTPEFLQAC
                     KEVRERDLLKQQKLLEEHKKLQEEWNKKQEELQAQQEEQQQQSADAPNGVLPVSELMN
                     GTTDNPISTNPEAVDENKEPVLENTTENIIEGEQKVISKEAKVEMQENETNVEKDTNG
                     KDISLSLDNVDESESESESESEAEEELNIDSTREVEIDLQELDSITTELLDITEDYNV
                     ERLEVCMARLMDIIWKDRNNWNKFGTLENLKQTIKSLEITL"
     gene            complement(<1057213..>1058946)
                     /gene="MSM1"
                     /locus_tag="CD36_54270"
                     /db_xref="GeneID:8048380"
     mRNA            complement(<1057213..>1058946)
                     /gene="MSM1"
                     /locus_tag="CD36_54270"
                     /product="mitochondrial methionyl-tRNA synthetase,
                     putative"
                     /transcript_id="XM_002420677.1"
                     /db_xref="GeneID:8048380"
     CDS             complement(1057213..1058946)
                     /gene="MSM1"
                     /locus_tag="CD36_54270"
                     /EC_number="6.1.1.10"
                     /inference="similar to AA sequence:UniProt:O74634"
                     /inference="similar to AA sequence:UniProt:P22438"
                     /note="In S. cerevisiae: involved in mitochondrial protein
                     synthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial methionyl-tRNA synthetase,
                     putative"
                     /protein_id="XP_002420722.1"
                     /db_xref="GeneID:8048380"
                     /db_xref="GOA:B9WI10"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="UniProtKB/TrEMBL:B9WI10"
                     /translation="MRFQIKGPFIQFRYKSTKPFYITTPIFYVNAAPHIGHLYSMLIA
                     DTRNKWEKLNPSKESFMLTGTDEHGLKIQSTAEKLGLEPKTLVDKVSQNFSKLAEQFN
                     VNYDRFIRTTDDDHIDLVRYFWNLMMERGFIYTDTHSGWYSISDETFFPETQIEEVVK
                     NGKVVKISSETKNEVVYQEETNYFFKLSLFQKQLIQFLKQNPEFIKPTHRYQFILKEL
                     EDTKLPDLSISRPSSRLKWSIEVPNDNTQKIYVWFDALLNYLTATEFPQDFEVKDSKY
                     ITPENSIWPATHVIGKDIIRFHCIYWPIFLMAAGIELPKQVIVHSHWLCDGFKMSKSL
                     GNVVDPMEISEYYGVDPVRFFLVENSNIDDDCKFSEELLQRSRDAVLGKYCNLISRIG
                     GKNFSIEEAVKSCAGGEFNNIREIIETCTINKDSVDGLLSSSSKLTTDLNDLYNQMDH
                     YFTNFEYIRAIQSWWSVINQANQIFQNAEPWTYVKLINSPDTPAELKEKYRVLTNYFV
                     YLCGETARISSILIQPVMPQLSKKILDRLDVSGRTSDFATLGADLKYGSGANSKSHKV
                     PLEKLAPRDIK"
     gene            complement(<1059104..>1059859)
                     /locus_tag="CD36_54280"
                     /db_xref="GeneID:8048047"
     mRNA            complement(<1059104..>1059859)
                     /locus_tag="CD36_54280"
                     /product="COPII transport vesicle biogenesis protein,
                     putative"
                     /transcript_id="XM_002420678.1"
                     /db_xref="GeneID:8048047"
     CDS             complement(1059104..1059859)
                     /locus_tag="CD36_54280"
                     /inference="similar to AA sequence:UniProt:P53039"
                     /inference="similar to AA sequence:UniProt:Q5AK69"
                     /note="Similar to S. cerevisiae YIP1;
                     In S. cerevisiae: integral membrane protein required for
                     the biogenesis of ER-derived COPII transport vesicles;
                     vesicle transport protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="COPII transport vesicle biogenesis protein,
                     putative"
                     /protein_id="XP_002420723.1"
                     /db_xref="GeneID:8048047"
                     /db_xref="GOA:B9WI11"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="UniProtKB/TrEMBL:B9WI11"
                     /translation="MAYYQQQMGNPQNMQFYQSNYTYQQPSNAQGTSGMMGSMDSNFG
                     SNIDVSGVMGNGELTPGLLAAFGTSGYPGEPPLLEELGINFQHIRSKTLVVLNPLTKD
                     IPSDIMADSDLAGPILFVLLFGTLLLLAGKVQFGYIYGVGLFGIIGLHYLFKFMSNET
                     TIDLIRSASVLGYCLLPLVLISVLGVVTNLDNLAGYILSAIAVMWCTYSASGFFVSVL
                     KLHNVRPLIAYPLCMFYTVFALMAIFVENVEEK"
     gene            <1060352..>1061959
                     /locus_tag="CD36_54290"
                     /db_xref="GeneID:8048381"
     mRNA            <1060352..>1061959
                     /locus_tag="CD36_54290"
                     /product="signal recognition particle (SRP) receptor
                     subunit alpha, putative"
                     /transcript_id="XM_002420679.1"
                     /db_xref="GeneID:8048381"
     CDS             1060352..1061959
                     /locus_tag="CD36_54290"
                     /inference="similar to AA sequence:UniProt:P32916"
                     /inference="similar to AA sequence:UniProt:Q5AK68"
                     /note="Similar to S. cerevisiae SRP101;
                     involved in SRP-dependent protein targetting"
                     /codon_start=1
                     /transl_table=12
                     /product="signal recognition particle (SRP) receptor
                     subunit alpha, putative"
                     /protein_id="XP_002420724.1"
                     /db_xref="GeneID:8048381"
                     /db_xref="GOA:B9WI12"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007222"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WI12"
                     /translation="MSQSLIIFKPSGKVEYQLNNKIHPFNEFISSIVNETYTTISLNF
                     TTKTLNNRRFYCYNKDNVYVALYFDSITTIDNDQIKQTLTGILKTFNKLEPESDGDKL
                     KKLVDMQFNNLMKLKQQEKVQEPNITSPVRSGSSTPKKIESKQPANSKKMRKWDNGEI
                     VEANDGKALDYSANQGTIGTEFLPELKIDKSAFTKERDLVLVNELNEILNESDDESES
                     PDQTSGSVGNGFFSKIGSYLGGTINVDEVSKKFREQLISKNITPGTATTIIDKIKTKL
                     STNKKVTMAVYKQALTDELTKILTPNVSTDLLHDIKRNAELNTRPYVISVVGVNGVGK
                     STNLAKLAFWFLQNNLNVLICACDTFRSGAVEQLKVHVNNLNRLNEASTNTKSRIDIF
                     EKGYGSGDHVVQTAKQAIQYAGENNFDIVLIDTAGRTHSNAKLMAPLKKFGDAASPNK
                     IIMVGEALVGTDSVEQATNFNKAFGNKRTLDFFIISKVDTVGDLVGTMINMVMATNVP
                     ILFVGTGQTYTDIKRLSVKQVVEMLMK"
     gene            <1062682..>1065894
                     /locus_tag="CD36_54300"
                     /db_xref="GeneID:8048382"
     mRNA            <1062682..>1065894
                     /locus_tag="CD36_54300"
                     /product="phosphatidylserine decarboxylase proenzyme
                     precursor, putative [contains: phosphatidylserine
                     decarboxylase beta chain; phosphatidylserine decarboxylase
                     alpha chain]"
                     /transcript_id="XM_002420680.1"
                     /db_xref="GeneID:8048382"
     CDS             1062682..1065894
                     /locus_tag="CD36_54300"
                     /EC_number="4.1.1.65"
                     /inference="similar to AA sequence:UniProt:P53037"
                     /inference="similar to AA sequence:UniProt:Q5AK66"
                     /note="Similar to S. cerevisiae PSD2;
                     In S. cerevisiae: converts phosphatidylserine to
                     phosphatidylethanolamine"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphatidylserine decarboxylase proenzyme
                     precursor, putative [contains: phosphatidylserine
                     decarboxylase beta chain; phosphatidylserine decarboxylase
                     alpha chain]"
                     /protein_id="XP_002420725.1"
                     /db_xref="GeneID:8048382"
                     /db_xref="GOA:B9WI13"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="UniProtKB/TrEMBL:B9WI13"
                     /translation="MRSSGYLNSNNGSSTSLESNNVNKSTDKNQLYLKVVCNCATDLV
                     PQGITGTGSESKKTYSSSKSINPVLVVQLNNTIKSTSKKLNTNQPSWNDELYMPLKHQ
                     DDSSLLIFSVWDKHTRYKNYLGELRLNVRDVFVDNGNFVDKTELKWYHLNSNTKYHSF
                     ITGSILVGFELVIKNKKKRFHSSYNDKFQQLSIDSDVESAFKSWLSNLTKPTIYSVNN
                     KINPNDQGFYDDELVNEADLESVLTDKSKKSHLNVPGVNGLLSVPGDDSNDAGSFSDT
                     SFLSDGGYASDASANLFDHREALPDSKKSRIKSKMRLRRSKQEYENFELASRQVLGVV
                     FIEIVSCEDLPPYKNFTRTSFDMDPFVVVSFGKKTFRTGWKRHTLNPVFNERLAFELL
                     PHESNFSIQFLVLDKDHFSFHDNVAHISLPLRTLTEYATAKPTEGENSDVNTSDSNSN
                     SQIGNGFTTEDTEFPENDSVQIIENETPSNKQSRKRYLSRKKVVKTHLDLKKFKAMSL
                     SLQLHDQKYIGKYAPKLKIRVRFETYPELRKKFWRVLLEESISTPDNRDSCDYIELIS
                     LLDTLGCVNSDELVELFYSNLGKSSWGGDLLFFDEIVDQMETYINQNADNGKVKIFEF
                     EKCPICNQKRVSKKQDLDIITHFAICASKDWSVVSKLLSSSYVTPTQATKKWFTKALI
                     KLTYGKYKLGGNSANILVQDRMTGIIVEEKMSVYVRLGIRLLYKGLDKARSKRVRILL
                     KNMSIKQGKKFDAPQSKSDIASFIRFHKLDLDECEIDDPSQFATFNDFFYRKLKPGAR
                     EIEDEKNSKIVTSPADCRSVVFESIDKATQLWIKGTGFTIPKLIHNDHSMRISSYTLG
                     IFRLAPQDYHRFHSPVDGVIESIKHIDGEYYTVNPMAIRSELDVFGENVRTIVTIKTK
                     DFGNIYFIAVGAMMVGSIVLTKDTGYEISKGEELGYFKFGGSTVLLLIESDKFKFDTD
                     LVKNSSSGLETLLRVGQSIGHSPDIDEYKRDHISFDKLDKNKQLRLIRVLTGGDLKDK
                     HMLSNWEATKIDMEDFQAIEDEETFDEDILDEDASIKSED"
     gene            complement(<1066970..>1069216)
                     /locus_tag="CD36_54320"
                     /db_xref="GeneID:8048383"
     mRNA            complement(<1066970..>1069216)
                     /locus_tag="CD36_54320"
                     /product="methionyl-tRNA synthetase, cytoplasmic,
                     putative"
                     /transcript_id="XM_002420681.1"
                     /db_xref="GeneID:8048383"
     CDS             complement(1066970..1069216)
                     /locus_tag="CD36_54320"
                     /EC_number="6.1.1.10"
                     /inference="similar to AA sequence:UniProt:P00958"
                     /inference="similar to AA sequence:UniProt:Q5AK65"
                     /note="Similar to S. cerevisiae MES1;
                     In S. cerevisiae: forms a complex with glutamyl-tRNA
                     synthetase (Gus1p) and Arc1p, which increases the
                     catalytic efficiency of both tRNA synthetases; also has a
                     role in nuclear export of tRNAs"
                     /codon_start=1
                     /transl_table=12
                     /product="methionyl-tRNA synthetase, cytoplasmic,
                     putative"
                     /protein_id="XP_002420726.1"
                     /db_xref="GeneID:8048383"
                     /db_xref="GOA:B9WI14"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR018285"
                     /db_xref="InterPro:IPR023458"
                     /db_xref="InterPro:IPR029038"
                     /db_xref="UniProtKB/TrEMBL:B9WI14"
                     /translation="MSLEVYGVKGNTLLALANNLKLSIALAAFQPKVELALNEVESNL
                     SLKDKKSGFELVEPNAIVKYLANDFNTTEAIQFEEEVLYAAIKSNKKDEIAKITGLPK
                     FAKEELTPSQIIVFASLYPAFKDNKENEWFIKFSQLPEVATGIKNALEITPVEREKET
                     NTGKQNVETGHLVKKQANKILPKSDERNILITSALPYVNNVPHLGNIVGSVLSADIYS
                     RYAKNRNYNTLFICGTDEYGTATETKALEENVTPQQLCDKYHAIHKEVYDWFDIGFDY
                     FGRTTTPLQTEIAQDIFMKLHNKGYLEEKTTEQLYCEHHKSFLADRFVEGTCPKCDYE
                     DARGDQCDKCGNLLDPLELINPRCKVDGNTPVVKESTHIYLKLNDLEEPLKEWVLDSS
                     AKGAWSKNSKNITDSWIKRGLEPRCITRDLIWGTPVPLKGYDKKVLYVWFDATIGYVS
                     ITANYFKDSNTDDYLKWWRNPENVDLYQFMGKDNVPFHTVVFPASQIGTGDKWTKLHH
                     LSTTEYLQYENGKFSKSRGVGVFGNNAKETGVSPSVWRYYLASNRPETQDAHFSWDEF
                     VAKNNSELLANLGNFVNRIVKFVIAKYNGVIPKFDTKNIPDYGKFETDINSLLASYID
                     NMENVNLRKGLELAMAISSRGNQFLQDNKLDNSLYANQPAKSDAVVAVAINLVYLVSA
                     IIYPFMPETTAKIDQILNAPALSITNKFELVLLPGHCIGKAQYLFTRIDDKKIDEWRK
                     LYGGQQKK"
     gene            <1069444..>1070796
                     /locus_tag="CD36_54330"
                     /db_xref="GeneID:8048384"
     mRNA            <1069444..>1070796
                     /locus_tag="CD36_54330"
                     /product="glutamyl-tRNA(gln) amidotransferase subunit,
                     mitochondrial precursor, putative"
                     /transcript_id="XM_002420682.1"
                     /db_xref="GeneID:8048384"
     CDS             1069444..1070796
                     /locus_tag="CD36_54330"
                     /EC_number="6.3.5.-"
                     /inference="similar to AA sequence:UniProt:Q03557"
                     /inference="similar to AA sequence:UniProt:Q5AK64"
                     /note="In S. cerevisiae: may be involved in aerobic
                     respiration"
                     /codon_start=1
                     /transl_table=12
                     /product="glutamyl-tRNA(gln) amidotransferase subunit,
                     mitochondrial precursor, putative"
                     /protein_id="XP_002420727.1"
                     /db_xref="GeneID:8048384"
                     /db_xref="GOA:B9WI15"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR004412"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:B9WI15"
                     /translation="MRKTVTPIRLLSDGIRVKDKWNSLISNLEIEPTNSAGPLSGTTY
                     IVKDNIVTNHGYTTAASKILSNYESPFNATILDLLSNNGSKLIGKSNLDEFGMGSANY
                     NSYFNKVINPYDDTKVPGGSSGGSAASVAGKMCSFSIGTDTGGSVRLPASYCNVFGFK
                     PTYGRISRWGVIPYAQTLDTVGIIGDNVNIIKRVYDVLNRCDNKDPTCLPEDVRKKIP
                     TTEKKILTIGVPNEFVLKELSADVREAWEYALTKICELGHSVKPITIKTIKKALPSYY
                     TLATAEAASNLSRYDGIRYGYNTNEMVHSPIELIATNRSNGFGSEVQRRILLGNYTLS
                     SDSGDHYLRATQIREELCAEFSSVFNNSHVLLQDEQSSNNVDLIMSPTSTSTAPTWDE
                     YVSANEKNFLNSYVNDVLTVPASLAGIPAISVPVNGIGIQLMGQFGDDDLVLQLADQI
                     "
     gene            complement(<1071087..>1071929)
                     /locus_tag="CD36_54340"
                     /db_xref="GeneID:8048385"
     mRNA            complement(<1071087..>1071929)
                     /locus_tag="CD36_54340"
                     /product="GTP cyclohydrolase I, putative"
                     /transcript_id="XM_002420683.1"
                     /db_xref="GeneID:8048385"
     CDS             complement(1071087..1071929)
                     /locus_tag="CD36_54340"
                     /EC_number="3.5.4.16"
                     /inference="similar to AA sequence:UniProt:P51601"
                     /inference="similar to AA sequence:UniProt:Q5AK63"
                     /note="Similar to S. cerevisiae FOL2;
                     In S. cerevisiae: catalyzes the first step in the folic
                     acid biosynthetic pathway"
                     /codon_start=1
                     /transl_table=12
                     /product="GTP cyclohydrolase I, putative"
                     /protein_id="XP_002420728.1"
                     /db_xref="GeneID:8048385"
                     /db_xref="GOA:B9WI16"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="InterPro:IPR018234"
                     /db_xref="InterPro:IPR020602"
                     /db_xref="UniProtKB/TrEMBL:B9WI16"
                     /translation="MSNPSHNPKHHLREEDANGTQEGLKSTVPIKRSKLVASSNLVSP
                     NFLPRDLIETPLQTRAASPLILNPPIDSDGLSWPSQGARLRIEQTSEEAKAREERIAS
                     AVKVILEELGEDTSREGLLETPERYARAMLYFTKGYEDNIRDVIKRAVFEEDHDEMVI
                     VRDIEIYSLCEHHLVPFFGKAHIAYIPNKRVLGLSKLARLAEMYSRRFQVQERLTKQI
                     AMALSEILKPRGVAVVIEATHMCMVSRGVQKTGSSTTTSCMLGCFRDQQKTREEFLTL
                     LGRK"
     gene            complement(<1072365..>1076186)
                     /locus_tag="CD36_54350"
                     /db_xref="GeneID:8048386"
     mRNA            complement(<1072365..>1076186)
                     /locus_tag="CD36_54350"
                     /product="cell wall biogenesis protein phosphatase,
                     putative"
                     /transcript_id="XM_002420684.1"
                     /db_xref="GeneID:8048386"
     CDS             complement(1072365..1076186)
                     /locus_tag="CD36_54350"
                     /inference="similar to AA sequence:UniProt:A3LNR8"
                     /inference="similar to AA sequence:UniProt:P24276"
                     /inference="similar to AA sequence:UniProt:Q2U2X3"
                     /inference="similar to AA sequence:UniProt:Q4WSW3"
                     /inference="similar to AA sequence:UniProt:Q5AK62"
                     /note="Similar to S. cerevisiae SSD1;
                     Apparent disagreement about what this gene actually
                     encodes; contains a Pfam hit corresponding to the
                     catalytic domain of ribonuclease II, so those entries
                     identifying the gene product as an exoribonuclease are
                     probably correct;
                     In S. cerevisiae: protein with an apparent role in
                     maintenance of cellular integrity; interacts with
                     components of the TOR pathway; exoribonuclease R,
                     putative; exosomal 3'-5' exoribonuclease complex subunit,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cell wall biogenesis protein phosphatase,
                     putative"
                     /protein_id="XP_002420729.1"
                     /db_xref="GeneID:8048386"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:B9WI17"
                     /translation="MSSSQDYNNNNNNAPARVSSRKGKNLHVAHRRSPSELTNLMVEQ
                     YNLQRQLEEVQAQQKLLEEKQKQQQQQFTYPLAQGSSELAPPPISSGYGGNRSSHSRS
                     SSINTHRRTGSGSGGTAHGHSRRHSLGLNEAIKAAANQKQSNRNSLSPTIPSEVKVDS
                     SDDIGSFKFPPSSGDQGDSSGQSSSHNRSRSLAYGQQSFKFPPTPDQSNDNRGNSLLP
                     PNPNFTVTQSPDRGHNRRSSHFRTASRGSGNNNTDGINSNWRAQQQSPQQQQRSGGLL
                     EPPQVGFTPGHKPRNSSYGGGSSVSSLQQFLPNNGGSNNSSQQGGHQGGGNNGRKTLF
                     APYLPQSSLPELINEGRLVTGTLRVNKKNRSDAYVSTDGLLDADIFICGSKDRNRALE
                     GDLVAVELLIVDEVWESKKEKEEKKRRKDNTLNSRPLTDDIHNDATSAPNTAEGSVTG
                     TSKEDGAGSNEEETGGLARRGSLKQRPTMKKNDDVEVEGQSLLLVEEEEINDEIKPLY
                     AGHVVAVVDRIPGQLFAGTLGLLRPAQAAQAARDKKNGKESTVQNPKAPKIVWFKPTD
                     KKVPLIAIPTEQAPKDFVENHEKYADRLFVASIKRWPITSLHPFGTLVSNLGPIDSPE
                     TEIDSILRDNNFLCDEYPDDDDENDIVSVNAYDLPPIEPEFEGAQREEYLNDYIIAFT
                     QNGEFVDHALHVKRISNTKIELGFHAADIAYFIKPGSSLDRKSKKRSSSVFLPQKTVN
                     LFPKQVNKMVSFKENEKNLAVSVVFEIDTSNFEVEDLYIHESVIVPKQLVTYDAFDTI
                     LSGQSVDSISSATSDYVKTFSLIAKEFRRHRLSNRSLGITPNLTLLDQLDDEKVRLDL
                     NIFKDSLAFDVISEISHKVNSAIAAKVHAGLGDQAILRRHPLPTLQKMETFVRKATSL
                     GFKIDTTTSSTLQNSILKIDDPVKRKCVETLLYKCMSRGKYYVAGKQDADSYAHYYFN
                     LPLYTHFTAPLRRYADLIVHRQLKAVLNKQVEDKDLDSLKAITDYCNFKKDCAASAQE
                     QAIHLLLSQTINEMSETAGQLLCMGTVVQVYESSFDVFIPEFGVEKRVHGDQLPLVKA
                     EFDKGERILELWWEKGVDSATYIPPDEKSSLSYRNSIKNKYRTSALQAAKIQSKTALE
                     KSTTPADSVAEKLSKLNLEPPKLTVPSLKGNELNAVEKDETRSMPSSPTQAEIPKNIR
                     TNSSSRISASGNTFSLEPYLQNTITRVEGDSYIQVIKELTQVPVLLRAEIGMALPCLT
                     VRVLNPFAEER"
     gene            complement(<1077644..>1079068)
                     /locus_tag="CD36_54360"
                     /db_xref="GeneID:8048387"
     mRNA            complement(<1077644..>1079068)
                     /locus_tag="CD36_54360"
                     /product="DNA polymerase III (delta) small subunit,
                     putative"
                     /transcript_id="XM_002420685.1"
                     /db_xref="GeneID:8048387"
     CDS             complement(1077644..1079068)
                     /locus_tag="CD36_54360"
                     /EC_number="2.7.7.7"
                     /inference="similar to AA sequence:UniProt:P46957"
                     /inference="similar to AA sequence:UniProt:Q5AK60"
                     /note="Similar to S. cerevisiae POL31"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA polymerase III (delta) small subunit,
                     putative"
                     /protein_id="XP_002420730.1"
                     /db_xref="GeneID:8048387"
                     /db_xref="GOA:B9WI18"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="InterPro:IPR024826"
                     /db_xref="UniProtKB/TrEMBL:B9WI18"
                     /translation="MSSSQYYNKEVDESVVSRQTIEEFTKRNEFFLKPGSRKYAKQYF
                     SMYQYRLKNLRDRAHKTAMEKWGHGTKKINGNMIEKQDKILDIASGKLCWVIGTVFCD
                     AKYKLDILNDVEKGTDDVLPLEPVTYVDKNEQPIVMLEDESGRAILNNDNFLTKNLLV
                     TGCIVAVLGIEVQAGIFEIMDIAYPDCAPQKPLTLGENKRGKIALVSGLSIGGEGQYD
                     LKLELLKQYLLGELGNAEDKLNTSQISSLIIAGDSIMPISNLRAEMDLKNYVTTNNYG
                     SKNISKYNANSFKKLDEFITDIIVSLPVAVMPGKNDPAEICLPQQPLHRSLFKNNSSL
                     LNGDRLNRLTNPQWIDVQTVKILGTSGQNVDDIKKYIAPQNDHQFTSIEIMENNIKWQ
                     NFIPTAPDTLYCYPYENYDPFIFCDDLPHVYFVGNQQSYDSKLLQYDGVNIRLISVPK
                     FKESGQFVLLDLDTLETEVVTIEI"
     gene            complement(<1079323..>1080993)
                     /locus_tag="CD36_54370"
                     /db_xref="GeneID:8048388"
     mRNA            complement(<1079323..>1080993)
                     /locus_tag="CD36_54370"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_002420686.1"
                     /db_xref="GeneID:8048388"
     CDS             complement(1079323..1080993)
                     /locus_tag="CD36_54370"
                     /EC_number="3.6.1.-"
                     /inference="similar to AA sequence:UniProt:Q03532"
                     /inference="similar to AA sequence:UniProt:Q5AK59"
                     /note="Similar to S. cerevisiae HAS1"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_002420731.1"
                     /db_xref="GeneID:8048388"
                     /db_xref="GOA:B9WI19"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WI19"
                     /translation="MAKTSKSKGNHKKSETSKVSRKRSHEDSESEVEDNEKVVEELDA
                     DFDEVAGLLGDDIEDPESKSQSKKEKQKAKDEAKLEKLTKPQVSKEITEDDSENVLFE
                     NADLSEPTMRAIKEMGFTKMTKVQAKTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIEL
                     LYSLKIKPRNGTAVIIITPTRELALQIFGVARELMQFHSQTCGIVIGGADRRQEATKL
                     SKGVNLLVATPGRLLDHLKNTQFVFSNLKALVIDEADRILEIGFEDEMKQIIKVLPNE
                     NRQSMLFSATQTTKVEDLARISLRPGPLYINVVPEKDVSTADGLEQGYVVCDSDKRFL
                     LLFSFLKRNVKKKIIVFLSSCNSVKFYSELLNYIDLPVLDLHGKQKQQKRTNTFFEFC
                     NAKQGILVCTDVAARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTARGTQGKGKSLMFL
                     TPSELGFLRYLKAAKVPLNEYEFPANKIANIQSQLTKLIKTNYLLNQSAKDGYRAYLQ
                     AYASHGLKTVYQIDKLDLKKVSASFGLDQVPRVNLSIGGTKTKKQKRS"
     gene            1081699..1081771
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CD36_tRNA_0084"
                     /db_xref="GeneID:8048389"
     tRNA            1081699..1081771
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CD36_tRNA_0084"
                     /product="tRNA-Ala"
                     /anticodon=(pos:1081732..1081734,aa:Ala,seq:agc)
                     /db_xref="GeneID:8048389"
     gene            <1082045..>1082923
                     /locus_tag="CD36_54380"
                     /db_xref="GeneID:8048056"
     mRNA            <1082045..>1082923
                     /locus_tag="CD36_54380"
                     /product="uncharacterized mitochondrial protein, putative"
                     /transcript_id="XM_002420687.1"
                     /db_xref="GeneID:8048056"
     CDS             1082045..1082923
                     /locus_tag="CD36_54380"
                     /inference="similar to AA sequence:UniProt:P40098"
                     /inference="similar to AA sequence:UniProt:Q5AK57"
                     /note="Similar to S. cerevisiae FMP10"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized mitochondrial protein, putative"
                     /protein_id="XP_002420732.1"
                     /db_xref="GeneID:8048056"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:B9WI20"
                     /translation="MFCRSRTISVKHLQSFRSFATRSSFDSPFDHLPKLNNRSWFNWK
                     TTTAFFLLGSYLAYNETLFNYYEKYTEIDEKDPNIKILPMQLEYKLKNLPIYQQLAHP
                     KNSHQWYKLQSWENLDRNILDNQTKVKKQDEYQEPTLTNQTLNKPGGILIKPVIFHNI
                     ETDEGVHIVHAGYRLCGYPFIIHGGIIATLLNETFKRNASLSKYTTSNLKDDFKVENL
                     IINYKRPTLANQFLIVKTKKKESPENDNRTIVLESVIEDSKGKVLVKSEALLHDTGRA
                     TNRIKQQTENSKKSWW"
     gene            <1083222..>1084622
                     /locus_tag="CD36_54390"
                     /db_xref="GeneID:8048390"
     mRNA            <1083222..>1084622
                     /locus_tag="CD36_54390"
                     /product="subunit of the COMPASS (Set1C) histone
                     methyltansferase complex, putative"
                     /transcript_id="XM_002420688.1"
                     /db_xref="GeneID:8048390"
     CDS             1083222..1084622
                     /locus_tag="CD36_54390"
                     /inference="similar to AA sequence:UniProt:Q06920"
                     /inference="similar to AA sequence:UniProt:Q5AK56"
                     /note="Similar to S. cerevisiae BRE2;
                     In S. cerevisiae: subunit of the COMPASS (Set1C) complex,
                     which methylates histone H3 on lysine 4 and is required in
                     transcriptional silencing near telomeres; involved in
                     telomere maintenance; similar to trithorax-group protein
                     ASH2L"
                     /codon_start=1
                     /transl_table=12
                     /product="subunit of the COMPASS (Set1C) histone
                     methyltansferase complex, putative"
                     /protein_id="XP_002420733.1"
                     /db_xref="GeneID:8048390"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:B9WI21"
                     /translation="MNKETSEEPSIEPQVQGNESIEETQSEHTYSTRSKERKREEELQ
                     RKSQLKQKQHNVIIHPRLKPVPFKNSDLIPVSLPEPNAATTINEIEFFQTEDLPLNKR
                     GFKYKHCRPNPNFPSNLYSTTDVPPYHVCTSLFDRSSGVLFSNDLKSITTSQGWRSAR
                     TNVCIREGSYYFEFKILNSNEKSHVRIGIGRKEASLEAPVGFDGYSYGLRDVDGQFMT
                     ISRRQKLCVENGFKTGDVIGFLIQLPSLEEHRRAIEEFVNEKSQLQPEQKLKKRKKKK
                     IENDIKDNVKFIEHGNIVRDQIPIKYKNGLYYEQYEYTTTKTMEHLLNPVTVFGEKAI
                     IEMDDKRKNIPVIPNSKIRLFKNGVEQESIIDLYSFLPTNIEDHEDINLGPNTKQQQN
                     PNYRNTDDGTLGYYPMLSAFQYGVVNLNAGPNFEFPPSEPVKPLSDRYNEQVVEQFYW
                     DILDEVEAEYLDSFDL"
     gene            complement(<1084617..>1085351)
                     /locus_tag="CD36_54400"
                     /db_xref="GeneID:8048391"
     mRNA            complement(<1084617..>1085351)
                     /locus_tag="CD36_54400"
                     /product="DNA repair protein, putative"
                     /transcript_id="XM_002420689.1"
                     /db_xref="GeneID:8048391"
     CDS             complement(1084617..1085351)
                     /locus_tag="CD36_54400"
                     /inference="similar to AA sequence:UniProt:Q07913"
                     /inference="similar to AA sequence:UniProt:Q4WFF3"
                     /inference="similar to AA sequence:UniProt:Q53EK2"
                     /inference="similar to AA sequence:UniProt:Q5AK55"
                     /note="Similar to S. cerevisiae NSE1;
                     In S. cerevisiae: plays an essential role in genomic
                     stability, being involved in DNA repair and DNA
                     metabolism; conserved in eukaryotes from yeast to human;
                     subunit of the non-structural maintenance of chromosomes
                     (SMC) complex, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA repair protein, putative"
                     /protein_id="XP_002420734.1"
                     /db_xref="GeneID:8048391"
                     /db_xref="GOA:B9WI22"
                     /db_xref="InterPro:IPR011513"
                     /db_xref="UniProtKB/TrEMBL:B9WI22"
                     /translation="MYSEAHRLLLTYIRSVRYVEAGVLLEAFKFMIEKLQLEIQASKN
                     ILDQYIAEINSKISGQNFKIERKTHEITGDLYYIFINTLSDEIVQESSVYTTAELTVI
                     KYLIRNIIEASDYRCSLARVNANQTISTNTNKNLMEADSMVDRLIDDGWFISTIDDRL
                     MLSIKTLCELKEYLIETYGVNDDTDADGKVLLCTQCKEIVTLGWIIPSGKPFHKKCYD
                     VYCRTNQIYPEDESDLLRVGPDPSTL"
     gene            <1085765..>1087330
                     /locus_tag="CD36_54410"
                     /db_xref="GeneID:8048392"
     mRNA            <1085765..>1087330
                     /locus_tag="CD36_54410"
                     /product="cell wall glycosidase precursor, putative"
                     /transcript_id="XM_002420690.1"
                     /db_xref="GeneID:8048392"
     CDS             1085765..1087330
                     /locus_tag="CD36_54410"
                     /EC_number="3.2.-.-"
                     /inference="similar to AA sequence:UniProt:P53301"
                     /inference="similar to AA sequence:UniProt:Q5AK54"
                     /note="Similar to S. cerevisiae CRH1;
                     In S. cerevisiae: cell wall protein that functions in the
                     transfer of chitin to beta(1-6)glucan, putative chitin
                     transglycosidase; chitin transglycosidase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cell wall glycosidase precursor, putative"
                     /protein_id="XP_002420735.1"
                     /db_xref="GeneID:8048392"
                     /db_xref="GOA:B9WI23"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR017168"
                     /db_xref="UniProtKB/TrEMBL:B9WI23"
                     /translation="MYKSIITFLILFLRYVLSESIDNLYEEKEEDDDNDGYDDNNSDY
                     DGQRQKCNPYRDKSCLANDEALGRKIFESFAEGTKYFTITSSTRGIRFGAEGLALTIQ
                     DEFDNPALVSSFYIMYGKVEAEIRGAAGKGIISSFYLQSDDLDEIDVVEIFGSDPYEF
                     QTNFFIKGNTTTYDRGRYHEMHPSPLSEFHKYGIEWSPDLITWYLDDKPVRMLGRRNK
                     HGLPCSPMFLKFSLWSVEEDDEGTIAWAGGAAKFSEGPFTMHIKNLKVQDYSKALSYT
                     YGNLHDGNWLDLRADGGYLYEGHKYCRPPKMLEKSKPTSKTATGEKQVFTSSKLQKIV
                     TTAINKERITSLSYIPSATNSPTTWDQLSEWETEEDEMGMGTGTGTGTDGTDENEESD
                     NDDNEESITATPRKVSTRRLNILTQSPQLSQNESKVATKITNTTTKNIHNTTISVKIS
                     KIDSKKIEATSIYYSSSTPQPTSRARMPYNIFFNYPGKENSRFKSGVSSILSTSFTGV
                     VIAEILVIVVLLL"
     gene            <1088060..>1091056
                     /locus_tag="CD36_54420"
                     /db_xref="GeneID:8048393"
     mRNA            <1088060..>1091056
                     /locus_tag="CD36_54420"
                     /product="6-phosphofructokinase subunit alpha, putative"
                     /transcript_id="XM_002420691.1"
                     /db_xref="GeneID:8048393"
     CDS             1088060..1091056
                     /locus_tag="CD36_54420"
                     /EC_number="2.7.1.11"
                     /inference="similar to AA sequence:UniProt:O94201"
                     /inference="similar to AA sequence:UniProt:P16861"
                     /note="Similar to S. cerevisiae PFK1"
                     /codon_start=1
                     /transl_table=12
                     /product="6-phosphofructokinase subunit alpha, putative"
                     /protein_id="XP_002420736.1"
                     /db_xref="GeneID:8048393"
                     /db_xref="GOA:B9WI24"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="UniProtKB/TrEMBL:B9WI24"
                     /translation="MPSPDAINRISYISLVTSDIDKFNQTFQFYSQLGFRLTKSFSKI
                     SSYGSGLGDNHPEFQLGVSHDSLKEAWLESYPLQNIDNNGNLRPWQEMEIYDGDNCQR
                     LNESTVIKIRLLNEKFFLNSSIPQQKQFVFFTTQLNQIENILNNLNIKYGKIIDNVIL
                     TEDPLNNIISFSNTENELCKTRYLSPEDFVEKTTTEILTKRKKLQLDSKYGSFEEISS
                     TEVTNGGNGGNGGNGGGGRKKKIGVMTSGGDAPGMNPAVRAVVRAGIYYGCDVYAVYE
                     GYEGLVKGGDLLKKMEWSDVRSYMSLGGTSIGTARCKEFRERTGRLQGAYNMIKNGID
                     ALVVCGGDGSLTGADLFRSEWPSLVKELVDSGRLTKEEVSPYEHLTIVGLVGSIDNDM
                     SGTDVTIGAFSALERITEMVDYIGATAASHSRAFVVEVMGRHCGWLALLSGLATGADF
                     VFIPERPPKAGLWKEQLKEVCLRHREYGRRKTTVIVAEGAIDDELNPITSEEVKQVLV
                     DLGLDTRNTILGHVQRGGTAVAYDRRLATLQGVEAVKAVLEMTPETPSPMIGILKHKI
                     VRIPLVDAVKQTKAVAEAISNKDFDKAMGLRDNSFYDDYRYFRDISIYDDGSKQLNED
                     KRLNIAIVHVGAASAGLNAATRAVALYSLSRGHKLYAIQDGFTGLVKGNLKNLTWMDV
                     EGWHNLGGSEIGTNRSLPSQNFGQVAYNLQKYNIQGLLIVGGFEAFTSLHELSQQKSN
                     YPIFEIPMVVVPATVSNNVPGTEYSLGSDTCLNQLVSYCDAVQQSASSTRRRVFVVEV
                     QGGHSGYVASYCGLITGALATYTPESNINLRELQGDIDLLQKVFATDRGEDHNGTLIV
                     RNEQASVVYSTELIANILKENANKRFETRTAIPGHVQQGFTPSANDRVMAVKFSLKAM
                     EFIETRNGCYDKQNRKFSDEEISEHSQVVIGIHGDVVKFTCIKHLYENEANVILRKGK
                     TVHWTDMIDVANILNGKSLLKKQERY"
     mobile_element  complement(1093726..1093931)
                     /mobile_element_type="retrotransposon:solo LTR, tara F,
                     partial"
     gene            <1102959..>1105658
                     /gene="HSR1"
                     /locus_tag="CD36_54430"
                     /db_xref="GeneID:8048394"
     mRNA            <1102959..>1105658
                     /gene="HSR1"
                     /locus_tag="CD36_54430"
                     /product="heat shock factor (HSF)-type DNA-binding
                     protein, putative"
                     /transcript_id="XM_002420692.1"
                     /db_xref="GeneID:8048394"
     CDS             1102959..1105658
                     /gene="HSR1"
                     /locus_tag="CD36_54430"
                     /inference="similar to AA sequence:UniProt:P53050"
                     /inference="similar to AA sequence:UniProt:Q5AKL3"
                     /inference="similar to AA sequence:UniProt:Q9HFN3"
                     /codon_start=1
                     /transl_table=12
                     /product="heat shock factor (HSF)-type DNA-binding
                     protein, putative"
                     /protein_id="XP_002420737.1"
                     /db_xref="GeneID:8048394"
                     /db_xref="GOA:B9WI25"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027722"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:B9WI25"
                     /translation="MSKKKNPGDPRIKKNAFVHKLYTMLHDPSLNHLIWWTNSNGEEN
                     TFALCPGKEFANCLTQYFKHGNVASFVRQLHMYGFHKVSDPSSNTYSTINNNNNNNSG
                     SSSSNKDVPPVWEFKHSSGRFKRGDENSLIYIKRRSSSNHNSRLGTYSETIHHPLLSN
                     PFINQPQLIYQDYSMGTPIEVQPFYNNQNQPPMYYQPPLPPLPPQQQQQQQQQVIATP
                     QYHQYNNYHMQPLQQPLQPTNALFDYQQTIIQPVPTPHQPGSFVQQIPAPPAPAPPAL
                     APSSLDQSQSQSQSQQYIPQLQYRQNPYPQPLSGTQPQQLQESHSGSLIYQPIPHYST
                     TPPPPPPPEPPAPPKDTIHNHNHNHTQLQTTPITIATKINGNLSRPSSSSSSSSNSLS
                     NSAAVAVHEQNSYLKFRKIWHNEINENNENNEKINNLKPRNPSLMFDPLIQVDCNSNS
                     NCNSNCNSERSSKTIQQNNSNSIISILTNKENNLKSSPSPSPSTSTTRATTTTNSIIT
                     LPPPSVIDRSVSIIGSSNPFDISLRINNNIQQQQQQQKQQQKQQQKQQQLFNGTPLTQ
                     NGRLPKIASPLMTCNTGSRSVSVSGSPTMIIGNGNGDVDIGNNSGSRNSTSININNFG
                     SKKFSIFSNSLQERLRPSIFEFHSINNHNNNNINNSNNNSNNLSKELNTTIVTIPKIN
                     SNSNFNSNSNFNSNSGSSRTTSQSSISSLSISGLSSKKSSLSSISSSNTNTNNLSILN
                     SINYRNNNSNNNSNSNNSISTISPKLSSLLHHQQQQHLEPEPEHENESQNQNSVVITN
                     DTNIHSLVPCSSSTTTTTSTDHRQVSNSPISRQQQQQQNSGTNNNNNNKKVSVTSLLL
                     PNQGYVPPPPPPPPPPPLYKSSIITEEENSTTSSNNSSSTGGG"
     gene            complement(<1108223..>1108918)
                     /locus_tag="CD36_54440"
                     /db_xref="GeneID:8048042"
     mRNA            complement(<1108223..>1108918)
                     /locus_tag="CD36_54440"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420693.1"
                     /db_xref="GeneID:8048042"
     CDS             complement(1108223..1108918)
                     /locus_tag="CD36_54440"
                     /inference="similar to AA sequence:UniProt:Q5AK50"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420738.1"
                     /db_xref="GeneID:8048042"
                     /db_xref="InterPro:IPR022592"
                     /db_xref="UniProtKB/TrEMBL:B9WI26"
                     /translation="MSRRTEIKQKQELQARFQLAISANHQKALNWLPPLKSAAAAATT
                     TTSASSNSNDINSSTSDDSFMDLQIIPQGSSLSKLDNLQKIGDFINSKDITKMKQSTT
                     TITTNRAPKSKPMLALMNKMRDNNRKNIRQTHHHHHHNHQQSTSNINKNKNKNKPVIP
                     NKSKPSLQNYNANEKDQDEDEDDDDEDSRAMRSRTVKKGSSLLLENKLNRHNNNNNNN
                     NGTKMKKNNIRPF"
     gene            <1109164..>1109910
                     /locus_tag="CD36_54450"
                     /db_xref="GeneID:8048395"
     mRNA            <1109164..>1109910
                     /locus_tag="CD36_54450"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420694.1"
                     /db_xref="GeneID:8048395"
     CDS             1109164..1109910
                     /locus_tag="CD36_54450"
                     /inference="similar to AA sequence:UniProt:Q5AK49"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420739.1"
                     /db_xref="GeneID:8048395"
                     /db_xref="UniProtKB/TrEMBL:B9WI27"
                     /translation="MTNIIIDHSSTFTAYILALSIYFKYHHLRNLKIIIIENEISQSL
                     HTKPWCGISTLNNFKLSNQEFINYLIQFTIPLGKVSIQPISPNPDIPIKEIMNTIIDS
                     KNYVALLYHPIDLMNKIRFVMFRSGRVSFISPNINIDQRQLHQSIPGIKVINTKRNHH
                     NINSLIYHSNIIGTRCHNGNLPSQILWIPKFSSKKFVNCTINNLQIMLDSNIDPHANI
                     DLNYALKQCDMVLDTIDKLMGNSIPLNNRL"
     gene            complement(<1110079..>1110605)
                     /locus_tag="CD36_54460"
                     /db_xref="GeneID:8048396"
     mRNA            complement(join(<1110079..1110476,1110581..>1110605))
                     /locus_tag="CD36_54460"
                     /product="Golgi transport protein, putative"
                     /transcript_id="XM_002420695.1"
                     /db_xref="GeneID:8048396"
     CDS             complement(join(1110079..1110476,1110581..1110605))
                     /locus_tag="CD36_54460"
                     /inference="similar to AA sequence:UniProt:Q03554"
                     /inference="similar to AA sequence:UniProt:Q5AK48"
                     /note="Similar to S. cerevisiae GOT1;
                     In S. cerevisiae: evolutionarily conserved non-essential
                     protein present in early Golgi cisternae that may be
                     involved in ER-Golgi transport at a step after vesicle
                     tethering to Golgi membranes;
                     Traffic through the yeast Golgi complex depends on a
                     member of the syntaxin family of SNARE proteins, Sed5,
                     present in early Golgi cisternae. Got1 is thought to
                     facilitate Sed5-dependent fusion events (Pfam: PF04178);
                     spliced gene; Got1-like family Golgi transport protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Golgi transport protein, putative"
                     /protein_id="XP_002420740.1"
                     /db_xref="GeneID:8048396"
                     /db_xref="GOA:B9WI28"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="UniProtKB/TrEMBL:B9WI28"
                     /translation="MIWLSERQKFGVSFTAGGIFFFIFGIMTFFDSSLLALGNLLFII
                     GITLIIGPQRTITFFSRPTKLRGTICFILGILLILIKRAFIGFILESFGILGLFGDFF
                     GTIIQFLRSIPYIGDVLSHPLIAPTIDRLAGISNTLPV"
     gene            <1111168..>1111968
                     /locus_tag="CD36_54470"
                     /db_xref="GeneID:8048397"
     mRNA            <1111168..>1111968
                     /locus_tag="CD36_54470"
                     /product="uncharacterized protein ygr268c homologue,
                     putative"
                     /transcript_id="XM_002420696.1"
                     /db_xref="GeneID:8048397"
     CDS             1111168..1111968
                     /locus_tag="CD36_54470"
                     /inference="similar to AA sequence:UniProt:P40325"
                     /inference="similar to AA sequence:UniProt:Q5AK47"
                     /note="Similar to S. cerevisiae HUA1;
                     In S. cerevisiae: computational analysis of large-scale
                     protein-protein interaction data suggests a possible role
                     in actin patch assembly"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein ygr268c homologue,
                     putative"
                     /protein_id="XP_002420741.1"
                     /db_xref="GeneID:8048397"
                     /db_xref="InterPro:IPR017987"
                     /db_xref="UniProtKB/TrEMBL:B9WI29"
                     /translation="MTNNNDFDLPPSYDEAVNSSSSSNSNSTRPNQSSSQPPAPPARP
                     QTNRPQPPPPSSSSSSNANLYTNNLNLPFTYKRGYYCSKCKNSGYKKNGDICHKCWDT
                     LYLNQNAYNPNQTNLPFTYPKRYYCCKCRNTGYKLKNGKTCQNCWESFGPRNSYSFVN
                     TNYQPSYFGGTTFIPSTMGPPIPNAKRVAPGSPELGGILCGNCRGQGMVHFLFDTDLC
                     PVCGGLGRVFTGPPRPPPPHPPPPPPPMPQTPYMPQYQPQYMNYGPKR"
     gene            complement(<1112215..>1113981)
                     /locus_tag="CD36_54480"
                     /db_xref="GeneID:8048398"
     mRNA            complement(<1112215..>1113981)
                     /locus_tag="CD36_54480"
                     /product="delta-1-pyrroline-5-carboxylate dehydrogenase,
                     mitochondrial precursor, putative"
                     /transcript_id="XM_002420697.1"
                     /db_xref="GeneID:8048398"
     CDS             complement(1112215..1113981)
                     /locus_tag="CD36_54480"
                     /EC_number="1.2.1.88"
                     /inference="similar to AA sequence:UniProt:P07275"
                     /inference="similar to AA sequence:UniProt:Q5AK46"
                     /note="Similar to S. cerevisiae PUT2;
                     In S. cerevisiae: nuclear-encoded mitochondrial protein
                     involved in utilization of proline as sole nitrogen
                     source; deficiency of the human homolog causes HPII, an
                     autosomal recessive inborn error of metabolism"
                     /codon_start=1
                     /transl_table=12
                     /product="delta-1-pyrroline-5-carboxylate dehydrogenase,
                     mitochondrial precursor, putative"
                     /protein_id="XP_002420742.1"
                     /db_xref="GeneID:8048398"
                     /db_xref="GOA:B9WI30"
                     /db_xref="InterPro:IPR005931"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:B9WI30"
                     /translation="MLRSTTRNTLRLATKYVKISPNVVRHTLPKVSGVRFASQLAHVK
                     TPPNLQNEPVKNFGFKDTKDWDLLRASLTKFTDEGVLKVPLVVGGKKIYRDETKTQVN
                     PAKHSQVLADVSQATPEDIIAAIDAAKAAKAKWAETSWTDRAAIFLKAADLISTKYRY
                     DMLAATMLGQGKNVYQAEIDCVAELIDFFKFNVKYAEEMYQQQPIQTSPGVWNRAEYR
                     PLEGFVYAVTPFNFTAIAANLVGAPALMGNTVVWKPSATAALSNYLLLTILEEAGLPA
                     GVINFIPGDPVEVTDIVLNDKEFSALHFTGSTDVFKKLYSKISENVSSDKYRDFPRIV
                     GETGGKNFHLIHPSASINHSVLSTLRGAFEYQGQKCSATSRLYVAESLWPEFKDQLIG
                     AMSQITIGNSSESENLNTFMGPVIHEQSFQKLSNAIEQAKSDPELEIIAGGSYDNTNG
                     FYVQPTLIKTTNPNHEFLTKEFFGPILTTYVYPDDEFENIIKSIDSITKYGLTGSIFA
                     RNRDAIRIAEENLRYAAGNFYINDKSTGAVVGQQWFGGARASGTNDKAGSGNILSRFV
                     SIRNIKENFYELTDFKYPSNYQ"
     gene            complement(<1114393..>1115424)
                     /locus_tag="CD36_54490"
                     /db_xref="GeneID:8048399"
     mRNA            complement(<1114393..>1115424)
                     /locus_tag="CD36_54490"
                     /product="subunit of the dynactin complex, putative"
                     /transcript_id="XM_002420698.1"
                     /db_xref="GeneID:8048399"
     CDS             complement(1114393..1115424)
                     /locus_tag="CD36_54490"
                     /inference="similar to AA sequence:UniProt:P36224"
                     /inference="similar to AA sequence:UniProt:Q5AK45"
                     /note="Similar to S. cerevisiae JNM1;
                     In S. cerevisiae: required for proper nuclear migration
                     and spindle partitioning during mitotic anaphase B"
                     /codon_start=1
                     /transl_table=12
                     /product="subunit of the dynactin complex, putative"
                     /protein_id="XP_002420743.1"
                     /db_xref="GeneID:8048399"
                     /db_xref="GOA:B9WI31"
                     /db_xref="InterPro:IPR028133"
                     /db_xref="UniProtKB/TrEMBL:B9WI31"
                     /translation="MNKYSDLPDIDNEGQEVFESSDVESEIELPIETTNDPDVEVSSI
                     NVDQSKELFARNEIVDTTGFDFSGNLSRLNGYSVTQVEETTEEKLSRISRELEEIKLQ
                     DHHTVSQQPDQLLTILSELKSENTIIKPLRSEQLKIDSLFKHIESDTPVASKSFDRLI
                     DLENRLSKLESVVGTEDTTTSVQLTINDLSRKISIVENPEYDFDKIRNEVGKLTKELE
                     ELDLKRKVLDLDDDSTKTITKQDKIDELYEKLPNINKYNQVAPMLLTRLKTLNSIHQE
                     MKNNIDLSNGIDQILNDVQLDLKNWDQTITKLNERINDYEDNFEKNSKTVQERISDLI
                     LKVDSLSTD"
     gene            complement(<1115594..>1116700)
                     /locus_tag="CD36_54500"
                     /db_xref="GeneID:8048400"
     mRNA            complement(<1115594..>1116700)
                     /locus_tag="CD36_54500"
                     /product="uncharacterized GTP-binding protein, putative"
                     /transcript_id="XM_002420699.1"
                     /db_xref="GeneID:8048400"
     CDS             complement(1115594..1116700)
                     /locus_tag="CD36_54500"
                     /inference="similar to AA sequence:UniProt:P53295"
                     /inference="similar to AA sequence:UniProt:Q5AK43"
                     /note="Similar to S. cerevisiae RBG2"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized GTP-binding protein, putative"
                     /protein_id="XP_002420744.1"
                     /db_xref="GeneID:8048400"
                     /db_xref="GOA:B9WI32"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WI32"
                     /translation="MGILEKIAQIQEELSRTQKNKATEYHIGLLKGKLARYRRELLEP
                     QPGQGSSGGGQGFEVAKAGDARVSLIGFPSVGKSSFLSKVTNTKSEAANYEFTTLTSV
                     GGILEYNGAEVQIVDLPGIIKAASQGKGRGRQVIAVSRTSDLILMVLDATKGGDQREI
                     LENELESMGIRLNKERPNISIKVKKTGGVKMNSITPPKYLDEKIVTALLKDYKIHNAD
                     VLIRDENVTIDDFIDVINDQHISYIKCLYVYNKIDAVSLEECDRLAREPNTVVMSCEL
                     DLGIEDLKEEIWRQLDLLRLYTKRRGVQPKFDDPMVVRNNSTILEVCDSIHRDMKNQF
                     KYALVWGSSAKHSPQKCGLTHPVHDEDVVQIVTK"
     gene            <1116927..>1117631
                     /locus_tag="CD36_54510"
                     /db_xref="GeneID:8048401"
     mRNA            <1116927..>1117631
                     /locus_tag="CD36_54510"
                     /product="uncharacterized protein ygr272c homologue,
                     putative"
                     /transcript_id="XM_002420700.1"
                     /db_xref="GeneID:8048401"
     CDS             1116927..1117631
                     /locus_tag="CD36_54510"
                     /inference="similar to AA sequence:UniProt:P53328"
                     /inference="similar to AA sequence:UniProt:Q5AK42"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein ygr272c homologue,
                     putative"
                     /protein_id="XP_002420745.1"
                     /db_xref="GeneID:8048401"
                     /db_xref="InterPro:IPR019310"
                     /db_xref="UniProtKB/TrEMBL:B9WI33"
                     /translation="MPKAAKKPRHKSRGAPIQVAESIGSGSAKIKKKIRDIERLIKKN
                     PNLPADKKIEYDRALKALKVELQNSQVQNKAKVLAKKYHMVRFFERKKAVRKLKNLRK
                     EFEEISKAGVRKDIKKARKQLRHGEIDLAYVILFPKTEKYISLYPSPNDEDQTDPNVI
                     KGLKITEERRREFRKQVEKLMEEGKLPFSIDDALEGKNVRLDNERNQKAVLTEEIDAP
                     EQKQDEQQEEQDDFFE"
     gene            complement(<1117831..>1123611)
                     /locus_tag="CD36_54520"
                     /db_xref="GeneID:8048402"
     mRNA            complement(<1117831..>1123611)
                     /locus_tag="CD36_54520"
                     /product="RNA helicase, putative"
                     /transcript_id="XM_002420701.1"
                     /db_xref="GeneID:8048402"
     CDS             complement(1117831..1123611)
                     /locus_tag="CD36_54520"
                     /EC_number="3.6.1.-"
                     /inference="similar to AA sequence:UniProt:P53327"
                     /inference="similar to AA sequence:UniProt:Q5AK41"
                     /note="Similar to S. cerevisiae SLH1;
                     In S. cerevisiae: involved in translation inhibition of
                     non-poly(A) mRNAs; required for repressing propagation of
                     dsRNA viruses; antiviral helicase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA helicase, putative"
                     /protein_id="XP_002420746.1"
                     /db_xref="GeneID:8048402"
                     /db_xref="GOA:B9WI34"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WI34"
                     /translation="MASYTVSSTKSYMQAMQPMIDALNRINTGNKQQKIPNIDNENAK
                     ISPIDKILDKFANVTIDSLNHIGNKNINNDVVIHEIEDACNNISKQRGLEESEIYTLV
                     KSLLLQSPTDEELQSSLFDILGFDEFDLISKIIQNKQSFSTRESSALMSPEERAQQVI
                     DNHQRTKNQSLLPKSTHQKYPNVFKNPDVGNIISITGKKFSLPQGTTRDSYATHEELV
                     IPYPENKPNKWISEKNLVKISDLDFLCQGTFKSYKNLNKMQSLVYPVAYNTNENMLVC
                     APTGAGKTDVALLTILHTINQFVTETVTDDGNVSVDIDYDEFKIVYVAPLKALAAEIV
                     EKYSKKLKWLGINVRELTGDMQLTRQEIINTQIIVTTPEKWDVVTRKSTGDSELVAKV
                     KLLIIDEVHLLHEDRGSVIETLVARTLRQVESTQSMIRVVGLSATLPNFMDVADFLGV
                     NRNVGMFYFDQSFRPVPLQQQILGVRGKAGSKLARENIDKVSYEKLADYINQGLQVMV
                     FVHSRKDTVNTARTFIRMAVEYGESDIFNCSEADSYEKFKREASNKNRSKELKELFVH
                     GFGVHHAGMLRSDRNLTEKMFESGAIKVLCCTATLAWGVNLPAAVVIVKGTQVYDSKA
                     GGFVDLGISDVIQIFGRAGRPQYEKYGTGILCTTSDKLDHYVSLLTQQHPIESKFGDK
                     LIDNLNAEISLGTVTNVEEAVQWLGYTYMMVRMKQNPFAYGIDWKELQEDPTLTNRRR
                     EMVFTCAKRLHHLQMIIFDENSEAFTPKDLGRIASDFYLLSNSVEIFNQMMNPLATEA
                     DILSMISMSSEFDSIKFREEESKELKQLVEEDAPCQVAGDIDSPQGKTNILLQAFVSQ
                     AHIKDSALISDSNYVAQNSARICRSLFLIAMNRRWGKLMKIMLSLCKSIDKRIWAFEH
                     PMTQFELPQPVLRNIKAKNPSMLTLRDMEAGELGDLVHNFKMGSILYKLIGKFPFIDI
                     ESEIFPITTNVMRVHVDLQPDFVWDEKYHGNAQFFWLTVEESDRSEILHVEKFILHKK
                     QLHSPHEMDFMIPLSDPLPTQVVVRVVSDSWIGSETVHAVSFQHLIRPSNETIKTDLL
                     RLQPLPVTALHNPDVEKIYSSKFKYFNPMQTMVFHSLYNTNSSVFVGSPTGSGKTVVA
                     ELAIWHAFNEFPSSKVVYIAPMKALVRERVDDWRERICKNTSHRLVELTGDSLPTIQE
                     VKEADIIITTPEKFDGISRNWQTRKFVQQVSLVIMDEIHLLASDRGPILEMIVSRMNY
                     ISSQTKKPIRLLGMSTAVSNAFDMAGWLGVKNGLFNFPQSVRPVPLQMYIDGFPENLA
                     FCPLMKTMNKPAFMAIKQHSPNKPVLIFVASRRQTRLTALDLIHLCGMENNPRRFLKI
                     SDDELQDILENVKDDTLRLSLQFGMGLHHAGLVESDRQISHKLFEQGKIQILIATSTL
                     AWGVNLPAHLVIIKGTQFFDAKIEAYRDMDLTDILQMMGRAGRPAYDTSGIAIVYTKE
                     SKKVFYKHFLNLGFPVESSLHKVLDNHIGAEISAGTITTRQEAMDFLTWTFLYRRAHN
                     NPTYYGIEDISQYGISQYLAKLIDSTIENLVESKCVYTGGSDELHATPFLEISSYYYL
                     SHLTIRNFVNTVTPDFEFRDCLRVLCQAAEYNELATRHGEELINMEMSQSMRYPAEDL
                     NCEFIWDPHVKAYLLIQAFMSRVELPIADYAQDTISVLDQALRILQAYIDAAAELGYF
                     KVVMSFIQLMQCIKQRYWYDDDPVSALPGLKLVNEGKTKHTLKYLGSMKTGQLFGLAK
                     KLGVSGENIENQGNDYHEVNDEEAKKKFVKIASHLPTGNLEIKQQEQNLIKVVLIHDN
                     YPLNNDFKVYCPHFPKPQRESWFIILHDEKELHLLKRASPRLSNKKGIIVCDLDIPDD
                     LFGKELYLECVNDGLDIAYSEKISLL"
     gene            complement(<1124075..>1125838)
                     /locus_tag="CD36_54530"
                     /db_xref="GeneID:8048403"
     mRNA            complement(<1124075..>1125838)
                     /locus_tag="CD36_54530"
                     /product="alpha-glucoside transporter, putative"
                     /transcript_id="XM_002420702.1"
                     /db_xref="GeneID:8048403"
     CDS             complement(1124075..1125838)
                     /locus_tag="CD36_54530"
                     /inference="similar to AA sequence:UniProt:Q3SCJ4"
                     /inference="similar to AA sequence:UniProt:Q5AK39"
                     /note="Similar to S. cerevisiae MAL31; high-affinity
                     maltose transporter, putative; maltose permease, putative;
                     maltotriose transporter, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="alpha-glucoside transporter, putative"
                     /protein_id="XP_002420747.1"
                     /db_xref="GeneID:8048403"
                     /db_xref="GOA:B9WI35"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WI35"
                     /translation="MTIEEYRPDQKNVSTPSIVSVDDKTTNASHISNAGQDNVDDYIS
                     KFLDMSNTAKAEDERDKTMPLKECIRTFPKACFWSVVLSTALIMEGYDTNLLASFYAY
                     QGFAKKFGRYYEDLGEYQVPAKDQLGLSMCYQTGQLVGVYIGAHLVDIIGYRYTLIPA
                     LASSIGLIFIQFFAPNVSVLMVSYVLLGINWGSYQTVCVSYAMDIAPTTLRLYLTTYI
                     NCCWVFGQLISSGVVKAVSEMTDPHAYRIAFAIQWIWPIPIMTGIFFAPESPWFLARK
                     GRLEEAKHSLERLLSQNKHIPDKSIVSQSMLTKIQMTIKEEDAVSAGSSIIECFKGTN
                     FRRTRIAAFTWLIQNITGSSLMGYSTYFYQNAGVPVSMSFNFSIIQYCLGILGTIGSW
                     FLSQKCGRFTIYFYGLCTMTLLLLLTGGMGTSDKKSLSMAVGSMLLVYTFVYDLTIGP
                     MCYCIVGEMPSSKLRAKTVMLARNLFNIAGIIIAIVTPYMLNPTQWNWKAKSAFLWAG
                     FAILSAIWVYFELPETKGRTLAELDKMFEDKVPARKFKYTTPNTFDAGEMMEKMGNTG
                     LKSIVLDTEHVEEASHIESKV"
     gene            <1128415..>1130154
                     /locus_tag="CD36_54540"
                     /db_xref="GeneID:8048404"
     mRNA            <1128415..>1130154
                     /locus_tag="CD36_54540"
                     /product="alpha amylase, putative"
                     /transcript_id="XM_002420703.1"
                     /db_xref="GeneID:8048404"
     CDS             1128415..1130154
                     /locus_tag="CD36_54540"
                     /EC_number="3.2.1.20"
                     /inference="similar to AA sequence:UniProt:Q02751"
                     /inference="similar to AA sequence:UniProt:Q5AK38"
                     /inference="similar to AA sequence:UniProt:Q76CZ0"
                     /note="Similar to S. cerevisiae MAL2; alpha-glucosidase
                     (maltase), putative"
                     /codon_start=1
                     /transl_table=12
                     /product="alpha amylase, putative"
                     /protein_id="XP_002420748.1"
                     /db_xref="GeneID:8048404"
                     /db_xref="GOA:B9WI36"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006589"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR015902"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:B9WI36"
                     /translation="MTIEYTWWKDATIYQIWPASYKDSNGDGIGDIPGIISTLDYLKE
                     LGIDIIWLSPMYKSPMEDMGYDISDYESINPDFGTMEDMQNLIDGCHQRGMKIICDLV
                     VNHTSSEHEWFKQSRSSKTNPKRDWYIWKKPKIDSKTGEKLPPNNWMSYFSGSAWEYD
                     ELTDEYYLRLFAKGQPDLNWENEECRQAIYNSAMKSWFQKGVDGFRIDVAGLYSKDQS
                     FKDAPIVFPDQTYQPSGDLTSNGPRIHEFHQEMYREVTSKYDVMTVGEIGHCDRDEAL
                     KYVSAKRKELNMIFLFDLVEVGSNDQDRFRYNGWNLIDFKKAIKNQSDFIKGTDAWST
                     VFIENHDQPRCISRFGNTKSLDSSVKTGKLLAMLQTTLTGTLFIYQGQEIGMTNLPRS
                     WSIDEYKDINTINYYKDFKKRYGNEPDFKQREEKLLDVINLVARDHARSPVQWNDNEP
                     YAGFSTHQPWTRVNDNYKQINVANELKDPNSVLKFYQTLLKLRKNYKDLFIYGSFDIL
                     DFNNEKVFTYIKQHQDGSLPKAYVTLNFANESIPFKPLIEGEFKLISTNVQQSEYDTS
                     VLSPYEGRIYIVE"
     gene            complement(<1130300..>1132471)
                     /locus_tag="CD36_54550"
                     /db_xref="GeneID:8048405"
     mRNA            complement(<1130300..>1132471)
                     /locus_tag="CD36_54550"
                     /product="uncharacterized protein ygr266w homologue,
                     putative"
                     /transcript_id="XM_002420704.1"
                     /db_xref="GeneID:8048405"
     CDS             complement(1130300..1132471)
                     /locus_tag="CD36_54550"
                     /inference="similar to AA sequence:UniProt:P53326"
                     /inference="similar to AA sequence:UniProt:Q5AK37"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein ygr266w homologue,
                     putative"
                     /protein_id="XP_002420749.1"
                     /db_xref="GeneID:8048405"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:B9WI37"
                     /translation="MPSSTNPTQTNDNWFNPIPIEDYYKINEQARANVPTSPPNDETL
                     GNYTISCGPILRLVGTWENNESNEDPNYRASILLVIKDTEATPNETGPAITYKIGPSS
                     SSTTAASAKFSTGEFPGVKFYQEHDYSFYRYSIELTLTENEQKVEYFIDNHFKPNFQF
                     YLPSKTQSMNVISYSCNGFSLGTDANEYKSSLWLDVLTKHSKQHYHVMLGGGDQIYCD
                     AIKLHSERLKQWTEISNPIKKKSFPVDDEIINEFKQFYLNHYLGWFGKGYWKGTNSSV
                     LESLFPLSSAQIPCVNIFDDHDIIDGFGSYHDSTMNAPIFTAVGNVAYKYYMLFQHHI
                     NPEEKLHLSDPSWVLGSTTGPFIKQKNHSVFMRLGKEISLLGLDCRTERKLKQIVDPS
                     TYNIIFDRLKKEIGSTSDTKHLLVMLGVPILYPRLVWLEKVLTSTALIPIRKLAQKGV
                     IAKGLVNEFDGDVEVLDDLNDHWCSKHHKAERNRLIKRLQEFGAANGVRITILSGDVH
                     LGCIGRLKSKFHSHPNAHQFLHDGDHQSTEKLNKDVIETPEYDPRLLFNITSSAIVNA
                     PPPDAMATLLNKRSGIHHFNRDTDEDILPLFIKNLDGSNRDNKQFLNERNWSDLILAK
                     QSIIYKDNVSSNDQEEEEEPIRKFPQPVLDGSNTDLLKDQTVDSRHVKYPLYSDSLVT
                     TLRFEKDKSDLSSPSVGYEVLIPKLFGKYKLDPAPVKHVDQ"
     gene            <1137038..>1139455
                     /locus_tag="CD36_54560"
                     /db_xref="GeneID:8048406"
     mRNA            <1137038..>1139455
                     /locus_tag="CD36_54560"
                     /product="uncharacterized protein ygr237c homologue,
                     putative"
                     /transcript_id="XM_002420705.1"
                     /db_xref="GeneID:8048406"
     CDS             1137038..1139455
                     /locus_tag="CD36_54560"
                     /inference="similar to AA sequence:UniProt:P50089"
                     /inference="similar to AA sequence:UniProt:Q5AKJ8"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein ygr237c homologue,
                     putative"
                     /protein_id="XP_002420750.1"
                     /db_xref="GeneID:8048406"
                     /db_xref="UniProtKB/TrEMBL:B9WI38"
                     /translation="MTTFLTTTSITNNNLTNTLTTTTSNTNNSSTPRTTTATNSTNND
                     KENLNSTTPTKDFLAKYPNFSKCVSFNNLHPPEYESDFPYTTPIYNLNNPSQQHHHLF
                     DSNYTFGSSSGSGSTPKIFIPFQDFNFGNGSNNNTSSSGTSRRHSSSAGTTSTGFTKR
                     KRLKLPPPPAKSILKNKVSQQQVEYNNMFENISEATIEYHKQEREQQEQQEQQDEQDE
                     DSQSGSGSGNSSVNSSPLLTATNISTPINDLKETQQLPTPRRKSLVGLTDEELMALDP
                     QFQTTKSKNNDLDKFKFDNQKTYYLSPSTRKGSTSDGATGANGNVATGVKRQDYPTSN
                     ENNYKSISLTVRYGETTHNDYTRTLLTIISGRRHTWHSLDWLFHIKQDLQNQPTLLAD
                     GDYLVIAGLIPIKFIKDYNNSNKKKKLSVEDYLYQKCCNLLNYLMEYISQLNLKLKIT
                     VEFVIDYENENESLVVGGGGGDSSKPLKGEKYMIDHLFKQYQPNLIIIGNKSSNLNFK
                     YPVKMNKLNNLYLIKLSSYIVKYSTIPVILVGLLIGFNDDTTNTSSSSSSAVKFNKPT
                     ITFSISKTPSSELTPKHSQTTSCNKSSSTPDLSDDHDADDNSSIESIESLTPKEYTDD
                     KKRQEMFNEKMTEINNTPFNSPDKYFDWIQTISDNSLQASKNYLIGIKSKDDSIIIDD
                     KIHAIYKSQTWNVNSGSMSHDDLSDGNGGNGSMYKVKSLISIEDDEEVKRKQEELRMK
                     KRNKRNSSVKSSGSVGGFIHSIKSNDNNSIISSGDKNTDKNKNNSTDKSTKRKSSIWK
                     KLGFSKG"
     gene            complement(<1139914..>1142298)
                     /locus_tag="CD36_54570"
                     /db_xref="GeneID:8048407"
     mRNA            complement(<1139914..>1142298)
                     /locus_tag="CD36_54570"
                     /product="pyrimidine pathway regulatory protein, putative"
                     /transcript_id="XM_002420706.1"
                     /db_xref="GeneID:8048407"
     CDS             complement(1139914..1142298)
                     /locus_tag="CD36_54570"
                     /inference="similar to AA sequence:UniProt:P07272"
                     /inference="similar to AA sequence:UniProt:Q5AK35"
                     /note="Similar to S. cerevisiae PPR1;
                     In S. cerevisiae: positively regulates transcription of
                     genes involved in uracil biosynthesis; zinc
                     finger-containing transcription factor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="pyrimidine pathway regulatory protein, putative"
                     /protein_id="XP_002420751.1"
                     /db_xref="GeneID:8048407"
                     /db_xref="GOA:B9WI39"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:B9WI39"
                     /translation="MSESSPPPQKKHKPTSSKLTRAISACKRCRTKKIKCDQKFPQCG
                     KCEANGVECIGVDSITGREIPRSYIVHLEERVKFLEEKLKLQGEIGGIDDDINTPGGS
                     SKNGDELVSDKPSIKKENPLINSKHDSIAFSKLMSTAVRVQNRLSDPNIKTGYLGQNS
                     AHTTTTDTGIDDTNCSIAPAVLPPKSTAMQFLRVFFHQCNSQLPLFHREEFLRDYFIP
                     VYGEFDESISLASNTTSINKSFFKNMDKTSYWFDIYKSKIQQLLSESSTKDIQSIANN
                     IIPPIKYRKPLYFLNLLFAVATSANHLRYPIHISESFRLAAMRFSQDVDNSIDPLEHL
                     QGILLYAGYSIMRPTNPGVWYIMGEALRICVDLDLQNELKTKSKQNFNIDNFTRDKRR
                     RIFWCCYSMDRQICFYLDRPFGIPDESINTPYPSVLDDSKIIPNDNTTDYYNCGDDDE
                     NFSYKNVSISFFKIRKIQSQVTKILYTNAEIPREYKDLNHWKQSIILQLTHWKQELYS
                     DSTMKRMNCDFNNIFFQLNYHHTLLYIHGLSPKNYKLSLIDYENLTNSSIQVINCYTE
                     LLKTKSINYTWAGVHNLFMAGTSYLYALYNSKEIRLINSIEQVQNITNNCLLVLQSLI
                     GRCDAANYCCEIFHNLTMIILNLKYSPDNKGLITSTTTTINNPSSASKVSRESLYRIN
                     NGNVHSNLFHLVTELDHLNPLTKVVNSNDQDNISNATDVMSSPLMDPSLLPLNQQTIL
                     QWNDEDLQNFLNELNQSNQSSPSNSSIRDEKKTFELIHDMPNEIIWDEFFANKQ"
     gene            <1143548..>1145188
                     /locus_tag="CD36_54580"
                     /db_xref="GeneID:8048408"
     mRNA            <1143548..>1145188
                     /locus_tag="CD36_54580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420707.1"
                     /db_xref="GeneID:8048408"
     CDS             1143548..1145188
                     /locus_tag="CD36_54580"
                     /inference="similar to AA sequence:UniProt:Q5AK33"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420752.1"
                     /db_xref="GeneID:8048408"
                     /db_xref="UniProtKB/TrEMBL:B9WI40"
                     /translation="MYKLKLLYAFGLLVNSSLSLTIHSTSSSIVPPSVAHPLDDNTYF
                     YPHPTPVSNCELTFSTDEYTTTVAFSYGCPTGSVTPPPNFPPTVPYGCTYFASRTYCP
                     YNCDTSLVHYYDYLVQVTSCPEQSCIFDKSGGRPSFKCEPTTSTDSWSSYIPSEVSNE
                     VSATPDLDSISHDNSTWHDSGSTDRTTYYPKPEHPMTTKMPVTCELKQTSSQGNSWND
                     VSCNYFPTECTKATTFNVHNQTVTYIWCPSTTIELFSSGETTTTFCPFNTCYDYSDHT
                     DNSGNTRVDNSGFEVHTTRATLAATVTANAGTVAITKTAATIDTICTETKTMDDRVVG
                     GHGHAQGSFDYTQNIINTDNIPIYKTKEDTDTDCYIITTCPTPVTLTVTHEITRTETV
                     TEYKTLTANDHGDICIVSTTNEVNPTRTSYRNQAIITSQAVNGDFYHGYPSKPNYPDT
                     WKQHGTEKATTTETPETSVEKPLDESETSGEKPADKPVDESVDKPADEPIVKPNHKPT
                     DNPIRTTEPITSTIGNYSIDYRSTTWRNSSTLVTTVVN"
     gene            <1145449..>1145922
                     /locus_tag="CD36_54590"
                     /db_xref="GeneID:8048409"
     mRNA            <1145449..>1145922
                     /locus_tag="CD36_54590"
                     /product="DNA-directed RNA polymerase III subunit,
                     putative"
                     /transcript_id="XM_002420708.1"
                     /db_xref="GeneID:8048409"
     CDS             1145449..1145922
                     /locus_tag="CD36_54590"
                     /inference="similar to AA sequence:UniProt:P47076"
                     /inference="similar to AA sequence:UniProt:Q5AK30"
                     /note="Similar to S. cerevisiae RPC17"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-directed RNA polymerase III subunit,
                     putative"
                     /protein_id="XP_002420753.1"
                     /db_xref="GeneID:8048409"
                     /db_xref="GOA:B9WI41"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="UniProtKB/TrEMBL:B9WI41"
                     /translation="MKVLTERDSFLSNYEVLQHLQNIKKKYNWSFNPDDEKFLKNKKN
                     KHHFTGCGINLEIITRDVLSCLENNDSSLIQSQESFKQLMEFLNQFELMKVEKLQIVN
                     SLPRSLVVLYALVEECEDRFGEETSEKIIEKINELFPIEQEEEGEDAQEDEEINE"
     gene            complement(<1146062..>1148314)
                     /locus_tag="CD36_54600"
                     /db_xref="GeneID:8048410"
     mRNA            complement(<1146062..>1148314)
                     /locus_tag="CD36_54600"
                     /product="lipase, putative"
                     /transcript_id="XM_002420709.1"
                     /db_xref="GeneID:8048410"
     CDS             complement(1146062..1148314)
                     /locus_tag="CD36_54600"
                     /EC_number="3.1.-.-"
                     /inference="similar to AA sequence:UniProt:P53118"
                     /inference="similar to AA sequence:UniProt:Q12103"
                     /inference="similar to AA sequence:UniProt:Q5AK29"
                     /note="Similar to S. cerevisiae ROG1"
                     /codon_start=1
                     /transl_table=12
                     /product="lipase, putative"
                     /protein_id="XP_002420754.1"
                     /db_xref="GeneID:8048410"
                     /db_xref="GOA:B9WI42"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR016445"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WI42"
                     /translation="MSESSSETEISKIPLAMTKEQLDNIEHKILFRQVKSVKAGDIER
                     FRIHFTPHAEGDEVIIPPTLWVKIRNTEPVSKRAIYLAGPYILYVDCRSSDYDPNVKY
                     FVTADQPVFEPQLLAGQSFYIQLSCHTLKKDYSWIVDVVPQIIFNTTISIDFEIMIGT
                     SKQILHEASFPEKSVPMSDKIGCFNELLHVYNWDTLDLWNLPVLNPDKPKHLVILTHG
                     LHSNASSDMLYLKEQIDRIAELRNDNEEIVVKGYFGNIGKTERGIKYLGSRVAEFIID
                     LVTENESFNNGKVKKISFVGHSLGGCVQTFAIAYLQVNFPWFFEAIKPINFITLASPL
                     LGVVNENPSVVKWVLSAGFVGNTGQELGLKYLENGAKPLLLLLPAGPTHEVLKKFVRR
                     TVYANAINDGIVPLRTSSLLFLDYKGLAEIINSEELAQSDETGKIPESVESANKFSAV
                     QTFLSYLMPQKQASEEYRRFQTQDDKVVETNKSDGKSIPNSTFLDSAASLILPPLPSM
                     KYIVDPSTRENIVIHDKVYYEKDLPERDLDVELDSFEWLEEEIAREYHKNMGWRKVVV
                     KMKPDAHNNIIVRRRFANAYGWPVIQHLVENHFGPNRTVDLKSIDSSIMDSVSTDSLD
                     EENGLTRIISRDLISRQNKEIDENVTEEQRLEDYPHEWINSEHNGDSMFAVGVTGLLG
                     EVADMVGGFRDQITKYSLNPPTLPIIGEIPLPAALMAPTNTNNGNTKSEEELNKDLKL
                     SNNGVMNDFI"
     gene            <1148677..>1148991
                     /locus_tag="CD36_54610"
                     /db_xref="GeneID:8048411"
     mRNA            <1148677..>1148991
                     /locus_tag="CD36_54610"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002420710.1"
                     /db_xref="GeneID:8048411"
     CDS             1148677..1148991
                     /locus_tag="CD36_54610"
                     /inference="similar to AA sequence:UniProt:Q5AK28"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002420755.1"
                     /db_xref="GeneID:8048411"
                     /db_xref="InterPro:IPR020515"
                     /db_xref="UniProtKB/TrEMBL:B9WI43"
                     /translation="MSGNLHSDLHQIELTAHALLSGSLDNLNENFESLNQSQLILLTR
                     LKIIEERLNNFKSIINDNIINEKELEEQFNKVKQLRKRLERCLKVTESIEMRVDKLEN
                     QP"
     gene            complement(<1149078..>1150103)
                     /locus_tag="CD36_54620"
                     /db_xref="GeneID:8048412"
     mRNA            complement(<1149078..>1150103)
                     /locus_tag="CD36_54620"
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit precursor, putative"
                     /transcript_id="XM_002420711.1"
                     /db_xref="GeneID:8048412"
     CDS             complement(1149078..1150103)
                     /locus_tag="CD36_54620"
                     /EC_number="2.4.99.18"
                     /inference="similar to AA sequence:UniProt:P48439"
                     /inference="similar to AA sequence:UniProt:Q5AK26"
                     /note="Similar to S. cerevisiae OST3;
                     In S. cerevisiae: gamma subunit of the
                     oligosaccharyltransferase complex of the ER lumen, which
                     catalyzes asparagine-linked glycosylation of newly
                     synthesized proteins; oligosaccharyl transferase gamma
                     subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="dolichyl-diphosphooligosaccharide--protein
                     glycosyltransferase subunit precursor, putative"
                     /protein_id="XP_002420756.1"
                     /db_xref="GeneID:8048412"
                     /db_xref="GOA:B9WI44"
                     /db_xref="InterPro:IPR006844"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="UniProtKB/TrEMBL:B9WI44"
                     /translation="MKISVILFMVTLWSLVLGGLTNNELLKIVKNRRNKVLELNDENF
                     ENILNGQRDYHLIALLTSEAPNLNCVLCRELAPEYSVVANSWFQDHPNGVAEVELTEQ
                     EEKDGKKQPKNIYFFKSEFKDSRKLFSILQLQNIPKMFYFPPTKHLGPNNYLKEKVEY
                     QFFQGDHKELLKNWLIEVTDHRFNLYIPVNKTKIAINAIGTFITVLLLRVFSKQVIQV
                     ITSRVIWCAGSIISVILFTTGYMFNQIRGTPYVMEHRDGRTEYFAPGQQAQFGVETQI
                     MSFLYGFLSILVIVLVKRAPEVKNQSANLILVATVSSLIFVLFSLLLSIFGVKGLGFP
                     YRFINFF"
     gene            complement(<1150290..>1152434)
                     /locus_tag="CD36_54630"
                     /db_xref="GeneID:8048413"
     mRNA            complement(<1150290..>1152434)
                     /locus_tag="CD36_54630"
                     /product="calpain-like cysteine protease, putative"
                     /transcript_id="XM_002420712.1"
                     /db_xref="GeneID:8048413"
     CDS             complement(1150290..1152434)
                     /locus_tag="CD36_54630"
                     /EC_number="3.4.22.-"
                     /inference="similar to AA sequence:UniProt:Q03792"
                     /inference="similar to AA sequence:UniProt:Q4WK75"
                     /inference="similar to AA sequence:UniProt:Q5AK25"
                     /note="Similar to S. cerevisiae RIM13"
                     /codon_start=1
                     /transl_table=12
                     /product="calpain-like cysteine protease, putative"
                     /protein_id="XP_002420757.1"
                     /db_xref="GeneID:8048413"
                     /db_xref="GOA:B9WI45"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="UniProtKB/TrEMBL:B9WI45"
                     /translation="MPLPCLEQFLYHLERSYLYLCIDNTKLSKKECLESIKILNSIAK
                     TTSSPQIKVLSQYTLNHYESLDKPITVSDKLEWISSKLTPETFFPPVIWFNETVTSHS
                     ELFIDTESIIQDSNNTAFEKLPNKLAKFKYIEISNWNNEITHLKNLYQDILPNCSFVS
                     SFLAIVDANIPIIDTITPQTSSQKYKVSLRFNGVLRNVTVDSNFPVMPNSRNLIIKSY
                     SDTELYWPALIEKAYLTVMGNGYNFAGSNMANDAYVLSGWLPQIIKLSNGQLPSNIDY
                     LWRLRKQNKVTMGIGTGTLSKQLSSQLNLVSGHDYVIDNIKDGVITVKNPWLDPTDRV
                     VEIKDFNYFKYLYVNWKPNHKPFQHNFLYQAKPNTYNQPQFTIKCIEETWVLLERHLP
                     ETSQSHWMDMNVFETQNKVITPSQYKKHLSVETNNRLQLIKLKPGIFTIVVSSNKPCR
                     FTLSSFNAIFSKSKYKHEYTETLNDEWSSDTNGGNWAMSTYINNPQYDVIVKQTTDLI
                     IGMYGQGQINFHLFHTTSDSLGERIQNFDKTKLINYQNYNAFYQSSSYSLTPGHYKLV
                     VSEYNRGLGDFQLVLNSSEPITISKVPPYLGLYNITKLFNWDNTNRFKLNFETTGYNS
                     VVKIKIGYFNGESDFELQTSYRPAMRASLFNSQTKQPIQINEQFNDSLYGVFLHEVLP
                     QPQEYILLIERFEIGFGRCIVEIGCNNKVILK"
     gene            <1152566..>1154017
                     /locus_tag="CD36_54640"
                     /db_xref="GeneID:8048414"
     mRNA            <1152566..>1154017
                     /locus_tag="CD36_54640"
                     /product="GPI mannosyltransferase, putative"
                     /transcript_id="XM_002420713.1"
                     /db_xref="GeneID:8048414"
     CDS             1152566..1154017
                     /locus_tag="CD36_54640"
                     /EC_number="2.4.1.-"
                     /inference="similar to AA sequence:UniProt:P30777"
                     /inference="similar to AA sequence:UniProt:Q5AK24"
                     /inference="similar to AA sequence:UniProt:Q9USN0"
                     /note="Similar to S. cerevisiae GPI10;
                     In S. cerevisiae: integral membrane protein involved in
                     glycosylphosphatidylinositol (GPI) anchor synthesis;
                     putative alpha 1,2 mannosyltransferase required for
                     addition of the third mannose onto the GPI core structure;
                     human PIG-Bp is a functional homolog; alpha 1,2
                     mannosyltransferase, putative;
                     glycosylphosphatidylinositol-anchor biosynthesis protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="GPI mannosyltransferase, putative"
                     /protein_id="XP_002420758.1"
                     /db_xref="GeneID:8048414"
                     /db_xref="GOA:B9WI46"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:B9WI46"
                     /translation="MTKSTLLSSYKLFAFICIFRLLNSFAIETFFQADEFFQALEPAH
                     HFVYGYGYLTWEWKQQLRSAIHPLIYALGYKLVGDNTTLVRICPKIINALIATIGEYN
                     LYKFIIVYDSEKLAWITLMLSLFNPFNWYVITRSFSNNLEMVLTVLALRFWPWNKKIN
                     GRWYISLGFGFVSCIIRPTNILIWIPLGIWLLINVRINFKWVVTSLMEVVLILLTNTA
                     LDYYFYHQMTFPLYNFLEFNVFKNLSIFYGTAPWHFYLFQAIPLMLMLYLPLMIYGLK
                     KNILLFTGLFYVIGFSLIQHKEFRFIYPIHPILLYFTARGYVRLRPKFVLLGILLNVC
                     IGLFFTNVHERGVIDLTRYLAAQSTPSVGFITPCHSTPWQSYFHSPNLDINSWFLTCE
                     PPLHLNKPSLEEIKRYRDQSDQFYDAPKSFLQMHLGKDLPMTEQLVIFEPLEQLIKDE
                     LGNGYHECKRFYNSFFHWDNRRNGDIIVYCRNE"
     gene            <1155670..>1156722
                     /locus_tag="CD36_54650"
                     /db_xref="GeneID:8048415"
     mRNA            <1155670..>1156722
                     /locus_tag="CD36_54650"
                     /product="alcohol dehydrogenase 1, putative"
                     /transcript_id="XM_002420714.1"
                     /db_xref="GeneID:8048415"
     CDS             1155670..1156722
                     /locus_tag="CD36_54650"
                     /EC_number="1.1.1.1"
                     /inference="similar to AA sequence:UniProt:P07246"
                     /inference="similar to AA sequence:UniProt:P43067"
                     /note="Similar to S. cerevisiae ADH1;
                     In C. albicans: at surface of yeast-form cells but not
                     hyphae; soluble in hyphae; immunogenic in human or mouse"
                     /codon_start=1
                     /transl_table=12
                     /product="alcohol dehydrogenase 1, putative"
                     /protein_id="XP_002420759.1"
                     /db_xref="GeneID:8048415"
                     /db_xref="GOA:B9WI47"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B9WI47"
                     /translation="MSEQIPKTQKAVVFDTNGGKLVYKDYPVPTPKANELLIHVKYSG
                     VCHTDLHAWKGDWPLATKLPLVGGHEGAGVVVGMGENVKGWKIGDFAGIKWLNGSCMS
                     CEFCQQGAEPNCGEADLSGYTHDGSFQQYATADAVQAAKIPAGTDLANVAPILCAGVT
                     VYKALKTADLEAGQWVAISGAGGGLGSLAVQYAKAMGLRVVAIDGGEEKGEFVKSLGA
                     EAYIDFTKEKDIVEAVKKATHGGPHGAINVSVSEKAIDQSVEYVRPLGKVVLVGLPAH
                     AKVSAPVFDAVVKSIEIKGSYVGNRKDTAEAVDFFSRGLIKCPIKIVGLSDLPEVFRL
                     MEEGKILGRYVLDTNK"
     gene            complement(<1156822..>1157307)
                     /locus_tag="CD36_54660"
                     /db_xref="GeneID:8048416"
     mRNA            complement(<1156822..>1157307)
                     /locus_tag="CD36_54660"
                     /product="autophagy protein, putative"
                     /transcript_id="XM_002420715.1"
                     /db_xref="GeneID:8048416"
     CDS             complement(1156822..1157307)
                     /locus_tag="CD36_54660"
                     /inference="similar to AA sequence:UniProt:Q5AK22"
                     /inference="similar to AA sequence:UniProt:Q6BH63"
                     /note="Similar to Debaryomyces hansenii ATG16"
                     /codon_start=1
                     /transl_table=12
                     /product="autophagy protein, putative"
                     /protein_id="XP_002420760.1"
                     /db_xref="GeneID:8048416"
                     /db_xref="InterPro:IPR013923"
                     /db_xref="UniProtKB/TrEMBL:B9WI48"
                     /translation="MSSNQELSQDILNQLNLRDSREKNHKIDAKYFNAFQQLSQKLNK
                     LSTTTNTLLQGQSHNSETLTSLINSKEIENLKLENTELITNLNNLIINNEKLTQTITA
                     KDQTIKSLTKLNDKLNSKIEALNLEINEKNKTIELINDEVLTNQIQLNVLQSKLESLE
                     K"
     gene            <1157570..>1159894
                     /locus_tag="CD36_54670"
                     /db_xref="GeneID:8048417"
     mRNA            <1157570..>1159894
                     /locus_tag="CD36_54670"
                     /product="uncharacterized protein yml020w, putative"
                     /transcript_id="XM_002420716.1"
                     /db_xref="GeneID:8048417"
     CDS             1157570..1159894
                     /locus_tag="CD36_54670"
                     /inference="similar to AA sequence:UniProt:Q03722"
                     /inference="similar to AA sequence:UniProt:Q5AK21"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein yml020w, putative"
                     /protein_id="XP_002420761.1"
                     /db_xref="GeneID:8048417"
                     /db_xref="UniProtKB/TrEMBL:B9WI49"
                     /translation="MTSLEAEATDPPRNDNDNNTDIVLRSHSENTSNVNSTPNGNDTP
                     TETQQHNRLYETFFFWNSSTTNIEEQRELSIAQESTETPQLQPEQISEESTQELEVSN
                     NQQQSENTTTWWNFSSYSMVSYFKPTQTISDEETPLLMAPSTSQTTSTKEDSNHTIPQ
                     TSWWDWLVGSTTPTDNGEDDEDESHTSNLELYKRAKLAIETSKEEIHYVFKKSISIDS
                     DISNKVELSVYGTLTEETPVEYNCSKRKNPLSPNEILENLTNNKEFNSTSNRNNMPGI
                     DGVSSNSTIIPSFDDNYRDITTMTRLRILLKTYIICDGITDTINLPNENHLYKESQKH
                     VLYLKKKKLKKITIIGVHSFLPNKLVRSLMGNRSSGNSNTFVETATSSVLSWLKENDN
                     NDNNDIDINDYDIETLSVEGQGKINERVEKSYQLIIKNWSHILESSQFIFFVSHGIGS
                     VVAINLFSKLLTEHDSGITSRNKFLGALCMNGGFLGPFKGLNSRLIIRAFTSIENEII
                     NEVFQYQNTKSKLSMQLNNAMDNLIENNVKIVFSGVINDPFIPLFSSLALQFSHPNIT
                     RNIYYNDNNNNNIYNISNCEVVPFVSQLLKIICLMKNLGYDQDYDLVRDLSDKFDFLT
                     STDMGYSISGASANTTAPFTGFENYTGATNNSNTKCNSTIFNDEKLYKEAIRFSLETT
                     DLIGKQRDLVITDYNMIEGSSNEGNSNFYNMLPWNMRSLLNDFIQVKHIKSYQLIEQL
                     ISQFNNEWDPTSKTWKDIKYCLGGLEDFHVDELI"
     mobile_element  1161982..1162229
                     /mobile_element_type="retrotransposon:solo LTR, iota C"
     gene            <1166795..>1168798
                     /locus_tag="CD36_54680"
                     /db_xref="GeneID:8048418"
     mRNA            <1166795..>1168798
                     /locus_tag="CD36_54680"
                     /product="homeobox transcription factor, putative"
                     /transcript_id="XM_002420717.1"
                     /db_xref="GeneID:8048418"
     CDS             1166795..1168798
                     /locus_tag="CD36_54680"
                     /inference="similar to AA sequence:UniProt:P07269"
                     /inference="similar to AA sequence:UniProt:Q06858"
                     /inference="similar to AA sequence:UniProt:Q5AK20"
                     /note="Similar to S. cerevisiae PHO2;
                     In S. cerevisiae: homeobox transcription factor;
                     regulatory targets include genes involved in phosphate
                     metabolism"
                     /codon_start=1
                     /transl_table=12
                     /product="homeobox transcription factor, putative"
                     /protein_id="XP_002420762.1"
                     /db_xref="GeneID:8048418"
                     /db_xref="GOA:B9WI50"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:B9WI50"
                     /translation="MSLDSISSSGNQELSTPTPPTSLSSTNSNNNNNVSSGQKRIRAT
                     GEALEFLISEFERNPNPSPERRKFISDKAQMNEKAVRIWFQNRRAKQRKFERQMLKKE
                     RDSPGNYAGIYNTYTPNTTGVASTNMTNVNTNGTGTTTDFNNKLNNISSIPVEVNEKY
                     CFIDCRSLSVGSWQRIKTGFHESNLLSNNLVNLAPVTLNQVMANVDLLIILSKKNLEL
                     NYFFSAISNNSRILFRIFYPLNAVVKCSLFDNNYYQNNNNNNNNGNTSSDDNSISEIR
                     LNLCQKPKFSVYFFNGSNTNNQWSICDDFSEGQQVSRAFAANENNLPSNEPQQSLSST
                     VPHVLVGNTSSLQYLSQFILQHQQRQKQQSQNQFEFNSQSFDTIPTSAINNSFNVNKT
                     ISASGMQGFVPGDFQELPAIYESISNNNQPTTTDSKDSNKHTPSSTTFTPQNSNGNNH
                     SNANATYTNFYNESPFSIASTATTINNNNNKNRSNSQSHNPIFSDQLFYESSESASTN
                     SPQFSIKKLNSETKLYINGNVSSNSSTNGPPLDDDNNLFDGVTRFTTTETSPDDDILG
                     MFTDQTQEPSTFEMANGGTSNGSSYTHIKNGSLTKSDKTFTGFNETNNNNNNGISFVD
                     EFHVGNEFGDFDFDHHYSQDHQQHQQNDNNGNTNLDSFIDFEN"
     gene            <1169275..>1170537
                     /locus_tag="CD36_54690"
                     /db_xref="GeneID:8048419"
     mRNA            <1169275..>1170537
                     /locus_tag="CD36_54690"
                     /product="mitochondrial inner membrane protein, putative"
                     /transcript_id="XM_002420718.1"
                     /db_xref="GeneID:8048419"
     CDS             1169275..1170537
                     /locus_tag="CD36_54690"
                     /inference="similar to AA sequence:UniProt:P40990"
                     /inference="similar to AA sequence:UniProt:Q5AK19"
                     /note="Similar to S. cerevisiae MSS2;
                     In S. cerevisiae: peripherally bound inner membrane
                     protein of the mitochondrial matrix, binds to the Cox2p
                     C-terminal tail to facilitate its translocation through
                     the inner membrane"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial inner membrane protein, putative"
                     /protein_id="XP_002420763.1"
                     /db_xref="GeneID:8048419"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:B9WI51"
                     /translation="MLRQFLRNASSNPTKVTASITSTLSPSTNNSHVNTSKTQRPELL
                     TILPSKRILNRILFDIDSQLTYKQMMPILNHIYNNLSTPESINLTQLKIQSSSYDLMK
                     FKKLLQEIRKVTNSINVHLLDLENELIEQSAELGNNDAISILAFETIRKRQILKEIVD
                     EEDYKHANELIKQLIDINHPLVFKMAGDLSWELNQPNQAIEYWQNYIDLVNKDKRGGG
                     GDDYDDHLCQIYYNMGYYYFTYLKHPKLSLAKLNFQKCINHGSSNVSGSSTGSNSNEF
                     IVKSHFYLGQLYVNNNPKLSKYHWEIASSSGLKDSIINLGFLEMNCFQNYHLAIEWFK
                     LGMELNPSEVQCLIGLFDAYIALQNWKSANIYLSKLNKLFETIAEKKKTSELPENIKS
                     SIIYNESMLKTFHQTRLNDIKLVTSKIV"
     gene            complement(<1170632..>1172289)
                     /locus_tag="CD36_54700"
                     /db_xref="GeneID:8048420"
     mRNA            complement(join(<1170632..1172197,1172269..>1172289))
                     /locus_tag="CD36_54700"
                     /product="DNA damage response protein kinase, putative"
                     /transcript_id="XM_002420719.1"
                     /db_xref="GeneID:8048420"
     CDS             complement(join(1170632..1172197,1172269..1172289))
                     /locus_tag="CD36_54700"
                     /EC_number="2.7.11.1"
                     /inference="similar to AA sequence:UniProt:P39009"
                     /inference="similar to AA sequence:UniProt:Q5AK18"
                     /note="Similar to S. cerevisiae DUN1;
                     In S. cerevisiae: cell-cycle checkpoint serine-threonine
                     kinase required for DNA damage-induced transcription of
                     certain target genes, phosphorylation of Rad55p and Sml1p,
                     and transient G2/M arrest after DNA damage; also regulates
                     postreplicative DNA repair;
                     spliced gene; cell-cycle checkpoint serine-threonine
                     kinase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA damage response protein kinase, putative"
                     /protein_id="XP_002420764.1"
                     /db_xref="GeneID:8048420"
                     /db_xref="GOA:B9WI52"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:B9WI52"
                     /translation="MSLIRKRKLDELEQEQQCGSKTQDKPVLENSMTKLIGRLYNVNE
                     KGTNLDIPKKPVVIIGRSSSCDIRIQGIDVSSKHCQLNIIQTTNKHINTRNEYLSLTD
                     LSSNGIKINDEIMNKRTSVILKTGDKIAFAKTGGSYIFRYIISDEDAEEDGDESVQAK
                     KKKKYASFFDDYILGKQLGSGHYAVVKEAKDKKTGQAVAVKIFHPNKSGLVNKANSAQ
                     QQQEELKLQQEMNLLLSIDHPNIVKFINHYVEPINNYSVNTYLVLEKMNSGELFQRII
                     NKSKLRIDETKAIFRQILSGLKYLHDHDIIHRDIKPENILLDITPKTSPHQKSMGPWD
                     KDEFDIKVKIADFGLAKFIGELKFTNTLCGTPAYVAPEILKPNC