GenomeNet

Database: RefSeq
Entry: NC_012867
LinkDB: NC_012867
Original site: NC_012867 
LOCUS       NC_012867            2267510 bp    DNA     linear   CON 28-AUG-2017
DEFINITION  Candida dubliniensis CD36 chromosome R, complete sequence.
ACCESSION   NC_012867
VERSION     NC_012867.1
DBLINK      BioProject: PRJNA38659
            BioSample: SAMEA2272258
            Assembly: GCF_000026945.1
KEYWORDS    RefSeq; complete genome.
SOURCE      Candida dubliniensis CD36
  ORGANISM  Candida dubliniensis CD36
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Debaryomycetaceae;
            Candida/Lodderomyces clade; Candida.
REFERENCE   1
  AUTHORS   Jackson,A.P., Gamble,J.A., Yeomans,T., Moran,G.P., Saunders,D.,
            Harris,D., Aslett,M., Barrell,J.F., Butler,G., Citiulo,F.,
            Coleman,D.C., de Groot,P.W., Goodwin,T.J., Quail,M.A.,
            McQuillan,J., Munro,C.A., Pain,A., Poulter,R.T., Rajandream,M.A.,
            Renauld,H., Spiering,M.J., Tivey,A., Gow,N.A., Barrell,B.,
            Sullivan,D.J. and Berriman,M.
  TITLE     Comparative genomics of the fungal pathogens Candida dubliniensis
            and Candida albicans
  JOURNAL   Genome Res. 19 (12), 2231-2244 (2009)
   PUBMED   19745113
REFERENCE   2  (bases 1 to 2267510)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-AUG-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2267510)
  AUTHORS   Gamble,J.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-JAN-2009) Gamble J.A., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FM992695.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2267510
                     /organism="Candida dubliniensis CD36"
                     /mol_type="genomic DNA"
                     /strain="CD36"
                     /type_material="type material of Candida dubliniensis"
                     /db_xref="taxon:573826"
                     /chromosome="R"
     gene            complement(3572..5215)
                     /locus_tag="CD36_25010"
                     /pseudo
                     /db_xref="GeneID:8050202"
     misc_feature    complement(3572..5215)
                     /locus_tag="CD36_25010"
                     /inference="similar to AA sequence:UniProt:Q59KM5"
                     /note="Similar to C. albicans YRF1, (HPR5);
                     incomplete sequence; apparent frameshift (exact joining
                     regions uncertain); probable pseudogene"
                     /pseudo
                     /db_xref="GeneID:8050202"
     gene            <6147..>7151
                     /locus_tag="CD36_25040"
                     /db_xref="GeneID:8050023"
     mRNA            <6147..>7151
                     /locus_tag="CD36_25040"
                     /product="retrotransposon protein, putative"
                     /transcript_id="XM_002421564.1"
                     /db_xref="GeneID:8050023"
     CDS             6147..7151
                     /locus_tag="CD36_25040"
                     /inference="similar to AA sequence:UniProt:Q59ZR5"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="retrotransposon protein, putative"
                     /protein_id="XP_002421609.1"
                     /db_xref="GeneID:8050023"
                     /db_xref="UniProtKB/TrEMBL:B9WKJ8"
                     /translation="MWSRKKHVVNLTNFVSTCGQKCAGSGRWSGNRMPKKTRYFWKTR
                     RLDLASTAKFCTTCRTLGHTRWTCTYGNHCFRCNENSHSTGGHFAYMEAQEAKVAKTT
                     GYTLISKNKKKRRVQIPGYPPKNSPANQGQTISTNQGTTKNLPADQGPTTPAEQGKTT
                     SAEPGKVQNTSAITAPTEPVSQDGVQTPSENTDPFKTVVTNWVPTIREHTEPVVEGLN
                     KINYTNNSTVTTPKPVKPLESVWMNETSKEDEEITILEERKVPRIRKPAQNPVSMSSE
                     EDDENDADYTDETMDEVSEQDSEDDNMETEDYQDGITNVDVPEETINQFIQIKNESQY
                     "
     mobile_element  6228..8997
                     /note="5' truncated ORF1 + 3' truncated ORF2
                     (subtelomeric)"
                     /mobile_element_type="LINE:RA, Zorro1-like"
     gene            <6979..>9033
                     /locus_tag="CD36_25050"
                     /db_xref="GeneID:8050024"
     mRNA            <6979..>9033
                     /locus_tag="CD36_25050"
                     /product="polyprotein of L1-like non-LTR retrotransposon
                     Zorro 1, putative"
                     /transcript_id="XM_002421565.1"
                     /db_xref="GeneID:8050024"
     CDS             6979..9033
                     /locus_tag="CD36_25050"
                     /inference="similar to AA sequence:UniProt:Q59K55"
                     /inference="similar to AA sequence:UniProt:Q9P8H7"
                     /note="transposable element;
                     Similar to C. albicans POL90"
                     /codon_start=1
                     /transl_table=12
                     /product="polyprotein of L1-like non-LTR retrotransposon
                     Zorro 1, putative"
                     /protein_id="XP_002421610.1"
                     /db_xref="GeneID:8050024"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:B9WKJ9"
                     /translation="MMKMMSIISMKPWMKFSNKIQKMITWKQKTTKMELLMLMYQKKQ
                     STNLFRLKMRVSTEYVNVGSFNCEKTQNVLAPQELIEKYDILFLQELNESNIKVIKQL
                     NLPTTLIFSEKTGIIIHHKINGLIKVHKQHVIDIGIQLAPDLSDALVTINNKKYHLIN
                     TYYPIADKSKQQKALTTCLSENLTKDKPIIWGGDFNHILSETLDRSYEGADKPGEAGS
                     RKLSLELYHQLQLKDVFRSLFPTQKNHTNNNPHNNRRIDRFHISETIEVGEFHQEKLT
                     TIKSTHDLIAITIKISNKPIIDMGRPRFIIRDNLMENPLFINDIIKNKPKNWKQLKQT
                     ISKLTRTKRYKKMEKELDSDIFDDLRVRFNGKTKPKNKAILKMEDLDGTIAETTDEIL
                     IIAKLFMETLYKKSPNIPNNITHYLKEFTTKVTNDERAKLDAPITLNELTDELTGKSA
                     SSTPGEDGFNFRFIKICWEVIGPILVNVSEEIQNSGKLPQELQNIIINLIPKKGKSNN
                     INNTRPISIIDCAIRLISSVYNSRFQKILTNYISPDQHGFLSGRTISDASQKIQLVID
                     EMNKHKRKISGPGAILVDMAKAFDSLDHSYLKQVLKKFNLGPRTISFCMAITSGHKGQ
                     VSVNNKTSEEFKLDRGVRQGNPLSPLLFILALEPLFFQLNRRIQGIHMGKKLRVTRRH
                     IL"
     mobile_element  complement(9009..9106)
                     /note="partial ORF1 (subtelomeric)"
                     /mobile_element_type="LINE:RI, Zorro1-like"
     gene            <12280..>13344
                     /locus_tag="CD36_25070"
                     /db_xref="GeneID:8050025"
     mRNA            <12280..>13344
                     /locus_tag="CD36_25070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421566.1"
                     /db_xref="GeneID:8050025"
     CDS             12280..13344
                     /locus_tag="CD36_25070"
                     /inference="similar to AA sequence:UniProt:Q5AAF0"
                     /inference="similar to AA sequence:UniProt:Q6BR86"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421611.1"
                     /db_xref="GeneID:8050025"
                     /db_xref="UniProtKB/TrEMBL:B9WKK0"
                     /translation="MSSTTTLTATMNPTTDKVTFTTSNTQGEFDLLDIFSNDMDFEQA
                     YDMYNNIQEKTALGSFEHLQKVQMLNQQYVSNLPPPNQFPDQFAYERAQILNGGYTPK
                     QKPPANNDDPFDQFFTNTESNALEKFLDNLANPVASVNPLQFYNRTSSLDGDVDFNFE
                     MHTMKVPHHLKPKSIDHAALKQELTEAFAHPTTITQLPSPNTTDYKTTPQKPTPPKPQ
                     FVTPPTSGDESKKRTSDIEDDESEEESTKPLKKRKRSSTKPLLSLEQKRLNHSHSEQK
                     RRQLCKLAYQRCLELIIDLDAFNKLPELNESERKSKRARINKDGLPNLSKHNALIRIS
                     NEMILIKSMNDGLKKLLQNS"
     gene            complement(<13415..>15181)
                     /locus_tag="CD36_25080"
                     /db_xref="GeneID:8050026"
     mRNA            complement(<13415..>15181)
                     /locus_tag="CD36_25080"
                     /product="ATP-dependent helicase, putative"
                     /transcript_id="XM_002421567.1"
                     /db_xref="GeneID:8050026"
     CDS             complement(13415..15181)
                     /locus_tag="CD36_25080"
                     /EC_number="3.6.1.-"
                     /inference="similar to AA sequence:UniProt:P38766"
                     /inference="similar to AA sequence:UniProt:Q5AAF1"
                     /inference="similar to AA sequence:UniProt:Q9UUA2"
                     /note="Similar to S. cerevisiae RRM3; DNA repair and
                     recombination protein, mitochondrial precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP-dependent helicase, putative"
                     /protein_id="XP_002421612.1"
                     /db_xref="GeneID:8050026"
                     /db_xref="GOA:B9WKK1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003840"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028880"
                     /db_xref="UniProtKB/TrEMBL:B9WKK1"
                     /translation="MKPIVKSQFKLDDFFKRSKFVKHEDVVVKPVERQESALQFMDSD
                     AGFEENDDSSFDKSVEIVNLRSAMQQGKRRGDFLDAHQPKKLTKKEPEEVVTEIFLSA
                     EQQRVVDIVVQKKESIFFTGSAGTGKSVVLKEIVKACRGVYGDNFGVTASTGMAACNI
                     QGQTLHRYLGIGLGRDPVDKLAKRINKNSVVLRRWQQMRLLIIDEISMIDAALFDKIE
                     AVARVVRKSDRPFGGIQVVACGDFYQLPPVNKEGRPKFCFEGNSWGRVIKRAIVLKQV
                     FRQRGDSEFIDMLNALRVGKMDAAAIAGFACLQREIDYPDKLEPTELFPTVNEVRMAN
                     QSRLQRLPGKDFKFVARDRGDPKQHHLLDYLMCDKVLRLKEGAQVMNIVNYSDSIVNG
                     TLGTVLFFVTRRLYYKFIQQYGGIDASDAESIKEMRFICHRIGETEYSNEEKEYFEGL
                     SNERKEWVQQATNIAMQETTAECLPVINFSTHGPDVVTMVERHDFKIERANKKVNEDE
                     SNVLAREQLPLLLSWAMSIHKSQGQTLDRVRVDLGRSFADGQAYVALSRATSKDRLEL
                     RNFRPHKVTTSEAVRRFYATLE"
     gene            <14939..>19762
                     /locus_tag="CD36_25090"
                     /db_xref="GeneID:8050027"
     mRNA            <14939..>19762
                     /locus_tag="CD36_25090"
                     /product="formin, involved in spindle orientation,
                     putative"
                     /transcript_id="XM_002421568.1"
                     /db_xref="GeneID:8050027"
     CDS             14939..19762
                     /locus_tag="CD36_25090"
                     /inference="similar to AA sequence:UniProt:P41832"
                     /inference="similar to AA sequence:UniProt:Q5AAF4"
                     /note="Similar to S. cerevisiae BNI1"
                     /codon_start=1
                     /transl_table=12
                     /product="formin, involved in spindle orientation,
                     putative"
                     /protein_id="XP_002421613.1"
                     /db_xref="GeneID:8050027"
                     /db_xref="GOA:B9WKK2"
                     /db_xref="InterPro:IPR010472"
                     /db_xref="InterPro:IPR010473"
                     /db_xref="InterPro:IPR014768"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B9WKK2"
                     /translation="MCIQKIPTPLPLSHSTSQIDYLNTFIKRRIVILLKPCITIHKSK
                     CRLSPLNRLNHHVLMLDKLGPFKKVIQLKSQLDYGFHDKEKSTGICCDFFFFFFFFAT
                     RFVNTPDQTIPFFFFRFSHTKSSNTYHNLKQHPPMSNSSPKRQSVFTKGMKKLQKSKS
                     LLNFSSESINEPPPENFSLDPKSNINTIGLSLVGYGLSNDHLPPPKQHPISEPDSPSR
                     TTSPKLHVTTKFNTKQRVESFQTAANFKNQIPPDEIVDQLFEKLLSIRVFPNEALYSL
                     KKQPVERKWELLLREHETNHHFDLKKLSKQAADKFLANRDKFQEHEFLMMSRGNTQEP
                     KQKLKPLRIVSGGQDEEEAYMSSPSDSSKTVTVTKLVHDDSNTSKLSIESGGSSGAPT
                     ETESLLGLVNKKLKLRDGSPDWYVSRIMANKLSLRDCKKLERKLVENSLVKQTGVTWT
                     QGFINAQGETALSVVLTKINKKSIKSNEEFDKEYLIVKCLKHINSEKETQPLKEKVYV
                     VKALVFLLVSPRLTTRILVTEVLVMLMLHRDKTLWKSALEGLSNLQDRNGDYVIFQPW
                     LNAFEETIIKYSWSQNKAGELSNLKNYATITLILINSMVDICTSLKRRISIRRDFGNA
                     RILNIFEKLAQIEDTRIDNEIEKYEMYAEEDYNAYIEGKNKRNSKQLPNIPKPTFKQL
                     QVSDFIDIAEPVVESTTPETSTPENLKETSFEELSLEDNFFASESDSFDEEKSFMTKL
                     KEAEDIESDGAMKSVLQRLMKLKRSERSTEDVHKMLVLVDSMLQHVTNESRVVGTDAH
                     SVLNITIQKLMDRLSTEDMARRAVAESKKLSRQLELVMEEKQSLERELETNTVDTIRE
                     LKKENYYQTELIATQERQLSKLQQEVEQLQQQNETAFHNPPIVEPAGQQDFGNGTIAT
                     LKDTSSSPSKRPPTPPGLYTDKGQPNSIPAAPPIPDLVKGPPPPPSMDTASPAAPPPP
                     PPPPPPPPPLPPFMGTPSPDAPPPPPLPPFMGTPSPAAPPPPLPSFLDNSKPPAGPPL
                     PPPMPGLLQPGKVKELGVLFKEKHKPEPKHGITKTKADVVPSIRPKNKLKQMHWDKLE
                     NIEKTFWNNLEDSVLSNKLIEHGVLGEVEQVFAAKTATIKKKNNAESQPQPTKKSFLS
                     RDLSQQFGINLHMFANLSEEKLVLKVLRCNSEILENTSVLEFFNNEALVELSDSLFRN
                     LAPYSTDPRTRKKPMKNPDELERADRIFLELCYNLRHYWRSRSRALLFSQTYKKDYVD
                     LMKKLNIVDEANAALKKSESLQNVLGIIRTVGNFMNDDAKQALGFKLDTLQRLKFMKD
                     DQNSMTFLHYIEKIVRHSFPEYGSFVDDLNVLSTLHNISIEQLETDCEEMSRSVKNIT
                     DSLERGKLSNKKDLHPEDRILTTISSPMLNAKNKNAMLQSHLKRTTGELNSLMTFFGE
                     NPKDSTARNTFFYKFVTFISEYKKAHVENIQREEEQRTYEIRKKILEDKIAKKEKSKE
                     GSAEPEAVVDTAEESSAVIDSLLEKLKSTTPVTTNRTKIRNRRSKALSFYSTSENPLL
                     ELDREFANTKYESVNNLKRRMTTRKGIIDGDTSPKSEQFMSRAQAMLHQLRKEEE"
     gene            <19927..>22869
                     /locus_tag="CD36_25100"
                     /db_xref="GeneID:8050028"
     mRNA            <19927..>22869
                     /locus_tag="CD36_25100"
                     /product="C-1-tetrahydrofolate synthase, cytoplasmic,
                     putative (EC 6.3.4.3)"
                     /transcript_id="XM_002421569.1"
                     /db_xref="GeneID:8050028"
     CDS             19927..22869
                     /locus_tag="CD36_25100"
                     /EC_number="1.5.1.5"
                     /EC_number="3.5.4.9"
                     /EC_number="6.3.4.3"
                     /inference="similar to AA sequence:UniProt:P07245"
                     /inference="similar to AA sequence:UniProt:Q5AAF6"
                     /note="Similar to S. cerevisiae ADE3; C1-THF synthase,
                     putative; formyltetrahydrofolate synthetase, putative (EC
                     6.3.4.3); methenyltetrahydrofolate cyclohydrolase,
                     putative (EC 3.5.4.9); methylenetetrahydrofolate
                     dehydrogenase, putative (EC 1.5.1.5)"
                     /codon_start=1
                     /transl_table=12
                     /product="C-1-tetrahydrofolate synthase, cytoplasmic,
                     putative (EC 6.3.4.3)"
                     /protein_id="XP_002421614.1"
                     /db_xref="GeneID:8050028"
                     /db_xref="GOA:B9WKK3"
                     /db_xref="InterPro:IPR000559"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020628"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="InterPro:IPR020867"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WKK3"
                     /translation="MLRLRPAIRSIRNFHRTCVSLDAVVVSGTKLANSIRANVAEKVI
                     NYNKEHFGDNNKSFENFRFQPSLTILQVGSRPDSSAYVKSKLKAAASSNIKSKLIKLD
                     ETISQEDLVEVIDRLNKDPKVHGILVQLPLPKHIDESVITNAVVTDKDVDGFDHYNVG
                     QLSKRGGTPFFKPCTPNGIMELIKTTGVSLRGKTAVVIGRSDIVGTPVATMLRNEDCT
                     VTVCHRYTQNLPEIVRQADIVVAAVGIPEYVKADWIKEGAVVIDVGINYKDDPTAKRG
                     RRLVGDIDYEEVAKKASFITPVPGGVGPMTVAMLCSNVYDAALIHAKKAHEHGFKPLE
                     LNIKDPVPSDIEISRTQKPKKITKVAQELGILDAELEPYGHYKAKVDPKSVIERLDEQ
                     AEGSAQDKGNYVLVAGITPTPLGEGKSTTTMGLTQALGAHLGYNAIANVRQPSMGPTF
                     GVKGGAAGGGYAQVIPMDEFNMHLTGDIHAISAAQNLLCAAVDTRMFHESTSKTTTGF
                     FKRLVPVKKGKRSFTPSMLKRLEKLGIDKTNPDDLTAEEIEKFAKLNIDPDSITIKRV
                     VDCNDRFVREITIGEGKNEASKYPPRKTGMDITVASELMAILALSNSLKDLRQRVGKL
                     VVGTQRDTGVAITAEDIGCAGAITALLKDAIKPNLMQSLEGTPVFVHAGPFANISIGA
                     SSVIADKLALKLTSPSNPINNGDTGFVVTEAGFDFTMGGERFFNIKCRASGLKPDAVV
                     LVATSRALKLHGGATDVKPGQPLPAEYITENLEYLEKGCANLAKQISNIKQYNVPVVV
                     AINQFETDTDAEIKLIQSLALKAGADFAVPSNHWAKGGAGAVDLASAVVDAVKLAPLE
                     QQKYLYDVNDTVEEKLLAITTKMYGASGIELSPLAKKQIETYTKQGYDKLPICIAKTQ
                     YSLSHDPSLKGVPTGFTVPIREVRCSAGAGYLYALAAEIMTIPGLPTHAGFMNVEVND
                     KGEIEGLF"
     gene            complement(<22876..>23562)
                     /locus_tag="CD36_25110"
                     /db_xref="GeneID:8050029"
     mRNA            complement(<22876..>23562)
                     /locus_tag="CD36_25110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421570.1"
                     /db_xref="GeneID:8050029"
     CDS             complement(22876..23562)
                     /locus_tag="CD36_25110"
                     /inference="similar to AA sequence:UniProt:Q04304"
                     /inference="similar to AA sequence:UniProt:Q5AAF8"
                     /note="homology to bacterial nucleoside-diphosphate-sugar
                     epimerases but no Pfam domains for epimerase;
                     Pfam domains for tetrahydrofolate
                     dehydrogenase/cyclohydrolase, catalytic domain,
                     tetrahydrofolate dehydrogenase/cyclohydrolase,
                     NAD(P)-binding domain and formate--tetrahydrofolate
                     ligase"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421615.1"
                     /db_xref="GeneID:8050029"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B9WKK4"
                     /translation="MSVKNIIVFGSHGKIGQQFVRLLADKTSVFKGTAVVRNNEQAKT
                     IKSITSNSPNVSLLNFTLDNANVGEIASAIKGHDAVVFTVGSAGKNLLQVDLDAAVKT
                     FEASVEAQVKRFIIISAIHADNREFFSNLSLRNYYIAKHYADRVLVNEFGGELDYTIL
                     KPTELTDEAATGKIRIIKGTDEDIGTITRADVAKVIYEIVNDQDTFGKSYNIANGDLD
                     ITDKRIYKIV"
     gene            complement(<23694..>25961)
                     /locus_tag="CD36_25120"
                     /db_xref="GeneID:8050030"
     mRNA            complement(<23694..>25961)
                     /locus_tag="CD36_25120"
                     /product="enhancer of polycomb-like protein 1, putative"
                     /transcript_id="XM_002421571.1"
                     /db_xref="GeneID:8050030"
     CDS             complement(23694..25961)
                     /locus_tag="CD36_25120"
                     /inference="similar to AA sequence:UniProt:P43572"
                     /inference="similar to AA sequence:UniProt:Q5AAG1"
                     /note="Similar to S. cerevisiae EPL1"
                     /codon_start=1
                     /transl_table=12
                     /product="enhancer of polycomb-like protein 1, putative"
                     /protein_id="XP_002421616.1"
                     /db_xref="GeneID:8050030"
                     /db_xref="GOA:B9WKK5"
                     /db_xref="InterPro:IPR019542"
                     /db_xref="InterPro:IPR024943"
                     /db_xref="UniProtKB/TrEMBL:B9WKK5"
                     /translation="MAAAPAPAKNQGKAKQHVTGARFRQRKISVKQPLTIYKQRDLPT
                     LDSNELEPSQVHHLNSNASSTQQPRDIHAVETGVDKNEEEEVHLQQVINAAQKALLGS
                     QKEEKTSDMYIPTPDASRIWPEAHKYYKDQKFKQPETYIKFSATVEDTVGVQYNMDEI
                     DEKFYRETLCKYYPKKKNKSEENNRKCTELEFETICDKLEKTIEARQPFLSMDPTNIL
                     SYEELSSYIVDQFKSAVKTSNPYIVTNGGNLEYISTTALKERLSKEIKYEPFVTIFDK
                     NQVSTTAVRPIPKLFELFGRPIYDHWKERKIERKGKTIQPTLKFEDPNSNEKENDNDP
                     YICFRRREFRQARKTRRADTIGAERIRSMQKSLHRARDLIMSVSEREILKLENFQSEH
                     ELFKVRCNTKACKRELNIKGDDYLFFPHKKKKVVRTSEDEEREKKKREKKKQDHELAV
                     KQQQTLQQQATPQQPPHPPQKQDGTSTGQPYVKLPPAKVPDMDLVTVSLVLKEKNETI
                     KRAVLEKLRKRKEHDKGFINLTDDPYQPFFDISTNRAEELSHIPYSSIAATHYHQFNT
                     SNYLNDQLKKLFEEKKPLPGVKTFLGSNGELVPSKAFPHLSSLLEEKYKSTSGYIERL
                     LHSVETQDFSSYTNGFKDVEPKEANDPGMAFPQRIRRRVGRAGRVFLDHQHQHQHPQS
                     NSLLESPNSDRVGTIPDIYCKEDAIKRLQSKWKFDTEYKTTDPFSLDPSKLNGISPST
                     QSIRFGSMLLNRTRK"
     gene            <26920..>29043
                     /locus_tag="CD36_25130"
                     /db_xref="GeneID:8050031"
     mRNA            <26920..>29043
                     /locus_tag="CD36_25130"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421572.1"
                     /db_xref="GeneID:8050031"
     CDS             26920..29043
                     /locus_tag="CD36_25130"
                     /inference="similar to AA sequence:UniProt:Q5AAG4"
                     /inference="similar to AA sequence:UniProt:Q6BNX1"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421617.1"
                     /db_xref="GeneID:8050031"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:B9WKK6"
                     /translation="MDPSVPSVTPFLNSVCPGYTGLDDNVHYPLEDMPNECREHIWPT
                     ATTNATIKLDYTYLNVARPALNKSESTTYVSLPLHITNMFDNLVSKSEKASEGYMHIG
                     ANVNALTHDPFKVINLNPGCITRILDWDRSNNPFADNKTLTFNKLANNFNKLFVKNDL
                     FDDLATNRDVKILNSKPITTAKLLVSSHVNILNVFALNEKSEFMNTTKNEGTSPPDDK
                     YIEEPVLRLEFKDSVITALSTFVLNEDPLVVLGFHSGVLMILKINQLKYQLFDALKVH
                     KVLEVDAVTCIEAIRHPNYDYLVVAGYSNGEVVILNPYGVKQSYSKSVVDKDVSTTFF
                     KKFDLSPLGKVDNSFVLGHFKVSHKPITSLTSTLPINKPLQPSEAQPLIVAIAADDGY
                     VRFVDFVFTYNRNYGEKRQVITTDIISNYFNTSITDIEFSPDFKFFSVVGKGDLIEVF
                     KMSYYNVNGLLHKSSGRRSRSGTVNSAHSGSETRLKEPKEMYPPIIKDIQIAGRFKGH
                     TNIVKSTKFVKDDFSTSVYKLVSCGYDGKLIVWEFDYKALPKIKKSHSKPSPTSPRES
                     RSKTSHERKQILLSPSPLARRKHTRNRSIEENHTTSMNMLLQDTNTPKPPLSSDQIEV
                     VATLYKSLYEIRLKRHYKKKSTNQIIICPIENDKLVPSIEVPLLIIDLSKLVKDGKID
                     SFYLDRSTLWCFAKSGDLFRYTIST"
     gene            complement(<29040..>30569)
                     /gene="MKC1"
                     /locus_tag="CD36_25140"
                     /db_xref="GeneID:8050032"
     mRNA            complement(<29040..>30569)
                     /gene="MKC1"
                     /locus_tag="CD36_25140"
                     /product="mitogen-activated protein kinase, putative"
                     /transcript_id="XM_002421573.1"
                     /db_xref="GeneID:8050032"
     CDS             complement(29040..30569)
                     /gene="MKC1"
                     /locus_tag="CD36_25140"
                     /EC_number="2.7.11.24"
                     /inference="similar to AA sequence:UniProt:P43068"
                     /inference="similar to AA sequence:UniProt:Q00772"
                     /codon_start=1
                     /transl_table=12
                     /product="mitogen-activated protein kinase, putative"
                     /protein_id="XP_002421618.1"
                     /db_xref="GeneID:8050032"
                     /db_xref="GOA:B9WKK7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008352"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:B9WKK7"
                     /translation="MDQQDVPIYYGRSVNKVYNQEFIIDRRFKIVKELGHGAYGIVCS
                     AKYDDGSNDDADSNNGNTSSSTDGSFVAIKKITNIFSKNILCKRALRELKLLQFFRGH
                     KNITCLYDLDIIPNPMTGEFNEIYLYEELMECDMHQIIRSGQPLTDSHYQSFIYQVLC
                     GLKYIHSADVLHRDLKPGNLLVNADCELKICDFGLARGFSENPDENAGFMTEYVATRW
                     YRAPEIMLSFTNYTKAIDIWSVGCILAELLGGKPLFRGKDYVDQLNQILMILGTPPES
                     TLQRIGSHRAQNYVRSLPIMRKVSYKQLFPDANPLALDLLEKMLTLDPHERISVEDAL
                     SHKYLEVWHDPRDEPECQVKFDFKSFETVDGLDEMRSLIIDEVKNFREFVRKPIEEQQ
                     QIQLQLQIQKREKQRQEEEERAQQQQEQQRQFQIQESMDISQTPYNNLETNMGTPQVE
                     DDYPKPQELNEFTFSNLESSNTTNSMNLFQDMTQPPGEEYIKLEEELGFGLDGAMFNN
                     Y"
     gene            complement(<31426..>32598)
                     /locus_tag="CD36_25150"
                     /db_xref="GeneID:8049698"
     mRNA            complement(<31426..>32598)
                     /locus_tag="CD36_25150"
                     /product="aminotransferase, putative"
                     /transcript_id="XM_002421574.1"
                     /db_xref="GeneID:8049698"
     CDS             complement(31426..32598)
                     /locus_tag="CD36_25150"
                     /inference="similar to AA sequence:UniProt:Q4W8Z3"
                     /inference="similar to AA sequence:UniProt:Q5AAG7"
                     /codon_start=1
                     /transl_table=12
                     /product="aminotransferase, putative"
                     /protein_id="XP_002421619.1"
                     /db_xref="GeneID:8049698"
                     /db_xref="GOA:B9WKK8"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:B9WKK8"
                     /translation="MVKQEDFAVEQFMDKFETEIEWNMAETCTASLSFNELFQLIPDK
                     SVSEPLQQKLFDTKLTYGHIKGSPELKQAVAQLYNDEGGSITTSDIVITNGAIGANFL
                     TLYALVDHGDKVVVVNPTYQQLASVARVFSGAPENIISWNLNFEDNYLPNLDELQNLV
                     DVHEPKLLIINNPNNPTGAVWGHLIMDKIVKICSTKGIYILCDEVYRPLYHSTDDKPK
                     SIVNYNYEKTVSTSSTSKAFSLAGLRLGWVVTKDQDVIQKLYSKRDYNTISVSTIDDM
                     LATVALTNYKHILARSYNICETNLKILEAYIESTPLLSWVKPKGGSTCFVKVNIDNID
                     TMEMCVELVEKYKILVVPGEVFDNRKGYLRIGFGNSTQDIKQGLIRLSEYFKSKGY"
     gene            <35270..>37357
                     /locus_tag="CD36_25160"
                     /db_xref="GeneID:8050033"
     mRNA            <35270..>37357
                     /locus_tag="CD36_25160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421575.1"
                     /db_xref="GeneID:8050033"
     CDS             35270..37357
                     /locus_tag="CD36_25160"
                     /inference="similar to AA sequence:UniProt:Q5AAG8"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421620.1"
                     /db_xref="GeneID:8050033"
                     /db_xref="GOA:B9WKK9"
                     /db_xref="InterPro:IPR008967"
                     /db_xref="InterPro:IPR024061"
                     /db_xref="UniProtKB/TrEMBL:B9WKK9"
                     /translation="MDSNKEKIEDLASLFLPDLLHPSTVNSSPSTSTSPRATKSDDYD
                     MGSIFLKDSKLNNPNTGLPSSFQEFLSNNNFINRSNDIEEERPQQQQQQQPQQYSHHY
                     SGYMPFEMNPSASQHVLNYNPGMQQMFQQPNIASQQNFLSSSIPGQQQQQSQMTSNFP
                     RTNSYYGKYPGDYDEWFASTNSSITNLNGLYQQQLLQSQMLQQPQPMPQPQRGEIKDT
                     QIDSKSGSSTPKRKKTKSRKRDIKNLEVQIDYKPSKLKRLLDLKQSGATSSNDYKIID
                     KNNNEVTIDLNGFLNGRFLTNDIDNNNYIFMQNELQRGEDGFAKAAVNKKENPKVVSC
                     YRRNYIQISVNMNIRGFKDDSKLLKLQTSEYGYTTTRVIKYFKIEVSAAADILNSKGV
                     PIIIKNENKDIEREKEKEARRISLQSNYEYKADTVSPTYINTSEHVIILNDEPISNGC
                     IDKYFVVKKLQFKNATPNNGNLNFQNYYHLKAKLSCIVADIYYDDYDIDMANDGGGGS
                     NNNEILLAELVSEPIIVRGRNPSFYAERNDILIKGRSASSKSSFKIAAQSSELKLTAS
                     VEADEDEDEEFIVEHEDEQEEEDDHHNHSGGDQEDQIQANNHNGTGESPISSGDDDNT
                     QMAPLSYSTNQSALDVKSVDKYKYYPINSVYYLPPINVVYFPHRAHQSQKDDQEQTSI
                     VQENRKSSNVYFK"
     gene            complement(<37579..>38805)
                     /locus_tag="CD36_25170"
                     /db_xref="GeneID:8050034"
     mRNA            complement(<37579..>38805)
                     /locus_tag="CD36_25170"
                     /product="3-ketoacyl-CoA thiolase A, peroxisomal
                     precursor, putative"
                     /transcript_id="XM_002421576.1"
                     /db_xref="GeneID:8050034"
     CDS             complement(37579..38805)
                     /locus_tag="CD36_25170"
                     /EC_number="2.3.1.16"
                     /inference="similar to AA sequence:UniProt:P27796"
                     /inference="similar to AA sequence:UniProt:P33290"
                     /note="Similar to S. cerevisiae POT1; acetyl-coA
                     acyltransferase, putative; beta ketothiolase, putative;
                     peroxisomal 3-oxoacyl CoA thiolase, putative; thiolase IA,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="3-ketoacyl-CoA thiolase A, peroxisomal
                     precursor, putative"
                     /protein_id="XP_002421621.1"
                     /db_xref="GeneID:8050034"
                     /db_xref="GOA:B9WKL0"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020610"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020615"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:B9WKL0"
                     /translation="MDRLNQLSGQLKPTSKQSLTQKNPDDVVIVAAYRTAIGKGFKGS
                     FKSVQSEFILTEFLKEFIKKTGVDASLIEDVAIGNVLNQAAGATEHRGASLAAGIPYT
                     AAFLAINRLCSSGLMAISDIANKIKTGEIECGLAGGIESMSKNYGSPKVVPKIDPHLA
                     DDEQMGKCLIPMGITNENVANEFNIPREKQDAFAAKSYSKAEKAVSSGAFKDEILPIR
                     SIIRSPDGSEKEIIVDTDEGPRKGVDAASLSKLKPAFGGTTTAGNASQISDGAAGVLL
                     MKRSLAEAKGYPIVAKYIACSTVGVPPEIMGVGPAYAIPEMLKRTGLTVDDVDVFEIN
                     EAFAAQCLYSAEQCNVPEEKLNINGGAIALGHPLGCTGARQYATILRLLKPGEIGLTS
                     MCIGSGMGAASILIKE"
     gene            complement(<39429..>39869)
                     /locus_tag="CD36_25180"
                     /db_xref="GeneID:8050035"
     mRNA            complement(<39429..>39869)
                     /locus_tag="CD36_25180"
                     /product="3-ketoacyl-coa thiolase, putative"
                     /transcript_id="XM_002421577.1"
                     /db_xref="GeneID:8050035"
     CDS             complement(39429..39869)
                     /locus_tag="CD36_25180"
                     /inference="similar to AA sequence:UniProt:Q9Y735"
                     /codon_start=1
                     /transl_table=12
                     /product="3-ketoacyl-coa thiolase, putative"
                     /protein_id="XP_002421622.1"
                     /db_xref="GeneID:8050035"
                     /db_xref="UniProtKB/TrEMBL:B9WKL1"
                     /translation="MEVATSHPRTKVQTIAKQVTFQFANECDLEIHCSPFGLSGLYIK
                     INGTDIMGIGSTMGLITGSTRGLIHYNDSNDLVDQKYKLYVVIDDDDMLRIDFTKIYT
                     DASNENNEKQVQEVPTLIFRGKCPEGRPDNIEPFIGIFSFERET"
     gene            <40229..>41971
                     /locus_tag="CD36_25190"
                     /db_xref="GeneID:8050036"
     mRNA            <40229..>41971
                     /locus_tag="CD36_25190"
                     /product="transcription factor with zinc cluster
                     DNA-binding motif, putative"
                     /transcript_id="XM_002421578.1"
                     /db_xref="GeneID:8050036"
     CDS             40229..41971
                     /locus_tag="CD36_25190"
                     /inference="similar to AA sequence:UniProt:Q5AAH1"
                     /note="Similar to C. albicans ZCF38;
                     see SGD entry for orf19.7518 for info on gene and product
                     names; transcriptional regulator of nitrate assimilation,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="transcription factor with zinc cluster
                     DNA-binding motif, putative"
                     /protein_id="XP_002421623.1"
                     /db_xref="GeneID:8050036"
                     /db_xref="GOA:B9WKL2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:B9WKL2"
                     /translation="MSSTTPRASVACNLCRSSKIKCINNSDSTRCHRCASLDLECTYT
                     LKTSQLKKRKLTKEFASKTSPKSTVFLPDKKLIIETAEIFFENQYKGIFPLFHKPSFF
                     QFLRSKEFDPSTYIQDYRPRKNIPDPVVLLAILALCARLHPEMPKIFGEFDESEAESF
                     FPSFNSVAAPGFASNASKYFGWHARKLLRFDEPSIERVQALCILSSHEWGEGNASRSY
                     MYVGIAARMALILGLDDEPKPETGLSETENFIRMEMKRRAMWSVYMMDRCNSSGRSSH
                     TCISLDEIKVRLPCNEKEFIFGVGKQQPFRNGELVGLSLCGYQIVLFETWREISRWVG
                     VTGAKLEKIPPWESTSPYYLLSKKLDEFEEKLPAELKFNEFNLQAHIAGGSASDFAYF
                     SGLLLLCRVFLNREYFYASPEASPPGWWKQQATVLFDALDKLDQIPKLLKPLNLMVIA
                     PFTGFHVFSTASTCLYIAAYPKKVMKTHFNGDVIKKYQRMAQDNLETLFSWSDSWGLG
                     KSWINTLKEMKEVFARSTDYDQLRFKMRDYGNIEKKPDISNLLVLDEAPILDFMNNLD
                     LPNIFPDWNDAMNI"
     gene            complement(<41958..>43319)
                     /gene="CHT1"
                     /locus_tag="CD36_25200"
                     /db_xref="GeneID:8050037"
     mRNA            complement(<41958..>43319)
                     /gene="CHT1"
                     /locus_tag="CD36_25200"
                     /product="chitinase precursor, putative"
                     /transcript_id="XM_002421579.1"
                     /db_xref="GeneID:8050037"
     CDS             complement(41958..43319)
                     /gene="CHT1"
                     /locus_tag="CD36_25200"
                     /EC_number="3.2.1.14"
                     /inference="similar to AA sequence:UniProt:P29029"
                     /inference="similar to AA sequence:UniProt:P40953"
                     /inference="similar to AA sequence:UniProt:P46876"
                     /codon_start=1
                     /transl_table=12
                     /product="chitinase precursor, putative"
                     /protein_id="XP_002421624.1"
                     /db_xref="GeneID:8050037"
                     /db_xref="GOA:B9WKL3"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:B9WKL3"
                     /translation="MIPNIIILLAISIVASASNIAAYWGQNAGGNQQSLGDYCSSSPA
                     SIIILSFLDGFPNLSLNFANQCSETFSSGLAHCSQIGSDIKSCQQQGKTVLLSLGGAT
                     GNYGFSSDSEAVQFAGTLWNKFGGGKDSERPFDDAIVDGFDFDIENKDQTGYAALATQ
                     LRKYFGTGSKSYYLSAAPQCPYPDESVGDLMSQVDLDFAFIQFYNNYCSLNKQFNWNS
                     WSNYARGKNIKLYLGLPGSSSSAGSGFVGLSTVQNAVASIKGDVNFGGISVWDISSAE
                     NSGYLNQLHQALSGSGSSVAPSNSYNPYQSYNPNTQLTTTYGGSTATASAYVSVGFTA
                     GATHRSTTTNGLFAWIDSLFGSSPTSQSSVVQQAAATATPKPTASAFDWFGWFDGTTT
                     STTLQTVYSTVPADQTVYMTLTTTVGSQSLFNKRDVVAEAKSTNLQICWLLFIPLIAL
                     ICS"
     gene            <44208..>47090
                     /locus_tag="CD36_25210"
                     /db_xref="GeneID:8049680"
     mRNA            <44208..>47090
                     /locus_tag="CD36_25210"
                     /product="beta-n-acetylglucosaminidase, putative"
                     /transcript_id="XM_002421580.1"
                     /db_xref="GeneID:8049680"
     CDS             44208..47090
                     /locus_tag="CD36_25210"
                     /inference="similar to AA sequence:UniProt:Q4WCK9"
                     /inference="similar to AA sequence:UniProt:Q5AAH4"
                     /codon_start=1
                     /transl_table=12
                     /product="beta-n-acetylglucosaminidase, putative"
                     /protein_id="XP_002421625.1"
                     /db_xref="GeneID:8049680"
                     /db_xref="GOA:B9WKL4"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:B9WKL4"
                     /translation="MSTFYAGQLLCGGFQGTTVTPQAYHLIVEHHVSAMILSRKNAIN
                     VEQMSKLIKDLQYIAMTEGRYTYPIMFAIDEEGGMMNSLFDPDFLTQYPGAMALAATG
                     DPQLVYEISRAIATEIKKIGFSIILGPVLDVVTKLSHQLVGVRSFGTTIEDVVKYGRM
                     CARGLQDGGLFTVGKHFPGIGNAAVDSLLELPMMGDSLEQLKHFNVVPFGELINEGLL
                     DGISAAGCGVPNISPDETHACLSPIVINQLLRQELRFDGFVISECLEMEALYHSVGLG
                     QGVILAINAGCDLVMVCHDMALQNEATDSIKKAVVNGNLDEETLIKSLKRIKKLQTRL
                     PSWAQIFPEGEVSAKLPPTLFKNEYPVLWEQHQQLSSLAYRKSITLIRDFDGTLPIAK
                     HLSARGGNQVDSILLLTPLLNPIYPCKKTDTTERLFTGEEVFQKFGDFLSNHPINKTK
                     SYNVLHTTYTANGLTPLHESLIERSKIVIFLTSEAGRNMYQIGIVKYVSILCGVNPQT
                     LTKGLGPVQPRKPLIIVATSSPYDFFYNKSIGSAYLCCYDYTDNALENLASVLMGDFE
                     AEGCVPGEKKFLTKHKKSVAEGRTKNIHSSAHQPKRRWLVDEFSMERDWQGLVKLLRT
                     NNDQLTNDGFYKRLDGLLSSTSKHQKHFVVRNSSLNILYGIVLTWVDESKCGHLAYIL
                     VEKSKRLQSIGKNLHVRAVRYLIKERKCNEIVLGSSFPLISLGGNISKPFFEGVGWNI
                     QASADKNVMVLPNVDSWSVPKNILQEIMIVGVRFDICSDTSKLRKMMERCCQSESYDA
                     REYKNIKSLYNEAEKYLKINSPYEVKIILALEPTSQSVIGSIVIFTSNSQLSKFYPFI
                     DEFAEKNDPSENRSVVGGIAGPIIDPSYSNLTEIFKYGLICSAITFLKTSLSEEPMQC
                     CIMTDVSTEDKAMRGVKEIGFEVWKSYHDDYGYNDVSSNVENKFGM"
     gene            <48333..>49994
                     /gene="PCK1"
                     /locus_tag="CD36_25230"
                     /db_xref="GeneID:8050038"
     mRNA            <48333..>49994
                     /gene="PCK1"
                     /locus_tag="CD36_25230"
                     /product="phosphoenolpyruvate carboxykinase, putative"
                     /transcript_id="XM_002421581.1"
                     /db_xref="GeneID:8050038"
     CDS             48333..49994
                     /gene="PCK1"
                     /locus_tag="CD36_25230"
                     /EC_number="4.1.1.49"
                     /inference="similar to AA sequence:UniProt:O13434"
                     /inference="similar to AA sequence:UniProt:P10963"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphoenolpyruvate carboxykinase, putative"
                     /protein_id="XP_002421626.1"
                     /db_xref="GeneID:8050038"
                     /db_xref="GOA:B9WKL5"
                     /db_xref="InterPro:IPR001272"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="InterPro:IPR013035"
                     /db_xref="InterPro:IPR015994"
                     /db_xref="UniProtKB/TrEMBL:B9WKL5"
                     /translation="MAPPTAVESSINFEGHPTIKSTQDPLVQKLSLNTDTVIRHNAPP
                     PTLYEDGLLEKGTTISSTGALMAYSGNKTGRSPKDKRIVDESTSSHNIWWGPVNKQVD
                     ELTWKISRSRALDYLRTREKLFVVDAYAGWDPRYRIKVRIICARAYHALFMTNMLIRP
                     TEEELKNFGEPDFTIYNAGQFPANIHTKGMTSATSVEINFKDMEMVILGTEYAGEMKK
                     GIFTVMFYLMPIKHKVLTLHSSCNQGVEKGDITLFFGLSGTGKTTLSADPHRKLIGDD
                     EHCWSDNGVFNIEGGCYAKCLDLSAEKEPEIFNSIKFGAILENVVYDPITKVVDYEDS
                     SITENTRCAYPIDFIPSAKIPCLADTHPTNIILLTCDASGVLPPVSKLTNAQVMYHFI
                     SGYTSKMAGTEEGVTEPQATFSACFGQPFLVLHPMKYAQQLSDKISEHNANAWLLNTG
                     WVGSSVARGGKRCPLKYTRAILDAIHSGELSKVEYEKVPVFNFNVPKSCPGVPSDILN
                     PTKAWTQGADSFDKEIKSLASKFAENFKTYADQATEEVKAAGPEA"
     gene            <51063..>52646
                     /gene="CYP52A14"
                     /locus_tag="CD36_25250"
                     /db_xref="GeneID:8049703"
     mRNA            <51063..>52646
                     /gene="CYP52A14"
                     /locus_tag="CD36_25250"
                     /product="cyp52a14 (cytochrome p450), putative"
                     /transcript_id="XM_002421582.1"
                     /db_xref="GeneID:8049703"
     CDS             51063..52646
                     /gene="CYP52A14"
                     /locus_tag="CD36_25250"
                     /inference="similar to AA sequence:UniProt:Q5AAH6"
                     /inference="similar to AA sequence:UniProt:Q874J3"
                     /note="multi-gene family in Candida sp.;
                     possibly fungus-conserved"
                     /codon_start=1
                     /transl_table=12
                     /product="cyp52a14 (cytochrome p450), putative"
                     /protein_id="XP_002421627.1"
                     /db_xref="GeneID:8049703"
                     /db_xref="GOA:B9WKL6"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002402"
                     /db_xref="InterPro:IPR002974"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:B9WKL6"
                     /translation="MTVSTLEIQDIIQQYITKWYVIIPTLFVVYQVVDFLYVRSLRSR
                     FGAKAPTNNESDGYWGFHLPFLLVSKKAEGTIIDFAGERFKNITHPEVPTFQFPIFTV
                     KVISTVDPENIKAVLATQFNDFSLGTRHNQFAPLLGDGIFTLDGAGWKHSRSMLRPQF
                     AREQVAHVKALEPHMQVFFKHVRKSGGRTFDIQELFFRLTVDSATEFLFGESVESLRD
                     ESIGMALEAVDFDGKKEFAQAFNFSQNYLASRAVMQQMYWLLNSSEFQSCNTKVHKFA
                     EYYVNKALELSPESLEKQQGYVFLYELVKQTRDTKVLRDQLLNILVAGRDTTAGLLSF
                     VFFELARNPRVFAKLREEIEQKFGVGEDSRVEEISFESLKSCEYLKAVLNECLRLYPS
                     VPQNFRVATKNTTLPRGGGPDGLSPILVRQGQTVMYSVYVTHRDTKVYGKDANEFRPE
                     RWFEPETRKLGWSFVPFNGGPRICLGQQFALTEASYVTVRLLQEFGHLTMDPNTQYPP
                     KKMSHLTMSLFDGTNVEMY"
     gene            <53587..>55203
                     /gene="ALK3-A"
                     /locus_tag="CD36_25260"
                     /db_xref="GeneID:8049683"
     mRNA            <53587..>55203
                     /gene="ALK3-A"
                     /locus_tag="CD36_25260"
                     /product="N-alkane inducible cytochrome P-450, putative"
                     /transcript_id="XM_002421583.1"
                     /db_xref="GeneID:8049683"
     CDS             53587..55203
                     /gene="ALK3-A"
                     /locus_tag="CD36_25260"
                     /inference="similar to AA sequence:UniProt:Q12582"
                     /inference="similar to AA sequence:UniProt:Q5AAH7"
                     /note="multi-gene family in Candida sp.;
                     possibly fungus-conserved"
                     /codon_start=1
                     /transl_table=12
                     /product="N-alkane inducible cytochrome P-450, putative"
                     /protein_id="XP_002421628.1"
                     /db_xref="GeneID:8049683"
                     /db_xref="GOA:B9WKL7"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002402"
                     /db_xref="InterPro:IPR002974"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:B9WKL7"
                     /translation="MSPSLVHQILAIAHPYVEYLQANFTKWYILVPGILIALNVLTFL
                     YTKYLEYKFNAKPVTNFIQDYTFGVLTPLILIYYKSQGTVMEFANNLWGNRFFIKNAD
                     VGTGELRIFGMHLIETKDPENIKAILATQFNDFSLGTRHGFLYSLLGDGIFTLDGAGW
                     KHSRSMLRPQFAREQVSHVKILEPHMQVFFKHVRKNKGKAFDIQELFFRLTVDSSTEF
                     LFGSSVESLRDETIGMSPSVKNLAGRDEFAEAFNYSQTINAYRFLLQQFYWLCNGSKF
                     RKSIATVHKFSDFYVQRALSLSKAELDDQKGYVFLYELAKQTRDPKVLRDQLLNILVA
                     GRDTTAGLLSFVFFELARNPTVYAKLKEEIYNKFGSGEDARIDEITFESLKQCEYLKA
                     VINESLRLYPSVPHNFRTATRNTTLPRGGGPDGMSPIVVKKGQSVMYTVLATHRDTKT
                     YGADANDFRPERWFEPETRKLGWAYVPFNGGPRICLGQQFALTEASYVTVRLLQEFGH
                     LTMDPETCYPPKLMNSLTLSLLEGANVEMY"
     gene            <55389..>60938
                     /locus_tag="CD36_25270"
                     /db_xref="GeneID:8049671"
     mRNA            <55389..>60938
                     /locus_tag="CD36_25270"
                     /product="nuclear pore protein, putative"
                     /transcript_id="XM_002421584.1"
                     /db_xref="GeneID:8049671"
     CDS             55389..60938
                     /locus_tag="CD36_25270"
                     /inference="similar to AA sequence:UniProt:P47054"
                     /inference="similar to AA sequence:UniProt:Q5AAH8"
                     /note="Similar to S. cerevisiae NUP192; nucleoporin,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="nuclear pore protein, putative"
                     /protein_id="XP_002421629.1"
                     /db_xref="GeneID:8049671"
                     /db_xref="GOA:B9WKL8"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR021827"
                     /db_xref="UniProtKB/TrEMBL:B9WKL8"
                     /translation="MSGKFNWSSDVFADIYNTLKFETNIDLDTIDFTNIKNDLANVLI
                     TPLPSDQSRSKLGDASKPVALPCGDEVKLNQASIEITGVLSNELDLDELNTAELLYNA
                     SDLSYKKGTSIGDSARLAYYLRAHYILNIVGFLVSQKRLDIITNDHQVLFDNVLKSFS
                     RIYTLSGKLNDMIDKQKVTGDINSLAFINCINYSRSQLFNAHELLGQVVFGLVDNYYE
                     SFGTLSNYKSLVEFISKNISDEDIFVIHFLPLTLQLFKKLLQLGDETSVDQFYKTITS
                     SISKDYETNNFSKSEDIDLSKSKLSGFEIVTSFIFLTEFIPWCKQSSSRTAKYDFKDD
                     ILKYMELLISYGVMERLLSYCSETSNVKTQQAYDWSNMYDFRALLQKNFPRLTPAKFH
                     YPGSQELSSVVRPGYENVSKLVDISFLTLDPSLNETLVSPFFQSFFSVFISNAAVVMT
                     SLRDSEEDFVLSALNASDEEEEEEKEESDNEEDSTTPRDKEKLSGLDLDKIAQRAELE
                     RFYLAFAYTYNNRSELCALFWGDERVTNDIIGFISWGLANNTSPLITATFCMLLGTLA
                     SAGGDASSRIWEILVHNNNNTGMKKNDFSKISVDSLYDSLKYYIDSLNESFEQDLNDQ
                     LMLSQKKQDFLFSATTSKQDLDDSGENRIVIELAEDSLVFISGFIQLLSAIVKNLNTK
                     NERSKEIKSVIYARFSPIIKGFLKFDNLINGSRFLQVDANIQSSNNPKFIDLPNVYVS
                     DDSRIILTNLILTFLGDFVDNDSDPYIRYEIWRLVDRWMYQGLYSLAEDKKDDAFRHI
                     KRKYISKKNVPVNQAFTTNLTHLSQIGNFAVLVKKLLTPFEDSNEAFTKYSLLYPCDL
                     GLGYRFNNQLGIWPYIEFLMQNVFANSSTIASKRDRFNLQVNLLELFSNALDEIDWKF
                     LIDVAPKIIRDLKNFNGVFDSLIPGVQLDFEVFVKLHHSVAVMNYLFESKTFTALFGL
                     VNIGVDSINESSESAELVSRSLCVINSLLKVQNSFINKLLPILRNKDTQQQLHRGTTI
                     GIGTSMSLALATPRTIFDCIYYPKNLGTHGVADFYEVILFHLPAVVQFALYVSCENPI
                     STKALSILKGVSQSKFFVTTVSSSADPLLNNDRLITTFENIDESIKIKFAFIDKFEEL
                     EDSLNMKYEILDFILGNLDQFDGKAATIAHFLLGYKVKGDTLELVQSNDQITLLKSFL
                     NTLSISLDLISEIDYNNGNNHIIDVGPAKLSSMILQILIKLCQDPISSSITLNQLREY
                     EQLFEKLVNCQPKLDLNTVWCGNQFNGDLQIDASNVFVDNQPSTQAFFSFISQRNLIL
                     QYLSLEFHSVKSRTKREYYSKVLTNDKEFVNRTPKVLTFLNILNYSFKNFEVQKYEWL
                     DRKFNMSLILEEVNAQKNGTLDFSVLTKAFRLLCQTSNLITPESKQLFAEEIMVEGSK
                     ISDFVTKYSVSTDLKDVQLKCLHSWCQLIEILVTDSGINSSNFILEVLQVIIPKINDY
                     FDVDISFSEEMVSLCVLLFDLYDQSTLTNRKGEEFALGIERLIPLFQTCIAGILNSNS
                     TPGLRSDLYVVGNKFLLKCFERESFLKQMMLIIKSVDKKFFQVICNDAIYSEGPSRIT
                     STLFLESLVHLGTLVKVDFILNAVIKNNALSLLVRSVKRTDAMIKLCQEKNSGVTLEH
                     FVFDLMAFKATLYFFARVAKSKNGALQLIQNELFSILNSSKFLQIDPDIGLSLQIEEV
                     QDHKTVNVNVLLDTPLSITDLVDPYKLRNENNISYFEFLVPIFQLLTTVLLSMGPNYQ
                     PAIIQTKELMKSVNRLVVGVMKRDFLVETKQIGKGLYKEESHELASLKELVKLFILID
                     SLANYSV"
     gene            <61036..>61337
                     /locus_tag="CD36_25280"
                     /db_xref="GeneID:8050039"
     mRNA            join(<61036..61255,61315..>61337)
                     /locus_tag="CD36_25280"
                     /product="U6 snRNA-associated Sm-like protein Lsm6,
                     putative"
                     /transcript_id="XM_002421585.1"
                     /db_xref="GeneID:8050039"
     CDS             join(61036..61255,61315..61337)
                     /locus_tag="CD36_25280"
                     /inference="similar to AA sequence:UniProt:P62312"
                     /inference="similar to AA sequence:UniProt:Q06406"
                     /inference="similar to AA sequence:UniProt:Q6BR90"
                     /note="Similar to S. cerevisiae LSM6;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="U6 snRNA-associated Sm-like protein Lsm6,
                     putative"
                     /protein_id="XP_002421630.1"
                     /db_xref="GeneID:8050039"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:B9WKL9"
                     /translation="MADTIEFEKTDPSKFLSGIIGSSVSVKLHNGVEYKGNLQTIDGF
                     MNVVLDEGIETVNGKVTKEYGDVFIRGNNVLYISEA"
     gene            <61552..>61917
                     /locus_tag="CD36_25290"
                     /db_xref="GeneID:8050040"
     mRNA            join(<61552..61614,61672..>61917)
                     /locus_tag="CD36_25290"
                     /product="ATP synthase f chain, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_002421586.1"
                     /db_xref="GeneID:8050040"
     CDS             join(61552..61614,61672..61917)
                     /locus_tag="CD36_25290"
                     /EC_number="3.6.3.14"
                     /inference="similar to AA sequence:UniProt:Q06405"
                     /inference="similar to AA sequence:UniProt:Q6BR89"
                     /note="Similar to S. cerevisiae ATP17;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP synthase f chain, mitochondrial precursor,
                     putative"
                     /protein_id="XP_002421631.1"
                     /db_xref="GeneID:8050040"
                     /db_xref="GOA:B9WKM0"
                     /db_xref="InterPro:IPR019727"
                     /db_xref="UniProtKB/TrEMBL:B9WKM0"
                     /translation="MSFVIRRQLSTLIPPKIASAKNLGSNPNAKRMAEVVKFYNKLPQ
                     GPAPAAKKSNNPFARYRAAYFDGDNASGKPLVHLAIAIVIFGYSLEYQHLKHAQHEGH
                     "
     gene            <62490..>66122
                     /locus_tag="CD36_25300"
                     /db_xref="GeneID:8050041"
     mRNA            <62490..>66122
                     /locus_tag="CD36_25300"
                     /product="protein kinase Kin1 homologue, putative"
                     /transcript_id="XM_002421587.1"
                     /db_xref="GeneID:8050041"
     CDS             62490..66122
                     /locus_tag="CD36_25300"
                     /EC_number="2.7.11.1"
                     /inference="similar to AA sequence:UniProt:P13185"
                     /inference="similar to AA sequence:UniProt:P13186"
                     /inference="similar to AA sequence:UniProt:Q5AAI1"
                     /note="Similar to S. cerevisiae KIN1"
                     /codon_start=1
                     /transl_table=12
                     /product="protein kinase Kin1 homologue, putative"
                     /protein_id="XP_002421632.1"
                     /db_xref="GeneID:8050041"
                     /db_xref="GOA:B9WKM1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001772"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:B9WKM1"
                     /translation="MNHQDPDLQYHNKKAYPPNLSSIAPPPQQPLSGRPATPRMLRSI
                     SGTLKSRTELSNSDRSQELNNETKSSNSPHYVVDTHNRQPEPESLRPNIQAPTAVHGS
                     QQKGSLLPPPSIPNPANMKPAPTPTGVDQPPAKQKPVPAPKHPQPPPQQQPQQQQQQQ
                     FHRKSIGDWNFVKTIGAGSMGKVKLAQHNATHEICAVKIIPRAAKLYQRAHANDPPPQ
                     TTQEAAQRHKEFEKEVARDRRTIREGALGRLLYHPFICRLYEMVPMTNHYYMLFEYIE
                     GGQMLDYIVAHGSLKERHARKFARGIASALDYCHRNNVVHRDLKIENIMINEKGDIKI
                     IDFGLSNLYAPKNLLKTYCGSLYFAAPELLSAKPYIGPEVDVWSFGVVLYVLVCGKVP
                     FDDQSVSVLHEKIKKGNVEYPAFLSRECVSLLARMLVVDPTKRASLYEVCSHPWMNKG
                     YDYKVNNYLPKREPLRLPLDPEIIKTIANFELGTAQGVADELTSILTSVEYQMSCENW
                     YKITESGREYASSQNAQILPDPTGGFHPLVSIYYLVDEMRKRKKAKEEALKAQRRAQV
                     PTIAVPTPKQQQQQQQQQPPPDTSQPLPERKPAPHEEITNSAVATQAQANTNAPKIVE
                     TFSETPQRTLDPSKQSVDEKPSAPAPSIAVPEQAHTSSVPSSFVKTQTSIDEDQLSIP
                     EQQSPRTSTPQTLDPAKAVGGSSGSAISAPNAGTGAGFNSLLRRLSSKKYKGASSPKR
                     STSPSPNVESLSPQPTKTDPMVRRGVSMKVTAKEKQTNTRPTKSELIKKKPQHGRSSS
                     TSNKMQGFIPVEYLPPLPTIDTNTNTIVSESAKQENLAVPSSSRNMHPTARAKSVGGG
                     HMRKDSYGRAPHGSQNPLPPLPISMATQNSQEVVGKDTNEGFFDDVELDDVGYQQVPQ
                     LTESEIIEQYNLSKPNSMPSIEHCKTLFLKGFFSVQTTSAKPLPVIRYNIINVLSKLG
                     VRFQEVKGGFVCMHTPSVQPNHGNELDEENKLYGDAFKSKSSDSFEAVEAEGSKTPSR
                     QPSFQMSSHAPTTPSGPKSHRSSNSIGSISGNVPRRKFSIGNAFNTYRKKNGSQVMMP
                     PNTPATAKVIHGLYDDDGKERNGDEDDDVGDDEYGYDDSADSLNGYGGGSDMLISSRI
                     EQRAKHQRTVSSSSQKASKSPLKFEIHIVKVPLVGLYGVQFKKIMGNTWNYKTLASQI
                     LNEMNL"
     gene            complement(<66145..>66477)
                     /locus_tag="CD36_25310"
                     /db_xref="GeneID:8050042"
     mRNA            complement(<66145..>66477)
                     /locus_tag="CD36_25310"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421588.1"
                     /db_xref="GeneID:8050042"
     CDS             complement(66145..66477)
                     /locus_tag="CD36_25310"
                     /inference="similar to AA sequence:UniProt:Q5AAI2"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421633.1"
                     /db_xref="GeneID:8050042"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:B9WKM2"
                     /translation="MMNSAPPPYYMVSFTSKLNLDVVNDEYAQMADLMVSLAKQQPGF
                     LGLESTRDPASKIGITISYWKDKTSILQWKQQHDHQLAQELGKSKFYDYFTVRVALVE
                     RDYRFENV"
     gene            complement(<66544..>67782)
                     /locus_tag="CD36_25320"
                     /db_xref="GeneID:8050043"
     mRNA            complement(<66544..>67782)
                     /locus_tag="CD36_25320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421589.1"
                     /db_xref="GeneID:8050043"
     CDS             complement(66544..67782)
                     /locus_tag="CD36_25320"
                     /inference="similar to AA sequence:UniProt:Q5AAI3"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421634.1"
                     /db_xref="GeneID:8050043"
                     /db_xref="UniProtKB/TrEMBL:B9WKM3"
                     /translation="MVSRSHSSTPVPIDDNHPIHSLTIGNHDQITLLSKQTPIFLLNQ
                     QEENGFQTPELVALRNSTQYVYVINWLYNYRGYLKLQSEFFDVDLFELELLGFFNAFD
                     LSSLFINRLKLALTTTVQNSKLVELEDFEFVFRSHFGNDTPLGGQIDNEQDLPKFDLL
                     NITDKFEILYILINYISKYSKFRDWLEKQGLTIRIDPLFTRPSAHESIEYFSLFDDNR
                     LYKRTITYYPLTIPKKRKLSPESPQDFFEAKVFDIKDVKFELVYKNIYEFNEYLGKIK
                     KSSAHKLLYSKLAGKSSTIIDSIFDNEVKKRKYLTNKRKEIQMVNLLAVRKRSSRLEA
                     KERQRQEELERQREQESKYAAERRFERRMKLRNTENIDTGRLSRDQRMQLRQLHYEST
                     PETESNQTPETEQPEVIVLD"
     gene            <70726..>71700
                     /locus_tag="CD36_25330"
                     /db_xref="GeneID:8050044"
     mRNA            <70726..>71700
                     /locus_tag="CD36_25330"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421590.1"
                     /db_xref="GeneID:8050044"
     CDS             70726..71700
                     /locus_tag="CD36_25330"
                     /inference="similar to AA sequence:UniProt:Q5AAI5"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421635.1"
                     /db_xref="GeneID:8050044"
                     /db_xref="UniProtKB/TrEMBL:B9WKM4"
                     /translation="MVNNLTSGIAATSFKHNHHQQHQHQHQHQHQHQHQHPTSPPPAI
                     SITTNSPRIPTHSPISPPSANNTHNNNSSAGSSGGFPFSSTVISPRNSITSFSNPTKQ
                     LRANSNDNGNVNGRRVSNSNYSITSTPTSSNNRYSFSEYSNEQIIDLMEREQDAIVLK
                     LMKEIEFLKQENKMLRSTPTPGGNSATSNTCSPSNSISSPSTPPIRRSSSLSSRRSSI
                     TANNINSTTFGAGINESSRTGNCGGSTTAMSAPIFNYPFRDCTSTINSGGNFDEIRKK
                     QKSEMTSSIYIARKPSINGRYEEIIDENRNLKRQLKKLQGELELLKKK"
     gene            <72070..>73230
                     /locus_tag="CD36_25340"
                     /db_xref="GeneID:8050045"
     mRNA            <72070..>73230
                     /locus_tag="CD36_25340"
                     /product="chitin deacetylase 2 precursor, putative"
                     /transcript_id="XM_002421591.1"
                     /db_xref="GeneID:8050045"
     CDS             72070..73230
                     /locus_tag="CD36_25340"
                     /EC_number="3.5.1.41"
                     /inference="similar to AA sequence:UniProt:Q06703"
                     /inference="similar to AA sequence:UniProt:Q5AAI6"
                     /note="Similar to S. cerevisiae CDA2"
                     /codon_start=1
                     /transl_table=12
                     /product="chitin deacetylase 2 precursor, putative"
                     /protein_id="XP_002421636.1"
                     /db_xref="GeneID:8050045"
                     /db_xref="GOA:B9WKM5"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="UniProtKB/TrEMBL:B9WKM5"
                     /translation="MISWLGFYIMILIPSIINGSDLSLRLQSKFMPTSFSPRNIFDTH
                     NNPTINTINNNKEDQSGSGGGSGGRGGGLPPSPMQFPPKLPFPKWLSDFTGLHEWPDL
                     DPPYIPLDFIDFNKIVNIPIHKQGQCHDTNIKTKTNTNNNNNNNQSPLSILRTPKACS
                     FDCFNCVEIDDVYTCPKLSQTFDDGPSMATLKLLQSFNQTGLKTTLFTLGVNIVRFPE
                     IYQQCHLLGHIMGSHTWSHKFLPSLTNQEIISQIEWSIWAMNATSNHLPKWFRPPYGG
                     IDNRIRSILRQFGMQAVLWDFDTFDWKMLGGDSSGGTTSSNNNRRKEEDVFSEVEKFK
                     LMKNNKGLILHHDAIQKTVDVGIMIHEKLLNHDQLTVPLCVGGIDYIKTFPK"
     gene            complement(<74965..>75741)
                     /locus_tag="CD36_25350"
                     /db_xref="GeneID:8050046"
     mRNA            complement(<74965..>75741)
                     /locus_tag="CD36_25350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421592.1"
                     /db_xref="GeneID:8050046"
     CDS             complement(74965..75741)
                     /locus_tag="CD36_25350"
                     /inference="similar to AA sequence:UniProt:Q5AAI7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421637.1"
                     /db_xref="GeneID:8050046"
                     /db_xref="UniProtKB/TrEMBL:B9WKM6"
                     /translation="MSDAVEKVKQAVKPQQHFKSITIEHVYHYSFIEYITQYLLSIQI
                     VNSIYKSFILPLIDVVNVNIFSVSPIFDVLSFIDQLINSGLVTFDKYFLEIPIQTLNS
                     FGKTYVTPIENKLINLNNKYLNTAIEVKTRSEGEFYKVVETIQEVLINLKNFTFNKSI
                     EIQQDLVATYNKELQSTDPKGNLIGKNLQASYNTASKTINKLNDDYLTPLKNQTQDYV
                     DQFASQTKQRADEFINDAKQKVSPKLNELKESAPIVSASA"
     gene            complement(<82112..>83497)
                     /locus_tag="CD36_25370"
                     /db_xref="GeneID:8050047"
     mRNA            complement(<82112..>83497)
                     /locus_tag="CD36_25370"
                     /product="nucleosome assembly protein, putative"
                     /transcript_id="XM_002421593.1"
                     /db_xref="GeneID:8050047"
     CDS             complement(82112..83497)
                     /locus_tag="CD36_25370"
                     /inference="similar to AA sequence:UniProt:P25293"
                     /inference="similar to AA sequence:UniProt:Q5AAI8"
                     /note="Similar to S. cerevisiae NAP1"
                     /codon_start=1
                     /transl_table=12
                     /product="nucleosome assembly protein, putative"
                     /protein_id="XP_002421638.1"
                     /db_xref="GeneID:8050047"
                     /db_xref="GOA:B9WKM7"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:B9WKM7"
                     /translation="MTEQPINTKKKNGDISKAPTPQNTPASVTNSYMRSKPPTVSTIQ
                     ESNNEDGTGTGTGVGVGAVTGGIANNPVLLSMIQGKLGDLVGKQSGYIDNLSKPVKNR
                     VYGLKSLQLNQMKLEAQFQKELLELEKKFFAKYQPLYVKRKQIINGELEPTVEEIEEG
                     QQLEEEEKGIDKEEGEGEGEEEEEEDQGGDDDDDDEKGIPGFWLTALENLSTVSETIT
                     DRDSEVLANLIDIRMEYLSTPGFQLIFEFKSNEFFENQILTKTYHYQAELGYSGDFVY
                     DHADGCEIRWKSKENNVTITIERRKQRNKTTKQTRTIEKLTPTESFFNFFDPPKPPKI
                     KSEGDDDDDNNNEDGLQDKQRENNGDDEGDEGDEEEDEELEARLELDYQLGEEIKDRL
                     IPRAIDWFTGDAVDFDYQDFEGEGDEDEFSDEDGEGDSDDDDDDDDEDDDDNDAATGN
                     QKQPPPECKQQ"
     mobile_element  83766..88860
                     /note="5' truncated near start of ORF1 and with segment of
                     ORF2 inverted (formerly LINE RC)"
                     /mobile_element_type="LINE:RB, Zorro3"
     gene            complement(<83885..>84328)
                     /locus_tag="CD36_25380"
                     /db_xref="GeneID:8050048"
     mRNA            complement(<83885..>84328)
                     /locus_tag="CD36_25380"
                     /product="polyprotein of l1-like non-ltr retrotransposon
                     zorro 3, putative"
                     /transcript_id="XM_002421594.1"
                     /db_xref="GeneID:8050048"
     CDS             complement(83885..84328)
                     /locus_tag="CD36_25380"
                     /inference="similar to AA sequence:UniProt:Q59KQ0"
                     /note="transposable element;
                     Similar to C. albicans POL92 polyprotein of L1-like
                     non-LTR retrotransposon Zorro 3"
                     /codon_start=1
                     /transl_table=12
                     /product="polyprotein of l1-like non-ltr retrotransposon
                     zorro 3, putative"
                     /protein_id="XP_002421639.1"
                     /db_xref="GeneID:8050048"
                     /db_xref="UniProtKB/TrEMBL:B9WKM8"
                     /translation="MKKSEIHFCQLCNTGTDSVVYYIFECGETKELWSKHFNSQRTPQ
                     FIIGNQHLNKKELIALNEYINEVVQKVKRRRKFTNLESWGEARCGRRNKYTCLAITTR
                     QLDFIRKLPIQCLQASSTLNIIHGGGVFKRTLHYEFFSFPLKKWP"
     gene            complement(<88022..>88420)
                     /locus_tag="CD36_25390"
                     /db_xref="GeneID:8050049"
     mRNA            complement(<88022..>88420)
                     /locus_tag="CD36_25390"
                     /product="non-ltr retrotransposon zorro 3 orf1-related
                     protein, putative"
                     /transcript_id="XM_002421595.1"
                     /db_xref="GeneID:8050049"
     CDS             complement(88022..88420)
                     /locus_tag="CD36_25390"
                     /inference="similar to AA sequence:UniProt:Q59KP9"
                     /note="transposable element;
                     possibly should be merged with adjacent ORF Cd36_25400"
                     /codon_start=1
                     /transl_table=12
                     /product="non-ltr retrotransposon zorro 3 orf1-related
                     protein, putative"
                     /protein_id="XP_002421640.1"
                     /db_xref="GeneID:8050049"
                     /db_xref="GOA:B9WKM9"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:B9WKM9"
                     /translation="MFVTSLLISSQDKFRKEESFQKQTDSNNRLIFEKCTTRVLSNCR
                     YCEYCRSMNHTKYNCQLIKPCANCGVKGHKTTSCKKKLRRCQRQFYKDQEANSISQFY
                     HLRWLKEIQMNYFKEEVVRNQTKRRFFFFS"
     gene            complement(<88553..>88792)
                     /locus_tag="CD36_25400"
                     /db_xref="GeneID:8050050"
     mRNA            complement(<88553..>88792)
                     /locus_tag="CD36_25400"
                     /product="non-ltr retrotransposon zorro 3 orf1-related
                     protein, putative"
                     /transcript_id="XM_002421596.1"
                     /db_xref="GeneID:8050050"
     CDS             complement(88553..88792)
                     /locus_tag="CD36_25400"
                     /inference="similar to AA sequence:UniProt:Q59KP9"
                     /note="transposable element;
                     possibly should be merged with adjacent ORF Cd36_25390"
                     /codon_start=1
                     /transl_table=12
                     /product="non-ltr retrotransposon zorro 3 orf1-related
                     protein, putative"
                     /protein_id="XP_002421641.1"
                     /db_xref="GeneID:8050050"
                     /db_xref="UniProtKB/TrEMBL:B9WKN0"
                     /translation="MDTDASDYYTEEEQEEGKTPKGPYSEFSKCNKFTYFTPETSTTK
                     VAENNYIQESLPEDNTSKTYASVAASYKTNLPYFS"
     mobile_element  88986..94337
                     /mobile_element_type="retrotransposon:sampi A, Tcd24, LTR"
     gene            <89576..>90394
                     /locus_tag="CD36_25410"
                     /db_xref="GeneID:8050051"
     mRNA            <89576..>90394
                     /locus_tag="CD36_25410"
                     /product="transposable element protein, putative"
                     /transcript_id="XM_002421597.1"
                     /db_xref="GeneID:8050051"
     CDS             89576..90394
                     /locus_tag="CD36_25410"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="transposable element protein, putative"
                     /protein_id="XP_002421642.1"
                     /db_xref="GeneID:8050051"
                     /db_xref="UniProtKB/TrEMBL:B9WKN1"
                     /translation="MDGSDKSIIVAVKRQMMNRLIQTKNDMAASKFKTSTIFAIARPH
                     LAGMAAEWLQEFENDQIEKENTINGERRSNSTTLTIQEFIHQFDTRFLQKNNNMEIQE
                     FIHQFDTRFLQKKNDMDIQVNLNKLTHTGTYDQFRNAFFKLYDRMIEKNDAAVNSYTL
                     DLFKSKVRPMFYPELSAIHSISELRYFRPSEGSLAADEALQKVINSTNSSGHQSQPKK
                     FNNSNNQQWDDKKVCLRHGPCNHTTNECSTIANLIDADKNKSNKQFTKSESKKN"
     gene            <90619..>91830
                     /locus_tag="CD36_25420"
                     /db_xref="GeneID:8050052"
     mRNA            <90619..>91830
                     /locus_tag="CD36_25420"
                     /product="reverse transcriptase (fragment), putative"
                     /transcript_id="XM_002421598.1"
                     /db_xref="GeneID:8050052"
     CDS             90619..91830
                     /locus_tag="CD36_25420"
                     /inference="similar to AA sequence:UniProt:Q96WX1"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="reverse transcriptase (fragment), putative"
                     /protein_id="XP_002421643.1"
                     /db_xref="GeneID:8050052"
                     /db_xref="GOA:B9WKN2"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="UniProtKB/TrEMBL:B9WKN2"
                     /translation="MKLSSPDGTFLATVTEKISIFWPAINENVTFIVADFDNFPIILG
                     AEVAKKFLKFPDTIQEWNDETMKSQDPIPTQADTDTSPMDIDLVVDTYLDEVDSLEEN
                     LEERFVSSLMLSHSSLFPTKSTKSFSIDLNKQLSNENLVVSNITTEPDTQFHHNEKAQ
                     TLLQQLLIEYSDTVNNEPLMLQKPTHAYYHDIKLKDENAMAYRKAYKIPLRYSDELQR
                     QLKQYLDAGFIEPTVSPFGAPIVMVPKANGEVRLCNDFRGLNKLTIADHFHLPNMEEL
                     LMEVKNSTYYSSIDLCQGYHQVLINEADKEKTAFHTPFGSFHWVVMPFGLINAPASFQ
                     RMMEQVFREYNHDFMLIYLDDLIIYSKNLKEHLEHLKLVFDTLRKANLRAKLKKCKFM
                     CKTITFLGHHK"
     gene            <92457..>92996
                     /locus_tag="CD36_25430"
                     /db_xref="GeneID:8050053"
     mRNA            <92457..>92996
                     /locus_tag="CD36_25430"
                     /product="polyprotein (fragment), putative"
                     /transcript_id="XM_002421599.1"
                     /db_xref="GeneID:8050053"
     CDS             92457..92996
                     /locus_tag="CD36_25430"
                     /inference="similar to AA sequence:UniProt:Q572H0"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="polyprotein (fragment), putative"
                     /protein_id="XP_002421644.1"
                     /db_xref="GeneID:8050053"
                     /db_xref="UniProtKB/TrEMBL:B9WKN3"
                     /translation="MLSRDFTKSLQLSSISISLHHNILGEEFFDRVKAAYTDDKRIAL
                     LYSTLINLNQSPATTNIHKSIKFAIKQYTVKDGLLFYKGINKLGNSILRLVIPTAELQ
                     LEIVRLHHDSPTATHYGALKMLADLSELYYWPNMFNQIKLYTKWCYKCQTIKPSNTHE
                     NGLLQPILWSFQSDSESSQ"
     gene            complement(<94585..>96882)
                     /locus_tag="CD36_25450"
                     /db_xref="GeneID:8050054"
     mRNA            complement(<94585..>96882)
                     /locus_tag="CD36_25450"
                     /product="peroxisomal long-chain fatty acid import
                     protein, putative"
                     /transcript_id="XM_002421600.1"
                     /db_xref="GeneID:8050054"
     CDS             complement(94585..96882)
                     /locus_tag="CD36_25450"
                     /inference="similar to AA sequence:UniProt:P41909"
                     /inference="similar to AA sequence:UniProt:Q5AAI9"
                     /note="Similar to S. cerevisiae PXA1"
                     /codon_start=1
                     /transl_table=12
                     /product="peroxisomal long-chain fatty acid import
                     protein, putative"
                     /protein_id="XP_002421645.1"
                     /db_xref="GeneID:8050054"
                     /db_xref="GOA:B9WKN4"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WKN4"
                     /translation="MINISRLAGYNKQDVKNILLLLHEFITTYRDNKVKLNYQSRPVI
                     LFFSTLIATAGFGLYFTLRNIITKYNEYALNKKLRRPSLIRQSSNILKNGAREIYIPK
                     GKDKVTRIIIPKPNNDQYAADKYLYKDFVRNQRILQQQQKGAIFNSRFLNQLTIIWKI
                     LIPKFYCQNTSLLLSQCFFLIFRTWLSLLVAKLDGQIVKNLIAANGRKFSRDLIYWLL
                     IAFPASYTNAAIKYLDLRLALGFRTNLTRYIHDMYLDKSMAYYKIGLNNSDILNIDQY
                     ITDDVTNFCQSLCSLFSSMGKPFIDLIFFSVYLRDNLGTGAIIGIFANYMVTALMLKR
                     ATPSFGKLSSQRAHLEGIYYNQHLNVMTNSEEIGFYKGSLIEKFKLNENFQKLIKHIS
                     KEINISFGYAALEDYVLKYTWSAWGYIFAGLPVFLDELWPKEAVALTGDDDDDDIAAA
                     IAKKKTSKQQDDKDTPVDAATEGKNMRQFITNKRLLLSLADAGSRLMYSIKDVNTLTG
                     YTDRVFNLLTQLHRVHAPKFDYGDKNGYGDIQGTIQDNYPDGLRFENIRVIIPTAEGS
                     EYPPLVDNLNFQLKHKSMLILGSNGCGKTAIARIIAGLWPLYSGLLSKPNDDDIFYLP
                     QKAYFTTGNLRDQIIYPHTYTEMLEMGYNDDYLYHILREVKLEYLLKREKSLNTVKTW
                     SSVLSGGERQRLSIARALFKHPKLIVLDDCTNAVSTDVEEYLYELLIKKKLTFISLSN
                     RPSLEKYHDHVLEIEEGNWQLKTVS"
     gene            <98711..>99907
                     /locus_tag="CD36_25480"
                     /db_xref="GeneID:8050055"
     mRNA            <98711..>99907
                     /locus_tag="CD36_25480"
                     /product="nicotinamide-nucleotide adenylyltransferase,
                     putative"
                     /transcript_id="XM_002421601.1"
                     /db_xref="GeneID:8050055"
     CDS             98711..99907
                     /locus_tag="CD36_25480"
                     /EC_number="2.7.7.1"
                     /inference="similar to AA sequence:UniProt:P53204"
                     /inference="similar to AA sequence:UniProt:Q06178"
                     /inference="similar to AA sequence:UniProt:Q5AAJ0"
                     /note="Similar to S. cerevisiae NMA1"
                     /codon_start=1
                     /transl_table=12
                     /product="nicotinamide-nucleotide adenylyltransferase,
                     putative"
                     /protein_id="XP_002421646.1"
                     /db_xref="GeneID:8050055"
                     /db_xref="GOA:B9WKN5"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR005248"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:B9WKN5"
                     /translation="MDPTNDPNFTPPSLNKNIEPTAPSDKIPSIMPIQPFVLEELGEG
                     VDGPAPHPASSSRPTPTTARSYDASHASDTESKYHSKIPRKHTELISSSSSDEENEPI
                     PEITPPKKEILPPSIKVRSSQIADLEEVPHGIQRQALKLEDYHFPTHRLATTLTDDSK
                     HPLVIVACGSFSPITYLHLRMFEMALDAITEQTRFEVIGGYYSPVSSNYKKQGLAPAH
                     HRVRMCELACERTSSWLMVDAWESLQPKYTRTALVLDHFNEEINIRRGGIMTRSGEKR
                     GVKIMLLAGGDLIESMGEPDVWADQDLHHILGKYGCLIVERTGSDVRSFLLSHDILYE
                     HRKNILVIKQLIYNDISSTKIRLFIRRGMSVQYLLPNSVIRYIQQHNLYGDSEPVKQV
                     MSDRAD"
     gene            complement(<100075..>102525)
                     /gene="LEU1"
                     /locus_tag="CD36_25490"
                     /db_xref="GeneID:8050056"
     mRNA            complement(<100075..>102525)
                     /gene="LEU1"
                     /locus_tag="CD36_25490"
                     /product="3-isopropylmalate dehydratase, putative"
                     /transcript_id="XM_002421602.1"
                     /db_xref="GeneID:8050056"
     CDS             complement(100075..102525)
                     /gene="LEU1"
                     /locus_tag="CD36_25490"
                     /EC_number="4.2.1.33"
                     /inference="similar to AA sequence:UniProt:Q00464"
                     /inference="similar to AA sequence:UniProt:Q5AAJ1"
                     /inference="similar to AA sequence:UniProt:Q6BUD7"
                     /note="alpha-IPM isomerase, putative; isopropylmalate
                     isomerase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="3-isopropylmalate dehydratase, putative"
                     /protein_id="XP_002421647.1"
                     /db_xref="GeneID:8050056"
                     /db_xref="GOA:B9WKN6"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR004430"
                     /db_xref="InterPro:IPR004431"
                     /db_xref="InterPro:IPR012235"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:B9WKN6"
                     /translation="MTQLIASILYKPTKKNFKSSVQLFLFSFYFTLYTPYKYFTMAPR
                     TLYDKVFEDHIVHKDDSGSYLLYIDRHLVHEVTSPQAFEGLKNAGRSVRRTDCTLATV
                     DHNIPTISRANFKNVDSFIEQDDSRLQVKTLEQNVKDFDVTYFGMTDDRQGIVHVVGP
                     EQGFTLPGTTVVCGDSHTSTHGAFGSLAFGIGTSEVEHVLATQTIIQAKSKNMRITID
                     GDLSEGITSKDLVLHVIGVIGTAGGTGCVIEFAGKAIENLSMEARMSICNMAIEAGAR
                     AGMIKPDETTFNYIKGRPLAPKGEEWEKAMKYWKTLHTDEGAKFDYDIKIAASDIVPT
                     ITWGNSPQDALPITASVPDPATVSDPIKKSGMERALKYQGLTPNTPLKEIKIDKAFIG
                     SCTNSRIEDLRAAAKVAKGHKKADNVKLVLVVPGSGLIKKQAEKEGLDKIFEAAGFSW
                     REAGCSMCLGMNPDILDPEERCASTSNRNFEGRQGALSRTHLMSPAMAAAAAIKGHFT
                     DIREFDYATQDEPQIQVAHDIEDKELQDAVYEHEKEYIEDTPETQAERLEDIPKDEPE
                     FKKARTDIDNSATGAPGIDNSFKVLTGITAPLYKANVDTDAIIPKQFLKTIKRTGLKD
                     GLFYELRFVKGENGKDVETDFVLNVEPYRKAEILLVTGDNFGCGSSREHAPWALKDFG
                     IKSIIAPSFGDIFYNNSFKNFLLPIRIPQEIIESKLVPVVTSGHRLTIDLPNQQIRDG
                     ETDEVLIEHFDVEEFRKHCLVNGLDDIGLTLQKEEYIKEYEAKRKVKFSFLEGGSKLI
                     KPIKGTKKSIYGNRAQEW"
     gene            <102890..>105463
                     /locus_tag="CD36_25510"
                     /db_xref="GeneID:8049696"
     mRNA            <102890..>105463
                     /locus_tag="CD36_25510"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421603.1"
                     /db_xref="GeneID:8049696"
     CDS             102890..105463
                     /locus_tag="CD36_25510"
                     /inference="similar to AA sequence:UniProt:Q5AAJ3"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421648.1"
                     /db_xref="GeneID:8049696"
                     /db_xref="GOA:B9WKN7"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016157"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:B9WKN7"
                     /translation="MMPPGGRKSKIRPPRKSLISSSSSSENSTTDPVIDFDKNWSVLS
                     SAISQIQNKNVSNLSYEQLYRKAYVLVLRKFGGKLYDNVASVIRTHLLTRREKLLGVS
                     ANHDLFMQSILQEWSEHLQAMKFISDVLMYLNKVYVAEHKKLLIYDLGIQLFKDYVIK
                     YNDDEVGSKIVNMVIGEITKSRTGVVITSSMYITKIINMMELLVEPSGSSDILFGDSY
                     YQIKFEPKFLKSSEESLYNLSQEFVSYNSGTKYLQLTTQFIKDEDNRVRFYLPPSTYP
                     KLVELMNNIMIKDKIDKMMLSSNQGLDYWLKPVVSNIFEDTNIETYHYTDLKMLYNLI
                     GRFDDEYQLLRLRLKEAIIAQGNSLPDYVRSSIENSGKKQSNNSPAFATKWIETILKY
                     RDQLLQVWKTSFEENLMIEQTFTFAMRDFINGTNKRGPASVNAPELLSVYMDYFIKQL
                     TKGSSSNKDISLKSGDQTEDLISNSIQFLRFIKDKDAFEANYANHFAKRFLNSKTGNS
                     PSSNKDIEEIILAKLSEEMGTSSLDKVIKMNRDVRSSKDTTNDWKRYLNKQSKSADLV
                     EMELKICNVTDWPKSMTKDYKWFSRTENEETPFKWPRQLRNTIKQFEEFWSNGKKNDN
                     KSLYWSPKFGSMDLRITYPSRTYEINLSTFAAIIMLLFAPQSTNADGSTVSAFDEIKE
                     LTYEEILELTGIPEPELKRHLQSIAVAPKSRLLVKIPMSKDVNKNDVFKLNAKFKSPS
                     VKVKVLTVSASSSSSSASSSSKNSSKSVAKTEQEEELEEVNANIMEGRKIEVNAAIVR
                     ILKSRQSIKHNDLIEELLKQLSNRFQPSIILIKQRIEDLIDKEYLKRDTDDRNLYHYI
                     A"
     gene            <105822..>107120
                     /locus_tag="CD36_25520"
                     /db_xref="GeneID:8050057"
     mRNA            <105822..>107120
                     /locus_tag="CD36_25520"
                     /product="nadph dehydrogenase, (old yellow enzyme),
                     putative"
                     /transcript_id="XM_002421604.1"
                     /db_xref="GeneID:8050057"
     CDS             105822..107120
                     /locus_tag="CD36_25520"
                     /EC_number="1.6.99.1"
                     /inference="similar to AA sequence:UniProt:P40952"
                     /inference="similar to AA sequence:UniProt:Q03558"
                     /inference="similar to AA sequence:UniProt:Q5AAJ4"
                     /note="Similar to S. cerevisiae OYE2"
                     /codon_start=1
                     /transl_table=12
                     /product="nadph dehydrogenase, (old yellow enzyme),
                     putative"
                     /protein_id="XP_002421649.1"
                     /db_xref="GeneID:8050057"
                     /db_xref="GOA:B9WKN8"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:B9WKN8"
                     /translation="MTVSTPLTKTNLFKPITIGDVKLNHRVVHAPTSRKRSTKDNYPT
                     DLMIDYYKSRSQYPGSFIIFESSLVSERSGLVPHKIGLWNEKHCLALKQIVDEVHKNK
                     CFISCQIMANGRTSNAKLMQSKNLPVLAPSITYPNETAEKLASELNFPIKALTIEEIH
                     GIQNDFVNAAVNSLKIADFDFVELHATSGFLIEQFLSPLSNKRTDEYGGDLINRCRFL
                     IEIIDKFINHPDIGAHKFGIRISPWYSHNGMVYPEENKLGNGIPYQFCQYILEQLEER
                     KSQGNEIAYVSIVEPRVSGNSDVESFGNKSNDGIIKYWSGKLIRAGGYATNFNVVNPT
                     SIKTNKQFTNENGEIVHYANLINDVSNDDRTLIGFSRPFTSNPDLIYRLENNLKLEYY
                     DRPTFYTQTGDGYLTFKNYDGSPVTQLSDGELNREGISLQ"
     gene            <107517..>112634
                     /locus_tag="CD36_25530"
                     /db_xref="GeneID:8050058"
     mRNA            <107517..>112634
                     /locus_tag="CD36_25530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421605.1"
                     /db_xref="GeneID:8050058"
     CDS             107517..112634
                     /locus_tag="CD36_25530"
                     /inference="similar to AA sequence:UniProt:Q5AAJ6"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421650.1"
                     /db_xref="GeneID:8050058"
                     /db_xref="InterPro:IPR019021"
                     /db_xref="UniProtKB/TrEMBL:B9WKN9"
                     /translation="MSDTEYISDSEDDALRGELLIDQNKFADILSRLSPRKQELTRHR
                     LERLTNVSYVNRENNTRSARLRHHQNNEIRNTISNRIEDSDDDSDLNTIDLIRNLPRR
                     SNNEIEQRKDSTSQHQSQNHTVTQNNVDNTVVLDDQENEHHLQSYLNTTTSYVTWSGR
                     SLRKRNFASTHPYLADQAHYLGLSDVDYLNEIYEENDHNLEKVVKYLNYNYERLKKRY
                     PKDEKYRSKNFYTIISRQSHLAREKELQEEQITGDSVSLPNINDEFEEEDDEGNKEFT
                     IDPLDDLNSQIYETDESSNEPDDFLQPVKHHRLVIPDDDEDNDTNNINGNYYSRNVVD
                     EESGSGSDSDSSKSDIYVRVGGRFRKEKNALKGVLPESAKRLSIYQPGSKRSSNRHLQ
                     KSQAVSEYRKGMALRKRTKRKISERDDFTGFVDDTITYDTNNELYHELYDQPVVIEEQ
                     TPSLSYPSFESVTNFSESSASEDEDKQMSYESDLDIFDVRPREADIAGIDEETRNVDD
                     NEELDEPLDYEVREGDYINHMLATAPKSKSTRSKRQSTGTTATMNTSSRRTYKSQKRS
                     IAGMLSRSKGARGHSTKGDVQRSDSSTVSVMNRSTPSRRRQPKARSTRVRSDDSYSRL
                     PVKRITSLQHQRSKKTTASTRKLKKRKDTLQLTTLDNYIKGNPRDIFADNYLFSRSPI
                     LSTTIVEAESVTRFVKETYKNVNPSAPQIAPSIILGSQPIFEFGCILNDIVLDKITAL
                     GDGKFYQIYKDSVTIEFLGETVVLTLIDHESSKARYEKLLIHLARLFKSSDLSNESLI
                     QTFYTTIKGILEWNLILQERPTERNWKLAHLVLSNIIDSPYLTASSIRFILPYFFLVG
                     YTMNMIAKLNGKTSSCDLNNLGMRYWQLFFETFSGDLFESMNFEAGSKSKEAESYFIL
                     CRLLEESGVWWTTIVNALQVYKAFDVSLLLESVFCLCVFARKGYSWEPLQLVYQMASA
                     EETLGVEFYYRYLEIVYFMNQRNNWPLPETVVLQIYSSITKMKFANFIDEIGMPDLIG
                     KVSTRFDIPDDSFFERFMQLLYWYISGLSEPSKVKKLVTKLFTFSKFQYVNDQNHHVM
                     FINRLNFILLLASVSKVDLKTQLLNLLEGIMNAKDAKLIKLASKGVCVLTEIAIQRDT
                     KLPIEGISIVIQCCVNGYYSVHGVLKVWKNFLTLIKDLFHNPLSRLSHSLQLLNISKS
                     IDINNIPDKIIIDICRILSDITSSMINAKDVVVQKHIKTITSLNEFVVSLLHRQMGRL
                     PLPSVMQENRVSGLIEILLSMWVQCAFILGESWERLILQTYAYTGNQQSREQFALYFY
                     SKILQFNNLQGCKELVTRQVLRDLVCFNPSKYLFSILQKLQKERWGLFSPGKMNGVTL
                     LMITNSRHVVVSNILQNLAANSSAISIYEYQLYVKDILRTLNIEFEKYYSSLRYKTFC
                     INVIKDIQKYCEPTLINESLLANLASKLGISENELSHLKIQKLPLKEKLKAFVGEFLN
                     SVYFGGDYIKILEKFTFEEGVELIYHLVSVLLQEMQANSDFITWKVIYLLLKFFDENL
                     RLFKFKFINLQFKHFLKSLVELPKVRQHNTSTADQYYRICCLLCITSILRYCKIIFEG
                     YTDLNEIECYWVLFSNAVHSYNPDKSRSLEFVYSSFGMQELLNDFRFPKDPNPQDDIS
                     QESLQVAHRVLVSEIDLIDTTSGEVPDTCILDYDFNF"
     gene            complement(<112662..>114596)
                     /locus_tag="CD36_25540"
                     /db_xref="GeneID:8050059"
     mRNA            complement(<112662..>114596)
                     /locus_tag="CD36_25540"
                     /product="ESA1-associated factor, putative"
                     /transcript_id="XM_002421606.1"
                     /db_xref="GeneID:8050059"
     CDS             complement(112662..114596)
                     /locus_tag="CD36_25540"
                     /inference="similar to AA sequence:UniProt:P53201"
                     /inference="similar to AA sequence:UniProt:Q5AAJ7"
                     /note="Similar to S. cerevisiae SWC4; SWR1-complex
                     protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ESA1-associated factor, putative"
                     /protein_id="XP_002421651.1"
                     /db_xref="GeneID:8050059"
                     /db_xref="GOA:B9WKP0"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR027109"
                     /db_xref="UniProtKB/TrEMBL:B9WKP0"
                     /translation="MSANDILDVLNIQRDESNQPPKKKQKSSSTPTLPDGKQLTGMAR
                     ELYNLVGPNTPPINLNSHSYTANKEKMKKFKPSPWTRMPFTPKQGIELYHWVKGSKEL
                     IEQQELEEDGTPKPYFFEKYNVQLEIPEFIDEDTYDLYMIEIKEYENKVREERERREK
                     ERKEREKRDLEEKKKQQQQQQQQQQQKVQQDQQQQKQQNKNADDGKNTESNNNADQKE
                     TEQKSEENKTIEEKKQTEEKKDDGESKDTNNEAKPVAEDVKTEKEKTEDKELPKTNDS
                     ETNKTEKKDDEEASAKSKDSTAESQLENKKENDEDTDLEWTYKETKHLFELCQAFELK
                     WPIIHDRFPNPNRTAEDLKEQFYRICIKILENQENKNQALIDSLKAYSKPRELERKQY
                     LENLLKRTPAEIAEEESLVIEARRFEIAAKKMLMERSNLLTLLDSPQTTQNVSQYQSS
                     QGITNLYNNLLIYDKHQKKKQMANKANTQQEPVPPPIPLAASSSVKRDRGFQTQLQQY
                     LSSFLKQNHHTNPAVKQEINSIQQLLMKRLTQKEEEAYGLHFHGTEKLNPGVMLRSQQ
                     KLPGLNQRQSILKSVNILLQEMDIPTGGGTSWKPIMPTRKTMAKYDELIRSVVTLLDV
                     KKAKDKLEAEIKLIKSQRGL"
     gene            <114786..>115877
                     /locus_tag="CD36_25550"
                     /db_xref="GeneID:8050060"
     mRNA            <114786..>115877
                     /locus_tag="CD36_25550"
                     /product="regulator of ty1 transposition protein,
                     putative"
                     /transcript_id="XM_002421607.1"
                     /db_xref="GeneID:8050060"
     CDS             114786..115877
                     /locus_tag="CD36_25550"
                     /inference="similar to AA sequence:UniProt:Q07794"
                     /inference="similar to AA sequence:UniProt:Q5AAJ8"
                     /note="Similar to S. cerevisiae RTT109"
                     /codon_start=1
                     /transl_table=12
                     /product="regulator of ty1 transposition protein,
                     putative"
                     /protein_id="XP_002421652.1"
                     /db_xref="GeneID:8050060"
                     /db_xref="InterPro:IPR013178"
                     /db_xref="UniProtKB/TrEMBL:B9WKP1"
                     /translation="MLDCMLSPDILKDGEFETIYFLTNPIYIKSPIHIPKSTIGKPDT
                     VKIRHFFALLHQDSIVLGLEVFVYLQIYSDFVEKYVYVSKCDTVGLEKSTIKIGSVIG
                     PVLQYIINYNGYKIKMNNVEEKSRDVSDPSTLVRLQRLRDKLPDIYPNLPYYNDIPPK
                     EECIEYRTLPKTQNLKLCVFTKPAKEYLFPNSAKNPYKNLLNGQSLLRWWIAIIDNIT
                     NGWDSHKLMIPGADKYATRKFIEKYSDWSEGHIFKQDGLAVRAIPLFPDDPKGRFLEL
                     VIVECRYGKMSVSRFYQELAYRQEFLLGDCVSLIGCCRENLDVTYQDDSASTVTISEY
                     KEFMNSLKSVDFSDRLEVSNFVSNYRKSN"
     gene            <116407..>117996
                     /locus_tag="CD36_25560"
                     /db_xref="GeneID:8050061"
     mRNA            <116407..>117996
                     /locus_tag="CD36_25560"
                     /product="bypass of stop codon protein, putative"
                     /transcript_id="XM_002421608.1"
                     /db_xref="GeneID:8050061"
     CDS             116407..117996
                     /locus_tag="CD36_25560"
                     /inference="similar to AA sequence:UniProt:Q08280"
                     /inference="similar to AA sequence:UniProt:Q5AAJ9"
                     /note="Similar to S. cerevisiae BSC6"
                     /codon_start=1
                     /transl_table=12
                     /product="bypass of stop codon protein, putative"
                     /protein_id="XP_002421653.1"
                     /db_xref="GeneID:8050061"
                     /db_xref="GOA:B9WKP2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WKP2"
                     /translation="MSQDKTNQDPEPLPTKFPASQETTPSGSSSNSGSTVVVPPIQTP
                     QFQNIKHEIEFEGEILTIDSTNWRNSRLLKLQILVSFGVFILFGLAEQTVGTIIPKLQ
                     HDYSINDIQISFIFFCSVSGYLLTAMINSITHEYLGIRGVTVLGSTSMALSYLIASHK
                     PPFVIFLMCYFMSGVGFGTLDASINTWMGNLVDSNQLLGIVHGCYGIGSLISPSLISY
                     LLSKSNNPWKWPNYYVILSVVAGFCLVSLILTFKYETPKKYKYISQLRHQQQKQQGQT
                     QKDGSIELEHFTGIHGSTTKDSFDLEATVDDNEELEEEEEDHHSTSVRKTLSSTLVWS
                     FALILFIYVGGEAAFAAWLVTFLLRIKNLDYKTASYMATTFWSGVTIGRIGLGFVTAH
                     FFSSELWANLIYILVSFLGCLLFWVLTFIETSTLLVIVLFLVVLVTGIAIGPIFPTTI
                     VSSVNILPAKYQTSGIGFICAFGGGGGAGIPFLIGLLAESSEVGLRTYPLIISLMFGI
                     LLGVWILIMQKYSSKYKRNTL"
     gene            complement(<118115..>118384)
                     /locus_tag="CD36_25570"
                     /db_xref="GeneID:8050062"
     mRNA            complement(<118115..>118384)
                     /locus_tag="CD36_25570"
                     /product="BolA domain protein, putative"
                     /transcript_id="XM_002421609.1"
                     /db_xref="GeneID:8050062"
     CDS             complement(118115..118384)
                     /locus_tag="CD36_25570"
                     /inference="similar to AA sequence:UniProt:P53082"
                     /inference="similar to AA sequence:UniProt:Q4WLS5"
                     /codon_start=1
                     /transl_table=12
                     /product="BolA domain protein, putative"
                     /protein_id="XP_002421654.1"
                     /db_xref="GeneID:8050062"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:B9WKP3"
                     /translation="MSSSVLTADLLRDIIATRLNANLVQVEDMSGGCGQAFAVIIVSS
                     LFQGKNKLARHRLVNNELKDEIASIHAFTQKGFTPDEWIAQGGHL"
     gene            complement(<118747..>123120)
                     /locus_tag="CD36_25580"
                     /db_xref="GeneID:8050063"
     mRNA            complement(<118747..>123120)
                     /locus_tag="CD36_25580"
                     /product="Rho-GTPase-activating protein, putative"
                     /transcript_id="XM_002421610.1"
                     /db_xref="GeneID:8050063"
     CDS             complement(118747..123120)
                     /locus_tag="CD36_25580"
                     /inference="similar to AA sequence:UniProt:P35688"
                     /inference="similar to AA sequence:UniProt:Q5AAK0"
                     /note="Similar to S. cerevisiae LRG1"
                     /codon_start=1
                     /transl_table=12
                     /product="Rho-GTPase-activating protein, putative"
                     /protein_id="XP_002421655.1"
                     /db_xref="GeneID:8050063"
                     /db_xref="GOA:B9WKP4"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:B9WKP4"
                     /translation="MNHSFDTPQRGNSIHQSFANPNTTNTTRSTINIVESPDNRGSII
                     ATTEPSSPPPPPPKNSGSSPRRKFNPFGHSRSHSHTSNNGKRLFYPVHHDGRYHNIND
                     QFPPISSVSQPMHPSSPVPTSPTPIPAAAPAPTTSSKPKREQSLRYYIPRDTPPQTPH
                     MNQLPKPVGKSPQPNWTNLIPPLPGKPQPSYNSHDTFQQQKQNKLIDTDDFNFGTEPI
                     ISTPEPSSRQHPEPLSNQSNFNNNNYSNHRTSTRSGLDPSQRHSIAVSPTPEKQNSAT
                     QSTDTINTSSIRPAPSVSGSSSSLLHKQQLQEPSSPSKSERKPGRKKSRKVCAKCGLE
                     ITSQFVRALNNAYHVDCFTCHECGKQCSAKFFPYEITNEQDSTKTQVALCEYDYFKKL
                     DLICYVCNSALRGPYITALGNKYHLEHFRCNVCQRVFESDESYYEHDNNIYCHFHYSK
                     LYASHCEGCQSSIVKQFVELFRGGRNQHWHPECYMVHKFWNVCITPDSVGLQKLFDLP
                     DDVLNGLKLMRDDNESHITVDSAMLMSIEQQIEQVVLKCWVTLSGYEEITAKCISDML
                     LCACTGNKFNGIVVTGKLVLNVEVLFNALDYVILMCKSSHELLHKKFGTPPNQDDSES
                     SSTEEEYFQMLKKEPRNITGKIMSYLAILRKSDHIAKSGSLSAELLSVITGCAHYLKL
                     LIRIGLYNALKLNKLYGTTNAIEKFLQLTSEHEAISLLAGDSKTQLSLINSKLTIPAS
                     STDACSSCAKSIEKSCLKLDNNRWHIRCFVCSLCKRTIPPIEASETKFDVIHQSIVCR
                     KCPCEQFDTGFHLVSDLSQLIYLLKIALFRSRSVMKVDLTKIPRSYISDSQSDTDDVD
                     VAQDNYSQTLNDVTSLRSKRQSQKLSKSIKKKARKSIIVEAPEADKARKEDIKTHPLG
                     MKSGVAANDALKSGGINDESTIAEELNDLSFDSQTSRQQGTRKTSSASQLSYNPGGDE
                     SLSVTRKSLKIRDEPQRQTTHTHLDRTSDLLKNEKSLTLDDIPRIVAAEQAREQRPNA
                     FKHHNSLYQRQTAPHRLKASGHTSTVITPTGVLDNILNTSQPHPEEPVVRKQKYYSEL
                     TKDEHFIIRHIAVEALSHISKSYSNKEELLSLIQTKKQPTFWDKFKFGGGDGKKDKAM
                     AVFGVELQSLTKKYGIDSDLGVGPSKLRIPIVVDDIIAALRQKDMSVEGIFRLNGNIK
                     RLRELTEQINKNPLKSPDFSVQNAVQLAALMKKWLRELPNPLLTFGLYDMWVSSQRQV
                     NPVLRKRVLQLTYCMLPRSHRNLVEVLLYFFSWVASFSEIDEETGSKMDIHNLATVIA
                     PNILISKQSSNSSSGNSSNSGTNNSDSQQSSGDNYFLAIEVVNQLIEQHEEFSIIPSD
                     ILEFYEKCGFDKFDSTKKEITTRDVMMKIDKELKETPDYFDNFELKNPAGLTSQEVKR
                     NSVSRIESKIQNKELNGISER"
     mobile_element  125064..127294
                     /mobile_element_type="transposon:Mutator transposon H"
     gene            complement(<128242..>128793)
                     /locus_tag="CD36_25590"
                     /db_xref="GeneID:8050064"
     mRNA            complement(<128242..>128793)
                     /locus_tag="CD36_25590"
                     /product="U3 small nucleolar ribonucleoprotein protein,
                     putative"
                     /transcript_id="XM_002421611.1"
                     /db_xref="GeneID:8050064"
     CDS             complement(128242..128793)
                     /locus_tag="CD36_25590"
                     /inference="similar to AA sequence:UniProt:P32899"
                     /inference="similar to AA sequence:UniProt:Q5AAK1"
                     /note="Similar to S. cerevisiae IMP3; U3 snoRNP, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="U3 small nucleolar ribonucleoprotein protein,
                     putative"
                     /protein_id="XP_002421656.1"
                     /db_xref="GeneID:8050064"
                     /db_xref="GOA:B9WKP5"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:B9WKP5"
                     /translation="MVRALKHHEKKLLKKVDFLDWKQDQGHRDTQVMRTYHIQNREDY
                     HKYNKICGDIRKLAHKLSLLPSTDPFRIKHEQLLLEKLYNMGVLSTKSKISDLENKVT
                     VSILCRRRIGVVMCRLKMAETISDAVKFIEQGHVRVGPNVITDPAYLITRNLEDYLTW
                     VDNSKIKRNVLKYKNKIDDFDLA"
     gene            <129045..>129740
                     /locus_tag="CD36_25600"
                     /db_xref="GeneID:8050065"
     mRNA            <129045..>129740
                     /locus_tag="CD36_25600"
                     /product="mitochondrial 54S ribosomal protein YmL16"
                     /transcript_id="XM_002421612.1"
                     /db_xref="GeneID:8050065"
     CDS             129045..129740
                     /locus_tag="CD36_25600"
                     /inference="similar to AA sequence:UniProt:P32904"
                     /inference="similar to AA sequence:UniProt:Q5AAK3"
                     /note="Similar to S. cerevisiae MRPL6"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 54S ribosomal protein YmL16"
                     /protein_id="XP_002421657.1"
                     /db_xref="GeneID:8050065"
                     /db_xref="GOA:B9WKP6"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002358"
                     /db_xref="InterPro:IPR019906"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:B9WKP6"
                     /translation="MFTATRSATTTASFCRLFSSSTRTLSNIGKKPIKLYEGVNYSIE
                     SIPLEFCKKFTKRNKTFILDRQIITNGPLGKLRVEIPEFINISQTNNENDKSIIVSVK
                     KPENKIQRSLWGTYRSILYNNIIGITEGHLSIVKFVGTGYRAILEKDEKTGEDIISLK
                     IGLPFTPKLKIPKGLKVSSPNPARLVIEGSDKQQVKLFAAFIREHKKPEPYKGKGIFV
                     DDEKIVLKQRKVK"
     gene            <129995..>130876
                     /locus_tag="CD36_25610"
                     /db_xref="GeneID:8050066"
     mRNA            <129995..>130876
                     /locus_tag="CD36_25610"
                     /product="mitochondrial 54S ribosomal protein YmL9"
                     /transcript_id="XM_002421613.1"
                     /db_xref="GeneID:8050066"
     CDS             129995..130876
                     /locus_tag="CD36_25610"
                     /inference="similar to AA sequence:UniProt:P31334"
                     /inference="similar to AA sequence:UniProt:Q5AAK4"
                     /note="Similar to S. cerevisiae MRPL9"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 54S ribosomal protein YmL9"
                     /protein_id="XP_002421658.1"
                     /db_xref="GeneID:8050066"
                     /db_xref="GOA:B9WKP7"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019926"
                     /db_xref="InterPro:IPR019927"
                     /db_xref="UniProtKB/TrEMBL:B9WKP7"
                     /translation="MFSLPQQTFKRGIGLLLNHQFSSNITSIRNVSAKITSIHAITSL
                     KTTAPTRNHTVQESTKRKLLLERPGLFAIKRGMITWFNEKGEHIPATVLEVDSCEVLG
                     YKLFRDFGYTAVIMGTIDKLKNVKSTNDLRIFETAKVSPKQKIGEFKIRSIDNDIESK
                     LIPVGTELTADYFTVGQKVDVKGITKGKGFAGVMKRWGFSGGRATHGTSKAHRTPGAT
                     GGNQNPGRVFPGKKMPGRMGNRNNTGFNLEVLHTDGEAGILIVKGNVPGPKKSIIKVY
                     DAIKEYGNSINNTINQE"
     gene            complement(<131664..>132539)
                     /gene="ADE1"
                     /locus_tag="CD36_25620"
                     /db_xref="GeneID:8050067"
     mRNA            complement(<131664..>132539)
                     /gene="ADE1"
                     /locus_tag="CD36_25620"
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase, putative"
                     /transcript_id="XM_002421614.1"
                     /db_xref="GeneID:8050067"
     CDS             complement(131664..132539)
                     /gene="ADE1"
                     /locus_tag="CD36_25620"
                     /EC_number="6.3.2.6"
                     /inference="similar to AA sequence:UniProt:P27616"
                     /inference="similar to AA sequence:UniProt:P43060"
                     /note="possibly fungus-specific; saicar synthetase,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase, putative"
                     /protein_id="XP_002421659.1"
                     /db_xref="GeneID:8050067"
                     /db_xref="GOA:B9WKP8"
                     /db_xref="InterPro:IPR001636"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR018236"
                     /db_xref="InterPro:IPR028923"
                     /db_xref="UniProtKB/TrEMBL:B9WKP8"
                     /translation="MTSTNLEGTFPLIARGKVRDIYQVDDNTLLFVATDRISAYDVIM
                     ANGIPNKGKILTKLSEFWFDFLPIENHLIKGDIFEKYPQLEKYRDQLEGRSLLVRKLK
                     LIPLEVIVRGYITGSGWKEYTKSKTVHGIPIGDVVESQQITPIFTPSTKAEQGEHDEN
                     ITKEQADAIVGKELCDRIEKIAIDLYTKARDYAATKGIIIADTKFEFGLDGDKIVLVD
                     EVLTPDSSRFWNAAKYKLGQSQESYDKQFLRDWLTTNGVAGKDGVAMPEDIAAQTKQK
                     YVEAYESLTGEKWQD"
     gene            complement(<132939..>136178)
                     /locus_tag="CD36_25630"
                     /db_xref="GeneID:8049670"
     mRNA            complement(<132939..>136178)
                     /locus_tag="CD36_25630"
                     /product="chromosome region maintenance protein, putative"
                     /transcript_id="XM_002421615.1"
                     /db_xref="GeneID:8049670"
     CDS             complement(132939..136178)
                     /locus_tag="CD36_25630"
                     /inference="similar to AA sequence:UniProt:P30822"
                     /inference="similar to AA sequence:UniProt:Q9P8X1"
                     /note="Similar to S. cerevisiae CRM1; exportin, putative;
                     karyopherin, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="chromosome region maintenance protein, putative"
                     /protein_id="XP_002421660.1"
                     /db_xref="GeneID:8049670"
                     /db_xref="GOA:B9WKP9"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR014877"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B9WKP9"
                     /translation="MDAILDFSTDLDINLFDQTVDTFFKGSGNDQKNAQLVLNKFQEH
                     PDSWKFADKILSNSNNAQSKYIALSSLNKLIQYRWKTIPDNERIGIRNFIVNMIISLC
                     DNEQEFETQRALINKIDLTLVSVLKQEWPHNWPEFIPEIVMSSRSSYNVCENNMIILK
                     LLSEEVFDYSQDQLTQAKAQQLKVSMKNEFEKIFTLCYEVLDKTTKSSLIIATLNALL
                     KYIQWIPSEYIYQTDLLNLLSTKFLAPPDTRAISMKCLTEVSSLPAHNEKTLIYFKNT
                     LEQIYSIVPITTNLKQSYKVASSSDQSFLQDLAMFLCTFLSNNLELLEKHKEAGELLQ
                     NSLYYLLELSRIEERELFKTCLDFWSTFVYGLFKEIRDLPSNELTPMMQLAYGNSLRP
                     TSSGGAPDPALLQKFPLRQHQYAEILSKLRLVIIENMARPEEVLIVENDEGEIVREFV
                     KESDTIQLYKSMREVLVYLTHLNVIDTEQIMIEKLARQIDESEWSWQNINTLCWAIGS
                     ISGAMNEDMEKRFLVSVIKDLLSLTEMKRGKDNKAVVASNIMYIVGQYPRFLKAHWKF
                     LKTVVNKLFEFMHETHEGVQDMACDTFIKITHKCKKHFVAVQANETEPFINEIIREIQ
                     QITEDLQPQQVHTFYEACGIIVSAEYNKAARDKLLSELMALPNMAWTAIIQQAGQDPE
                     LLSNTETVKIIANIIKTNVAVCKALGPGFYSQLGGLYVDMLSLYKAVSQMISDAVAKD
                     GIIATKTPKVRGLRTIKKEILKMIETYINQADNLQEIVRDLVQPLFGAVLEDYSSNVP
                     DARDAEVLRCLTALVSKAGHLIPDGVVLILQNVFECTLDMIKNDFVEYPEHRVEFYKL
                     LKEINAKSFQGLLQLSGEAFQSLINAALWAFKHNNREVEDNGLSLTLELIENVEKLGD
                     TPFTKAFYENFYFQILSDTLYVFTQPDHKSGFRYQAQLLAQLIHLVQDNVIKYPLYTS
                     DQAPEGTSNSDFLKQYLSQLLSSAFDNLQEVQLINFLKVLTTVYNDLFKFKSVLRDFL
                     VQLKEFGGDPTDYLFAEDKQIEREEQDRLQRERDMQVGGLIRPSEMDDE"
     gene            <137126..>137698
                     /locus_tag="CD36_25640"
                     /db_xref="GeneID:8050068"
     mRNA            <137126..>137698
                     /locus_tag="CD36_25640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421616.1"
                     /db_xref="GeneID:8050068"
     CDS             137126..137698
                     /locus_tag="CD36_25640"
                     /inference="similar to AA sequence:UniProt:Q5AAK7"
                     /note="possibly Candida-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421661.1"
                     /db_xref="GeneID:8050068"
                     /db_xref="UniProtKB/TrEMBL:B9WKQ0"
                     /translation="MIELISNSSHDWLSCYIIKLNITDQDSLDLEIKRFLTTTIANSQ
                     LTILIILQQEDEEGNKIELLNYLQFEIYKQSSKDIVVSIMTIPKGCDFSMLLSSQLNQ
                     IDDIIKDISKLDLSIALDVVNKEKLIFLMLNIPNLLPYLEQQQQRQDDQFTIEELFQN
                     FVKHHNSIKNILLSNELREWHHQLSKDIRR"
     gene            complement(<137773..>138786)
                     /locus_tag="CD36_25650"
                     /db_xref="GeneID:8050069"
     mRNA            complement(<137773..>138786)
                     /locus_tag="CD36_25650"
                     /product="malate dehydrogenase, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_002421617.1"
                     /db_xref="GeneID:8050069"
     CDS             complement(137773..138786)
                     /locus_tag="CD36_25650"
                     /EC_number="1.1.1.37"
                     /inference="similar to AA sequence:UniProt:P17505"
                     /inference="similar to AA sequence:UniProt:Q5AAK8"
                     /note="Similar to S. cerevisiae MDH1"
                     /codon_start=1
                     /transl_table=12
                     /product="malate dehydrogenase, mitochondrial precursor,
                     putative"
                     /protein_id="XP_002421662.1"
                     /db_xref="GeneID:8050069"
                     /db_xref="GOA:B9WKQ1"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:B9WKQ1"
                     /translation="MVKVAILGAAGGIGQPLSLLTKLNPNVDELALFDVVNVPGVGAD
                     LSHINSDSKTQSYLPKDKEDKTALAAALKDSDLVIIPAGVPRKPGMTRDDLFNINASI
                     VQGLAEGIAANSPKAFVLVISNPVNSTVPIVAQTLKAKGVYDPARLFGVTTLDIVRAN
                     TFISQLFPDQTKPSDFNINVVGGHSGETIVPLYSLGNSKQYYDILSEEQKKELIKRVQ
                     FGGDEVVQAKNGAGSATLSMAYAGYRLAESILAAVNGKSDIVECTFLNLDSSIKGASE
                     AKKLVKDLDFFSLPVQLGKNGITEVKYDILNQISDDEKKLLEVAIEQLQKNIEKGVSF
                     AKK"
     gene            140006..140312
                     /locus_tag="CD36_25655"
                     /pseudo
                     /db_xref="GeneID:8050070"
     misc_feature    140006..140312
                     /locus_tag="CD36_25655"
                     /inference="similar to AA sequence:UniProt:Q5AAK9"
                     /pseudo
                     /db_xref="GeneID:8050070"
     gene            <141259..>143967
                     /gene="NTC1"
                     /locus_tag="CD36_25660"
                     /db_xref="GeneID:8050071"
     mRNA            <141259..>143967
                     /gene="NTC1"
                     /locus_tag="CD36_25660"
                     /product="neutral trehalase, putative"
                     /transcript_id="XM_002421618.1"
                     /db_xref="GeneID:8050071"
     CDS             141259..143967
                     /gene="NTC1"
                     /locus_tag="CD36_25660"
                     /EC_number="3.2.1.28"
                     /inference="similar to AA sequence:UniProt:Q5AAL0"
                     /codon_start=1
                     /transl_table=12
                     /product="neutral trehalase, putative"
                     /protein_id="XP_002421663.1"
                     /db_xref="GeneID:8050071"
                     /db_xref="GOA:B9WKQ2"
                     /db_xref="InterPro:IPR001661"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011120"
                     /db_xref="InterPro:IPR018232"
                     /db_xref="UniProtKB/TrEMBL:B9WKQ2"
                     /translation="MFTKNHRRMSSTSSDDDPFDVAEKYYGEERKKKLNRVRTFSAFE
                     STKFGAGPISPLRSTYEPPPSIKETSEPLSSSSSSSPPTLTPQSSQVQFNLGVGKTKN
                     GSAIHSDSESEEGEEVDPVSSATKGERNEKDPFDTTDSKLENNNSTEHSSTSREIIPH
                     PTGFHGSPEESAPRRKPSIIPIYHDNISRDSVIRNANTPTTYNREKFHLRRGSLDEST
                     YVRPKKYYINDVQGTLKELLANEDTDNNCQITIEDTGPKVLRLGTANSLGINQSTIRG
                     TYRLSNLLQELTIASRFGRHQIVLDEARLSENPVDRMKRLISTSFWNNLTRVITKENI
                     VEMAKDTKIKESWIDEQGELHENQESHRIYVPYNRKDQYDFFQLIKSHRTDVQLDVQY
                     LPKKIDADYIKSINKKPGLLSIATRPDPETPGNLISWPYVVPGGRFNELYGWDSYMET
                     LGLLTDVKIDPSGNPCNIKHLELARGMAENFIYEIHHYGKILNANRSYYLGRSQPPFL
                     TDMALRIFNKTIEVAPESMDDAIDFLKRATLAAIKEYETIWCAHPRLDDKTGLSCYHP
                     EGKGVPPETEPTHFNAVLKPYLAKYGGIDQLDFIEKYNSGEIQEPELDEYFLHDRAVR
                     ESGHDTSYRLEGKCAYLATVDLNSLLYKYENDIAFILQSFFNDNLQDPFANDKTHSSK
                     IWLERSHQRKLNVDKYLWNEQDCIYYDYNVELQQQTNYESATTFWPLYAKLASPEQAA
                     KLIDQSLHKFEEHGGLVAGTLKSRGEVGLTRPSRQWDYPFGWAPQQILAWIGLVNYGY
                     DGIARRLAYRWLFMMTKSFVDYNGVIVEKYNVTKGAVPHRVDAEYGNQGLDFKGVATE
                     GFGWVNASYLFGLTFLNLYAQRALGSLTPPEIFLRNMHPEQRKQYK"
     gene            <144627..>146123
                     /locus_tag="CD36_25670"
                     /db_xref="GeneID:8049701"
     mRNA            <144627..>146123
                     /locus_tag="CD36_25670"
                     /product="hexaprenyl pyrophosphate synthetase, putative"
                     /transcript_id="XM_002421619.1"
                     /db_xref="GeneID:8049701"
     CDS             144627..146123
                     /locus_tag="CD36_25670"
                     /inference="similar to AA sequence:UniProt:Q5AAL1"
                     /note="Similar to S. cerevisiae COQ1"
                     /codon_start=1
                     /transl_table=12
                     /product="hexaprenyl pyrophosphate synthetase, putative"
                     /protein_id="XP_002421664.1"
                     /db_xref="GeneID:8049701"
                     /db_xref="GOA:B9WKQ3"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR017446"
                     /db_xref="UniProtKB/TrEMBL:B9WKQ3"
                     /translation="MLSFKQFRVSSSSLLTKRIRSRHHSSSTFKTAVETAEKLVTPPT
                     SKFSDPFSIVSHEMSNLAKSIANLIGSGHPTLNRVSSYYFEAEGKNVRPLIVLILSKA
                     LSRIPIEQRNRIPIDTIDVTEQKSFNGTPTKQNSTIAGKSIDDSLSPLAILHGINPKV
                     ILDPLSKPMDKLPIIGGSNKSEDKENSQGQLDILPKQRRLAEIVEMIHTASLLHDDVI
                     DLSDSRRGRPSGNIAFTNKMAVLAGDFLLGRASVAIARLRNPEVIELLSTTIANLVEG
                     EFMQLKNTVLQNNNNDEIFNDGDVKSIPQPTGKVPTKLHQYSVQQKNGGDAVVDHNIN
                     VEAAFEYYLHKTYLKTASLMSKSCRAAAVLSGSQDDIIENCYQFGRNLGLCFQIVDDM
                     LDYTSSDKTIGKPSQADLKLGLATAPILFAWKQEPKLGELIARKFNQPGDVEIARRAV
                     EKYNGVAQTKEMATMYCHQALKNLRVLPESEARSALELLTNSVLTRTN"
     gene            <146681..>147325
                     /locus_tag="CD36_25680"
                     /db_xref="GeneID:8050072"
     mRNA            <146681..>147325
                     /locus_tag="CD36_25680"
                     /product="Ran binding protein, putative"
                     /transcript_id="XM_002421620.1"
                     /db_xref="GeneID:8050072"
     CDS             146681..147325
                     /locus_tag="CD36_25680"
                     /inference="similar to AA sequence:UniProt:P41920"
                     /inference="similar to AA sequence:UniProt:Q5AAL2"
                     /note="Similar to S. cerevisiae YRB1; Ran-specific
                     GTPase-activating protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Ran binding protein, putative"
                     /protein_id="XP_002421665.1"
                     /db_xref="GeneID:8050072"
                     /db_xref="GOA:B9WKQ4"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:B9WKQ4"
                     /translation="MSAEDTKPKTEDSTSVPKPPTSNVFSMFGAKKEKKPEQEDSDNK
                     KPVESDKKEEKDSSKSTGDDNEVAEEEEADVEFTPVVQLDKKVEVKTNEEDEEVLYKV
                     RAKLFRFHADTKEWKERGTGDVKFLKHKTTGKVRILMRRDKTLKICANHLISADYELK
                     PNIGSDRSWVYTVTADVSEGEPEAQTLAIRFGNKENADLFKEHFDNAKKEAKKD"
     gene            <147983..>151945
                     /locus_tag="CD36_25690"
                     /db_xref="GeneID:8050073"
     mRNA            <147983..>151945
                     /locus_tag="CD36_25690"
                     /product="CDK inhibitor PHO81 homologue, putative)"
                     /transcript_id="XM_002421621.1"
                     /db_xref="GeneID:8050073"
     CDS             147983..151945
                     /locus_tag="CD36_25690"
                     /inference="similar to AA sequence:UniProt:P17442"
                     /inference="similar to AA sequence:UniProt:Q5AAL5"
                     /note="Similar to S. cerevisiae PHO81; phosphate system
                     positive regulatory protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="CDK inhibitor PHO81 homologue, putative)"
                     /protein_id="XP_002421666.1"
                     /db_xref="GeneID:8050073"
                     /db_xref="GOA:B9WKQ5"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:B9WKQ5"
                     /translation="MKFGKYLASRQLELPEYSGHFIDYKSLKKLIKQLAIPSTTTTTT
                     TTSIDGEVTISNIQQTLKENKASFFFRVERELEKVNSFYLEKQANLAINLNLLLMKRD
                     ELFNKSNQYLKRHGSAGDDSSLSNADINFRNSISFLNLYQNFKKIHQDLLRLQQFIEL
                     NETGFSKVVKKWDKRSKSHTKELFISTAVSVQPVFHKNEINELSDLVTQSLFDIESIM
                     DGDYSSLSNYNASTGVVSATATTTTTTTTTVSGSTPPAPGFNIPNVPGIDEHQAEEIF
                     TRHSSIVSSLPNNNEIDELYTSFVNVATIKEPDLSLLARWVEKINNGGSKSPEQPFTP
                     VVKYKISKIFLLSISNLKISDSFLELFLQFINYDVDFNFINDDFNNNKTILHQCCSIP
                     TASSQSDPNHNTSNHHPHHVTINNGVKVINSTDLINHSRTFIVKYIVEKLQFPSADEK
                     TKLLVHKDSNGKTCLHYAAQMNRPDLLDLLLLSYPQSHIDELDNDSMSPLLLAIKHGH
                     LNITKKLVRFGSNPFPKASKDTLQYLPINYACKFGDYKTLEYLLSNAKSQELIAKLIN
                     QQDVEGLLPLHVASRQGHYKLIKLLIQYGAQINKLDGFNKWTPIFYAAAEGHVKTTQE
                     LIKFGAKLNIIDEDGYNVLYYCVVEGHIDVINELLSYYQKGFPSSKLILDSANSTNST
                     SMSILGNGNDMDSGEEEEEGAPATTVTATAATTTADVDATSFNESNTSNNNVDSIPDL
                     QLPPPILPLRRYGHNFLEQKVLIELIFPSDQVFINLFNSTADLKPGRITITSNISDIV
                     PRNILLPIREDSYNNNGNSNNNCVFQTDVDSLCEFRIDFEIFPKFGTRLIAKTTALSF
                     EHITGNSPEINTVSLPLFDLRLKNIGELKFSYQVIFPYSGTLLETSKFDTYWKSSTSF
                     VKNRQTLKLNAAGGLSPNNFLSPGSVSTMPIPNNTNVNTTNNNNNGNGNAGVGVGGNS
                     TLIPSTQSIVTATSLSGEYLRIKVCLLSDGTPIVCPNWSISITDNIDLYLPNLTLKQL
                     NSITNDLFDYPRIIHDLSRLTNKDIPLIKKLLQIIYLPLDLVLDILNIDINLNLEIVF
                     PSLYELETLPFINNISNNLNQFIDNILSNVFNHIRSNKKRQQETQHIPNTTNPPSTNN
                     NNYRSIIFLSSNSLICKILNWKQPNFPVFLIMGGIAFNTKLNKFVKRTTNGLEITPHV
                     SQSLSRDGHLRSPSSPSSLELDDLTTRSIKEAVNFTINNNLIGLITSIHLLDLVPKLI
                     PLIRSTGLILVASSDVINEDKDKQDDEILRKELDCYTKTEINGLRFDDVLSFKEDISM
                     "
     gene            complement(<152048..>154312)
                     /locus_tag="CD36_25700"
                     /db_xref="GeneID:8050074"
     mRNA            complement(<152048..>154312)
                     /locus_tag="CD36_25700"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421622.1"
                     /db_xref="GeneID:8050074"
     CDS             complement(152048..154312)
                     /locus_tag="CD36_25700"
                     /inference="similar to AA sequence:UniProt:Q5AAL6"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421667.1"
                     /db_xref="GeneID:8050074"
                     /db_xref="InterPro:IPR018556"
                     /db_xref="UniProtKB/TrEMBL:B9WKQ6"
                     /translation="MNSFIIDSNDDSDYYYENNNNKERIEPYSSSLSLPLHTFPSSTV
                     SLVSNPRDFLEEEISTILINSDSSECNENFSIFIKCILDNVYNTSSKDKSSSSSTTIP
                     SSSYEEISYYALKLLTSNLFVKNFQFCVGKILAFLNMFTQITQTWLEETEEVNDQSSC
                     VKYESECLKEFLCITLLLLLKIKNSEDENTLDGNDSIISTDSASTTATATATDGLKLI
                     DIDYLFQTLSQFHIMSILAEFITTEIVAIDQNQSKFVILKFSCDIIFEYFYRIEILSD
                     IELNELINSANSNNNNKNLISTLVQYLLHNENFNNYDLDADDFNNEDKLIAYEELKLL
                     LLINEQFLMKSYNTNNKNLVFDELMMGNITNGNLNNITGFINLLIYHLNREESHIIKI
                     LILKFLYLVFTSSSTCKLIYLNDLKILIDILLRELNDLDYNDNIVLTMTYLRVLYPIL
                     MFSELCEINGHGYKSQEILETLRNIIINSEIKSVELEEELSISKLAVKCMNVKWLKKS
                     AQHQDFNQGIVDQSTKPAAITKSQSTQDTHSSEEDEEEEDDKIKLNEDINTSKESLAN
                     SFTRVASVRASSRSDYHKHTTVHNIERKNSMKSTATNSKTTTTNYDDPKNDMIMENNG
                     NIFLSKFSKMSINDNHNRNIRQLTNNTSMSDSLLYNSRKNSQSKPFITTTTNNNNNNR
                     TNHNLLDLPSEYLISKPLPKLPIPEKRQNMMIYDNNNNNSSTSSLNSNSSLKQKALKK
                     KAPPPPPPPPRRRK"
     gene            <155415..>159716
                     /gene="HYR1"
                     /locus_tag="CD36_25710"
                     /db_xref="GeneID:8050075"
     mRNA            <155415..>159716
                     /gene="HYR1"
                     /locus_tag="CD36_25710"
                     /product="hyphally-regulated protein precursor, putative"
                     /transcript_id="XM_002421623.1"
                     /db_xref="GeneID:8050075"
     CDS             155415..159716
                     /gene="HYR1"
                     /locus_tag="CD36_25710"
                     /inference="similar to AA sequence:UniProt:P46591"
                     /inference="similar to AA sequence:UniProt:Q5A6U1"
                     /inference="similar to AA sequence:UniProt:Q5AAL9"
                     /note="potential Hyr1-like cell wall protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="hyphally-regulated protein precursor, putative"
                     /protein_id="XP_002421668.1"
                     /db_xref="GeneID:8050075"
                     /db_xref="InterPro:IPR021031"
                     /db_xref="UniProtKB/TrEMBL:B9WKQ7"
                     /translation="MKLLQNILIIFALLTNFVFAIDITENRVDRGFVTLSFGEIIIHP
                     SASWSIIDNSFSNFIGKLDVKSKAGLYISSTSHLLALQVSLTSLLHSINNSGVISFDS
                     RVSLTPSSYDLRGLSFTNSGEMYFAASGRVPSTMSLTSASWTNTGLLSFYQNQRTSGA
                     VCLGFPLGSITNSGKICLNNQVYQQTTQIKGSGCFAANGDSTIYIANVLLSVSANQNF
                     HLVDKDSSMIVQAISTTQTFNVYGFGNGNKIGLTLPLIGNIFNSAYSYDSSTGILTLR
                     NILLEQNFNIGLGYDSNKFQVVTDSGSGIPSTIWGSVTYTGRVPTRTLPKSCQIACKP
                     IPEAPGVNPTDYTTTITKTNTAGNTITETGAVTISTDKSGSWFTTTSLFPTLATTTST
                     SISTTSSNVTPIKTTDNTLVEPLSTGDYISAPISSSDFISLESLVEQTLSNESPVSSS
                     AYYVSQESLAPSDASASDNSLFASESTLKTASGFLIAESSVTESYSQSADSGFFEIST
                     SSAIENSYISTPSSAEKSFFSEETHMSQASSTIDSYTYTSGLSSTTGSESYVTELSQF
                     SEVSLVTASESFITNELVGTESSNSGISLVSASVSTDLIGEPSISGDTLFESARQTEF
                     IKSSFSGDLVSESASGSFISSYVSNAKTRDISSDSFIASQFSVDESSYTSEMASERTI
                     ESFVQTSLYSIDFASETASESSSSMVVPSASTELSFETSSESIIAQSYISNDVPLESA
                     SQSFIVKPSYSEIAFESANESISSTIEVPLSSEIISEATGESIITQPSVSSGISLETT
                     SESMLFSDSSISTLFISSQTFHETTSDSILVVPSFFTSEVPFETDIYSSIVSTSLGSE
                     SVYSSKISLETPSESFIASENDVKEPSYSNEIILETPSTSFIASETYTVQSFVSGEVS
                     FESDRESTTSAKAILGELSVTGDLSSEITKESLVAQESVASESMILSETIIVEPSIFS
                     DLLFETTSQPTEIASSTTSGLYVSSTEELLASSDSAVDESSFAANSISATQAISLPVA
                     SESFVLTDSITFSETSSRYITISTFAPASDNSEKEFKTTWETANFDGSSVTESSILPT
                     TVITSSPSATNDVDNEITSTWNSISSDSSVATESDIVDQYTSHSTTSTSHPASKSLSD
                     RIETDFISTWTITGSLSDDSSSTTKPTPFSEFSNSDITTAVVSTWAAENSNLFTLVKS
                     STHLYVSGNFISSTATIVSIAEPILTSDVANTEYHSIGDVTKSTGSVSNQKAATTHYE
                     GGFTSESDIYTVVAPGESIQEFGTATITSCFESKCSESIVTYISNISHSTVTTGYVNS
                     VSTTDTYANDFSATGDYVASGSSRSAMEVTNSFATNTDIFSTSTALSQSDLFYSNSYI
                     STVTTGPITSSGSSQAIETGLSFVTTIRYENGSTNISTKHFKFMGIVVSILILFV"
     gene            complement(<160026..>161276)
                     /locus_tag="CD36_25720"
                     /db_xref="GeneID:8049692"
     mRNA            complement(<160026..>161276)
                     /locus_tag="CD36_25720"
                     /product="arginosuccinate synthase, putative"
                     /transcript_id="XM_002421624.1"
                     /db_xref="GeneID:8049692"
     CDS             complement(160026..161276)
                     /locus_tag="CD36_25720"
                     /EC_number="6.3.4.5"
                     /inference="similar to AA sequence:UniProt:P22768"
                     /inference="similar to AA sequence:UniProt:Q5AAM0"
                     /note="Similar to S. cerevisiae ARG1"
                     /codon_start=1
                     /transl_table=12
                     /product="arginosuccinate synthase, putative"
                     /protein_id="XP_002421669.1"
                     /db_xref="GeneID:8049692"
                     /db_xref="GOA:B9WKQ8"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018223"
                     /db_xref="InterPro:IPR023434"
                     /db_xref="InterPro:IPR024074"
                     /db_xref="UniProtKB/TrEMBL:B9WKQ8"
                     /translation="MSKGKVCLAYSGGLDTSVILAWLLEQGYEVIAFLANIGQEEDFE
                     EAEKKALAIGATKFVVVDVRKEFVEKVCFPAIQSNAIYENVYLLGTSLARPVIAQAQI
                     KVAEENGCFAVSHGCTGKGNDQVRFELSFYALKPDVVVIAPWRDPEFFQRFAGRKDLL
                     DYAASKNIPVAQTKAKPWSTDENLAHISFEAGILENPDTTPPKDMWKLTVDPTDAPDK
                     PETFSVVFEKGLPVKLILDDGKKVVTDPVELFIEANSLARRNGVGRIDIVENRFIGIK
                     SRGCYETPGLTILRNTHVDLEGLTLDREVRAIRDQFVTPTWAKILYNGMYFTPEGEYV
                     RSMIPPSQITVNGVVRAAAYKGSVTILGRSSDTEKLYDETESSMDELTGFSPEDTSGF
                     IAVQAIRIKKYGEAAREKGKPLDL"
     gene            <162264..>163865
                     /locus_tag="CD36_25730"
                     /db_xref="GeneID:8050076"
     mRNA            <162264..>163865
                     /locus_tag="CD36_25730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421625.1"
                     /db_xref="GeneID:8050076"
     CDS             162264..163865
                     /locus_tag="CD36_25730"
                     /inference="similar to AA sequence:UniProt:Q5AAM2"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421670.1"
                     /db_xref="GeneID:8050076"
                     /db_xref="GOA:B9WKQ9"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR007147"
                     /db_xref="UniProtKB/TrEMBL:B9WKQ9"
                     /translation="MEQNKKLGVTHAIREKLNFRDERLWKRFSARRLELIDTLDLSSR
                     KASEQEQEIRRVSEMLRLEFDYPASYTSDFNKLVRAAIQSVRRNRKRSSKKHTSPEES
                     SLKKRKLVDSDSNGNGNNTNSFLSEIVRNEEDVYDVNYNREKRFTSDDQAKGTIENMT
                     KPRLPPLTNFSMNKTINIPSAAVAKKNILNKIEKSRSCNESVNSKSENLQFLGKSVMS
                     TCIGYIFEKSFLDLNPQSMLYLRNKLNSEASLGKFFRQLDPVNTSSINDETAVISLYT
                     LLGAMVKDFGFEDIIFPICEILYASVLQEYPLMAKNSIPFRSEDQYLGSNITHPPEND
                     VYSLNKLAEVASHLQNTGSDTSMSTMEPSRSVTPTPSLTSSYKKRVYLKFFNQKLEFL
                     YPVRIAATPRYNELLENAKSAFKLPDTTIVFKHHGKIVQSDLELERVFKSDEDVIELE
                     ISTHNPMPIYEMHKRLSQQGYQHPTESQRIILPPPINTNATMNNGSNLTSRLGSFNFL
                     SNSEDASKPPLHPQRPILPNFQPLL"
     gene            <165377..>172063
                     /locus_tag="CD36_25740"
                     /db_xref="GeneID:8050077"
     mRNA            <165377..>172063
                     /locus_tag="CD36_25740"
                     /product="acetyl-CoA carboxylase, putative"
                     /transcript_id="XM_002421626.1"
                     /db_xref="GeneID:8050077"
     CDS             165377..172063
                     /locus_tag="CD36_25740"
                     /EC_number="6.4.1.2"
                     /inference="similar to AA sequence:UniProt:Q00955"
                     /inference="similar to AA sequence:UniProt:Q5AAM4"
                     /note="Similar to S. cerevisiae ACC1; biotin carboxylase,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="acetyl-CoA carboxylase, putative"
                     /protein_id="XP_002421671.1"
                     /db_xref="GeneID:8050077"
                     /db_xref="GOA:B9WKR0"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013537"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:B9WKR0"
                     /translation="MSDQSPSPSPSPSDSLSYTTLHESLPPHFLGGNSVLNAEPSKVK
                     DFVRAHQGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDEKAIQFTVMATPEDLEA
                     NAEYIRMADQFIEVPGGTNNNNYANVDLIVEIAESTNAHAVWAGWGHASENPLLPEKL
                     AASPKKIIFIGPPGSAMRSLGDKISSTIVAQHAQVPCIPWSGTGVDEVKIDPETNLVS
                     VADDVYAKGCCTSPEDGLEKAKKIGFPVMIKASEGGGGKGIRKVDDEKNFITLYNQAA
                     NEIPGSPIFIMKLAGDARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIA
                     RKETFHEMENAAVRLGKLVGYVSAGTVEYLYSHAEDKFYFLELNPRLQVEHPTTEMVT
                     GVNLPAAQLQIAMGIPMHRIRDIRTLYGADPHTTTNIDFEFKSETSLVSQRRPTPKGH
                     CTACRITSEDPGEGFKPSGGSLHELNFRSSSNVWGYFSVGNQSSIHSFSDSQFGHIFA
                     FGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETPDFEDNTITTGWLDELITKK
                     LTAERPDPIVAVVCGAVTKAHIQAEEEKNEYIQSLEKGQVPHKNLLKTIFPVEFIYEG
                     ERYKFTATKSSEDKYTLFLNGSRCVVGARSLSDGGLLCALDGKSHSVYWKEEASATRL
                     SVDGKTCLLEVENDPTQLRTPSPGKLVKYLVDSGEHVDAGQPYAEVEVMKMCMPLIAQ
                     ENGVVQLIKQPGSTVNAGDILAILALDDPSKVKHAKPFEGTLPAMGEPNVTGTKPAHK
                     FHHYAGILKNILAGYDNQVILNSTLKSLGEVLKDKELPYSEWQQHISALHSRLPPKLD
                     DGLTALVERTQSRGAEFPARQILKLITKAIHENGNDMLEDVVAPLVSIATSYQNGLIE
                     HEYDYFASLISEYYDVESLFSGENVREDNVILKLRDENKSDLKKVIGIGLSHSRVSAK
                     NNLILAVLDIYEPLLQSNSSVAGSIREALKKLVQLDSRACAKVALKAREILIQCSLPS
                     IKERSDQLEHILRSSVVQTSYGEIFAKHREPNLEIIREVVDSKHIVFDVLSQFLINPD
                     PWVAIAAAEVYVRRSYRAYDLGKIEYHVNDRLPIVEWKFKLASMGAAGVNDAQQAAVA
                     GGDDSTSMKHAASVSDLTFVVDSKTEHTTRTGVLAPARHLDDVDETLTAALEQFQPAD
                     AISFKAKGEAPELLNVLNIVITSIDGYSNENEYLSRINEILCEYKEELISAGVRRVTF
                     VFAHQIGQYPKYYTFTGPDYEENKVIRHIEPALAFQLELGRLANFDIKPIFTNNRNIH
                     VYDAIGKNAPSDKRFFTRGIIRTGVLKEDISISEYLIAESNRLMNDILDTLEVIDTSN
                     SDLNHIFINFSNAFNVQASDVEAAFGSFLERFGRRLWRLRVTGAEIRIVCTDPQGTSF
                     PLRAIINNVSGYVVKSELYLEVKNPKGEWVFKSIGHPGSMHLRPISTPYPVKESLQPK
                     RYKAHNMGTTYVYDFPELFRQATISQWKKYGKKVPKDVFVSLELITDETDSLIAVERD
                     PGANKIGMVGFKVTAKTPEYPHGRQLIIVANDITHKIGSFGPEEDNYFNKCTELARKL
                     GIPRIYLSANSGARIGVAEELIPLYQVAWNEEGSPDKGFRYLYLSTAGKESLEKDGKG
                     GSVVTERIVENGEERHVIKAIIGADDGLGVECLKGSGLIAGATSRAYKDIFTITLVTC
                     RSVGIGAYLVRLGQRAIQIDGQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYNNGV
                     SHLTANDDLAGVEKIMEWLSYVPAKRGLPVPILESEDSWDRDVDYYPPKQEAFDVRWM
                     IQGREVDGEYESGLFDKDSFQETLSGWAKGVVVGRARLGGIPIGVIGVETRTIENLIP
                     ADPANPDSTENLIQEAGQVWYPNSAFKTAQAINDFNNGEQLPLMILANWRGFSGGQRD
                     MYNEVLKYGSFIVDALVDFKQPIFTYIPPNGELRGGSWVVVDPTINSDMMEMYADVDS
                     RAGVLEPEGMVGIKYRRDKLLATMERLDPTYGDLKAKFNDSSLSPEEHSKVSAKLFAR
                     EKALLPIYAQISVQFADLHDRSGRMLAKGVIRKEIKWTDARRFFFWRLRRRLNEEYVL
                     RLISEQIKDASKLERVARLKSWMPTVEYDDDQAVSNWIEENHTKLQKRVNELKQEVSR
                     TKIMRLLKEDPNSAISAMKDYVEGLSKEDKEKFLKALK"
     mobile_element  172181..172456
                     /mobile_element_type="retrotransposon:solo LTR, kotuku K"
     gene            <173316..>174518
                     /locus_tag="CD36_25750"
                     /db_xref="GeneID:8050078"
     mRNA            <173316..>174518
                     /locus_tag="CD36_25750"
                     /product="cerevisin precursor, putative"
                     /transcript_id="XM_002421627.1"
                     /db_xref="GeneID:8050078"
     CDS             173316..174518
                     /locus_tag="CD36_25750"
                     /EC_number="3.4.21.-"
                     /inference="similar to AA sequence:UniProt:P09232"
                     /inference="similar to AA sequence:UniProt:P25381"
                     /inference="similar to AA sequence:UniProt:Q5AAM5"
                     /note="Similar to S. cerevisiae PRB1; putative protease,
                     subtilase-type YCR045C precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cerevisin precursor, putative"
                     /protein_id="XP_002421672.1"
                     /db_xref="GeneID:8050078"
                     /db_xref="GOA:B9WKR1"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:B9WKR1"
                     /translation="MVNILLSIWILIYFMTGLSFASSSYLVSLHSQETIDTFMAYDAT
                     YPQDLQVSELINSKFKIGNFSGFSGSFSEDIIKRLERCPLVDEIVPDITVKAYDATFQ
                     NSAPRHLARISRRKRMKPIKKYPYVYESDFIGKKVSAYVIDSGIAIGHPEFQGRARTG
                     KDFTDEGPGDKNGHGTHVAGLIGSHTYGVAKGVQIIDVKALNSKGTGSLSTILVAIEF
                     AVNHRLRSGRMGVANLSLGAYKNKLLNKAIDQATQTGLVFVVAAGNNNINACLTSPSS
                     SPYAITVGAIDDYNDSIASFSNWGECVDLFASGAYVKSVNIRSDFRPSVLSGTSMAAP
                     IVTGLVANLLNEGVDPELIKGQLIEMSTKHRISKSSLFLKKRTPNRIAYNGICYSYYQ
                     DEEDCFSD"
     gene            <174814..>176079
                     /locus_tag="CD36_25760"
                     /db_xref="GeneID:8050079"
     mRNA            <174814..>176079
                     /locus_tag="CD36_25760"
                     /product="cerevisin precursor, putative"
                     /transcript_id="XM_002421628.1"
                     /db_xref="GeneID:8050079"
     CDS             174814..176079
                     /locus_tag="CD36_25760"
                     /inference="similar to AA sequence:UniProt:P09232"
                     /inference="similar to AA sequence:UniProt:P25381"
                     /inference="similar to AA sequence:UniProt:Q5AAM8"
                     /note="putative protease, subtilase-type YCR045C
                     precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cerevisin precursor, putative"
                     /protein_id="XP_002421673.1"
                     /db_xref="GeneID:8050079"
                     /db_xref="GOA:B9WKR2"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:B9WKR2"
                     /translation="MYWVPFERGFSFIKKNGSNPVLFELTEMLINLACVFIALIDKCF
                     SNDSYFVSLKAEESIDHFMEYDKRYPKHLQVRDFISNSIAIGDFKGFSGRFSKDIIDR
                     LKRCPLVQEITEDIMFNALDFEIQEDAPRHLARISRRRRMKPNKPYPYMYETEYSGQG
                     VNAYVIDSGIEVDHPEFQGRASAGYDFTEEGSGDNNGHGTHVAGLIGSATYGVAKNVR
                     IVEVKALNSKGAGSLSTILAAIDFAVNHRIESGRKGVANLSLGAYKNHILNKAIEQAT
                     NTGLVFVVAAGNSNINACMTSPASSKYAITVGAIDDYTDSVTAFSNWGECVDIFASGA
                     YVRSVDARNHDKTQVLSGTSMASPIVTGMVANLLSQNVESWKVKSVLIRMAAKNKITK
                     TSLFLRKKTPNRILYNGVQERELENNEDD"
     gene            complement(<176125..>177357)
                     /locus_tag="CD36_25770"
                     /db_xref="GeneID:8050080"
     mRNA            complement(<176125..>177357)
                     /locus_tag="CD36_25770"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421629.1"
                     /db_xref="GeneID:8050080"
     CDS             complement(176125..177357)
                     /locus_tag="CD36_25770"
                     /inference="similar to AA sequence:UniProt:Q5AAM9"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421674.1"
                     /db_xref="GeneID:8050080"
                     /db_xref="GOA:B9WKR3"
                     /db_xref="InterPro:IPR007871"
                     /db_xref="InterPro:IPR021721"
                     /db_xref="InterPro:IPR022776"
                     /db_xref="UniProtKB/TrEMBL:B9WKR3"
                     /translation="MTAQETKKRKVEQNVLTCEYILPKKNRRCKMLRKKDAKYCSEHL
                     IHDENFNGERIACPFSSSHTVWKKDLKQHLRKCNDRPKENTNSCYELDFNKQLNNAEN
                     FELGNEEEEENTELMEKCIHILQKIQFEPLEFRILHHEGLETRLQEKTNQKHPIQQNS
                     IIANMESMGLLNNSFFYLEFGAGKGELSRYLNQCILQQRTSSSCTYGFGLIDRGKNRL
                     KADSKIISDSEAVHIKPQIKRSKIDIKDLNLDKFLVDLKINKVVAISKHLCGAATDLT
                     LKSIFNSTLLSNDQFGGALIAMCCRHVCSLDQLLPQSRKYLHDHDFKTVQSFNILKKL
                     VSWAVDKKDAQENSILGFNSQQREEIGLKARRLIDESRVHALKSILDDKYKVEIFWYV
                     QKDVTLENVCLSISKRTK"
     gene            <177534..>178904
                     /locus_tag="CD36_25780"
                     /db_xref="GeneID:8050081"
     mRNA            <177534..>178904
                     /locus_tag="CD36_25780"
                     /product="bud site selection protein 22, putative"
                     /transcript_id="XM_002421630.1"
                     /db_xref="GeneID:8050081"
     CDS             177534..178904
                     /locus_tag="CD36_25780"
                     /inference="similar to AA sequence:UniProt:Q04347"
                     /inference="similar to AA sequence:UniProt:Q5A841"
                     /note="Similar to S. cerevisiae BUD22"
                     /codon_start=1
                     /transl_table=12
                     /product="bud site selection protein 22, putative"
                     /protein_id="XP_002421675.1"
                     /db_xref="GeneID:8050081"
                     /db_xref="InterPro:IPR015158"
                     /db_xref="UniProtKB/TrEMBL:B9WKR4"
                     /translation="MKTNNYMWKLDLLESKFNRSTPRFPHTKKLLIAINHNHKLLKKI
                     PKSPEDAQEEIENIKSDIFQKKYHSAYSKLSKEVEKKTIPVEDKEFVSKLITSKLIKI
                     IQIACLNSKELKTNPPTYIGQHLREIIIDKSNEYNPSSFYITFCQNDKAVNNFVANLW
                     NNKNVKKILDEIEWSFRVVRGNLTRQEKDSRIKTTGGKVNLKDNEGSNGEDSSEDENG
                     SLDLDDAYDKFAIYDDNENGSEGEGQQPELDPNVNYNEVTDEEPSDEETKEDSSDDFF
                     EDEPPKKKQKQNEDSKKSFNLPQLASGYFSGGSDDEEEEYDDADNDKVVKEITTQRKN
                     RRGQRARQKIWAKKYGKEAKHVKKNQEILASERQRRQLEFEERQRKRELKAKLLAEKQ
                     QTGANALPLGERKSTTSTIPQQSLGSTNTATAEEKAIHPSWEAKRLEKEKLKNVKFQG
                     KKVVFD"
     gene            complement(<178918..>180357)
                     /locus_tag="CD36_25790"
                     /db_xref="GeneID:8050082"
     mRNA            complement(<178918..>180357)
                     /locus_tag="CD36_25790"
                     /product="glucosidase II subunit, putative"
                     /transcript_id="XM_002421631.1"
                     /db_xref="GeneID:8050082"
     CDS             complement(178918..180357)
                     /locus_tag="CD36_25790"
                     /inference="similar to AA sequence:UniProt:Q04924"
                     /inference="similar to AA sequence:UniProt:Q5A842"
                     /note="Similar to S. cerevisiae GTB1"
                     /codon_start=1
                     /transl_table=12
                     /product="glucosidase II subunit, putative"
                     /protein_id="XP_002421676.1"
                     /db_xref="GeneID:8050082"
                     /db_xref="GOA:B9WKR5"
                     /db_xref="InterPro:IPR002172"
                     /db_xref="InterPro:IPR009011"
                     /db_xref="InterPro:IPR026874"
                     /db_xref="InterPro:IPR028146"
                     /db_xref="UniProtKB/TrEMBL:B9WKR5"
                     /translation="MFQHLLTFYCLVTFVLGEIRGVSPENQDLYKPIIENGKQYWRCL
                     NDSSIRLTYDQINDNFCDCPDGSDEPGTNACPNPPFKFYCANKGHFPNFIDQFKVDDG
                     VCDYDICCDGSDEQGICEDKCENIHHQYEQYKNQLESFINDALKKKQALIELAQGKRK
                     QLVNELRKLEAVLPSRKSHLYELEVQLENSNEQETSVFDVLGDHISDLANKLEVHKRD
                     LLKQESRIQSLEKLLEKLSQEYNPNFNDPAVKESIHKYQEYLSNKDEDVVEDIKETNA
                     ILSELSEKAKSLVGNSENIYSQPTIRNMIHHYFQLFTNTFLTKPQLQVKTTLSNDQLL
                     NQIDKQKQEINKIESKIDDIKKNLSNDYGSDDILRAFDSAIINKKLGAYTYRINLLHS
                     VVQDDVLIGNYKKYENGMIYFDRGAKCWNGPQRSAVIEFECGKGPELVSVGEPEKCSY
                     KFIIKGEAWCHPITEQEIQNRFRINYELL"
     gene            <180490..>181881
                     /locus_tag="CD36_25800"
                     /db_xref="GeneID:8050083"
     mRNA            <180490..>181881
                     /locus_tag="CD36_25800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421632.1"
                     /db_xref="GeneID:8050083"
     CDS             180490..181881
                     /locus_tag="CD36_25800"
                     /inference="similar to AA sequence:UniProt:Q5A843"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421677.1"
                     /db_xref="GeneID:8050083"
                     /db_xref="UniProtKB/TrEMBL:B9WKR6"
                     /translation="MPNNITTIRYKRQIRPLLSKIHTLNDLYSKNASLFEFDVSKIDI
                     NKQIKSTVDDDDYHPRKKTKTISPEESIEPDFYNPRTPEERLKSLRRYVSSELFKAYT
                     ELFSILKPLLISLAPPDCTWTLATRCAFEIGKEMAESTTTTYYRLNNVHLFDPDLVHP
                     SIKELYDELYGDIDDWIDMEPVLVTSNYRRYLLTGYVSKLLVIHSQTTLYMFLPVLLH
                     WLSHQSSYLRHLGQLLGNDFFCFPDNSTTNIEELNGLKFNNTLQMFWTLYGINYWKPF
                     LNRTTLSVVLPYKISLDMFDGLEDTHQLPKGYYRRELYAMFQSCLNYNIIVMIMVKIF
                     QKARKKCKTYEEAYQHFKNIYISTLEMACNWLPFYSTIFPNNKIIFNSIRQLERFMQS
                     KLKVLSGQGGKYMLLYKKSQGFFESLDAISYYYLYPERKITLSSVDTIAKTAVKLRID
                     NHKFLAWLNKNAY"
     gene            complement(<181910..>182596)
                     /locus_tag="CD36_25810"
                     /db_xref="GeneID:8050084"
     mRNA            complement(<181910..>182596)
                     /locus_tag="CD36_25810"
                     /product="oxidoreductase, putative"
                     /transcript_id="XM_002421633.1"
                     /db_xref="GeneID:8050084"
     CDS             complement(181910..182596)
                     /locus_tag="CD36_25810"
                     /EC_number="1.-.-.-"
                     /inference="similar to AA sequence:UniProt:P35731"
                     /inference="similar to AA sequence:UniProt:Q5A845"
                     /codon_start=1
                     /transl_table=12
                     /product="oxidoreductase, putative"
                     /protein_id="XP_002421678.1"
                     /db_xref="GeneID:8050084"
                     /db_xref="GOA:B9WKR7"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:B9WKR7"
                     /translation="MFRGKTALVTGGSRGIGFAISKKLAIEGATVTLLARNEATLKQS
                     LSKLSTDYGQTHTYHPLDLTSLLHNPQELNFGSPTILINCAGVTNHSLLLRMTQEEIL
                     TTINLNLTVPILLSQMVVKDMLRQKGSDPTILNISSVLSMTEHFIPGTSVYAASKAGL
                     LGFTKSLGKELRGKIRVNALMPGLVKETDMGNKAVADINSVSIESVANEAIRILQDTK
                     LNGECIILDK"
     gene            complement(182713..182785)
                     /gene="tRNA-Thr (AGT)"
                     /locus_tag="CD36_tRNA_0089"
                     /db_xref="GeneID:8050085"
     tRNA            complement(182713..182785)
                     /gene="tRNA-Thr (AGT)"
                     /locus_tag="CD36_tRNA_0089"
                     /product="tRNA-Thr"
                     /anticodon=(pos:complement(182750..182752),aa:Thr,seq:agt)
                     /db_xref="GeneID:8050085"
     gene            complement(<183296..>184942)
                     /locus_tag="CD36_25820"
                     /db_xref="GeneID:8050196"
     mRNA            complement(<183296..>184942)
                     /locus_tag="CD36_25820"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421634.1"
                     /db_xref="GeneID:8050196"
     CDS             complement(183296..184942)
                     /locus_tag="CD36_25820"
                     /inference="similar to AA sequence:UniProt:Q4WDQ0"
                     /inference="similar to AA sequence:UniProt:Q5A846"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421679.1"
                     /db_xref="GeneID:8050196"
                     /db_xref="InterPro:IPR021988"
                     /db_xref="UniProtKB/TrEMBL:B9WKR8"
                     /translation="MFESDLAFYLALLILISPISLVFFKRFPIKGYSGANKVSFCLQC
                     LIALLNLNILYCFINSLTIELSHDNTANTLSIDPITATQQQGQVDYTPIKVSGYTFKN
                     QVATKNLKCDTIVYDQDINLQVSQAVNLNKPGDLKFFRGKLNQLRSSNKIYDLFFQDN
                     ENEVEESILERKWYKFCGSAVWLDKYGVYFMVNRIAYSKKGTRNNPTISVLAGQVFDK
                     NWVELTGKKFPFSELEFPTILPHDIDEGKEDEKVILGAEDPRVILHEYSNENGVRIQE
                     PLIAFNSLSTEVDWKRAMHIYRPLHDPHRIIRLSIENYAPREKEKNWAPFMDGNNLNF
                     VYNFPLRILRCNIDNGDCQKISGPDFNDKSNENAGKLRGGTNLVEIPSKSLPKHLRSR
                     KYWFGIARSHITNCGCVGELYRPHLILISRSKKSDQYQLNYVSDLLDFNINPEPWNPG
                     KSTCSDGKSVLIPNSLAFTKDDYMSVTFSEADKTNKMINAKGWLTYITKVLEFSRERL
                     NDESVDLVLESRLLSECSTFLSQQYCELSKDTMGWDKLLR"
     gene            complement(<185951..>187372)
                     /locus_tag="CD36_25830"
                     /db_xref="GeneID:8050086"
     mRNA            complement(<185951..>187372)
                     /locus_tag="CD36_25830"
                     /product="JmjC domain-containing histone demethylase,
                     putative"
                     /transcript_id="XM_002421635.1"
                     /db_xref="GeneID:8050086"
     CDS             complement(185951..187372)
                     /locus_tag="CD36_25830"
                     /EC_number="1.14.11.27"
                     /inference="similar to AA sequence:UniProt:P40034"
                     /inference="similar to AA sequence:UniProt:Q5A847"
                     /note="Similar to S. cerevisiae JHD1"
                     /codon_start=1
                     /transl_table=12
                     /product="JmjC domain-containing histone demethylase,
                     putative"
                     /protein_id="XP_002421680.1"
                     /db_xref="GeneID:8050086"
                     /db_xref="GOA:B9WKR9"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:B9WKR9"
                     /translation="MPINSESCPLCRAHSHTTEKEEDKTSWVQCSKCKIWYHVHCLNL
                     PTEEINQIVIYHCPECVPKYGESTYKRKSKRARVSIDYQSLNEGDTFAIDKSNHFHLH
                     NFLNFKGETNLNVTDKLTKTYALDTHMEKPILIPQANLTQNGMQFPVDKKEITIDYIT
                     DCCGEDTPLEVMDVISQQGISPPWRLKQWREYFKTSEEKRDRIRNVISLEISDVAKFG
                     ANFTRPKCVRDMDVVDRVWIEEDEQKRSKVTKYCLMSVKNSFTDFHIDFGGTSVYYTV
                     LSGAKTFLFFPPTDNNLELYKSWCLEPSQNFIWYPEYTITKNKKKIKPNDGFKVNLKP
                     GDLFIIPSGWIHAVHTPQDSIVIGGNYLTIRDMVMQLKINEIERATKVPTKFRFPMFN
                     KVLWLTAWYYYNHQNKFLDDIGEDEDGNAILTRLIGHLQGHLELSKTNATAKRSIPKI
                     IGKPMVFINKLLEWKEVMYGTAV"
     gene            complement(<187941..>191624)
                     /locus_tag="CD36_25840"
                     /db_xref="GeneID:8050087"
     mRNA            complement(<187941..>191624)
                     /locus_tag="CD36_25840"
                     /product="Hyr1p homologue, putative"
                     /transcript_id="XM_002421636.1"
                     /db_xref="GeneID:8050087"
     CDS             complement(187941..191624)
                     /locus_tag="CD36_25840"
                     /inference="similar to AA sequence:UniProt:P46591"
                     /inference="similar to AA sequence:UniProt:Q5A849"
                     /inference="similar to AA sequence:UniProt:Q6VBJ1"
                     /note="Similar to S. cerevisiae HYR1; hyphally-regulated
                     cell wall protein, putative; hyphally-regulated protein
                     precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Hyr1p homologue, putative"
                     /protein_id="XP_002421681.1"
                     /db_xref="GeneID:8050087"
                     /db_xref="InterPro:IPR021031"
                     /db_xref="UniProtKB/TrEMBL:B9WKS0"
                     /translation="MFPFLKVIVFIICLLPIFSALEIKENKIDRGKLNFDMQDITIKS
                     GVFWSIVDNSISTFLGSLTVEPHASFFVSSTSPILALQVAFVSFFGVFHNQGNIIFDS
                     RASFTSATYRIATSTFRNTGKMFFSASGTFPNTMDISASNWTNDGLLSFHQDQRTSGV
                     VSLGLPLGTIVNNGQIKLSNQVYQQRTQINGTGCFIATNNSTIYISNSLLPVYRTQNF
                     YLADDTSSIIVDSFSATQTFNVYGFGNGNKIGLTLPLVGNYWYSSYTYDATTGILVMR
                     NVFLEQKFNIGLGYNPSLFKVVTDWGAGIPSTILGSLSYSGCVPLKQLPSICKIELIS
                     SLDIPGTKPTQFTSTFISTDDSGRNAEYVGMFDVATNKNFEWVSAMAIITTLPINTVE
                     YPVTPVLEAQWLPTVSSFRSSSSTNKVTPIQSTETGVSTTISLVQITETLLPSGTFST
                     VKPLVSETTSLGLLFPTKTETQILIESTLIPVLPPKVTYFTNSSSKNEIYSSEVIVDR
                     EPISSELLMSDEVSNEVDKLCTDEFCVVSSDFSIEADYSSYYGIGFETFETFDTIEAF
                     GSAERFETAESFHIAETFDTVESSSIVETSQKFESSKTSIETSEWSTFSFPRESFSGL
                     PPPLIQSDTPVSFNSEPTKDTRSEMTIMWEVTDIQGSIITESGIILISGEYETTVTTF
                     PQDSYQLEGHTKYTKTWEVTNNNGSVVTESGLIEESGSYHTTVTTFPPNDRNWAWAAN
                     TIQFTKTWLVTNADGSIITESGIVGESDSYQTTVTTFPQELSSVSIYQTSKTHLPETI
                     NTDDTDPIPLATSSSIYQSVVVENEFTYLSDGTNTGVFNPTTGLGSDLSDDSMFIISQ
                     SLASIDPIESDYISESAVLDSRSLVTTQSMKSPTSLTAILSRVESSVDQFEYVSTLDS
                     KTSGGPIRIVPSEFPESDAPLIIELPDGESLNKTSVTSSIAVNETQNGIEPEFRQNED
                     VIITSTDSDIAHSIRISEETSGVSNYGDVDDDFTVNFVLLTSNYDNTGSKATSVDYSW
                     KLIVKSDEVQIGQTTGDYNYSIAAANTHHQGGASTQQSASTQQGTYTQQGVQQGSYLR
                     QDVSTQQGTQQGTGYTVADSHFEDFFSSKTTSTTTDDFTRSFDSKDNTTDISTSFFAH
                     LSIVGNSTVFETDYTDFSFIPKSNTSKSDIRGIDFVSNRTYNSHIEGSNVSSLVVKSG
                     SVVPLTRTVIVFVLLAISVVFML"
     gene            complement(<192512..>194497)
                     /locus_tag="CD36_25850"
                     /db_xref="GeneID:8050088"
     mRNA            complement(<192512..>194497)
                     /locus_tag="CD36_25850"
                     /product="glycogen [starch] synthase, putative"
                     /transcript_id="XM_002421637.1"
                     /db_xref="GeneID:8050088"
     CDS             complement(192512..194497)
                     /locus_tag="CD36_25850"
                     /EC_number="2.4.1.11"
                     /inference="similar to AA sequence:UniProt:P23337"
                     /inference="similar to AA sequence:UniProt:Q5A850"
                     /note="Similar to S. cerevisiae GSY1"
                     /codon_start=1
                     /transl_table=12
                     /product="glycogen [starch] synthase, putative"
                     /protein_id="XP_002421682.1"
                     /db_xref="GeneID:8050088"
                     /db_xref="GOA:B9WKS1"
                     /db_xref="InterPro:IPR008631"
                     /db_xref="UniProtKB/TrEMBL:B9WKS1"
                     /translation="MARDIDNHLLFEVATEVAHKVGGIYSVLKSKAPVTVAEYRERYT
                     LLGPLHYDSAQIEVEELPVTDPHIKQTLDSMSSKGIRWLYGRWLIEGAPRVLLFDIWS
                     AGHYLNEWKADLWNVAGIPTPDHDSETNDAILLGYLVAWFLGELVYNDRDRAVICQCH
                     EWLAGIALPLCRKRRIDVTTIFTTHATLLGRYLCAGSTDFYNNLDKFDVDAEAGKRGI
                     YHRYCIERSATHSADVFTTVSDITAYEAEHLLKRKPDGVLPNGLNVVKFQAVHEFQNL
                     HAIKKAKINEFVKGHFYGNYDFDLDNTLYFFIAGRYEFRNKGCDFFIESLARLNHKLK
                     EAGSKTTVVAFIIMPGKTQSYTVETLKGQAVVKQLESTIGEVQKKVGERLFEYCARYP
                     NADHQGNDEVPTIDELIKPADRVLLKRRIFALKRDGLPPIVTHNMVDDSTDPVLNHIR
                     RVQLFNKPEDRVKIIFHPEFLNANNPILSLDYDEFVRGCHLGVFPSYYEPWGYTPAEC
                     TVMGIPSITTNLSGFGCYMNDLVENPTDYGIYIVDRRMKSVDESINQLTDYMFDFCAK
                     SRRQRINQRNRTERLSVLLDWRSVHSEYSKARLLALKRAYPDYVGEKVVESKMKITRP
                     MSVPGSPRSLLLTPGDLGSLQDANQDISYFELGEEES"
     gene            complement(195701..196061)
                     /locus_tag="CD36_25855"
                     /pseudo
                     /db_xref="GeneID:8050089"
     misc_feature    complement(195701..196061)
                     /locus_tag="CD36_25855"
                     /inference="similar to AA sequence:UniProt:Q5A851"
                     /pseudo
                     /db_xref="GeneID:8050089"
     gene            complement(<196569..>199349)
                     /locus_tag="CD36_25860"
                     /db_xref="GeneID:8050090"
     mRNA            complement(<196569..>199349)
                     /locus_tag="CD36_25860"
                     /product="U3 small nucleolar RNA-associated protein,
                     putative"
                     /transcript_id="XM_002421638.1"
                     /db_xref="GeneID:8050090"
     CDS             complement(196569..199349)
                     /locus_tag="CD36_25860"
                     /inference="similar to AA sequence:UniProt:P25635"
                     /inference="similar to AA sequence:UniProt:Q5A852"
                     /note="Similar to S. cerevisiae PWP2; U3 snoRNA-associated
                     protein, putative; periodic tryptophan protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="U3 small nucleolar RNA-associated protein,
                     putative"
                     /protein_id="XP_002421683.1"
                     /db_xref="GeneID:8050090"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027145"
                     /db_xref="UniProtKB/TrEMBL:B9WKS2"
                     /translation="MKSDFKFSNLLGTVYRKGNLVFNQDGTKLLSPVGNRVSCFDLIK
                     SQSFTFNYQHRKNVQCIALNNQNTLMISIDEDGRAILVNFVSRVVLHHFNFKSKVNDI
                     KFSPCGKYFAIAIDRFIQVWKTPDLTEDRQFAPFVRHRIYSGHFDEVLNISWSLDSRF
                     FISTSKDMTAKIFSLNSDEKDVAMTFSGHRDYVINAFFSHDQEIIYTVSKDGALFKWE
                     YTERPKPENEESDDDDDDDETDKPMSWRITAKNFFYADGKLKCACFHPESKLLVVGFT
                     NGEFRLYEIEDFNLIQSLSMGQNAVNTVNINKTGEWLAFGSAKLGQLLVYEWQLESYI
                     LKQQGHFDSMNTLCYSPDGSRLVTGSDDGKIKIWDVRSGFCLMTFTEHTSAVTQVQFA
                     KRGQVLFSSSLDGTIRAWDLIRFRNFKTFTATSRVQFNCLAVDPSGEVIVGGSQDTFE
                     IYVWSVQTGQLLDSLTGHEGPISCLTFGKENSILASASWDKTIRIWNIFSRNQTVEPI
                     EIQSDALCLTMRPDCKELAVSTLDGHITIFDIEDAKQLHLIDGRKDIVNGRYLEDKFI
                     AKNSNRGKYFSTIAYSFDGLTLLAAGNNNSICMYDIENEVLLKRFIVSENMSLDGTLQ
                     FLNSSKITDAGINSDLIDRAGELSDLEDRVDNSLPGSHRGGDPSERRTRPEVRVTAVE
                     FSPTTAAFAAASTEGLLIFSINQELIFDPFDLDVDITPEATLESLKEKEYLVALVMAF
                     RLNENYLIHRVIESIPLQDIKLVCQDLPVIYVNRVLNFIGELLTKKESPHIEYYLIMV
                     KNLLIQHGRHISQNKFEFQSSMKLLSRFLNKTAKDVINVGKRNDHLLTYLTVSKDLKG
                     PNHHSEGEEDIEMNEDSDAENIEIDDDDDEEGWLGPNGKSVKAANGIVFSGPDNSSED
                     EDEEDEDELIEV"
     gene            <199611..>200006
                     /locus_tag="CD36_25870"
                     /db_xref="GeneID:8050091"
     mRNA            <199611..>200006
                     /locus_tag="CD36_25870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421639.1"
                     /db_xref="GeneID:8050091"
     CDS             199611..200006
                     /locus_tag="CD36_25870"
                     /inference="similar to AA sequence:UniProt:Q5A853"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421684.1"
                     /db_xref="GeneID:8050091"
                     /db_xref="InterPro:IPR019324"
                     /db_xref="UniProtKB/TrEMBL:B9WKS3"
                     /translation="MSTGLSNRVMNMKFMQKAEDSKLGKQKLEEQKKIHDLSEWVLPD
                     SAKLLKLAAMKPKIERVGFGTIMTNGSYNYSSTIKRSWGSNVSFEEIEDSESNNVEDI
                     DDEPLDLNTMWRKRKLESPSNSNKKKRFF"
     gene            complement(<200017..>201001)
                     /locus_tag="CD36_25880"
                     /db_xref="GeneID:8050092"
     mRNA            complement(join(<200017..200211,200303..>201001))
                     /locus_tag="CD36_25880"
                     /product="yeast Impact homologue, putative"
                     /transcript_id="XM_002421640.1"
                     /db_xref="GeneID:8050092"
     CDS             complement(join(200017..200211,200303..201001))
                     /locus_tag="CD36_25880"
                     /inference="similar to AA sequence:UniProt:P25637"
                     /inference="similar to AA sequence:UniProt:Q5A855"
                     /inference="similar to AA sequence:UniProt:Q9EQH0"
                     /note="Similar to S. cerevisiae YIH1;
                     has sequence similarity to the mouse IMPACT gene;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="yeast Impact homologue, putative"
                     /protein_id="XP_002421685.1"
                     /db_xref="GeneID:8050092"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020569"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:B9WKS4"
                     /translation="MTVEELTDEISAIDAIYPNSVTSIGPQIYTFKIPNHESVSIQLN
                     FPLTYPEEIPQLLQIIVEKTTQSSSFTDTSYLEKHVDEILQRVFVPEQVVLFELLTEL
                     QEFFDQYVEEHQQVMVEETEVMPVNEKQPKQVTPIESHIDVLQELKDPTIDWIQSDPI
                     VDRGSTFIAYVRQVNCLQEAQEYLDNLLTDKKIAKATHNISSWRIKMENGVTFQDCDD
                     DGETAAGGRLLHLLQMMDVWNVIVVVSRWFGGTHLGPDRFKHINSAAREAIIKGNFIV
                     DANDNTNGSSTKTNNAKKKKK"
     gene            <201514..>202509
                     /locus_tag="CD36_25890"
                     /db_xref="GeneID:8050093"
     mRNA            <201514..>202509
                     /locus_tag="CD36_25890"
                     /product="heat shock protein Sti1 homologue, putative"
                     /transcript_id="XM_002421641.1"
                     /db_xref="GeneID:8050093"
     CDS             201514..202509
                     /locus_tag="CD36_25890"
                     /inference="similar to AA sequence:UniProt:P15705"
                     /inference="similar to AA sequence:UniProt:Q5A857"
                     /note="Similar to S. cerevisiae STI1"
                     /codon_start=1
                     /transl_table=12
                     /product="heat shock protein Sti1 homologue, putative"
                     /protein_id="XP_002421686.1"
                     /db_xref="GeneID:8050093"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR025986"
                     /db_xref="UniProtKB/TrEMBL:B9WKS5"
                     /translation="MLSAEELKNQGNKAFSSKEYKKAAKIYRDAIQLDPYNPILYSNR
                     AQCFLYLQDYDRAYKDCVSGINLINSENHHHGSTAVLVKLQYRKGMALKGLQKWNSAK
                     EAFKKVLELDSSNQPAKTELSNLPIEDKMDVSIKIPVEKVEKLPKEFSEMIKSPPPME
                     NKPVKEPIVTTAATKEIETLFGSSKKQDNSKPLGKTETPHGSNKENADSTSTAMLSPM
                     HFLTTLKQLPEEQKLNGYRYILNIDNQSYADIFSSGIDAEFLQFYLDAASYVSTNDSL
                     SNWNQVVLNHLREFSTFKRYNLSLLMCDDKPKQTILQNIKNKFPEDLSEYQKYIS"
     gene            complement(<202510..>207768)
                     /gene="GSL2"
                     /locus_tag="CD36_25900"
                     /db_xref="GeneID:8050094"
     mRNA            complement(<202510..>207768)
                     /gene="GSL2"
                     /locus_tag="CD36_25900"
                     /product="glucan synthase, putative"
                     /transcript_id="XM_002421642.1"
                     /db_xref="GeneID:8050094"
     CDS             complement(202510..207768)
                     /gene="GSL2"
                     /locus_tag="CD36_25900"
                     /inference="similar to AA sequence:UniProt:O13423"
                     /inference="similar to AA sequence:UniProt:Q45U52"
                     /codon_start=1
                     /transl_table=12
                     /product="glucan synthase, putative"
                     /protein_id="XP_002421687.1"
                     /db_xref="GeneID:8050094"
                     /db_xref="GOA:B9WKS6"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:B9WKS6"
                     /translation="MILTFLFNYTDRNPKGYTSAFPSTGFRTPYVNSSRWQEVQKIGN
                     FDDFEDKFTDEPGKQLGENGIYDIYSNKYDPYPTWNPPEAVPITREDIEAIFLQLTTI
                     FGFQFDNTRNMFDYLMRLLDSRTSRLGPTHALRSIHADYIGGMNSNFRKWYFAAQLDI
                     DDFVGFDNVAKNGKIKGSNDPVPTLEQAESQWSTNMLALSPTDSVIQLAIYLLIWGEA
                     NNIRFMPECICFIFKCCNDFYFSIDPDTPVATATPSFLDHIISPLYNFYRDQSYILVD
                     GKYRRRDKDHESVIGYDDMNQLFWYSKGLERLVLADKKSRLMSLPPGERYQKLNQVLW
                     NRVFYKTFKESRGWSHVLVNFHRVWIIHSAVFWYYTAFNSPTLYTKNYQPSLDNQPTT
                     QARLSVLSLGGVVAVVIDIISLLFELRFIPRKWTGAQPVSKRLALLILALVLNVGPSV
                     YLFMFIPLNVETTVGLVISAFQFSFSVIMVLYLSTVPLGRLFSKKPKANDRRFLPQRS
                     FVTNFYSLAEGDRVASYGLWFAIFVSKFIESYFFLTLSLRDPVRELSIMKMNRCAGEV
                     WLGSWFCTRQPTIVLGLIYLTDLVLFILDTYLWYIVWNTVFSVCRSFYIGVSIWTPWR
                     NIFSRLPKRIFSKIISVSGDKNIKSKLLVSQVWNSIIISMYREHLISLEHVQKLIYKQ
                     IDNPGVEGDSVLKEPIFFVSQEDQTIKSSLFQDQAEAQRRITFFAQSLSTPMPEVGPV
                     HLMPSFTVLIPHYSEKITLSLREIIREEEQYSHVTMLEYLKSLHPLEWSCFVKDTKLL
                     AEEFETDSSSAELKREKLDDLPYYSVGFKVATPEYILRTRIWASLRSQTLYRTISGFM
                     NYSRAIKLLFDVENPDSTKFGTENDKLEQAAIMAHRKFRIITSMQRLKYFTPEEKENT
                     EFLLRAYPELQICYLDEEIDEASGEVVYYSALVDGSCAILENGEREPKYRIRLSGNPI
                     LGDGKSDNQNHSLIFCRGEYIQLVDANQDNYLEECLKIRSILAEFEEATFPLDPYSTD
                     LEGTESVYPVAIIGTREYIFSENIGILGDVAAGKEQTFGTLFARTLAHIGGKLHYGHP
                     DFLNGIFMTTRGGVSKAQKGLHLNEDIYAGMNVVLRGGRIKHCEYMQCGKGRDLGFGS
                     ILNFTTKIGAGMGEQMLSREYFYMGTQLPLDRFLSFYYAHSGFHLNNLFIMLSIHLFL
                     LVGANLAALTSESTICEYDKFRPITDPKRPHGCYNLIPVVHWLQRCIFSIFIVFVISF
                     VPLAVQELTERGFYKAITRLGKQFASFSPLFEVFVCKIYAHSLSSDISIGGARYLATG
                     RGFATIRVPFATLYSRFAVESLYYGSICGLLIFYCSLSMWKLQLLYFWITILGLLICP
                     FLYNPNQFSWNDFFLDYKECIQWFYRGNSKPRLSSWINFTRLKRSRIVGVKSKRYSIN
                     EEIKVVSEVKPSRFKLIISESFLQLCVITLVGLAYLFTNSQNESRGTYPVNSILRILI
                     ISFVPIGINLVILIVCFVVSTCIGPIFTLFCKKFPSFVAAIAHLLAVVNHVFFFELLW
                     LLQNWNFSVTVLGFALSTLIQCWFLQMMTILLVSREFRHDRSNRSWWSGKWATAGLGW
                     YIITQPMREAVCKLSEMSYFAGDLVATHIILFAQIPILLIPYADKWHTLMLFWLKPGN
                     QIRPRILSKRQKRRRRFQANLYLLIFLLGLILFSSIFVLPVIATKYFDIGFSEYIPEF
                     LHPLFQPYDAPTNLKGLKKKLEIKHY"
     gene            complement(<208259..>208762)
                     /locus_tag="CD36_25910"
                     /db_xref="GeneID:8049689"
     mRNA            complement(<208259..>208762)
                     /locus_tag="CD36_25910"
                     /product="microtubule and mitochondria-interacting
                     protein, putative"
                     /transcript_id="XM_002421643.1"
                     /db_xref="GeneID:8049689"
     CDS             complement(208259..208762)
                     /locus_tag="CD36_25910"
                     /inference="similar to AA sequence:UniProt:P35691"
                     /inference="similar to AA sequence:UniProt:Q5A860"
                     /note="Similar to S. cerevisiae TMA19; translation
                     machinery-associated protein, putative;
                     translationally-controlled tumor protein homolog,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="microtubule and mitochondria-interacting
                     protein, putative"
                     /protein_id="XP_002421688.1"
                     /db_xref="GeneID:8049689"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR011323"
                     /db_xref="InterPro:IPR018103"
                     /db_xref="InterPro:IPR018105"
                     /db_xref="UniProtKB/TrEMBL:B9WKS7"
                     /translation="MIIFEDVISGDELLSDAYDVKLVDGAVYEADCAMVTVGNGDIDI
                     GANPSAEDGEEALEDGAETVNNVVYSFRLQPTMFDKKSFTTYIKGYMKRVKAYLAEHN
                     PDAVEAFEKGATAYVKKVLGSFKDWEFYTGESMDPDAMVVLLNYREDGTTPYVAIWKH
                     GVKENKI"
     gene            complement(<209080..>210141)
                     /locus_tag="CD36_25920"
                     /db_xref="GeneID:8050095"
     mRNA            complement(<209080..>210141)
                     /locus_tag="CD36_25920"
                     /product="palmitoyltransferase, putative"
                     /transcript_id="XM_002421644.1"
                     /db_xref="GeneID:8050095"
     CDS             complement(209080..210141)
                     /locus_tag="CD36_25920"
                     /EC_number="2.3.1.-"
                     /inference="similar to AA sequence:UniProt:Q04629"
                     /inference="similar to AA sequence:UniProt:Q5A861"
                     /note="Similar to S. cerevisiae SWF1; spore wall formation
                     protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="palmitoyltransferase, putative"
                     /protein_id="XP_002421689.1"
                     /db_xref="GeneID:8050095"
                     /db_xref="GOA:B9WKS8"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:B9WKS8"
                     /translation="MLFTLIVAITIISSLATFLLLFGDSPSFRNTPIQKLRNSLLSIS
                     RDLFQFYQWLDRKLNGQLLKILNWLVPFGYVVVVTVCFQQFLTHTLPMLPSPSRFQLF
                     TIYFSMLLIYVSTILSSFSDPGRVTTSNLKLYPYVPNQLIFFDGKICSTCQITKPARS
                     KHCSVCNQCFLLYDHHCVWINNCVGYYNYKWFLLFLISNINMLGYGGWLCYSALTPVS
                     WRKITSTNNANKVTGIFLILCSIFIVITTLFTLLHLRYIYLGVTTNELDKWSEIDHLV
                     GLGVLYKIEPSIDNENYVERAILDGDVVYISLKNERILVDKSNVMNFKLQLISSVEND
                     LVNIYDNGFWNNLIERLKW"
     gene            <210379..>211470
                     /locus_tag="CD36_25930"
                     /db_xref="GeneID:8050096"
     mRNA            <210379..>211470
                     /locus_tag="CD36_25930"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421645.1"
                     /db_xref="GeneID:8050096"
     CDS             210379..211470
                     /locus_tag="CD36_25930"
                     /inference="similar to AA sequence:UniProt:Q5A862"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421690.1"
                     /db_xref="GeneID:8050096"
                     /db_xref="UniProtKB/TrEMBL:B9WKS9"
                     /translation="MATFITTLDEEINYIQDLLQSIPFSSDRTTHFLKVYKISHQELM
                     KLNEQPLKFPVEANKLLKLSISLGNLIRTLQIDEESYQQQHNQQRQFLQNLSNAKNGG
                     TNSGNNSNNGTRVSSTISDPFRDSAILQPPPLKHVINSNNNSNTNFMSPNVSQPPYQT
                     RFIKNLVSILKNFDIGSRNDIVQSSTTLNGTTMMTTTTTTNRDSVSSNQSIFYTPQRV
                     LSNGSNTSSANMSPIKLNSKQLLIEKLEININLDNLFIYKITLKLILEIFHILKQNLI
                     NTTSKLNDPSFAMTPTKYDFDESSSIFSSNSSNSQDSTLTNDEYYKFLSVVISRISHG
                     IIQPFVILIYREFVETKISDDFTQLINSL"
     gene            <212444..>214123
                     /locus_tag="CD36_25950"
                     /db_xref="GeneID:8050097"
     mRNA            <212444..>214123
                     /locus_tag="CD36_25950"
                     /product="N(2),N(2)-dimethylguanosine tRNA
                     methyltransferase, mitochondrial precursor, putative"
                     /transcript_id="XM_002421646.1"
                     /db_xref="GeneID:8050097"
     CDS             212444..214123
                     /locus_tag="CD36_25950"
                     /EC_number="2.1.1.32"
                     /inference="similar to AA sequence:UniProt:P15565"
                     /inference="similar to AA sequence:UniProt:Q5A863"
                     /note="Similar to S. cerevisiae TRM1"
                     /codon_start=1
                     /transl_table=12
                     /product="N(2),N(2)-dimethylguanosine tRNA
                     methyltransferase, mitochondrial precursor, putative"
                     /protein_id="XP_002421691.1"
                     /db_xref="GeneID:8050097"
                     /db_xref="GOA:B9WKT0"
                     /db_xref="InterPro:IPR002905"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B9WKT0"
                     /translation="MIKRLVKLLSKMSIPQSPVTEVAVETTTTNIVQPTTTISQEFNT
                     VQEGKATILTPKQDEVFYNPIQQFNRDLSIMAIKAYDEIRHEKMQAIKKKKKSNKKTK
                     LNGLKILESLAASGLRSCRYGLEIPEAGKIVANDMLAEAVKSINKNIEYNKLTEKVVA
                     NQGDAIKFMGSTDEKFHIVDLDPYGTAAPFIDSAIQCLEDDGMLLVTCTDAGVLAGSG
                     YPEKCFALYGGNNFGNAYVNGESNHEVGIRLILNLIASTAAKYKKTIEPMLSLSIDYY
                     FRIFVKVKTSPINVKNHASETMLTYGCNGCGHKIVQPLGIRNNTKFQYPKLQGPISAN
                     CQYCGTSYNVAGPMYAGSLHNREFIDKVLKINESSDKVIYATHERIKGMLTLASNELD
                     DAPFFFNLNQLCSIFKSPPISIEQYTKAVGNLGYKVSLTHAKKNCVKTNLPWNLNLLI
                     NRAWQIDQNEKYVKEMESKNVDELNEKVKEKLAKLKANIDINPSLGESTVGWKILNYF
                     RSNMNEEEKAVSIDFEKSNEEFEKIAKLRKVKMVRYQENPRKNWGPMARPK"
     gene            <217717..>218667
                     /locus_tag="CD36_25960"
                     /db_xref="GeneID:8050098"
     mRNA            <217717..>218667
                     /locus_tag="CD36_25960"
                     /product="Holliday junction resolving enzyme, putative"
                     /transcript_id="XM_002421647.1"
                     /db_xref="GeneID:8050098"
     CDS             217717..218667
                     /locus_tag="CD36_25960"
                     /EC_number="3.1.-.-"
                     /inference="similar to AA sequence:UniProt:Q03702"
                     /inference="similar to AA sequence:UniProt:Q5A864"
                     /note="Similar to S. cerevisiae CCE1; cruciform cutting
                     endonuclease, mitochondrial precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Holliday junction resolving enzyme, putative"
                     /protein_id="XP_002421692.1"
                     /db_xref="GeneID:8050098"
                     /db_xref="GOA:B9WKT1"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR015242"
                     /db_xref="UniProtKB/TrEMBL:B9WKT1"
                     /translation="MIQKSYLIKRLGSCKVSTLNDLAILTGSPVISNNKSCRIEGLTA
                     GYYFYLNHYHKIPSTQRSTLSIDVGIKNFSYCKSKSSKFPITITKWDKLNLDNKYGND
                     NYSSILHKDSILDNKRYLNQLTQLLVNELQPNKYDVVIMEIQRTRSAGNTSTLPNVLL
                     NYTLENLILGYIYPQIVIPMTSFKMTNFWLHRFITRSSTNTKKLKINHNKGIRFELMK
                     LWLNKLFVLPKYTNLELTKLDLLKYLNLDKSEKIDDLIDSLLYNLTINCQFQHFNEFH
                     QLMVSNDGDIAQFVHDKNKYHLELIQPIIDKYGLELKPGI"
     gene            <220029..>220844
                     /locus_tag="CD36_25970"
                     /db_xref="GeneID:8050099"
     mRNA            <220029..>220844
                     /locus_tag="CD36_25970"
                     /product="acetate transporter, putative"
                     /transcript_id="XM_002421648.1"
                     /db_xref="GeneID:8050099"
     CDS             220029..220844
                     /locus_tag="CD36_25970"
                     /inference="similar to AA sequence:UniProt:P25613"
                     /inference="similar to AA sequence:UniProt:Q5A867"
                     /note="Similar to S. cerevisiae ADY2"
                     /codon_start=1
                     /transl_table=12
                     /product="acetate transporter, putative"
                     /protein_id="XP_002421693.1"
                     /db_xref="GeneID:8050099"
                     /db_xref="GOA:B9WKT2"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:B9WKT2"
                     /translation="MSSGDSDSNSITSLKDIDGGDTNSLNQPVSRIKTTGDGDEFVII
                     GNKKYYRHELMQAFGGTFDVGLHPPPKLQIGNPSPLGLCAFSITTLVMSLYGLNVKDI
                     HNSNVVVGMAIFYAGTMQTLAGIWEFFVGNTFATTTMISYGSFFLSYGALYIPSFGIM
                     KAYATVDPTLKELQNAIGFFLIAWAIFSFFMLLCTMKSVISLFAMFVFIFFTFFLQGI
                     GFLLEHHGLIKAGNAFGILVTATGLFNAWAGVATTTNSYFVIPITWLSRHHGK"
     gene            complement(<221517..>223733)
                     /locus_tag="CD36_25980"
                     /db_xref="GeneID:8050100"
     mRNA            complement(<221517..>223733)
                     /locus_tag="CD36_25980"
                     /product="phosphopantothenoylcysteine decarboxylase,
                     putative"
                     /transcript_id="XM_002421649.1"
                     /db_xref="GeneID:8050100"
     CDS             complement(221517..223733)
                     /locus_tag="CD36_25980"
                     /inference="similar to AA sequence:UniProt:P36076"
                     /inference="similar to AA sequence:UniProt:Q5A868"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphopantothenoylcysteine decarboxylase,
                     putative"
                     /protein_id="XP_002421694.1"
                     /db_xref="GeneID:8050100"
                     /db_xref="GOA:B9WKT3"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="UniProtKB/TrEMBL:B9WKT3"
                     /translation="MSQDSSNQQPSQSESTQTISFDNTSTTTNHTEKRVSETKLENEN
                     FAASSDIAQAHNHPSIIKGNGSTTKNIAASGIKVNTNNSTTSGIAPPMKILTNSSKEV
                     TSPVLQNSNTPKLGSTNTSGTNIPVRNQSVSFSDIDNQERSRRFTISAKPSTVSVQQE
                     IQQQSSRHPSSAAPSRQSSVKTKRVSSPVNFEGSVYNDVLTFMTNHSHGKLNNALPSN
                     AHIGSIRSDNSSPITPEGAIDPGFNFEYDKNSINRIASPSPPPFSRSNGSSSTSSPKR
                     NKTPNTPDPASSNEPPTISDKLLSESYSQSAVKPFPSSHNVQPIKITGPGSNNSSRRG
                     SLKKSNKTIVSSPIGPPVPFQQFLSKQDDGKFHILLACTGSVATIKVPMIIDKLFQIF
                     TTSKISIQLVLTKSSSHFLRGCKIHEDVKIWRDEDEWANFADAYSSASTTVCTTTGND
                     NLNVTNRKPKNPYEKLILHNELRKWADIMLIAPLSANTLAKISNGIADNLLTSIVRSW
                     CPSTFQQVKKPIIVAPAMNTFMYTHPITAKQLNIISSPDFGIEVLKPVEKILVCGDIG
                     MGGMREWAEIVDILRRRVQSIKAEQKKLLDEEQRLNEEEEDNDDEDEEKDNDDNEDDE
                     DDDDDDDDDDDDDDDDDDDEDEDEDEDEDEEDDNEVDEDDTNKQKLVRNNTIENEESP
                     KKDDDEMIFEITDQEQSEQDDEGEGEIVANELRKISSVPSRRQQKIKIPKETQNLI"
     gene            <226106..>226606
                     /locus_tag="CD36_25990"
                     /db_xref="GeneID:8049800"
     mRNA            <226106..>226606
                     /locus_tag="CD36_25990"
                     /product="catalytic subunit of the Signal Peptidase
                     Complex (SPC), putative"
                     /transcript_id="XM_002421650.1"
                     /db_xref="GeneID:8049800"
     CDS             226106..226606
                     /locus_tag="CD36_25990"
                     /EC_number="3.4.-.-"
                     /inference="similar to AA sequence:UniProt:P15367"
                     /inference="similar to AA sequence:UniProt:Q5A869"
                     /note="Similar to S. cerevisiae SEC11"
                     /codon_start=1
                     /transl_table=12
                     /product="catalytic subunit of the Signal Peptidase
                     Complex (SPC), putative"
                     /protein_id="XP_002421695.1"
                     /db_xref="GeneID:8049800"
                     /db_xref="GOA:B9WKT4"
                     /db_xref="InterPro:IPR001733"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR028360"
                     /translation="MNIRQQITQFLSLAYVFSSAFMLWKTLSVIANSHSPIVVVLSGS
                     MEPAFQRGDILFLWNRDQQQKVGDIVVYEIDGKTIPIVHRVLREHHNQQKQLLLTKGD
                     NNAVDDLSLYAKKQQYLNQKADLVGTVKGYLPFIGYVTILISENVYFKYGMLGLLGLS
                     SLFSNE"
     gene            complement(<226776..>230888)
                     /gene="SLN1"
                     /locus_tag="CD36_26000"
                     /db_xref="GeneID:8049801"
     mRNA            complement(<226776..>230888)
                     /gene="SLN1"
                     /locus_tag="CD36_26000"
                     /product="histidine kinase, putative"
                     /transcript_id="XM_002421651.1"
                     /db_xref="GeneID:8049801"
     CDS             complement(226776..230888)
                     /gene="SLN1"
                     /locus_tag="CD36_26000"
                     /inference="similar to AA sequence:UniProt:O42695"
                     /inference="similar to AA sequence:UniProt:P39928"
                     /codon_start=1
                     /transl_table=12
                     /product="histidine kinase, putative"
                     /protein_id="XP_002421696.1"
                     /db_xref="GeneID:8049801"
                     /db_xref="GOA:B9WKT5"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:B9WKT5"
                     /translation="MRRLKIGIRSQLIIIVCFASLFSLLILGIVTGIYFSVNLKNLRL
                     ERLLVISQLKRTQVQQAIQYIAYQVMTVSEIDSLTVPLSNYRAGNNSKTVFSEAQNYL
                     QQYVLSTDSFISARLYDLDLQVVASSFDNMTLISDSAQDVVYPLRQNASIPQVLDTQS
                     GLFFTGPIANNSENFNSMYFMGITVPVLSNSSIILSQPSISGYLTIIASAESIRSALN
                     STSEDDYQAMAVEPVYGDPQQGIDNLQQNTYNGANQVIGFKLVFPVQDSLLEAGAIYN
                     INSSSSMKTALASNSGTATSVKSFFGKKVSIGFSRISVQDNLNWSIVIVQSSSVFNGP
                     ANKLRRITIGVVIGIGAFMCLVTFPLAVWFIRPITKLKEATEAITKYKKEKLNNVNSN
                     GPNSSTGSDSPNQPLLDMGTGMGKRNSINSSSISSSYSTGIRLPARIPRSKKIFKDEL
                     TELSEAFNIMTEELDKQYTHLEDRVKSRTKELEASKIEAESANEAKTVFIANISHELR
                     TPLNGILGMTSIAMEEEDPNRIHDSLKLIHRSGELLLHILTELLTYSKNTLNRSKLEK
                     SNFQILEIVYQVRSIFNKLAHDQRVNFKILVKPNIFRKLIIYGDSNRIIQIVMNLVSN
                     SLKFTPVDGSVGVSFKLLGEYDHEKSKKLDYKKVCILNDSSTSTVVPPPAPPSDTKPT
                     PKKSHIIDHNNRSANTTSPLTPVGKPTNTKTSKGDTNNTINKDMKVRKRNNNNKKRNH
                     NNNTNSDVFKNRRLSGSQRFSNIQEEELSPTAIDTDVDKYLTSSTDSDNISVTTLSTA
                     QYETTIFESQFKSKPLPKLPIDAKSQLSEKVEDNDMKEIINDDEEEDVSGVGVVQVDD
                     DDEDTVNEKQGNSSSSSTSNSTNEKQEEISPVSNNSTTVSIIRPRHNMMPSAQDFKSY
                     PTFDKKPEYDSNMSNNEIVKNNRVFRIRNMYQPKVWVIQIEVTDTGPGIEPALQEKVF
                     EPFVQGDQTLSRSYGGTGLGLSICRQLATMMHGTLTLKSTIGKGSTFTLTLPLPQTGE
                     IMVPPEDMAEFCEDEFNPAAKINRKVAFDDDGAENNNDNNNNNDDDDDDDDERLQGQE
                     QEKTSREDTNEKQNVQSSHTFNISSSSTSSLPPNSSSSDSPLPTSDSSDIYGGVNKSE
                     TGNYGNNEVAKKRVISTSSSLSTEGSSSKHNIGNEGNHGDDNNKNLTLTIDKPSLFTR
                     GSTGTANSGTTSSHSDKKSSYPFVADHTTVLDDISHLRILVAEDNMVNQEVIKRMLRL
                     EGLTNLTMACNGAEAIDFVKESIETNEIFDLIFMDVQMPKVDGLIATKMIRKNLQYNK
                     PIIALTAFADESNVKECLNSGMSGFLAKPIRRTNLRKIIVEFLLNEVVTS"
     gene            <232374..>232760
                     /locus_tag="CD36_26010"
                     /db_xref="GeneID:8049708"
     mRNA            <232374..>232760
                     /locus_tag="CD36_26010"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421652.1"
                     /db_xref="GeneID:8049708"
     CDS             232374..232760
                     /locus_tag="CD36_26010"
                     /inference="similar to AA sequence:UniProt:Q5A873"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421697.1"
                     /db_xref="GeneID:8049708"
                     /db_xref="GOA:B9WKT6"
                     /db_xref="InterPro:IPR024222"
                     /db_xref="UniProtKB/TrEMBL:B9WKT6"
                     /translation="MTKLILNPSDLSIEFPNISISNPQRIRILCQVIEYIPNESSLII
                     DKLPTVTSSSTTNTNNPNLVKVNIFDILNDCSLEVISRGTIINIDGYYDGSNIQPINI
                     YEINGINFIIENIGLLNQLNQLKSLT"
     gene            complement(<233134..>234969)
                     /locus_tag="CD36_26020"
                     /db_xref="GeneID:8049802"
     mRNA            complement(<233134..>234969)
                     /locus_tag="CD36_26020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421653.1"
                     /db_xref="GeneID:8049802"
     CDS             complement(233134..234969)
                     /locus_tag="CD36_26020"
                     /inference="similar to AA sequence:UniProt:Q5A875"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421698.1"
                     /db_xref="GeneID:8049802"
                     /db_xref="UniProtKB/TrEMBL:B9WKT7"
                     /translation="MNRGGGSYKKPYNGKKSSYQGKRNNGSYNKSPSNYKGNGKPKTD
                     SYNGYQGNKNKNYNGTRNNNNYSRNNKNHNDQGNRSQNLNSRNGGNYSSNNRAAVSAS
                     IEPITEENSNDSNNSKIFKFININLKDYKKRIPGEQANVRESKIEEQIKNDIIVEYRP
                     ICRFFLMNFDKIEFIDVNRNSIENYLKLIVDERHIEMKEHFKQFTLLNYMIQQIKEAF
                     KLQRHIDFDGVSKEEYNKWKSEQDESKQTETITFADEPFEFDEELVDFEEAFVDDKPI
                     DRPMDRPINTNGSKSKLKTNVLPTVIEENEPDVYIPTTKSSRQQEQEQQQQQQQQQQK
                     ESDETSWDMYRPSTRWTPVSSNGLFVSDSESSPQNSGSTSSLLSQSNSQQSPSQSQQS
                     THKQQHQQNQQNLQTTPSRRLPPTGPKSITSSKQLNSSNWSSPSYFRPTPTEPKFQRR
                     IRDYEADEPSEEEKLLIERRKKRKLEEKRALFGKVFHNDEDDHEDDSYHDDHANDMIT
                     SDDLFYHQMKSKKSNNIDNTNNIDNTNNIDNTNNNNNNNNDDGTVRDIEYKTFIERLK
                     SYNRKKNQKKDIEPKPRKSLHPKSVQRGTMKVKPHKFDKILALID"
     gene            <235993..>238890
                     /locus_tag="CD36_26030"
                     /db_xref="GeneID:8049803"
     mRNA            <235993..>238890
                     /locus_tag="CD36_26030"
                     /product="zinc finger-containing transcriptional activator
                     protein, putative"
                     /transcript_id="XM_002421654.1"
                     /db_xref="GeneID:8049803"
     CDS             235993..238890
                     /locus_tag="CD36_26030"
                     /inference="similar to AA sequence:UniProt:P21657"
                     /inference="similar to AA sequence:UniProt:Q5A876"
                     /note="Similar to S. cerevisiae DAL81"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc finger-containing transcriptional activator
                     protein, putative"
                     /protein_id="XP_002421699.1"
                     /db_xref="GeneID:8049803"
                     /db_xref="GOA:B9WKT8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:B9WKT8"
                     /translation="MENQQHHHSRHSSLQHEDSNNNNTNNNNNSPKVPSPHHNEQTSN
                     NNSNTNNNNNNNNASTNINNNNDTNNTNYSNYEQLYLPESNSSNNFLQQMDNDNQSPN
                     FMDQNWTPQMLPQTASYLANLDLPNIPNTHSNHYNPNTSYNSSSSIIQTIQHQHNVHH
                     EDLHEDQEKHHQYINSNSPSSHQQFTPQPGIPPPAKTNKQKRPCDQCRKRKIKCVIVP
                     NTNNCVQCEAKQVICTYTDQAPKRKLIDMNNNGGGGGEQLLKRGRMDTSILPNGTMIA
                     PPDVAIREVSPIQDYSAMNNSLLKRTLSLQFPRSSFYVGPTSSVYDINLLNSIIKSHE
                     NESPKNNKIEQVNLNNSVSLRKVSDTVQFILKEDQSPQSYQIMSNDVDTIEKFISPHG
                     QILVDLYFRIIHPSYPIIHKKVFIEKYSRTHREFSAPLLAAVYVLAIQWWDYDPQLNR
                     FPKPNVEMILKIGLNNYMLEILKRPKLSAVQAGLLLLQCKHIINCKTSNGLRQQGAGS
                     TINGNGSSGSINNGDADYSEWILCSQIVSLAEELGLGLDCNDWKLPKWERGLRKRLAW
                     AVYLEDKWLSLKLARPSHINESNWMVLPLYDQDFPEKHGDGDLKEGSSDIDNGKKIFI
                     NLIELSKILSDILNQFYSMKAMKEITEIDQVLKLAKPLQLRLRDWFRSLPMELQMSSV
                     QPRKLCSNGFLQLAYFATELTLHRKITTIIFNQTKLGNPPSPELVGVCRSAAKTRLMA
                     SIEFVRDLKQEHIHSFWHCSATSNFTLIGTFAAILLISSSTKEETDFYRDQILNYRWI
                     LKISSKGFDQAAEALADLDLVLTNIPGLIYDNVNVPSLLPNVSDNLSSIQSQMKHYSP
                     TAASPPSSTTSTQQQQQQQQQQRTRTAPIRESPLSSPQNMYTPPVNNSNNSNNNNNNN
                     NNANAGSGNSNKGSPPISHTQGLSPKTKSISVVSNSGTTPKSPVKSPQITK"
     gene            complement(<239075..>239689)
                     /locus_tag="CD36_26040"
                     /db_xref="GeneID:8049804"
     mRNA            complement(join(<239075..239593,239687..>239689))
                     /locus_tag="CD36_26040"
                     /product="ARP2/3 complex subunit, putative"
                     /transcript_id="XM_002421655.1"
                     /db_xref="GeneID:8049804"
     CDS             complement(join(239075..239593,239687..239689))
                     /locus_tag="CD36_26040"
                     /inference="similar to AA sequence:UniProt:P33204"
                     /inference="similar to AA sequence:UniProt:Q6BP29"
                     /note="Similar to S. cerevisiae ARC19;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="ARP2/3 complex subunit, putative"
                     /protein_id="XP_002421700.1"
                     /db_xref="GeneID:8049804"
                     /db_xref="GOA:B9WKT9"
                     /db_xref="InterPro:IPR008384"
                     /db_xref="UniProtKB/TrEMBL:B9WKT9"
                     /translation="MSQSLKPYLTAVRASLTAAICLEDFSSQLIERHNRPEIEVLPTR
                     IHNPELILNPMIIARNENEKILIESSINSIRISIKIKQADEIETILVHKFTRFLTSRA
                     ENFFILRRTPIKGYDISFLITNFHTEQMVKDKLVDFIIEFMEDVDKEISEMKLFLNAR
                     ARIVAESFLIPFD"
     gene            complement(<239896..>241689)
                     /locus_tag="CD36_26050"
                     /db_xref="GeneID:8049805"
     mRNA            complement(<239896..>241689)
                     /locus_tag="CD36_26050"
                     /product="pre-mRNA processing protein, putative"
                     /transcript_id="XM_002421656.1"
                     /db_xref="GeneID:8049805"
     CDS             complement(239896..241689)
                     /locus_tag="CD36_26050"
                     /inference="similar to AA sequence:UniProt:P33203"
                     /inference="similar to AA sequence:UniProt:Q5A878"
                     /note="Similar to S. cerevisiae PRP40"
                     /codon_start=1
                     /transl_table=12
                     /product="pre-mRNA processing protein, putative"
                     /protein_id="XP_002421701.1"
                     /db_xref="GeneID:8049805"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR002713"
                     /db_xref="UniProtKB/TrEMBL:B9WKU0"
                     /translation="MSSDWEELRTETGEVYYYNYKTNETSWTLPETTKTLPNEKQETT
                     SSRGKWEEYTTDDGKKYYYNESTGETTWEKPSEMLEGETNDKVDETELSELDKELKSK
                     PVESAGITSFKPDNEAKESFLKLLSDNKVDSTWSFQAVMENLVDKPEYWSVKDPVTRK
                     QLYEEYLVSKFQSELSNKSLLLENFKRNFKEELRKLEEKGLMCYNTRWITIKKLWIDQ
                     DNPIFKHSMMSDSELAAIFYEYTDKLKLQHEKNLQTKKNQALIELSTYLRQVNSSLVE
                     NSTTWEVLYENLINDSRFQSNKNFQNLTKLNILQLYENEIFPGIIDDIKSQITDISKI
                     NYRNDRKAREGYKKLLTELEIEADTEFKDIIEKIENNDAFIEICGRNGSSALELFWDI
                     VDEKKQILKVKKNLVDAVIATMKKNDNIYNEKMWESAKAFSDALKSVGDERLANLDLT
                     TTGNGKEITMIYTMLKQEFELKKQQEREKYLKKLDEDIQKFARWIYDNDRDLGENFLR
                     MEGTKFVISTRVNYEDEYKKLSKFDEFKPLLQYETELSTTRLTKKIIEEFVSEYNKRI
                     ARKRQSSISSSGVEGKPEKKLKTGIATVLNY"
     gene            <242723..>243964
                     /locus_tag="CD36_26060"
                     /db_xref="GeneID:8049806"
     mRNA            <242723..>243964
                     /locus_tag="CD36_26060"
                     /product="ceramide synthase component, putative"
                     /transcript_id="XM_002421657.1"
                     /db_xref="GeneID:8049806"
     CDS             242723..243964
                     /locus_tag="CD36_26060"
                     /inference="similar to AA sequence:UniProt:Q5A879"
                     /inference="similar to AA sequence:UniProt:Q6LD26"
                     /note="Similar to S. cerevisiae LAG1; sphingosine
                     N-acyltransferase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ceramide synthase component, putative"
                     /protein_id="XP_002421702.1"
                     /db_xref="GeneID:8049806"
                     /db_xref="GOA:B9WKU1"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="InterPro:IPR016439"
                     /db_xref="UniProtKB/TrEMBL:B9WKU1"
                     /translation="MSSSSSSLGVPHESSIRRRSSSVGRIDVGDTSASLSTMPTTRSS
                     RRRSIARLRELQDNSTTDSAIVHKLYIGFRELTYRHTWIIPLMVLIMAFGTFYLSSPS
                     GKVHQILEDMIIPSYHIPGTDQYGKGGNDFKFVGFYALFFTFLREFMMCCVLRPIAVW
                     FGIKKEAKQKRFLEQTYAMFYYGITGPFGLWIMRRLPLWYFNTTQFYVDYPHKTHDIF
                     FKIYYLGQAAFWVQQSVVLILQLEKPRKDFKELVLHHIITIALIWCSYRFHFTWMGLA
                     VYITMDISDFFLALSKTLNYLESPITGPFFVIFIGVWIYLRHYINLQILWSVLTEFKT
                     VGDYELNWITQQYKCWISQPITFSLIFALQLVNFYWLVLIFRILYRYIFTGVSKDERS
                     DDEEEEDEYSEDSADEKKKEQ"
     gene            <244400..>245395
                     /locus_tag="CD36_26070"
                     /db_xref="GeneID:8049807"
     mRNA            <244400..>245395
                     /locus_tag="CD36_26070"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421658.1"
                     /db_xref="GeneID:8049807"
     CDS             244400..245395
                     /locus_tag="CD36_26070"
                     /inference="similar to AA sequence:UniProt:Q5A880"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421703.1"
                     /db_xref="GeneID:8049807"
                     /db_xref="UniProtKB/TrEMBL:B9WKU2"
                     /translation="MSSSSQLQTLSKDELIEKVLELEAVLNEFQDSSKELERALEDEL
                     LELENIKSQISQQLDVKKQELAQANTKIINLTSELNTLHESTNTKLYEKDEIIHNLTS
                     QLVKTEIMNDSMENEDRIKTNKYEDQQKFNNQLLEKLALLESDYEREKKLNIEKQLYI
                     TNYQNHIKDLNRKIEVLENKVENNPQQQQQQQADASMISFKEMLKSTPPPNKIRDNEN
                     QKQSNIKKSDSLRKLKNLTTDIEAFLGNFSLSSNKKSPSPKPSSKILKSPSTTQLDTS
                     ITTDRSHNNDGTITTKDKRLTYSKRFSDLPSIRGSPTPSKRSNIEKSKSMKHLRM"
     gene            <245670..>252146
                     /locus_tag="CD36_26080"
                     /db_xref="GeneID:8049808"
     mRNA            <245670..>252146
                     /locus_tag="CD36_26080"
                     /product="AP-1 adaptor complex accessory protein,
                     putative"
                     /transcript_id="XM_002421659.1"
                     /db_xref="GeneID:8049808"
     CDS             245670..252146
                     /locus_tag="CD36_26080"
                     /inference="similar to AA sequence:UniProt:P39526"
                     /inference="similar to AA sequence:UniProt:Q5A881"
                     /note="Similar to S. cerevisiae LAA1; trans-Golgi network
                     (TGN)-endosome transport protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="AP-1 adaptor complex accessory protein,
                     putative"
                     /protein_id="XP_002421704.1"
                     /db_xref="GeneID:8049808"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B9WKU3"
                     /translation="MENFDQILDRYEKSEVFNYLTSLSAKLSNENETKSIQESDYLIY
                     LSQLNQLVEKANIPLDTKKKKPSEASNSQYEARQAISFNIYRLVSKNYISVLHKLPSK
                     IYDLANQLVNNLVVDDKGELSPITQVSIIILIDLFENFPNSLGSLINFSITQLYKILK
                     KYPNINSNLIFLLNSITKNATKMDIDDKMQYKLMKIVTKSIISESISYNMELECTTNV
                     LIKKNYVLCYKNLLLLMVSTNYEMLLAASTSSTSAGAKMKPETIMKQQHDFQMNLLTT
                     NEKTFNYCLSNFSKEIRIAMVELLANLLINFVPTGKFNAIEYLVTLFPLPEYNQWDSN
                     LLMKINDNGEPIVDNIRKEKNTLMGHDSESIINSSLELSLFQASVTETIIFYLQLEQF
                     QNLEFLSNNLTFILETILAKFVELNDMENHFMNQEWNKVLKYWGTIIEYIIQETGSAS
                     HEILCSFIYSKFVPESNNEDNSSHTSDQLVRTQSLNKQRKRESKMFSFKSKQSTKKKT
                     VSNWEVKPYQNPYQAFFLLFIIDMLLPYGVSFESMKKDEKPTTTPKDTEEELDLPTSS
                     SEIGSSSFIRGVLLNLIVNNNYYIRNYAIQTLLVYAKNNQAEINQLILHTFRLVDQEH
                     KHSDKETPGGDQNIIPISSVRLFSYSLALSSLIKQTDPALLQNSTIVKVLSFCTQSLK
                     HNTQSGVKNSSCWIILSSLVTLHNFSEYVKLNSSQFLVFWKSLLTSQFMSTSITASTP
                     EGQTKEVILNLMLRNFSLVCLLNYLNSVELTPESLKQIQFLLTKSYNYLTYLESNIEV
                     VGGVTSFNNTNFNELDYNVNILSNLLYTNYAFNNKLSTDRVFISLILYSKKIIFQSFT
                     KLATLLKNEINSNMVIFLIKVFSDAKLFSRIQSSESEKSKSKSKTLNQVADIGDNLVL
                     NEDYNYSFGVTSKLQYESMYIDELLIKFPFQFGIEEPQWLRKTFTFTTTPLPKPSIES
                     EYSPEASSWFDYFEKIAFSSVDHSINYEPGIVLTQNYSTHYKYSTNLTTSLVDLSIEL
                     FQLVFPYLSTKIQFSLLEQMRNSLTTSSVDPLRLKAIQINVSVTLHGLISNIVKKKIA
                     VEESILLVIIDIVKKMPIMRYDQLIKINASTLGLVSQLLDKNGVSGQITTLINDIVTD
                     SNPYRRGFSLLALSYIYSNTKLGFSDIYHISLQLLNDPNPIIYHFTIISTRQLFEFNH
                     DNLSLIPTVLNKIFSNYLNDSFGYDLSNKVLINLETKYNSIAEITKLLKLFVSSLGPA
                     LRDWEVDQKLKLKDMIISLSYGIGLSTLNDYVEVYKQLLLLFQELIIYDSNLMEGEIT
                     FFRDLLNLIISKNLKISLASVSPTSLNTDTIFPFNTSFDLYSGAYECYYELLKILGVD
                     ILTQDTVNLLWVSMNIKPCLELKQFIKLWLESSLEKNWFGILNSLFKLSSKKLIGPFI
                     ETNYQQKLLPLSQRQKKKNAQNVDFRDEEIENIVGDEGSDLDKNEPISWEFKLYIYEL
                     LNHLLDLAVGNSQLIERLKSKIPDIVKLSFLGSTSSITEIKLKGIELLNRSLALFGEL
                     EDPLYPSVSILEQQQAQIISALIPCFSPGNDYKVIVNAINVSSKFINLPRIKFYSKQR
                     ILKTLIYLLEEISSNKFVRFAFLETMSEFGRKSIQLAILNCWAVLKIDSYEDSENIEP
                     EFEETLTNYSSLLTSLWILVLREFSTLKYSESSSRELEIYGNYWINLISVLSLESERD
                     SEFINQYLPGDAQNFFFILFSQCMESLIKNRKVPEILASVKRLVKNPTLVTLLFNDEI
                     FGEIVDLFDRLILIDDDTEIQCSLVEIISTLFQTFVQCHQDNLECGFDKLFELIRISM
                     LPLFRILPFLRSDYDANNESNQLILKHVGDAANLLILKRAFECLLKMTDLFPSIVRTD
                     LYSCLFYILSKIYESQNKLLISVVVPFLKKTVIDAKEGAPELITIFYKTIRSYFEIEV
                     ENNYSIITMLILVTNGGVKLDADESQKLSNALLQLLESKDTAPTGIQCIKSLIQFSYV
                     SKENNLVVKFLVSDLIKHITRVNEADDHHNIDSKVAIEILMLFTRLVINDEQKQIALY
                     SVIIPVLVKSVDEVDKLYLHDKLIVLVHQNPSSFKQVVNKYLDDNQKKLTEEIVTSSV
                     ARNSESNQSVDSFEQVPEIQLKTFGV"
     gene            <252593..>255139
                     /locus_tag="CD36_26090"
                     /db_xref="GeneID:8049809"
     mRNA            <252593..>255139
                     /locus_tag="CD36_26090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421660.1"
                     /db_xref="GeneID:8049809"
     CDS             252593..255139
                     /locus_tag="CD36_26090"
                     /inference="similar to AA sequence:UniProt:Q5A883"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421705.1"
                     /db_xref="GeneID:8049809"
                     /db_xref="UniProtKB/TrEMBL:B9WKU4"
                     /translation="MPPPSTPNPHTIAQPEDVLSSSSSSSSPNISRYEEANALDSMQR
                     FRNASNNATSTTSFSGLNSINLVSDYMYRNLHAESNEHVINEPDAHFRSRILRHFSDM
                     HRLQNHFNELINAREQRNTLDHELAVNTIPVQLRNLSRELTRNENREVYYIETTDEDD
                     QSFQEDDDPNVIYYSDNHDESDVIDVNDDDDDDDESALSDNASTTLRQDIQNNERLLV
                     TSGRNNSALYPYRSSLLGTSALPLRRQNAIRIRQPPKKQGEEHSKSTNKDGNLIAEVL
                     NEEANALGADISRFYQALQSSVCFQGESPLFEKNYHDHGANFRDLYLINSSSRAMITE
                     LRQSNLDQRMDAYLSSRRNRSLWQKFPLPIAPPPPAIEKKRSRGTAKKTFKRQKLIHN
                     TEDEIAKYIDDSPSSLPKTRCSYSRIEKEAIMNGLPSSLMESGSSYSVGISADPLSRC
                     DVNFTDVNEIIHGVFTFTPEEKSPLLSVLLKLHNFTKFFCGFNDYSQSLPRSKILVRK
                     LNVLDRISVDNNVHFNNLKTRGVNIPFDGHLVDFRNHDLRFLSYNSNESFSSRFKTNR
                     VRLQLLEWMKLHPFIQFKENYFLSFLREVNDSMSYVCEAKLKKSKKSQALNTVKDFIS
                     NLHELTKDFSFSKDTKLPLIEDQKKQKSCSRRYKDLFVDEWERYLTGKLCQNITAKES
                     NTLINVQLNFILFVLKVDLSKFLDNFMDFIFQHCDDNDYINNYRKVYRNIVSDEEKES
                     DNYRAILICSIDRKTGAIEIHNTLPYLHYKDRSIKNANFILSSDHNLSTYSSRNTYVY
                     DDFEIFEGESVPLNSGTFNTGISIDSSNEAVVDSNLTGKVKLGTPVCDMV"
     gene            complement(<255247..>255642)
                     /locus_tag="CD36_26100"
                     /db_xref="GeneID:8049810"
     mRNA            complement(<255247..>255642)
                     /locus_tag="CD36_26100"
                     /product="cytochrome C oxidase-assembly factor,
                     mitochondrial precursor"
                     /transcript_id="XM_002421661.1"
                     /db_xref="GeneID:8049810"
     CDS             complement(255247..255642)
                     /locus_tag="CD36_26100"
                     /inference="similar to AA sequence:UniProt:P38824"
                     /inference="similar to AA sequence:UniProt:Q5A884"
                     /note="Similar to S. cerevisiae COX23"
                     /codon_start=1
                     /transl_table=12
                     /product="cytochrome C oxidase-assembly factor,
                     mitochondrial precursor"
                     /protein_id="XP_002421706.1"
                     /db_xref="GeneID:8049810"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="UniProtKB/TrEMBL:B9WKU5"
                     /translation="MTETTETKKEKETSQVPLNTTTKQQPIKLISDEVEKDTSKVNFT
                     KGSVEEFKFYPDNPKSHRHKYKWSMKEPSKFYDPCEESRMASMDCLYRNQDDKYACQE
                     FFDAYRECRKDFFRKKRQDTIDGAKGWGR"
     gene            <255873..>257576
                     /locus_tag="CD36_26110"
                     /db_xref="GeneID:8049811"
     mRNA            <255873..>257576
                     /locus_tag="CD36_26110"
                     /product="signal recognition particle (SRP) subunit,
                     piutative"
                     /transcript_id="XM_002421662.1"
                     /db_xref="GeneID:8049811"
     CDS             255873..257576
                     /locus_tag="CD36_26110"
                     /inference="similar to AA sequence:UniProt:P20424"
                     /inference="similar to AA sequence:UniProt:Q5A885"
                     /note="Similar to S. cerevisiae SRP54"
                     /codon_start=1
                     /transl_table=12
                     /product="signal recognition particle (SRP) subunit,
                     piutative"
                     /protein_id="XP_002421707.1"
                     /db_xref="GeneID:8049811"
                     /db_xref="GOA:B9WKU6"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004125"
                     /db_xref="InterPro:IPR006325"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR022941"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WKU6"
                     /translation="MVLADLGSRLRGALSSVESGSDDEISQMIKDICSALLESDVNVK
                     LVAKLRGNIKNKIEEANVSKETSAMNKRKKLQKIIFDELCALVDSNVEPPKPKKLSTS
                     TKTINGKKVRVSKESSHVIMFVGLQGAGKTTSCTKLAVYYKKRGFKVGLVCADTFRAG
                     AFDQLKQNAIKANIPYYGSYLEPDPVKIAFEGVQKFKQEKFDIIIVDTSGRHRQEEQL
                     FTEMVQIGEAVQPSQTVMVMDGSIGQAAESQARAFKESSNFGSIILTKMDGHAKGGGA
                     ISAVAATKTPIVFIGTGEHVGDLEIFKPTTFISKLLGIGDIQGLIEHVQSLNLHQDEG
                     HKQTIEHIKEGKFTLKDFQNQMNNFLKMGPLTNIASMIPGLSNIMSQVGDEETSKKIK
                     NMIYIMDSMTTKELESDGRIFIKEPSRIVRVARGSGCAVVEVEMILQQHRMMSTMAKS
                     AMAAQGGQAGPGGNPMANNPQMQRMMQQAQSNPNFMQQAMNMLGGAGGAGGAGGAGGA
                     GGLAGMMNNPAMMQQAQQMMRQNPQMMQQAQQMMKNPGMMQKMMQQFGGMGGMGGMGG
                     M"
     gene            complement(<257716..>258441)
                     /locus_tag="CD36_26120"
                     /db_xref="GeneID:8049812"
     mRNA            complement(<257716..>258441)
                     /locus_tag="CD36_26120"
                     /product="transcription initiation factor TFIID subunit,
                     putative"
                     /transcript_id="XM_002421663.1"
                     /db_xref="GeneID:8049812"
     CDS             complement(257716..258441)
                     /locus_tag="CD36_26120"
                     /inference="similar to AA sequence:UniProt:Q12030"
                     /inference="similar to AA sequence:UniProt:Q5A886"
                     /note="Similar to S. cerevisiae TAF10"
                     /codon_start=1
                     /transl_table=12
                     /product="transcription initiation factor TFIID subunit,
                     putative"
                     /protein_id="XP_002421708.1"
                     /db_xref="GeneID:8049812"
                     /db_xref="GOA:B9WKU7"
                     /db_xref="InterPro:IPR003923"
                     /db_xref="UniProtKB/TrEMBL:B9WKU7"
                     /translation="MSEPINKPEDEEMDVEFNDNDDQIVPDESSEQTQKQDDQQAHNQ
                     TNERETNTAASERPQNDTASSTNNPAGAANGTSPASVIPELPDLTRKDKTLKEVLDLM
                     DGDFAPIIPDAVTDYYLAKNGFETSDIKIKRLLALATQKFISDIAQDAYEYSRIRSAS
                     AVYNSSNPQVRAKLLLQGQQYANQQSLSGNSNNAGEGDQQQSQQSHSNAGNSQGKIVL
                     TMEDLSNALSEYGMNTSRPDFYR"
     gene            <258633..>262895
                     /locus_tag="CD36_26130"
                     /db_xref="GeneID:8049813"
     mRNA            <258633..>262895
                     /locus_tag="CD36_26130"
                     /product="WD repeat protein, putative"
                     /transcript_id="XM_002421664.1"
                     /db_xref="GeneID:8049813"
     CDS             258633..262895
                     /locus_tag="CD36_26130"
                     /inference="similar to AA sequence:UniProt:Q03897"
                     /inference="similar to AA sequence:UniProt:Q5A887"
                     /codon_start=1
                     /transl_table=12
                     /product="WD repeat protein, putative"
                     /protein_id="XP_002421709.1"
                     /db_xref="GeneID:8049813"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR025651"
                     /db_xref="UniProtKB/TrEMBL:B9WKU8"
                     /translation="MASRILNPYESSTFGNSLSLRVDGAIGAMSLSPNGRDAVLAGRR
                     GLFIIDLDDPFTPPRWLHHITSWEVADVQWSPHHFTKPSWCISTSNQKALLWDLKRPS
                     SNAIASILHSHNRAISDINFHPFDPEILATCAVDSFIMSWDMRAPRKPVAKWAQWRAG
                     ASQVKWNHENPNEIASCHDNSFYIWDTRKGALPVVKIEKAHEKKINGIDFTQGLKNIV
                     TCSNDNKVKFWNLESDEASNYISNFNYFDSARDSMIHPSVVIETDFPIARARSLPFGT
                     DKACGIMPLAGGNDSIHIVNYDDAYRDYLSEKTTQKLSSKPVYSFKGHRGPIKDFLWR
                     TRHEAYEGFDSKRKWKDYQLVTWSSKDFDLKLWQHDDAIYKGVNYDPTFHNVFKDESD
                     SEISRPETPQENQIYKYDTFCCEPRITIDDITKTNGGDLLSAMTLSLIAEKHKLASTE
                     FTQLNHLNWISGVRMGHNDSAERKNSSSSFEDDGPSNLGEEVSIVGHKFPKIRFEKIS
                     VSTGELVISLRGPLPALESTGMDRKDSTESNENNNAESAVSLRDKSIVSEGDKETEKM
                     SQKERESLHTESNTETSKEEFTADQKLVFIRVEIDFPKAYPFLELVSSEQFKSAKKFS
                     KLQKQNQIKFNVEETHELSASMKALMQENLENIAQFYSNKYQRFCLEHCLRYLMGEKV
                     ELDDDAMMDRNQNGSDSGDGEVIQEVGDEAWVDDLINQQPDIPTYSSGEEEEAETGLA
                     DLIPAHDKSLYQTTDSEVKDEETHLNRVGGKVPTVDSTPLPNGCGAIWSPTGQLVCFF
                     IPKSKTDGDTQEDGDGKAFQKFNIFKFTDGGFSSSHHQKSDSVGSEYGTNDDDNSDNS
                     SEDDNENRSIKSSSSSSSDDSFAKDWDEMLSNDAPRVRVQGLFKTSLGLGNYYDHESS
                     HKSSLNRLTSNGGTASNYKSSLKGERKRLNDETQSRRKNVVGIFDFGHLLPDKYELAR
                     EYRVLGDSPEILAKYNAAVAFKYGLKEISDVWKILEMILIKQIHYADNTEEFYPNYGL
                     NTPLQTGFGDQMLNKSRFYWNTHPFGSTWLIKEIFDYFEKKLNVQMLAMMSCILYENP
                     KNFKPTSELMNVPIHTPYQVLPLPPTVSITARNSTVYGSSHGKATTRDDIGFEHRNSA
                     LSGTRKELSAPPASVYARSISSSVGGESIANGSPDKFRVLKKNFALKSHSLGPSNNSH
                     SSLNDSLNESNASTPDRNMRISSSEKKNKGIILRKPYPLKKFRPKPAPIVSIEMQNIE
                     ELDVYEDINSQPLLGSIDKDKLVRYREIYAEMLYNWQLPVGRIKLLKFNYPEQDRTGS
                     TSTDIHKCSIGFKKRSQQHPHQNLLNPITTIYSKLPNSWNTSKRQVLKYCNLCQLAVT
                     KNFTLCTVCEHIMHTACAREWWTTDNHECASGCGCRCLERSF"
     gene            complement(<262976..>264016)
                     /gene="ERG27"
                     /locus_tag="CD36_26140"
                     /db_xref="GeneID:8049814"
     mRNA            complement(<262976..>264016)
                     /gene="ERG27"
                     /locus_tag="CD36_26140"
                     /product="3-keto-steroid reductase, putative"
                     /transcript_id="XM_002421665.1"
                     /db_xref="GeneID:8049814"
     CDS             complement(262976..264016)
                     /gene="ERG27"
                     /locus_tag="CD36_26140"
                     /EC_number="1.1.1.270"
                     /inference="similar to AA sequence:UniProt:Q12452"
                     /inference="similar to AA sequence:UniProt:Q874K0"
                     /codon_start=1
                     /transl_table=12
                     /product="3-keto-steroid reductase, putative"
                     /protein_id="XP_002421710.1"
                     /db_xref="GeneID:8049814"
                     /db_xref="GOA:B9WKU9"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B9WKU9"
                     /translation="MSLLKDSTVAVITGTSSNLGFNIAVRLLEGLPDNKEITLVVTSR
                     TLPKVKEVISDIKKYIVEKIPTKVNKVEFDYLLVDFTDMVSILSAYYDLNKRYRHIDY
                     LFINAAQGVYGGIDWIGAVLEVLQSPIEAVTNPTYKLQKVGVESGDKLGLVFQANVFG
                     PYYFIHRIKHLLQKGGKIVWISSLMSSPKYLSFNDLQLLRSPASYEGSKRLVDLMHFG
                     TYNKLEKEYEIKQYLVHPGIFTSFSFFQYLNVFTYYGMLFLFYLARFLGSPYHNISGY
                     IAANAPVAVALGQTKQNFKIASACTRSGKEYLLEEEIDSTGSEDVVSYLDTLTKEWDE
                     KLKDQIVNTRQP"
     gene            complement(<264221..>266776)
                     /locus_tag="CD36_26150"
                     /db_xref="GeneID:8049686"
     mRNA            complement(<264221..>266776)
                     /locus_tag="CD36_26150"
                     /product="chromosome transmission fidelity protein,
                     putative"
                     /transcript_id="XM_002421666.1"
                     /db_xref="GeneID:8049686"
     CDS             complement(264221..266776)
                     /locus_tag="CD36_26150"
                     /inference="similar to AA sequence:UniProt:P49956"
                     /inference="similar to AA sequence:UniProt:Q5A889"
                     /note="Similar to S. cerevisiae CTF18"
                     /codon_start=1
                     /transl_table=12
                     /product="chromosome transmission fidelity protein,
                     putative"
                     /protein_id="XP_002421711.1"
                     /db_xref="GeneID:8049686"
                     /db_xref="GOA:B9WKV0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WKV0"
                     /translation="MIQSEEHHQQTMPPATEFSMKDSCLFTQPETNIETEGSALNMSE
                     SLLFKDVKHDSETEESSKSSNTNIHNLIAPQEDRAINQETSKQDSQRLVVVDFDEMDQ
                     DFSPASKPSKTVKLFSGKQIKLAPRSTERVNIDEKQLSGVFLDMDTLTNKANLRNSFK
                     ENRKKLSKPPSSSIDGGTTSSQIWTEKYKPNNFIQLCSAGNDRQYRSILQWLKKWSPV
                     VFGDDIPHKENADPLGRPYKKILLIHGPTGIGKTTISHILAKHMGYTVQELNAANSMD
                     TLPQASGGGSSAYTNAASALKLKIVNALTSNSIHSQGKPTCLIIDEIDSLANINDVVK
                     VLNDLVQSDHRALNKKLKRSSMEDIEAKKKSKKKDIFLNRPIICIANDIYSQPSNRFG
                     PNPMEKLRPISEIIQFRKPTSSRTTSGAKTGGNAIKSVKDYLMEINKQENMGLDHQEI
                     GEIVEICEGDIRACINHMQFNSRSVDTIERRIAKTPLIDRQLSWFAMTDQLFKRDPQL
                     SKEENLARLFDGFMNGEGRALASNSGTFDRVLKGVFDKYLDIVHIQDDSLVKPCELSD
                     WISYQSQFTRSNETNEYSPLILLKASSLFSDIRVQPGSQTLIPNAKNLDFEHSQLLKS
                     NKNIVRSMENRLPVQVRVALGINHENAASLVLPCLAKILSPHMSAKVKSDLSAVEKRC
                     LERIAGLVKELDLSLEYSKDLETGLSSLKLNPDLDSLTIYDNYLTSIPAASVVKQTQL
                     RRQSLFPLITAELDRLNVSKKSVKRSLEDNIKESNNGDKITKKPKNLATTSLNFFKGR
                     YEEINSKTNMDNIDEGSSDGEKEFKTSRIWVKYNEGFSNAVRKNIGWNDLWLV"
     mobile_element  266903..267408
                     /mobile_element_type="retrotransposon:solo LTR, moa A"
     gene            <273306..>278477
                     /locus_tag="CD36_26160"
                     /db_xref="GeneID:8049815"
     mRNA            <273306..>278477
                     /locus_tag="CD36_26160"
                     /product="ubiquitin fusion degradation protein, putative"
                     /transcript_id="XM_002421667.1"
                     /db_xref="GeneID:8049815"
     CDS             273306..278477
                     /locus_tag="CD36_26160"
                     /inference="similar to AA sequence:UniProt:P33202"
                     /inference="similar to AA sequence:UniProt:Q5A892"
                     /note="Similar to S. cerevisiae UFD4; ubiquitin ligase E3,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ubiquitin fusion degradation protein, putative"
                     /protein_id="XP_002421712.1"
                     /db_xref="GeneID:8049815"
                     /db_xref="GOA:B9WKV1"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B9WKV1"
                     /translation="MADKEKKSNIIPHEDVSHFSDDDSMSIQDAEVSDSEHDLLIRLS
                     QQAQHRRASQNQYHNDINVIGDDSNNDTTTSLDLEVVSSEHDIEDHLDDEIIEEEDDN
                     DDDDDDNSENNEDDYSLYYRHGFQDRDDDFEDSDSLSMMETADFLRQLMQARRNRTAE
                     IHNSSSETAGQSLNEDDEMDDDDNDNINGDGGDDNDENRNEDDEEIEEGEEDEDPRAE
                     FLRVIGLVTGGNRNNSNGDTNSSGNDLVDVMQRLMGGGSVFDGGSARDSGEIDALVNN
                     LSQRQDTYIVLESLNELSERLLMMNGLTAERLIPANKLARSLVEIMEDPKLDEELELH
                     LVACRCLYNFLEVNQDFIHDALNNNAIPALCNKLTEIKYIDLTEQALQTLEMISRDPI
                     SHNSIISNNGLSACLQYLDFLTIHAQRKCLTIIANSCSNISITNFPRVKEAFNGIAEV
                     VRNHNDKVVVENAWLTISRIVMCFKNKPDLLNELFADKELLFKELTKVILVSCNKSSN
                     TSSESSQVTLNDGSNLSLITSLIILVSVSVDVSRILISECEIGSVIVKSLNKYAKQNQ
                     EIDPLKSHSDSISIEALMSAPKDLISQFLSLIGYLLPITYPPSDALYLGPNYEQDKER
                     QNINQTRIELCTQLIPTDYWKFVNDIWSLLILSFQATMDFDIRRKGFVNLYRIICSNE
                     SDFSVIKDVDSIAGLLANVVTQYQSIVIKDFASVEINEDDMVSTDVEESKDVDQGRTS
                     QEDEEEEDDYGEDDDEDEDVVHEDEEFSTLDSRGASSIQSSASSLPEDVNKLNSLMLL
                     LSSLKIIKVLLEKSPLIFIGVFEKEGLINDVLRLLNTLKDKIDLDVKDPRASINSMMS
                     AYSNKFIDSEFTKEYEYKLTSMVIYRNIVNITTDINAIYQQSKDEGLQNLSDSMRILQ
                     EVKTSLSNHRTIKSFSYNQWLELWNNLKLVFRGSLSVSSFELISSGVIETLTKLFSSD
                     YGLESNDCYKAFTATFWSDDSATLLVQKLQEALTRTESFDIVSATSGTSNQSSFARDR
                     NQAAIMASQIKLKLTAEGENTDQSKLPGNMQNMILSVHAIATFKSVFAFLKQRFEFFE
                     ELGGSLSRSSNNEDSERKQDLNIEFLINGEVIPNETTIYGAIYRSLQEKPDEDVNSSR
                     IWSKVHDVTYRKVSAEVSKESPFTNFNFHYNVDRELSIYDDTTINILKLLKILFRMNN
                     NNNNNSGNGLHNVSTKEFTNWKLTVKLNRQLEEPLVVASGTLPGWSIHLTKQFPFIFP
                     FETRIFFLQSTSFGYSRLIHQWQLRTNHNGDDNSSGVNGNQGNNQRLQLGRPTRHKVR
                     ISRKMMLQSAVKVLGMYGSTPGILEIEYFDEEGSGLGPTLEFYSTVSKEFSKKKLRLW
                     RDDEPRQTVSIDDESYVVNKCGLFPRPMDKAQLSSENGRKVLYFYSSLGKFIARALLD
                     SRIIDFNFNPVFLSLIQLLNKTSGISYTSKTSTSKLSKKMATISNLRLVDPTLADSLE
                     HLNKYIQLFEFNSDIHNVTVDGASVEDLALFFELPGNPDYELIPNGSDTLVTADNLEL
                     YINKVIEATLFSGILTQTKAFMDGFSKVFPINSLIIFSSRELVGLFGNAEEDWTMDTL
                     TSSIAANHGYTKDSEAIKSLIDILMNFNIEEKREFLQFLTGAPKLPIGGFKALRPELT
                     VVRKHAEDGLKDDDYLPSVMTCANYLKLPNYSSKEVMKEKLIQAMKEGAGAFLLS"
     gene            <278853..>279677
                     /locus_tag="CD36_26170"
                     /db_xref="GeneID:8049816"
     mRNA            <278853..>279677
                     /locus_tag="CD36_26170"
                     /product="F-actin capping protein subunit alpha, putative"
                     /transcript_id="XM_002421668.1"
                     /db_xref="GeneID:8049816"
     CDS             278853..279677
                     /locus_tag="CD36_26170"
                     /inference="similar to AA sequence:UniProt:P28495"
                     /inference="similar to AA sequence:UniProt:Q5A893"
                     /note="Similar to S. cerevisiae CAP1"
                     /codon_start=1
                     /transl_table=12
                     /product="F-actin capping protein subunit alpha, putative"
                     /protein_id="XP_002421713.1"
                     /db_xref="GeneID:8049816"
                     /db_xref="GOA:B9WKV2"
                     /db_xref="InterPro:IPR002189"
                     /db_xref="InterPro:IPR017865"
                     /db_xref="UniProtKB/TrEMBL:B9WKV2"
                     /translation="MSIKLNELVDSLIQSAPPAELKQVSQSLSSLTKGTSTSSTNSLI
                     QDSIEQYAQDNIISIDNIIISKYSKDENSSKYIDYVNNKLFNVDWSNQKIIDVEPYHN
                     NSNGNSYNELIQKLTQYGDDYYPSNFAFTVIPENQDQLRVIIIGQRANHDNFYTGQWK
                     SNYLITEQEIKGNIDLDIHYFEDGNVRLKFNESINSNNSSTLQSGNLINDSSKIVNFI
                     NEQENATMVKIVEQFNNLNQKTFKNLRRLLPVTRSKINWGSAIGNYRLGSDVVNKK"
     gene            complement(<279733..>280029)
                     /locus_tag="CD36_26180"
                     /db_xref="GeneID:8049817"
     mRNA            complement(<279733..>280029)
                     /locus_tag="CD36_26180"
                     /product="protein transport protein Sft1 homologue,
                     putative"
                     /transcript_id="XM_002421669.1"
                     /db_xref="GeneID:8049817"
     CDS             complement(279733..280029)
                     /locus_tag="CD36_26180"
                     /inference="similar to AA sequence:UniProt:O74231"
                     /inference="similar to AA sequence:UniProt:P43682"
                     /note="Similar to S. cerevisiae SFT1"
                     /codon_start=1
                     /transl_table=12
                     /product="protein transport protein Sft1 homologue,
                     putative"
                     /protein_id="XP_002421714.1"
                     /db_xref="GeneID:8049817"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:B9WKV3"
                     /translation="MSDTLYSQREHQNNQKFDQLASTLHQFRTTIDDDIHNNIQQENS
                     LLDSLNDNFNSLMVSVKQTSGELRTVMNRNASLTRIVGMILLGFFIIWMLYKLI"
     gene            <281076..>282254
                     /locus_tag="CD36_26190"
                     /db_xref="GeneID:8049818"
     mRNA            <281076..>282254
                     /locus_tag="CD36_26190"
                     /product="NADPH dehydrogenase, putative"
                     /transcript_id="XM_002421670.1"
                     /db_xref="GeneID:8049818"
     CDS             281076..282254
                     /locus_tag="CD36_26190"
                     /EC_number="1.6.99.1"
                     /inference="similar to AA sequence:UniProt:Q03558"
                     /inference="similar to AA sequence:UniProt:Q5A894"
                     /note="Similar to S. cerevisiae OYE2; old yellow enzyme 2,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="NADPH dehydrogenase, putative"
                     /protein_id="XP_002421715.1"
                     /db_xref="GeneID:8049818"
                     /db_xref="GOA:B9WKV4"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:B9WKV4"
                     /translation="MTISNSNLFKPINIGKKTISHRIAHLPTTRNRATKDHVPTDLMQ
                     KYYTDRAKTGGLLVTEATLISLNQGIYPNVPGIWNNQQRDAWKRITDSVHSVGGFISV
                     QLWALGRVGNAKLLKKHGLPLTGVSPIYEHEQAEKDAIKAGNPIQELTHNEIKDIIYN
                     QFANAAKLADEAGFDFIELHGANGYLFEQFIHPGTNKRTDKYGGSIENRARFLFEVVD
                     HLTTIVDPSKLAIRLSPLSNFQVPGINPTAKEDYSYIVQGLQKRADEGKGLGYINVVE
                     GRFSPDGSVEACDVNFVGDIWKGALLKGGNYTYDKKNNWETIEHDANSDDRTLVGFGR
                     YFIANPDLPDRIKKDLPLNDYDRSTFYTNDDYGYNTYPFYGQEIKVDPENKVFGVALA
                     "
     gene            complement(<282545..>284038)
                     /locus_tag="CD36_26200"
                     /db_xref="GeneID:8049819"
     mRNA            complement(<282545..>284038)
                     /locus_tag="CD36_26200"
                     /product="subunit of endosomal Vps27p-Hse1p complex,
                     putative"
                     /transcript_id="XM_002421671.1"
                     /db_xref="GeneID:8049819"
     CDS             complement(282545..284038)
                     /locus_tag="CD36_26200"
                     /inference="similar to AA sequence:UniProt:P38753"
                     /inference="similar to AA sequence:UniProt:Q5A895"
                     /note="Similar to S. cerevisiae HSE1;
                     described as a characterized gene/protein in SGD, but as
                     uncharacterized in UniProt entry;
                     In S. cerevisiae: required for sorting of ubiquitinated
                     membrane proteins into intralumenal vesicles prior to
                     vacuolar degradation, as well as for recycling of Golgi
                     proteins and formation of lumenal membranes"
                     /codon_start=1
                     /transl_table=12
                     /product="subunit of endosomal Vps27p-Hse1p complex,
                     putative"
                     /protein_id="XP_002421716.1"
                     /db_xref="GeneID:8049819"
                     /db_xref="GOA:B9WKV5"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:B9WKV5"
                     /translation="MTSLDLLINKATDPTLTSDNWQYILDVCDRISADPETETKRAIS
                     ILKTKLTSKDANVVLRSLSLLISIAENCGSRVKQEIATKSFLQDALVKRLSDKKLHAT
                     VKYKICEVLTQLYNAFKGDPSLKPMTDAYNKARSEHPRYFSKQTQGPSKPAKKERTQQ
                     DKDREEDELQRALKLSLQEFEQQKTGKKEPDVNKPLPEIQPEPESPPVETVATVSKVR
                     ALYDLVSYEPDELSFRKGDVITVIESVYRDWWRGSLPNGKVGIFPLNYVTPIVNKSPQ
                     DIAKEVEVENKLINGEQRKIERLLAILSSQQIETINEDEVTQLYNEIIPLRIQLGNSI
                     DKYGARQEELKVLNQSLNSEIKLYNELLDKSISSRAKHNTGGAMYQMSPYPTEQFPGQ
                     SQPPLSQQYQQAYAQPQQTSNYAQSQTMPSQFTQSQQAQPQYHQPHTRTGSQQEAPQY
                     SGYSNNNIPPPPATTFNQSPPAQLQQQDTSAGFGNAVYNRAAPGQPY"
     mobile_element  complement(284203..285934)
                     /mobile_element_type="transposon:Cirt transposon B
                     (degenerate)"
     gene            complement(<284973..>285347)
                     /locus_tag="CD36_26210"
                     /db_xref="GeneID:8049820"
     mRNA            complement(<284973..>285347)
                     /locus_tag="CD36_26210"
                     /product="transposase, putative"
                     /transcript_id="XM_002421672.1"
                     /db_xref="GeneID:8049820"
     CDS             complement(284973..285347)
                     /locus_tag="CD36_26210"
                     /inference="similar to AA sequence:UniProt:Q9P8U5"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="transposase, putative"
                     /protein_id="XP_002421717.1"
                     /db_xref="GeneID:8049820"
                     /db_xref="GOA:B9WKV6"
                     /db_xref="InterPro:IPR004875"
                     /db_xref="UniProtKB/TrEMBL:B9WKV6"
                     /translation="MINSGLLWVRLKVQKWLYLAMKIEPTLSRSRVEIVVSLSGEVLV
                     AAIIFKGQYSRSGWIDDEAPDYYYSGSKSGYTTYWLSWRWLEEVFIPQVKERTNNGKV
                     LLIMNGHGSHKTNKFKKNMGKQ"
     gene            <287949..>289520
                     /locus_tag="CD36_26230"
                     /db_xref="GeneID:8049821"
     mRNA            <287949..>289520
                     /locus_tag="CD36_26230"
                     /product="permease of the major facilitator superfamily,
                     putative"
                     /transcript_id="XM_002421673.1"
                     /db_xref="GeneID:8049821"
     CDS             287949..289520
                     /locus_tag="CD36_26230"
                     /inference="similar to AA sequence:UniProt:Q2UP40"
                     /inference="similar to AA sequence:UniProt:Q5A896"
                     /codon_start=1
                     /transl_table=12
                     /product="permease of the major facilitator superfamily,
                     putative"
                     /protein_id="XP_002421718.1"
                     /db_xref="GeneID:8049821"
                     /db_xref="GOA:B9WKV7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WKV7"
                     /translation="MSTVKPTTSHVESDIINKPESDHVEIRKSNISESDLGVEEISDL
                     KYINLPPSLQHMTQEELRALDKKTTRKIDLRLMPMLIFIYILNYLDRNNLASARLGGL
                     EKDIGLVGNQYQICISILFVGYILFQVPSNMLLNKMGRPSIYLSVVMTIWGAISTATG
                     AVQSFGGLLAVRVLLGVVESAFFPGALMILSSWYDKKTLASRNSILYAGSLISSAFSG
                     LIAAGILKMDGLGGVEGWRYLFIIEGGITVLTVPFAYFILPDNPSNTKFLSQEEKDII
                     MWKLKRDLGNVDDSDETAQESEMQGFIHACKDIKVWLLCAIHSFLVAACGVTNFFPSV
                     VQTLNFDRTTTLCLTAPPYVIAVIATYVWARHADNSGERFYHVTIPLVLSLVAFIIAA
                     ASLNIGARYFSMCLMIPSLYCAFVVILTWISNCCPRPPAKRAAAIAIVNCLSNSTSIW
                     NAYLYPSGDAPRYLVAFCCNSAFIVLSILFAVGLRIRLTVLNKRIERGTMDWQKELGK
                     GNDGSKISPDFRFLY"
     gene            complement(<293593..>296166)
                     /locus_tag="CD36_26240"
                     /db_xref="GeneID:8049822"
     mRNA            complement(<293593..>296166)
                     /locus_tag="CD36_26240"
                     /product="anaphase-promoting complex subunit, putative"
                     /transcript_id="XM_002421674.1"
                     /db_xref="GeneID:8049822"
     CDS             complement(293593..296166)
                     /locus_tag="CD36_26240"
                     /inference="similar to AA sequence:UniProt:P38042"
                     /inference="similar to AA sequence:UniProt:Q5A897"
                     /note="Similar to S. cerevisiae CDC27; cell division
                     control protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="anaphase-promoting complex subunit, putative"
                     /protein_id="XP_002421719.1"
                     /db_xref="GeneID:8049822"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:B9WKV8"
                     /translation="MHSTTTGAGGRSGSRSRSTSAAGAGATTTSSSTARILGPTLFQD
                     ETNSSANPKYIQQYLRSIIIHSLDTLNYQNAEFASERLLALMEQQRDQQISQQQNHHQ
                     QQQQQQQQQQRDEESDDFLDSMYLYCLVLYRQDKYKTCYFKLSNLKKFDHHLSCSFLY
                     GKCCLKLNKFKEGIFHLIKTKKYHDINNTNNTSKFSGTNTSNNNDRFNKFNYEYNRNI
                     SSDISSIYHILGDLYREVNDLKNSCMNYTLCLKLNQFDFEAFQKLCKLGVNIRVKSIF
                     KFQHQPYSKNNINNAFTSANANSHANNEGPTIPDLTNPFTDRSFNSKLTPSIHVDEFN
                     FSTPRVKTTNASTSSDAPLRKSNLNNGSTVNTNSNNGGGTGHTNNPNSIAAAAAAATA
                     ATASTTNNSNTNHDFEFTKPNYPDDKRKSQSTYSRITSRLISQPQNHHHHHHHQQQQQ
                     QQQQTGSSQMETPKKRNLKRNNSATLDPMYQQGTSASNSTANSISGIGGATSPATSSS
                     TASASSRSSSSSIIITKEIEKSEKHLLQLYLNLGKSYRSMCKYDCYKAIRMLETSLNE
                     FEKNTPWVLSKLGRLHYEIVNYPQSEFYFTKLRRLDRTRLQDMEYYSTLLWHLNKKVE
                     LTYLANELHDLQPNAAITWCVIGNLFSLIHEPNESIKCFNRAIKLDKKFTYAYTLKGH
                     EYFSNDNYEMALENFRISLLLDPRHYNALYGLGMIYINLGDYEKADYHFRKAISINPI
                     NIILICCCGMVLEKLNKRTLAIKQYELAHKLQPLNPLPIFKLGQLYFSLKNYSLALKN
                     FEILKNLAPNEASVHFLLGQLYNLQNDKFLAIKEFTVALNLDPKGNYLIREAMESLKK
                     S"
     gene            complement(<296993..>300328)
                     /locus_tag="CD36_26250"
                     /db_xref="GeneID:8049823"
     mRNA            complement(<296993..>300328)
                     /locus_tag="CD36_26250"
                     /product="protein Beb1, putative"
                     /transcript_id="XM_002421675.1"
                     /db_xref="GeneID:8049823"
     CDS             complement(296993..300328)
                     /locus_tag="CD36_26250"
                     /inference="similar to AA sequence:UniProt:P39969"
                     /inference="similar to AA sequence:UniProt:Q5A898"
                     /note="Similar to S. cerevisiae BOI2; protein Boi2,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="protein Beb1, putative"
                     /protein_id="XP_002421720.1"
                     /db_xref="GeneID:8049823"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:B9WKV9"
                     /translation="MDGGDTYICIKQFNARLGDELSLKIGDKIQVLADDREYNDGWYM
                     GKNLLTGEAGLYPKTFTQLITNNDSKTLLRSRSRRMMAPKSSDQENNPKDSTTPVVSS
                     NLNPNTTSKYPTSSEASNLAEPMSQLNINKDSQSSQYTGSHLNNQIDRALQELQGSNA
                     DLGKSGNSITDNSNNGTTNNNYKQPSLISKKSNDSSSSQYQSQQPKQSSGDKSRQSLT
                     EDLDPLKAYTWTPKQVSSYFALVLGFDMDVAGKFAQHKITGEILFELDLNLLKELDID
                     SFGTRFQLYKEIGKLKELNTKGVKDKQVRTDSSSTGSTGKNDTTSSALNSPPTASTTL
                     HDAEPHMDDNDMLNNTGKQQTQLMPSAVLTNTSDYNNSQQRSSSHHHQRKRSSSVDVA
                     PQQYLASDSTFMSPRRAPQPPSGGSPIDTSYKFGAGSEYDRPPSHYGMYMTRTNASSH
                     ALGSTSPGINSRPASSIYDSFSNHNRNGSSASKHHHKRNSSVTNNNNNNSKHHHRRHS
                     SVFSYLSSGNDDSTKPTPKLLSNKFQSNNLYKGDEGHGDLTSSSNNNKLVSPAQIKRE
                     TMSGQSSPRDSGSKSKRKSQIFDLSNSPVDIDDAKFSPKKSNSVSVRTKSMDAISGGD
                     DRRVASDSTGLSQSKPNNSSRLKGIRATSTQSFRSLTGSKKSKTSAFQEGIREITPDE
                     AIKSANYSGYMSKRSNNNLAWRTRYFTLHGTRLSYFQSLKDKKEKGLIDITAHKVIPI
                     DSASDDTDKADRYAAMYASTTFAGNYCFKLVPPAPGFKKGLTFTQPKTHYFAVETEEE
                     MRGWVKALMQATIDIDDSVPVVSSCSTPTVSLNKAQELLAKAREDTKLRDEQLKANGY
                     IRSLEDINDNSFSASLDYPDLTGENAFDNTSPAATSAPKLTLDTNFNRKSSGTLGTTG
                     TTGTLGTAGTVPTTPQLPRSSSQSGGFASPYLLASGLLSPKSGGAGPAMGSSSSPINE
                     NGTSTMSNSEYFGDTGYQTYKTLKPPSRQNSQYASITSTGGSIGFGYGSNNGGVVGGL
                     STTPYSAGSGSTTSSMNYNNNVNSPTNEFRSSRDLKSTSSPATGTSSMSGKKTQSRRT
                     SDKMMGFSSDASGSHSFVIKPKK"
     gene            <305424..>307514
                     /locus_tag="CD36_26270"
                     /db_xref="GeneID:8049824"
     mRNA            <305424..>307514
                     /locus_tag="CD36_26270"
                     /product="endosomal transmembrane protein, putative"
                     /transcript_id="XM_002421676.1"
                     /db_xref="GeneID:8049824"
     CDS             305424..307514
                     /locus_tag="CD36_26270"
                     /inference="similar to AA sequence:UniProt:P40071"
                     /inference="similar to AA sequence:UniProt:Q5A8A0"
                     /codon_start=1
                     /transl_table=12
                     /product="endosomal transmembrane protein, putative"
                     /protein_id="XP_002421721.1"
                     /db_xref="GeneID:8049824"
                     /db_xref="GOA:B9WKW0"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:B9WKW0"
                     /translation="MLNLISRWYIFNLFITSILAFDFGLGPTYYKHGDKVDLLVNKIE
                     SDTTQLPFAYQSLPFVCPPINGAKPVHLSLGELLKGDRIWQSGYQLQFGIDVPCNRLC
                     DMVLSTNSIKRASDLIKEGYVAHWTVDGLPGATTFESNNHRNKYYAAGFPLGFVNHDD
                     GMSYIYNHVMLVIRYHRQKENNNRYTIVGFEVYPKSVIDEQCPGSSKNYENFPLYYSV
                     DDKNQLIESKTKIAYTYSVYWREDNSIDYDSRWELYYENETNGTHVHIHWISFINSII
                     LIFLASLIVMIVLIKVLKKDIANGGSGKSDNTNSGTVLPLTNDIPMDIDGGDSSSAIK
                     NIGSGWKNLINEVNQIPHYPIFLTTLVSAGIQMVIAAMGVISILMINSIGIKNNFFNS
                     HQGAFFSLSIFCISVSGSISSYFGILLHKYLHYDNLNQPYNQLTIIKLSLLFSAALPA
                     FLFLIIFILNFFVWAKESSAALPFGTIVVFLLIFILIQCPLGIIGGYYANYYHKFDRF
                     LLTSKTPPPQSPLYEKSLLNHGEYNSSATNSKSSILSKILSYSKTILVYGLIPFGIVY
                     VELLFIFNSVWLEKTTFYYMYGFLFVTTLMLFIIIIESTIVAIYISLVVYNDPNWIWL
                     SFQVGSSIGWYIYGYSIYYFIKILNVDDFVSGLLYFVYMALASLMIGIASGSVSVLTG
                     LIFIRKIYGAIKVD"
     gene            complement(<307833..>309305)
                     /locus_tag="CD36_26280"
                     /db_xref="GeneID:8049825"
     mRNA            complement(<307833..>309305)
                     /locus_tag="CD36_26280"
                     /product="iron transporter, putative"
                     /transcript_id="XM_002421677.1"
                     /db_xref="GeneID:8049825"
     CDS             complement(307833..309305)
                     /locus_tag="CD36_26280"
                     /inference="similar to AA sequence:UniProt:P38310"
                     /inference="similar to AA sequence:UniProt:Q5A8A1"
                     /note="Similar to S. cerevisiae FTH1"
                     /codon_start=1
                     /transl_table=12
                     /product="iron transporter, putative"
                     /protein_id="XP_002421722.1"
                     /db_xref="GeneID:8049825"
                     /db_xref="GOA:B9WKW1"
                     /db_xref="InterPro:IPR004923"
                     /db_xref="UniProtKB/TrEMBL:B9WKW1"
                     /translation="MIKFEDYFSIQIFFIILRETLETAIIISVLLSFINQRSHKQHHQ
                     EEESLSANNENTTRPISTDPGSGDINRKLKFQVWIGAILGLIICFIIGIIFVLIFYFV
                     GQDYWSYTERVWEGVFSILSSVIITIMGIGLLRINKVMKLKWWIKLGDAYNYNGQQQQ
                     QQQQQQQQQQEEEEEIAALTDNDILFGSNGNGEEDEDRLNYGGTRSSSESNEIITNSN
                     SNGSSGSSNPGILNNDNEESIPLTVSSNFTPSNNKHKSIPKKSKHPHRQSFNKKYFLA
                     ILPLVTTLREGLEAVVFIGGSAMSSSPNSIPLSVICGISMGSIIGYFLYQGGNKLSLQ
                     YFLIFSTCFLYIVSAGLMSRGIWFLELEQFVRQCNGLDISETGSGPGSYDIAKSVWHV
                     NCCNGLTDGWWMVFNAIFGWTNSATYGSVLSYMIYWGVVIIWLKIKLYEERHGILPLV
                     PLKWQLKRIKKRIRLYELRKNHEQEQQQRSIENDRTALSA"
     gene            complement(<309984..>310562)
                     /locus_tag="CD36_26290"
                     /db_xref="GeneID:8049826"
     mRNA            complement(<309984..>310562)
                     /locus_tag="CD36_26290"
                     /product="phosphatidylglycerol/phosphatidylinositol
                     transfer protein precursor, putative"
                     /transcript_id="XM_002421678.1"
                     /db_xref="GeneID:8049826"
     CDS             complement(309984..310562)
                     /locus_tag="CD36_26290"
                     /inference="similar to AA sequence:UniProt:Q12408"
                     /inference="similar to AA sequence:UniProt:Q5A8A2"
                     /note="Similar to S. cerevisiae NPC2"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphatidylglycerol/phosphatidylinositol
                     transfer protein precursor, putative"
                     /protein_id="XP_002421723.1"
                     /db_xref="GeneID:8049826"
                     /db_xref="InterPro:IPR003172"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:B9WKW2"
                     /translation="MVSFKNLAIVTLVVTTSSVEGISFSNIYLNKAITIFKNPTSLIP
                     SFSNSKLINFQDTKPIPGDSPIEVCDATEKQLLHLDEVILTPNPPVAGQNLTFTAVGT
                     LDETIEEGAYVEVEVRYGFIKLIHQTYDLCEEIVKVDLQCPIQSGKQTITKNVEIPEE
                     VPPGKYLVVARAYTKDDEYITCLTATIIFPVQ"
     gene            complement(<311367..>314426)
                     /locus_tag="CD36_26300"
                     /db_xref="GeneID:8049827"
     mRNA            complement(<311367..>314426)
                     /locus_tag="CD36_26300"
                     /product="calcofluor white hypersensitive protein
                     precursor, putative"
                     /transcript_id="XM_002421679.1"
                     /db_xref="GeneID:8049827"
     CDS             complement(311367..314426)
                     /locus_tag="CD36_26300"
                     /inference="similar to AA sequence:UniProt:P25618"
                     /inference="similar to AA sequence:UniProt:Q5A8A3"
                     /note="Similar to S. cerevisiae CWH43; sensor/transporter
                     protein involved in cell wall biogenesis, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="calcofluor white hypersensitive protein
                     precursor, putative"
                     /protein_id="XP_002421724.1"
                     /db_xref="GeneID:8049827"
                     /db_xref="GOA:B9WKW3"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="InterPro:IPR027317"
                     /db_xref="UniProtKB/TrEMBL:B9WKW3"
                     /translation="MSEEKPIPVDSGDDELVVVEEVEKTPFFTFNASIISYLHTIFAS
                     SSFLAALAVGSYLHYYKIVQNSSFGYPDEWFPSVSATIGDRYPERSVFQIIIALTAGP
                     RFLLLIFNFISLFKKNSYLPYIATISGTLRTFTAGGWMYITSTDDHDAHDVFMISYMV
                     LTIPWTVCNTLLSPKGSLQRNARFYSAIAFFGTIVPLIYWFIQHKVHVRPGAYSIYAY
                     FEWGLIFFDILFDSWSAIDFTNIDISISATGIELVHVDSTTATVTTKTTTIESTKVTE
                     IETEIKPGPFDSQFSDIDVVVNLINSFIYWTVVTSLFLCVWYFPLWHMGISGYEAAVL
                     SFFLAPLLLIIPVSLNFFVTYPSISRTLTVILGIGAYKVQDPEQRLLTITAGTVFAVI
                     SVISEFSAFANHPKKLNSYISTFSLGLLATSIFKYLCFSNNPIWPIMHKENGGYNGIG
                     IFLGLLAAFFTPKQKQSTHKSTNGESVATAGGSLLLAALGFGGYYFSLSSYLSDSGTL
                     ALWTWEGFPIKGPTPVTGALYHFIAIMAAIIVNVKSHPNLFSSWSYNIIIGGGSAFVL
                     YNFGGWIGYVGAVIYTFYLTSIGPIIWNSIKGYNITGAFFFGYFFNILFGLASVWIVA
                     YAFVPGGPLLRERTDIVLGGSFVSILTGVLNYNLRREEFTKIKFTSCKIFKQTLTIIT
                     VLLALSISIFIKRYPSEPFKPYNEESKSFTAGIWCVHFGLDNDMWSSETRMRDLIRDA
                     EIDIIGLLESDTQRLIGGNRDFTQTIAEDLGMYVDYGPGPNKHTWGAALLSKFPIIES
                     THHLLPSPVGELAPAIHATLDIYGELVDVVVFHSGQEEDIEDRRLQSLGIQEIMGNSS
                     RPLILLSYLVTEPLQGNYNTYVSEKSRVYDIDNTDWDRWCEYILFRDLRKVAYARISR
                     STITDTELQIAKFKLLNDEEKNDDDLEFYYGNNFVNEDEIEENLRMPQIFRGDGVRGH
                     RYHVFDEPRYFAQHKWQRYNQEEQEQQQQQQQQGEEEERQNEEDEEY"
     gene            <314927..>315297
                     /locus_tag="CD36_26310"
                     /db_xref="GeneID:8049828"
     mRNA            join(<314927..314930,315005..>315297)
                     /locus_tag="CD36_26310"
                     /product="NADH-ubiquinone oxidoreductase subunit,
                     mitochondrial precursor, putative"
                     /transcript_id="XM_002421680.1"
                     /db_xref="GeneID:8049828"
     CDS             join(314927..314930,315005..315297)
                     /locus_tag="CD36_26310"
                     /EC_number="1.6.5.3"
                     /inference="similar to AA sequence:UniProt:Q03015"
                     /inference="similar to AA sequence:UniProt:Q6BKM4"
                     /note="Similar to N.crassa nuo-12.3;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="NADH-ubiquinone oxidoreductase subunit,
                     mitochondrial precursor, putative"
                     /protein_id="XP_002421725.1"
                     /db_xref="GeneID:8049828"
                     /db_xref="GOA:B9WKW4"
                     /db_xref="InterPro:IPR020163"
                     /db_xref="UniProtKB/TrEMBL:B9WKW4"
                     /translation="MGRLDSYENHQRPELVSFDDISYNDLSQVEAARKSMLREQWIRV
                     YELRVTHEALRKCRQYHQEDASRNCKSLVLKYMKMLESYPIQGYMGYQKNDPSQ"
     gene            <316020..>317149
                     /locus_tag="CD36_26320"
                     /db_xref="GeneID:8049829"
     mRNA            join(<316020..316066,316309..>317149)
                     /locus_tag="CD36_26320"
                     /product="ATP synthase gamma chain, mitochondrial
                     precursor"
                     /transcript_id="XM_002421681.1"
                     /db_xref="GeneID:8049829"
     CDS             join(316020..316066,316309..317149)
                     /locus_tag="CD36_26320"
                     /EC_number="3.6.3.14"
                     /inference="similar to AA sequence:UniProt:P38077"
                     /inference="similar to AA sequence:UniProt:Q5A8A4"
                     /note="Similar to S. cerevisiae ATP3;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP synthase gamma chain, mitochondrial
                     precursor"
                     /protein_id="XP_002421726.1"
                     /db_xref="GeneID:8049829"
                     /db_xref="GOA:B9WKW5"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="InterPro:IPR023632"
                     /db_xref="InterPro:IPR023633"
                     /db_xref="UniProtKB/TrEMBL:B9WKW5"
                     /translation="MFRSGVSTAANAVRVSARNYATLREIEMRLKSIKNIEKITNTMK
                     IVASTRLNKAQKAMASSRVFNESDREFLANAEPKPIEEEGAAKSDDKTLLIVVSSDKG
                     LCGSIHSQVAKAARKRTEQLNGNVDIVCVGDKVKAQILRTYADKVKLAFNGVGKEEPN
                     FTEVALIADEISKLGNYENVEILYNKFVSGVSFEPSKFSIYAADAIANSPGLSKYELE
                     NEEITSDVSQFSLANNLLAAMAEGYASEISARRNAMDNASKNAGDMINSYSILYNRTR
                     QAVITNELVDIITGASSLD"
     gene            complement(<317489..>320452)
                     /locus_tag="CD36_26330"
                     /db_xref="GeneID:8049830"
     mRNA            complement(<317489..>320452)
                     /locus_tag="CD36_26330"
                     /product="sulfate transporter/permease protein, putative"
                     /transcript_id="XM_002421682.1"
                     /db_xref="GeneID:8049830"
     CDS             complement(317489..320452)
                     /locus_tag="CD36_26330"
                     /inference="similar to AA sequence:UniProt:P53273"
                     /inference="similar to AA sequence:UniProt:Q5A8A5"
                     /note="uncharacterized vacuolar membrane protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="sulfate transporter/permease protein, putative"
                     /protein_id="XP_002421727.1"
                     /db_xref="GeneID:8049830"
                     /db_xref="GOA:B9WKW6"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:B9WKW6"
                     /translation="MASPYGIPNKSGGNDNSETFDFGGRSYVSMSYKPSLLSSSLVNT
                     GVEVHEQTANLANVLVTEPLNEEEEDNDDDDDDNLEQHQHQHQEQSEEHQHSISESSL
                     LMSNSPRSNYFSQVDVLESEIGSPSINSFKSNQNRSHSGSIPSVNSQPSSKDNIPEKQ
                     PSKLHSYLVKPIGYIPGVFLGTLLNILDGLSYGMIMFPISESIFSSLAPTGLSMFYMS
                     CIISQLIYSLGGSAFKAGIGSEMIEVTPFFHTMAGAIAKQMADNTNDAIIATTITSYA
                     ISSIVTGLVFFLLGKLKLGVLVGFFPRHILVGCIGGVGYFLIATGIEVSSRLEGGLSY
                     NYETFKYLFYNYTTLLEWTIPLLLALILIILQHKYHNSLLVPLYFIAVFIIFHLLVSL
                     VPSWSLNSARATGWVFPMVEDNEPWYNFYSLYKFNLVDWVCIVRQIPTMLALTFFGIL
                     HVPINVPALAVSVGMDEVDVDRELVAHGYSNAISGLVGSIQNYLVYTNSVLFIRAGAD
                     DRVAGVMLAIATAAVMMVGPVVIGYIPVCVVGALIYLLGYELLKEAIYDTWGRLRNIE
                     YITIIIIVVTMGAVDFVAGIGVGILLACLSFVVEAGRTPVVQGIYSGSVARSTVMRHP
                     KQQEFLKNVGEQICIVKLQGTLFFGSIGGVEKEIRNMFEHDKFKSNPIKYLIIDMKGV
                     ISLDFSAAEGFRRILNLANDFKTQFIISSVGEDDDIIQGLRDAGIFDNGANAPIELFS
                     SLNYALEWCENSFLKTYSKLKKSDPVKTRSVPASSTLTTRQSFASPSSYGAKFFGKYG
                     EFGTPRTNQVFQAASKTVYDEHKTESKFESQKNTLFQKQPLSLIMLSFQGLSDKDAEF
                     WSNITPYFVKEKIPENYQFYDTKNDEPAFFIVESGLIRSVIKFESEGRELHSSILPLV
                     AFGDLDDASEYRQIIYTTVNDTVVWKLSQAKLKEMLAKHGSKGEELYHELLEVEAKLI
                     RGRFDTMTANLIIAG"
     gene            <322118..>325561
                     /locus_tag="CD36_26340"
                     /db_xref="GeneID:8049831"
     mRNA            <322118..>325561
                     /locus_tag="CD36_26340"
                     /product="arginine-specific carbamoyl-phosphate synthetase
                     ammonia chain, putative"
                     /transcript_id="XM_002421683.1"
                     /db_xref="GeneID:8049831"
     CDS             322118..325561
                     /locus_tag="CD36_26340"
                     /EC_number="6.3.5.5"
                     /inference="similar to AA sequence:UniProt:P03965"
                     /inference="similar to AA sequence:UniProt:Q5A8A6"
                     /note="Similar to S. cerevisiae CPA2; carbamoyl-phosphate
                     synthase arginine-specific large subunit, putative;
                     carbamyl phosphate synthetase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="arginine-specific carbamoyl-phosphate synthetase
                     ammonia chain, putative"
                     /protein_id="XP_002421728.1"
                     /db_xref="GeneID:8049831"
                     /db_xref="GOA:B9WKW7"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:B9WKW7"
                     /translation="MITLKTAITQQFKITKKSISVFQKHSFSLSSLLRQKEQLRYAGA
                     DLLKNFTDEHAHKLVDVSKVLVIGSGGLSIGQAGEFDYSGSQAIKALKEANKQSILIN
                     PNIATNQTSHALADEIYYLPVTPEYITYIIERERPDGILLTFGGQTGLNVGVKLDKMG
                     VFERYGVKVLGTPIKTLETSEDRDLFAQALKEINIPIAESIAVENVDDALNAAKEVGY
                     PIIVRSAYSLGGLGSGFAANEEELRNLAAQSLSLAPQILVEKSLKGWKEVEYEVVRDR
                     VGNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEEYHMLRSAAIKIIRHLGVVGECN
                     VQYALQPDGLDFRVIEVNARLSRSSALASKATGYPLAYTAAKIALGHTLPELPNPVTK
                     TTTANFEPSLDYLVTKIPRWDLSKFQHVKRDIGSAMKSVGEVMAIGRNFEESFQKAIR
                     QIDPSYIGFQGDKFDNLDEALANPTDRRWLAVGQALLHENYTVDQVHELTKIDKWFLH
                     KLMNIVNMYRELEANGHLSIINHDLMSRAKKLGFSDKQIGLCVGADELEVRRVRKELG
                     IIPFVKKIDTLAAEFPANTNYLYTTYNATSSDIDFNDKGTMVLGSGVYRIGSSVEFDW
                     CAVSTARALRENGHKTIMINYNPETVSTDFDEVDRLYFEELSLERVLDIYELEHAQGV
                     VVSVGGQLPQNIALSLQNQGCNVLGTNPEDIDKAEDRHKFSQILDSIGVDQPAWKELT
                     SVKEAENFADEVGFPVLVRPSYVLSGAAMSVINNKSELDAKLSNASKVSRDYPVVISK
                     FIQGAQEIDIDGVANEGEVLVHAVSEHVENAGVHSGDATLVLPPQGLSPILLDRLKVI
                     ADKVAAAWKITGPFNMQIIKNDQNGTLNDETCELKVIECNIRASRSFPFVSKVLGINF
                     IDVAVKALIKQNVPQPVNLMNQKYDRVATKVPQFSFTRLAGADPFLGVEMASTGEIAC
                     FGKDLLEAYWTSIQSTMNFHLPKPGQGLLFGGDLTNDKLGKVASNLTGLGYKFYTASE
                     PVAQYLKNFVKEPVEIIEFPKTDKRALREIFQDKEIGAVFNLAKARAEDLLDEDYVMR
                     RNAIDFAIPLFNEPNTSLLFSQCLKEKIGHKVSFDEIPHKVEIPQEVKRWSEFIGGKP
                     V"
     gene            <326185..>327825
                     /locus_tag="CD36_26350"
                     /db_xref="GeneID:8049832"
     mRNA            <326185..>327825
                     /locus_tag="CD36_26350"
                     /product="ion transporter protein, putative"
                     /transcript_id="XM_002421684.1"
                     /db_xref="GeneID:8049832"
     CDS             326185..327825
                     /locus_tag="CD36_26350"
                     /inference="similar to AA sequence:UniProt:P53389"
                     /inference="similar to AA sequence:UniProt:Q5A9E8"
                     /note="Similar to S. cerevisiae HOL1; major facilitator
                     superfamily transporter protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ion transporter protein, putative"
                     /protein_id="XP_002421729.1"
                     /db_xref="GeneID:8049832"
                     /db_xref="GOA:B9WKW8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WKW8"
                     /translation="MTIQVDDYEMVPGTVHLIDINGNLDVQKNGDIILQPQPTNNPND
                     PLTWSKSKRLIQFSLVWIWGLFVAVAINWVGPVFGVWEKDLKTTIGDLSNAVAVGFLF
                     LGVGVLLVQPTTLKLGKRFIYIVGSIFTIISLAVGSQATEVGSIFAFKALVGLGASPC
                     DSVVELSATDLFFQHERSTAISSLILALYAGSFLGPIIAGYITDSIGWKWCFYVQIII
                     YSVFLIIQLAFQEETTFRRALSDETLEEEILQQIKSTEINNEKQIVSEPATKEVKDDE
                     ESGSSSIQSYKRKTYFQKVNLIHTDQNDSRSWLCIFYRPFFVLYYPAFIFGGIVYGSQ
                     MMWLSLTSTTQTLIYGAEPYNFSANGVGLTNLGCLIGSILGTFYGGKFVDWLSIRLAK
                     KNNGILEPEYRLWAMIVPTILNAGGLLAYYLPCANNASWAFSVVLGQGALGFAMSSSG
                     SICITYAIDSYPKVASEGIVLMLFIRNMMGMGFSYAISPWINRNGLVVVTWLMFMLSI
                     IINGSFIVMLVFGKQFRRWTAAHYEKVSESNYGEFFKR"
     gene            complement(<328197..>329078)
                     /locus_tag="CD36_26360"
                     /db_xref="GeneID:8049833"
     mRNA            complement(<328197..>329078)
                     /locus_tag="CD36_26360"
                     /product="N-ethylmaleimide sensitive factor attachment
                     protein, alpha, putative"
                     /transcript_id="XM_002421685.1"
                     /db_xref="GeneID:8049833"
     CDS             complement(328197..329078)
                     /locus_tag="CD36_26360"
                     /inference="similar to AA sequence:UniProt:P32602"
                     /inference="similar to AA sequence:UniProt:Q5A9E7"
                     /note="Similar to S. cerevisiae SEC17; alpha-soluble NSF
                     attachment protein, putative; vesicular-fusion protein
                     SEC17 homologue"
                     /codon_start=1
                     /transl_table=12
                     /product="N-ethylmaleimide sensitive factor attachment
                     protein, alpha, putative"
                     /protein_id="XP_002421730.1"
                     /db_xref="GeneID:8049833"
                     /db_xref="GOA:B9WKW9"
                     /db_xref="InterPro:IPR000744"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:B9WKW9"
                     /translation="MSDPRSLIAEAEKLLKPQSGFFSFLSGSSASMRKEDATDLYIQA
                     ANSYRLKKDFNLAGAQFVKAAEIQESLGNHNDTANHLVEAYKCFKGVSPTDAISSLSK
                     AIHIFLTQNGQFRRAANFTMDLAELYESVNDYENASKSYEQAGDYFTTDHAEALANKA
                     FLKCADLYALNGNYKKAVELYDNIIKNSLGNSLSRWSLKDYFFKVVLCVLCMDDVIEA
                     HKRKDQFLQDDPSWGQSREYKLVEGILESIDQGDVEGFSDKVFDFDQFSKLDKLKTQL
                     LLKVKNSVVAKDDDDLL"
     gene            <329349..>329939
                     /locus_tag="CD36_26370"
                     /db_xref="GeneID:8049834"
     mRNA            <329349..>329939
                     /locus_tag="CD36_26370"
                     /product="kinetochore-associated protein, putative"
                     /transcript_id="XM_002421686.1"
                     /db_xref="GeneID:8049834"
     CDS             329349..329939
                     /locus_tag="CD36_26370"
                     /inference="similar to AA sequence:UniProt:P47149"
                     /inference="similar to AA sequence:UniProt:Q5A9E6"
                     /note="Similar to S. cerevisiae NNF1"
                     /codon_start=1
                     /transl_table=12
                     /product="kinetochore-associated protein, putative"
                     /protein_id="XP_002421731.1"
                     /db_xref="GeneID:8049834"
                     /db_xref="InterPro:IPR007128"
                     /db_xref="UniProtKB/TrEMBL:B9WKX0"
                     /translation="MSAEENNKVRFERLRLVARKALEQSIKKSLTMEQVKTCFPTLVA
                     SPDGVRSLELALSQMSGFWHSNSLDEFDLIYKEKDIESKLDELDDIIQNAQQAKDSGK
                     EPSNIDQLSPLEIVDSTIVSNSKNVLDSLQMIYDQLCLDNAELYTELSDLTKESTRIN
                     NSIKSGIEQLNKEANNVELEKAGIQIDKLIDILEEK"
     gene            complement(<330005..>330967)
                     /locus_tag="CD36_26380"
                     /db_xref="GeneID:8049835"
     mRNA            complement(<330005..>330967)
                     /locus_tag="CD36_26380"
                     /product="mitochondrial 37S ribosomal protein MRPS28"
                     /transcript_id="XM_002421687.1"
                     /db_xref="GeneID:8049835"
     CDS             complement(330005..330967)
                     /locus_tag="CD36_26380"
                     /inference="similar to AA sequence:UniProt:P21771"
                     /inference="similar to AA sequence:UniProt:Q5A9P2"
                     /note="Similar to S. cerevisiae MRPS28"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 37S ribosomal protein MRPS28"
                     /protein_id="XP_002421732.1"
                     /db_xref="GeneID:8049835"
                     /db_xref="GOA:B9WKX1"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="UniProtKB/TrEMBL:B9WKX1"
                     /translation="MFKFTTRLLSTSRLLLSQAGESTSSVSATIPRFHVKFGAKQFIE
                     PGTNKRRAKRLRRKESRIKKQIIRDVNTLKQHEVKNVPLKVDPVLGDPNCGFVDRIMK
                     KVENQELTLAYGIDRVEFEKLLYAAEKLSLENASKNEALRESVIQTEENKRKAVMTIL
                     NLKNTNVPDKKKMAIKFAREEMQRSPGDTASPEVQAAVATIKIHYGMQQVKNMPKDKI
                     NIQGVRKLVQYRQTILKYLKRKNPESYYYTIAKLGLTDDVIVREFNMGKQYMQDFKVW
                     GDKVLVKETNSVAKKNKKIKDLKDRVAKYNELAKKNYEILYGTK"
     gene            <331194..>334145
                     /locus_tag="CD36_26390"
                     /db_xref="GeneID:8049836"
     mRNA            <331194..>334145
                     /locus_tag="CD36_26390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421688.1"
                     /db_xref="GeneID:8049836"
     CDS             331194..334145
                     /locus_tag="CD36_26390"
                     /inference="similar to AA sequence:UniProt:Q5A9P1"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421733.1"
                     /db_xref="GeneID:8049836"
                     /db_xref="UniProtKB/TrEMBL:B9WKX2"
                     /translation="METVGGLVKLRGLAKKYCEDDTQVNFNELYRHVFTDEPSVQYLD
                     VLLSWKVLDKIILLIVEGRHLDTLKFYKFSLRLFVHEYFRRNGDKQRVKDVFFLQLDN
                     NLRWKFVDKLANFVIDKSIKDYEVRIDILRFLTILQLNEEFGRYIFVNFIHDTDIQLN
                     YSLENIGDALSKDVTNIKDKRKNQHWLLQLINSFGSKNDVSPTNWQCAIIKFLFAWCS
                     SHKYGEYIQLFLKAVGVPSYFAIYASQGTIELVNLLKHVLEIDYCDVTFSQFRQTLRL
                     MFKDRARLIYKVISFISLYDCPFEDFSVLLNEYLTVSEAKKLLDRFIPTEKQVSLGCL
                     KQLTDDDDKKRFYIDILLTQVYQSNEYKPHFWKSITENSFEDIPGDMKFVTHYPTISR
                     VAETITLENKYDALREIDNHLKAVMGRVNPKNALSYTGSSKYFAKIESLVTLSPHEYE
                     ITLDERFGGDDFRFAVGVTICKPVKGNSLRNLGIDLVRVGRISKQNKTYIFKCENLEG
                     ANVTHVIFLPNTPTLKALEVLSYNNEMSHAQNMTNTSLVAKSLFDNSTGDRTEDTNNS
                     LSISQTFFAKKYDDVSSVLPDITDFHTIVLTPSESFLQQYKNVLLIRYGDEQSVNAVL
                     RYASEYFEKMQEVLGNGDVLQLKQISSPLQLDQILDNCLGKWNNSVKGISADNNELPN
                     EYLKIVKNPISNSNEAVRETKVLKQTMRVIRKVWFTLGKDLNMTMWNYICNTFSVVMT
                     VDDWLNVFDKIQVDTSFVYVNCNVSVLLMSYFKVDWQKQRSGSIKVIGGELEDFFSFK
                     IPNEIIPKSPSSSNISTFNPGLGSAKQLVSVQNQLEEAELCVLLFRYMRALDYPRESI
                     GIWVSCKRQLDLINEIAKNSNLDKNVGMPFVLFNKSGAYDYDHVSYSIVSLFTDSGYK
                     ELDCPGSLGNYYFSSNIEIDKDLLGLSDSTTDYRLNIVQGEKFGLKERTKESIVTVQS
                     KVQFQKIIDHL"
     gene            <334396..>335121
                     /locus_tag="CD36_26400"
                     /db_xref="GeneID:8049837"
     mRNA            <334396..>335121
                     /locus_tag="CD36_26400"
                     /product="GrpE protein homolog, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_002421689.1"
                     /db_xref="GeneID:8049837"
     CDS             334396..335121
                     /locus_tag="CD36_26400"
                     /inference="similar to AA sequence:UniProt:P38523"
                     /inference="similar to AA sequence:UniProt:Q5A9E1"
                     /note="Similar to S. cerevisiae MGE1; mitochondrial matrix
                     protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="GrpE protein homolog, mitochondrial precursor,
                     putative"
                     /protein_id="XP_002421734.1"
                     /db_xref="GeneID:8049837"
                     /db_xref="GOA:B9WKX3"
                     /db_xref="InterPro:IPR000740"
                     /db_xref="InterPro:IPR009012"
                     /db_xref="InterPro:IPR013805"
                     /db_xref="UniProtKB/TrEMBL:B9WKX3"
                     /translation="MHRALYTSLARTVNARCVSRSVRFVAPQVSVCNPQRLALRFNST
                     NASKEAAKEEAPKEEIKSEEQSSAGESEAQEVDPFAELKEKLEKKDKELASMKNHYAR
                     AVADFRHLQETTKTEVQKAKDFALQKFAKDLLDSLDNFNLALGHVKEDTLKLNDEVRS
                     LYEGVDMTKTVFEKTLNKYGIEKIDPIDQVFDPNLHEATFQMASPGKEPGTVFHVQQV
                     GYTLNERVLRPAKVGVVKSEDDN"
     gene            <335662..>336792
                     /locus_tag="CD36_26410"
                     /db_xref="GeneID:8049838"
     mRNA            <335662..>336792
                     /locus_tag="CD36_26410"
                     /product="homoisocitrate dehydrogenase, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_002421690.1"
                     /db_xref="GeneID:8049838"
     CDS             335662..336792
                     /locus_tag="CD36_26410"
                     /EC_number="1.1.1.87"
                     /inference="similar to AA sequence:UniProt:P40495"
                     /inference="similar to AA sequence:UniProt:Q5A9D9"
                     /note="Similar to S. cerevisiae LYS12"
                     /codon_start=1
                     /transl_table=12
                     /product="homoisocitrate dehydrogenase, mitochondrial
                     precursor, putative"
                     /protein_id="XP_002421735.1"
                     /db_xref="GeneID:8049838"
                     /db_xref="GOA:B9WKX4"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:B9WKX4"
                     /translation="MLAARSSIRRCFSTTSTTLKSLKIGLIPGDGIGREVIPAGKAVL
                     ENLPAKHDLQFEFVNLDAGFELFKKTGTALPDETVDILKKECDGALFGAVSSPTTKVA
                     GYSSPIVALRKKLGLYANVRPVKSVEGIGRPVDMVIVRENTEDLYIKEERVYKKEDGT
                     KVAEAIKRITETASTKIAKMAFEIALQREAVRKGTSGKQLHEKPSVTVTHKSNVLSQS
                     DGLFRETCRAVYDANANEYGGIEYKEQIVDSMVYRMFREPEIFDVVVAPNLYGDILSD
                     GAAALVGSLGVVPSANVGDSFAIGEPCHGSAPDIEGKGISNPVATIRSTALMLEFMGY
                     PEAAATIYQAVDANLAEDKIKTPDLGGNSTTQEVIDDIIRRF"
     gene            complement(<336846..>337976)
                     /locus_tag="CD36_26420"
                     /db_xref="GeneID:8049839"
     mRNA            complement(<336846..>337976)
                     /locus_tag="CD36_26420"
                     /product="WD repeat protein, putative"
                     /transcript_id="XM_002421691.1"
                     /db_xref="GeneID:8049839"
     CDS             complement(336846..337976)
                     /locus_tag="CD36_26420"
                     /inference="similar to AA sequence:UniProt:P53962"
                     /inference="similar to AA sequence:UniProt:Q5A9D8"
                     /codon_start=1
                     /transl_table=12
                     /product="WD repeat protein, putative"
                     /protein_id="XP_002421736.1"
                     /db_xref="GeneID:8049839"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:B9WKX5"
                     /translation="MEAKNLHTWLPFTNDDWILKVIQLSENEFIASTSNGSLIGYSIS
                     NLSSTPTIKIEKAHESSINDIVKIDNDSIASCSTDGIKIWNLRSKSAISTLTNTKKSN
                     FLSLAYKNNLLAAGTELVGVDAELHIWDIRNTDNVVRSFVDSHHDDITALEFHPTLTN
                     YLMSGSTDGYVNIYNLNETEEDEALHQVINFASVHSCHFITESRISILSHMETFMVHD
                     LNDTNYEELVEPKFKDFGDLRKEWPSNEYVIDISPAGFAAYGSHSESSLSLLPFNPER
                     ESFDISKLIFFPKAHGEEVVRDFIVIPNSKMALSCGEDGRIKLWELPFQLKSFLLGSE
                     EKETDITMTEGDVQSEKKSKKDRKDKKKDKKKHKKDVRFKPY"
     gene            <338557..>340539
                     /locus_tag="CD36_26430"
                     /db_xref="GeneID:8049840"
     mRNA            <338557..>340539
                     /locus_tag="CD36_26430"
                     /product="transcription factor TFIIIB subunit, putative"
                     /transcript_id="XM_002421692.1"
                     /db_xref="GeneID:8049840"
     CDS             338557..340539
                     /locus_tag="CD36_26430"
                     /inference="similar to AA sequence:UniProt:P46678"
                     /inference="similar to AA sequence:UniProt:Q5A9D7"
                     /note="Similar to S. cerevisiae BDP1"
                     /codon_start=1
                     /transl_table=12
                     /product="transcription factor TFIIIB subunit, putative"
                     /protein_id="XP_002421737.1"
                     /db_xref="GeneID:8049840"
                     /db_xref="GOA:B9WKX6"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017174"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:B9WKX6"
                     /translation="MSSLVKKGGTSFTPKLKKVVRKKPVVAAKPPITPPATQVKDGDE
                     DTSTVISNTENSNGVLTSATAQTTTDTETNIPTPASTQLPESPKSKPAFRIGPTKTSS
                     NEKSQKDYDIDPKDASKQYAGEVENENAIASSSEDDDDEDIFKPPVDPSKSRRQSITQ
                     RRLSNITASGLRSRSASISLHNADASHVPAKIGIPVSKPTKRRRSSVQARNSKRVSTT
                     QPPKPKAVVVPTMSTETTTSSMDRSESSAREEKKPPKKSDIKGISDDFIVGIDPKTQK
                     LTKFRRKGAVKVKKEADSVKNEAEPVKAEGDEVKLEVLSDTDSIPEEPDNLITTVTHI
                     SQIPNGINDEDADLFGEVDVNLEEVTMAELCKPTLRIGKVSTNFELVREAEKQLKQKK
                     AQRRRDRELARIERISLEDAIQKNEEQRRGTGDAVSKEDDEPKPDSLFDEEPQQATTS
                     LQLTFTDGKIGFNEESAIVAKPRADITSRSVEKSNPFANPITSTTYSRRIFTDKWTSE
                     ELNQFYQALSMFGTDFSLISQLFPHRTRKQIKSKFNLEERKFPEVVELALRRKLPVDF
                     EEYCANTKNDIKSLEYYNEELRKVRIEHEQSMNAIALEREKALKEDAEASRRREIEIR
                     TGSKPMSRAEKLKELRKNETVVGSIDDVRKKRETNV"
     gene            <340873..>341490
                     /locus_tag="CD36_26440"
                     /db_xref="GeneID:8049841"
     mRNA            <340873..>341490
                     /locus_tag="CD36_26440"
                     /product="phosphatidylinositol
                     N-acetylglucosaminyltransferase subunit, putative"
                     /transcript_id="XM_002421693.1"
                     /db_xref="GeneID:8049841"
     CDS             340873..341490
                     /locus_tag="CD36_26440"
                     /EC_number="2.4.1.198"
                     /inference="similar to AA sequence:UniProt:P53961"
                     /inference="similar to AA sequence:UniProt:Q5A9D6"
                     /note="Similar to S. cerevisiae GPI15"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphatidylinositol
                     N-acetylglucosaminyltransferase subunit, putative"
                     /protein_id="XP_002421738.1"
                     /db_xref="GeneID:8049841"
                     /db_xref="GOA:B9WKX7"
                     /db_xref="InterPro:IPR019328"
                     /db_xref="UniProtKB/TrEMBL:B9WKX7"
                     /translation="MSSSKNYKLEISPSINQTSSTESQNLLKFTVQSNTPNKIIQYRL
                     PIIVLLGSFAVAYIIQNIEQLKSYDIDVSHHGILLISVVGIALLLCLQTPKDTIIVMR
                     GIGIQLQSKKIWRFQSSDSFIPINNMIDLVIHEGFHDYGQVIFYLCVLTKAANDKNPI
                     TIVFPEFLPRKDILLTVWRLSRELLFGSTNRYWRRVPGQGLKQVV"
     gene            complement(342942..343057)
                     /locus_tag="CD36_tRNA_0090"
                     /db_xref="GeneID:8049842"
     tRNA            complement(342942..343057)
                     /locus_tag="CD36_tRNA_0090"
                     /db_xref="GeneID:8049842"
     gene            complement(344162..344477)
                     /locus_tag="CD36_26445"
                     /pseudo
                     /db_xref="GeneID:8049668"
     misc_feature    complement(344162..344477)
                     /locus_tag="CD36_26445"
                     /inference="similar to AA sequence:UniProt:Q5A9D5"
                     /pseudo
                     /db_xref="GeneID:8049668"
     gene            <344610..>345575
                     /gene="CSP37"
                     /locus_tag="CD36_26450"
                     /db_xref="GeneID:8049843"
     mRNA            <344610..>345575
                     /gene="CSP37"
                     /locus_tag="CD36_26450"
                     /product="37 kDa cell surface protein, putative"
                     /transcript_id="XM_002421694.1"
                     /db_xref="GeneID:8049843"
     CDS             344610..345575
                     /gene="CSP37"
                     /locus_tag="CD36_26450"
                     /inference="similar to AA sequence:UniProt:P53707"
                     /note="no apparent S. cerevisiae orthologue;
                     In C. albicans: role in progression of murine systemic
                     infection; hyphal cell wall protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="37 kDa cell surface protein, putative"
                     /protein_id="XP_002421739.1"
                     /db_xref="GeneID:8049843"
                     /db_xref="UniProtKB/TrEMBL:B9WKX8"
                     /translation="MSAGKYLLGTAALVGGVYYYDQYVQPILPRQQHQELAYQTQRVE
                     NKGTELNNKLTKKIEEGKKFVNEKTESVTQQVKNSDVYQKFQSNTEDYKKHVEDAVDN
                     DKNIFVVGIQKYIDFVNQLGEGKVQTGTTQYSTVSPNVEVKEKSIFGNWFDKTDNKVD
                     QLKNDADKKINEAKDKAESTKSDFFNWNSKKADELDKKANEAINWTNKQIDYASAEWN
                     KHYEQAKGDWNKALDDLTKQWNDTKKQLNGRFDSEKDKAIKGVEDAKSNFEKLSNDLT
                     NDASKNQKLKDAQDHFGKSLENLKLFGDDVYNDFAKRFDDLFNRK"
     gene            <346037..>347740
                     /gene="PRS"
                     /locus_tag="CD36_26460"
                     /db_xref="GeneID:8049682"
     mRNA            <346037..>347740
                     /gene="PRS"
                     /locus_tag="CD36_26460"
                     /product="prolyl-tRNA synthetase, cytoplasmic, putative"
                     /transcript_id="XM_002421695.1"
                     /db_xref="GeneID:8049682"
     CDS             346037..347740
                     /gene="PRS"
                     /locus_tag="CD36_26460"
                     /EC_number="6.1.1.15"
                     /inference="similar to AA sequence:UniProt:P39965"
                     /inference="similar to AA sequence:UniProt:P78600"
                     /codon_start=1
                     /transl_table=12
                     /product="prolyl-tRNA synthetase, cytoplasmic, putative"
                     /protein_id="XP_002421740.1"
                     /db_xref="GeneID:8049682"
                     /db_xref="GOA:B9WKX9"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004500"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:B9WKX9"
                     /translation="MIIIKRLLHIKTVPKSYGNQLSKFKYSKQIPTHEVLTKLGYITY
                     PRAGLVNWSKMGLLIQNKINQIIRQRMDEINFEEISLSLISHKDLWKLTNRWDQEEIF
                     KLVGDEYLLVPTAEEEITNYVKKQFLESYKNFPVGLYQINPKFRNEKRPRGGLLRGKE
                     FLMKDAYSFDLNESEAMKTYEKVVGAYHKIFQDLGIPYVKAEADSGDIGGSLSHEWHY
                     LNSSGEDTVFECNECHNVSNMEKALSYPKEIDETIDVSVKYFTTEDKSTLICAYYPSN
                     RVLEPKFIQNEVPDIDLESINDLSEFNHDISTRIVRIMDSRLSSRSNFPDFPISNFIN
                     RSLITTLTDIPIVLAQEGEICAHCEDGTLSASSAIEVGHTFYLGDKYSKPLDLEVDVP
                     TLNNNIEKQRIMMGCYGIGISRIIAAIAEINRDEKGLKWPRSIAPWEVTIVEVSQQKQ
                     STNDNDNPQENFKEVYNILNEANIDYRLDNRSDSMGKKLKQSNLIGIPLSIILGNQYP
                     IIEIEVRGDKKNNRWLQSYTKNKDQLHWKVETDAKGNDKKHYVHKDGLITVVNSLLND
                     M"
     gene            complement(<347992..>348129)
                     /locus_tag="CD36_26470"
                     /db_xref="GeneID:8049704"
     mRNA            complement(<347992..>348129)
                     /locus_tag="CD36_26470"
                     /product="beta subunit of the Sec61p ER translocation
                     complex, putative"
                     /transcript_id="XM_002421696.1"
                     /db_xref="GeneID:8049704"
     CDS             complement(347992..348129)
                     /locus_tag="CD36_26470"
                     /inference="similar to AA sequence:UniProt:P52870"
                     /inference="similar to AA sequence:UniProt:Q6BYQ9"
                     /note="Similar to S. cerevisiae SBH1; protein transport
                     protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="beta subunit of the Sec61p ER translocation
                     complex, putative"
                     /protein_id="XP_002421741.1"
                     /db_xref="GeneID:8049704"
                     /db_xref="InterPro:IPR016482"
                     /db_xref="UniProtKB/TrEMBL:B9WKY0"
                     /translation="MMKLFTDEAQGLRVDPLVVLFLAVGFIFSVIILHVFAKITGKFT
                     S"
     gene            <349237..>351717
                     /locus_tag="CD36_26480"
                     /db_xref="GeneID:8049844"
     mRNA            <349237..>351717
                     /locus_tag="CD36_26480"
                     /product="RNA-binding protein, putative"
                     /transcript_id="XM_002421697.1"
                     /db_xref="GeneID:8049844"
     CDS             349237..351717
                     /locus_tag="CD36_26480"
                     /inference="similar to AA sequence:UniProt:P34217"
                     /inference="similar to AA sequence:UniProt:Q5A9D1"
                     /note="Similar to S. cerevisiae PIN4; psi inducibility
                     protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA-binding protein, putative"
                     /protein_id="XP_002421742.1"
                     /db_xref="GeneID:8049844"
                     /db_xref="GOA:B9WKY1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:B9WKY1"
                     /translation="MDFRNLSTTPNQMDTVMQRRPSLSSLSSASGYSSSNYGGNPTPN
                     PNTSNTNNNSSGNSNNNTHANNTPKLSTQRLTNNRNLQSLWINQPSIAPSNVVPWVEQ
                     QQQQTLDSLENTKTDNNDDASSSTINNNVNVNANANVHANVHAHTNTNVNPNTTATSI
                     SASTTSNTTTSINDTNDNAKKINVSMINNNNSNNNNNTGNSNIANMLPSVSNATTMNN
                     SHSVNSTTNNTTNNEADDDELIPTAIVIKNIPFAIKKEQLLDVMTKLNLPLPYAFNYH
                     FDNGVFRGLAFANFTSTDETSAVVNQLNGREIGGRKLRVEYKKMLPAQERERIEREKR
                     EKRGQLEEQHRSASNASLASLLSAASTTAATKNLSVAGTNPSHTTERMFLNLPFNNSS
                     FNLPPVEINFNDLEVLELYTQLVLYRDDITKSTFELAISPVNLNISQRKIISILCNYL
                     NLLELFDNGLVIIRRKPGYIAQCITQQSIIPNSQQVSGSTHPQQHQQQQHQQQQHPSH
                     SSSMMNLHQLGGTLTVPTHPELLRSQSQSALPLPRLRQQTSTPIQQQNQQQSLSSSQA
                     QIQAQSQQPQQQQSHIQPQYNFYNQQSIQSQPQSARPYSQSYNIYQQQQQQQASAQQQ
                     QQQQQQQQLQYQQGHQSQVSTPTLNSSSAAALLRSSSSRSFVDVRSTPPMSTFTQQQQ
                     PIASSIHDSPTPHHHLPIQQQQQQQNHYYSNNNQGFGSQPQTPLTNNADVNSRFQPFG
                     QHSHLTSSFTSLSQTLPNNTNIDDFSNSIIDGNSISNKLNALGLGGNGNNASTTTTNN
                     NNNNSNHPATNSSGFDNSTSGSGIWGPK"
     gene            <352674..>354389
                     /locus_tag="CD36_26490"
                     /db_xref="GeneID:8049845"
     mRNA            <352674..>354389
                     /locus_tag="CD36_26490"
                     /product="protein phosphatase, putative"
                     /transcript_id="XM_002421698.1"
                     /db_xref="GeneID:8049845"
     CDS             352674..354389
                     /locus_tag="CD36_26490"
                     /EC_number="3.1.3.16"
                     /inference="similar to AA sequence:UniProt:P39966"
                     /inference="similar to AA sequence:UniProt:Q5A9C7"
                     /note="Similar to S. cerevisiae PTC2"
                     /codon_start=1
                     /transl_table=12
                     /product="protein phosphatase, putative"
                     /protein_id="XP_002421743.1"
                     /db_xref="GeneID:8049845"
                     /db_xref="GOA:B9WKY2"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:B9WKY2"
                     /translation="MGQILSQPVVEKHSDEHKDKYLAYGISCMQGWRINMEDSHATIL
                     NLYDLPMKKSLSSNSQHDEDSQDSITKSQQQQQQQQPQQNNDFASSTIEKQNSQDIKD
                     ADNDTQMSDSDEKLQENKEETDASPPAHIGFFGVYDGHGGEKAAIFTGEKLHYLIKET
                     KEFKQKDYINALKQGFLSCDQEILKDFYMRDDDSGCAATSAIITPDLIVCGNAGDSRT
                     IMSTNGFAKALSFDHKPSNEGEKARICAAGGYVDMGRVNGNLALSRGIGDFDFKKNVD
                     LPAEEQIVTCYPDVIQHNIDYNSDEFVVLACDGIWDCLTSQKCVECVRRGIYEKKSLS
                     TICEEIMDLCCAPTSDGSGIGCDNMSIAIVALLDYTKNETLDQWYEKIISRIEQQKND
                     PNSLNKYGPISQPYNELYKEMYGEYYDIGQQGQGGNGRSNIGGAAGGASGSGGTNING
                     NSIFGRSGYDEEEDEEKNVEGRRGDQDESALNGGAISLQKLLASNAITNENGVIYLDT
                     SSAQSLLAHFGVADAGAHEEDDDEEEDEEGEDVHQGLAHEEEEEEESKIEEISEELDD
                     EVKKD"
     gene            <356404..>358791
                     /locus_tag="CD36_26500"
                     /db_xref="GeneID:8049846"
     mRNA            <356404..>358791
                     /locus_tag="CD36_26500"
                     /product="histone acetyltransferase, putative"
                     /transcript_id="XM_002421699.1"
                     /db_xref="GeneID:8049846"
     CDS             356404..358791
                     /locus_tag="CD36_26500"
                     /EC_number="2.3.1.48"
                     /inference="similar to AA sequence:UniProt:P34218"
                     /inference="similar to AA sequence:UniProt:Q5A9C5"
                     /note="Similar to S. cerevisiae SAS3; something about
                     silencing protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="histone acetyltransferase, putative"
                     /protein_id="XP_002421744.1"
                     /db_xref="GeneID:8049846"
                     /db_xref="GOA:B9WKY3"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="UniProtKB/TrEMBL:B9WKY3"
                     /translation="MVSHLLNQLKITNNHIYSNIVPQDLDKRTIRVKPTNDYSLKSMI
                     KKNTHQKPTITKTNSITKIRPVQDNNSIKRGNRNFRNGNVFVKLTKKKYIVVINYDKT
                     KLSTTTTTIRSKSGVIPSLLPHSASYKPETQFDTSLSSEIPLPYKGILKYPDCVINNT
                     DPTKLDTERFNKFLNEGIVLRNKTTSHCEIESPASSNLPNQLINESNQSTESTPVPSF
                     SNLNKSKINRIVLRDFEINTWYIAPYPEEYSQCEVLYICEYCLKYMNSPMSYRRHQLK
                     NCNFSNNHPPGLEIYRDPKNKISIWEVDGRKNISYCQNLCLLAKLFLNSKTLYYDVEP
                     FIFYVLTEIDEKNPSNYHFVGYFSKEKLNSSDYNVSCILTLPIYQRKGYGNLLIDFSY
                     LLSRNEFKYGTPEKPLSDLGLLSYRNYWRVTIAYKLKQIYDKYLANNANGDSNNSRLS
                     LSVDILCKLTGMIPSDVIVGLEQLDSLVRNPLTHTYAIVINLEKINTEIAKWEKKSYT
                     KLDYEKLLWKPMLFGPSGGINSAPSLQPQSHPEQPGTTMSTGEGAVAVHSKPVIPQNS
                     ISLITNFLKDDINNPYTFEEEGFKEIEAHRETENDEIKNASLVEYVTCYPGIVVNNHI
                     SSGSGGGGGGSGGGSGSESNGSNGQTKSNEKVFKKSKKFTVEDDEIEEIFEIDELSSN
                     DENEPDFENDDNDNDNDEEEEEEDELDDFVDDDEVMEIKENYSDEDVSEDIIELIDDD
                     DDDEDDEEDWGRTWKRRAPSPPKRKTANVLASNRKPRSRGRPRGTFKLKPQDLGP"
     gene            complement(<358956..>360203)
                     /locus_tag="CD36_26510"
                     /db_xref="GeneID:8049847"
     mRNA            complement(<358956..>360203)
                     /locus_tag="CD36_26510"
                     /product="3'->5' exonuclease and endonuclease, putative"
                     /transcript_id="XM_002421700.1"
                     /db_xref="GeneID:8049847"
     CDS             complement(358956..360203)
                     /locus_tag="CD36_26510"
                     /inference="similar to AA sequence:UniProt:Q54SD3"
                     /inference="similar to AA sequence:UniProt:Q5A9C4"
                     /codon_start=1
                     /transl_table=12
                     /product="3'->5' exonuclease and endonuclease, putative"
                     /protein_id="XP_002421745.1"
                     /db_xref="GeneID:8049847"
                     /db_xref="GOA:B9WKY4"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="InterPro:IPR018228"
                     /db_xref="UniProtKB/TrEMBL:B9WKY4"
                     /translation="MINPRSFLRTMTRTNIWKPRYYDIGVNFSDSMFQGYYNGSSTSK
                     HPCDIHSVIERAHLFHVDKMLITASTIKESEDHFELCEKYSNQFDSTAGVHPCSVASE
                     FYKLNETNKKGEEANDSNRYSEELRDDVDIKLNKLRNIIIKGYKLGHVKAFGEIGLDY
                     DRLHYSSKHQQCEMLIKQLDLLDSLQTELNVQLPLFLHMRAACDDFIKIFKPYIDRGI
                     INPINGVVHSFTGTEQELNQLLQLGFYIGVNGCSLKTEENLQVVKKIPINRLLIETDA
                     PWCEIRKSHAGYKFINTTYPNKFYPEIDNTKQQQQQLLPITKNSPIKLHENLPFPSIK
                     KEHYQKHSDFVQKSKENANDPELLETRIGVLADPMIKSRNEPVNVGLVAEIICGLHDF
                     KNDTEIENFIDTVFENSCQLFKT"
     gene            <360374..>361078
                     /locus_tag="CD36_26520"
                     /db_xref="GeneID:8049848"
     mRNA            <360374..>361078
                     /locus_tag="CD36_26520"
                     /product="possible DnaJ-like splicing factor, putative"
                     /transcript_id="XM_002421701.1"
                     /db_xref="GeneID:8049848"
     CDS             360374..361078
                     /locus_tag="CD36_26520"
                     /inference="similar to AA sequence:UniProt:Q5A9C3"
                     /codon_start=1
                     /transl_table=12
                     /product="possible DnaJ-like splicing factor, putative"
                     /protein_id="XP_002421746.1"
                     /db_xref="GeneID:8049848"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:B9WKY5"
                     /translation="MSEELDRILSIEESAINKNKEIDRILSCSPFDYYSILEINPLLS
                     TTTEELLTIIKKVYRKKSLLIHPDKSDNPKASEAFDLLKKSEYHLTSSDESDIKEIEH
                     LYSIYQAYKPTPSKINNEQYCKLEFNDIINIEIRSKVKQVLIDEINELNLNKLIKQTE
                     LLRKDEMKQKIDLEKKIKQQLDKNWEDERDLRVNNWRKYSNKIERKQKQQQQQQQQEG
                     QSLGKVSKKKKKNVLV"
     gene            <361451..>362101
                     /locus_tag="CD36_26530"
                     /db_xref="GeneID:8049849"
     mRNA            <361451..>362101
                     /locus_tag="CD36_26530"
                     /product="peptidyl-tRNA hydrolase, putative"
                     /transcript_id="XM_002421702.1"
                     /db_xref="GeneID:8049849"
     CDS             361451..362101
                     /locus_tag="CD36_26530"
                     /EC_number="3.1.1.29"
                     /inference="similar to AA sequence:UniProt:P34222"
                     /inference="similar to AA sequence:UniProt:Q5A9C1"
                     /note="Similar to S. cerevisiae PTH2"
                     /codon_start=1
                     /transl_table=12
                     /product="peptidyl-tRNA hydrolase, putative"
                     /protein_id="XP_002421747.1"
                     /db_xref="GeneID:8049849"
                     /db_xref="GOA:B9WKY6"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="InterPro:IPR023476"
                     /db_xref="UniProtKB/TrEMBL:B9WKY6"
                     /translation="MTSQSNLSLIAVGVISFITGYYVHQMLRPTTPKRFRLKPTSSHT
                     SNSSSATTPNSYNSEDESENDDDDDDEEEEEEEEDDGLDINSLALNEIPGEVRMTLVV
                     RQDLKMGKGKAAAQCSHATLALYKKITNPQLDSYNPELVNRWEIRNGQAKITLQVPNQ
                     EEMDLLYAKAISLGINSYIVHDAGRTQIAAGSATVLGLGPAPKRILDEVTGDLKLY"
     gene            complement(<362267..>364051)
                     /locus_tag="CD36_26540"
                     /db_xref="GeneID:8049850"
     mRNA            complement(<362267..>364051)
                     /locus_tag="CD36_26540"
                     /product="disrupter of telomere silencing homologue,
                     putative"
                     /transcript_id="XM_002421703.1"
                     /db_xref="GeneID:8049850"
     CDS             complement(362267..364051)
                     /locus_tag="CD36_26540"
                     /inference="similar to AA sequence:UniProt:P40059"
                     /inference="similar to AA sequence:UniProt:Q5A9C0"
                     /note="Similar to S. cerevisiae DOT6; protein of unknown
                     function, involved in telomeric gene silencing and
                     filamentation, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="disrupter of telomere silencing homologue,
                     putative"
                     /protein_id="XP_002421748.1"
                     /db_xref="GeneID:8049850"
                     /db_xref="GOA:B9WKY7"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:B9WKY7"
                     /translation="MSSPEIETSTTSESKSGSSSQKNPSRTPTSWDAEDDILLMHLKD
                     NQKLGWKEIASNFTNRTPNACQFRWRRLKSGNLKNPPKSAAALGAQFKQNPNMNSAPK
                     KKKATTKNSNSTTDSTSKTTEKATKSGNTSKTTKNNGPANNSAKGNTPSNSTINNFTY
                     NPMTTGTFQGFDNNISTALAGLNALSNSPSYISNSGPATPKGLTSPTIHGSSTHHNGN
                     PNLAHKYEASPASDRSLDRRRSSATGSVTGHRNSNGGYYGDVSVDPTMNLPHSKSHPT
                     TPSSLTPRNSTSAGDKGTNFTHRGSISGVANISALRSNSIIQITTDERGSISSMGRAS
                     VSSLPSKSMNIPHHQSGNNSLAHLPVLFGGTGSISGPSRHSSISGSVGGQQTTLPSLR
                     SGSVVGSNIGYFSRSGSVVIPHNADKKEEEPFKFDKERLEASNKKLQKIRRSMPPSRT
                     KTKRKHGTPIPKLDIPWTMEEDELLINRRNRELSFAELSILLPQRTEGEIWARIDYLE
                     NLRNGGHRSANSRDSRRARQESIGLGDVDGFYDDDDDDDDDDVLQVSDDDDDEVLVDV
                     DDIPHPRKKKRRMSSAVNPLSVRGSIRK"
     gene            complement(<364779..>366347)
                     /locus_tag="CD36_26550"
                     /db_xref="GeneID:8049851"
     mRNA            complement(<364779..>366347)
                     /locus_tag="CD36_26550"
                     /product="anthranilate synthase component, putative"
                     /transcript_id="XM_002421704.1"
                     /db_xref="GeneID:8049851"
     CDS             complement(364779..366347)
                     /locus_tag="CD36_26550"
                     /EC_number="4.1.3.27"
                     /inference="similar to AA sequence:UniProt:P00899"
                     /inference="similar to AA sequence:UniProt:Q5A9L8"
                     /note="Similar to S. cerevisiae TRP2"
                     /codon_start=1
                     /transl_table=12
                     /product="anthranilate synthase component, putative"
                     /protein_id="XP_002421749.1"
                     /db_xref="GeneID:8049851"
                     /db_xref="GOA:B9WKY8"
                     /db_xref="InterPro:IPR005256"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR019999"
                     /db_xref="UniProtKB/TrEMBL:B9WKY8"
                     /translation="MQSQFVQPTIETLKKTIDTNRSSNESPNVYPVYKYVPHNDITIH
                     QAYLKLANLNDSNRTESFLFESSVKGDTIDRYSFIGIQPTKIIKTGDNPKKFAKEFCN
                     VDPITVLEKELSNYKQASLPGLPKFSGGATGYISYDCIKYFEPKTKRSMKDVLGLPEA
                     VLMFCDLVVAFDHVYQRFQIIYNIKINDKINQDIENLYKQATENIEKIEKILLRNVSN
                     EEIAPKQGPIKLGQNFTSNIGQEGYEKHVTTLKEHILKGDIIQAVPSQRIARPTSLHP
                     FNIYRHLRTVNPSPYLFYIDLLDFQIIGASPELLVQSDTKGRIVTHPIAGTMPRGKTN
                     EEDEENAEILRASLKDRAEHIMLVDLARNDVNRVCQPTTNKVDKLLTIQRFSHVMHLV
                     SEVSGTLREDQTRFDAFRSIFPAGTVSGAPKVKAMELIAELEKEKRGVYAGAVGHWGY
                     DGKTMDTCIALRTMVYKDGVAYLQAGGGIVFDSDEYDEYIETMNKMKANNNTIVEAEK
                     IWAGKVGKLEGVVE"
     gene            complement(<366719..>369700)
                     /locus_tag="CD36_26560"
                     /db_xref="GeneID:8049852"
     mRNA            complement(<366719..>369700)
                     /locus_tag="CD36_26560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421705.1"
                     /db_xref="GeneID:8049852"
     CDS             complement(366719..369700)
                     /locus_tag="CD36_26560"
                     /inference="similar to AA sequence:UniProt:Q5A9L7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421750.1"
                     /db_xref="GeneID:8049852"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:B9WKY9"
                     /translation="MLIPLLRRRYNLRNCRLLYFSLSLRRNSSKSSTAFFHENSICKI
                     DEITNNDFNSNLRFKHYYNNQNVFINPCSHYNKQKARPKNKNKNTEQFITPPQNFQDI
                     IDQNENNIPVEGSIVEIVRPDFTPKVGLVVRQALSRFDERYNKLLVLTNDNELLDVSA
                     SKVNFHLYQIIFPEFINLQQIVMFRHNKKCKERIRAIEFLNNFINDVLDLKKTLEPMF
                     DRIYSQVSTNSTNHVTLIDIIDAIKYQETLVIKIGSSFYNQCVLLFSIHWCLVNSPKW
                     IVPNYFINNKSTNVLQGHSNNFHTITNYFVTPGTIWASISKFMQYMEHTEKSHELIEK
                     FFVQLKSRKGDELCHFLQVYDGRHLAYILDVIKFAIVYPHDTIIKQLNKLTSFENCKT
                     PNDLYNKLLDLNIYDKSTEVILSSGIVDVGGSDRINVSSSDLNQLQMHKQWSGEHSDL
                     FKHLRTKKKYYRDHIVYGLPIDDNENCSRFAVSLETLNSRKYMLNIHIPDITTVLPPG
                     DFMMENMFNKFTELSSKMNNFINGFQSKLFSNRFEESKRFHKYETEDSENLWDDELLQ
                     NNNKSQRNPSKVTCMTISFEFNSYEPEPFKSFIDKISISFDSISNLNVKIVDKDLLEK
                     CLSGKLETSLFKLLRRNQTSGLSDRPYLNKGDIHNLNYINGIMKTFFKMREHLGAAVI
                     NPQQEFLISDNSKIGVDKTHTHTHSNFILRELQIFTGALVAEYCTQHRIPILFHCQDI
                     EPTMYDSDKVMVTHDNIMIPPYDSENYHHSVLAKNSDGYISLQASFVSKNYLSPNNVI
                     TSPRNNLPLGLKNGYVNIVDIFTRKEAIINQYQLLFYQQALFNRTLSMEKGYLKTVQQ
                     FNLLKSFGYQLQGPLIESRLMSYMEACHQSHEISLLVESILRKYSALKWLENVQIDIN
                     EGNGLKVFHCIVTLVGINYDLGVVCKCFCMELGIEVDVLTENTDIHIGNKLVCDKVLQ
                     VNAVDRTCLLRDENYGSTWYL"
     gene            complement(<369992..>371128)
                     /locus_tag="CD36_26570"
                     /db_xref="GeneID:8049853"
     mRNA            complement(<369992..>371128)
                     /locus_tag="CD36_26570"
                     /product="UBX domain-containing protein, putative"
                     /transcript_id="XM_002421706.1"
                     /db_xref="GeneID:8049853"
     CDS             complement(369992..371128)
                     /locus_tag="CD36_26570"
                     /inference="similar to AA sequence:UniProt:P34223"
                     /inference="similar to AA sequence:UniProt:Q5A9L6"
                     /note="Similar to S. cerevisiae SHP1; protein phosphatase
                     1 regulatory subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="UBX domain-containing protein, putative"
                     /protein_id="XP_002421751.1"
                     /db_xref="GeneID:8049853"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR012989"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:B9WKZ0"
                     /translation="MSESNPDSQLIAEFVSITNSSTYLAEQYLSRNNNDLVEAVEDFY
                     ANSEPSQKSETKKSFSSSKSTGSGIKTFRDLNDEDDDEEDDKTNTNFFTGGEKSGLQV
                     EDPNKDKDNDRSIIDQIFQKAREQMQQPDDRPSASQDDQPSPIKFSGKGFKLGDGNEP
                     SQIVEDPTTNSQKFKPSKVTREITFWKQGFTVGDGPLHRYDDPRNSNVLQELNQGRVP
                     MSILDVEFGQDVDVSVYKKTDEDWSPPKRKIGGYHGTGHRLGSPVPGEVLVNNETSFQ
                     PDINKPNGKDKDEEKDEDEGEGEGDSTVQIRFANGKKTSHKFNSSDSILKVYEFVRNH
                     EYNSEPTRSFTLSHAFPVKPIEESNEITIADAKLKNAVIVQRWK"
     gene            complement(<371871..>374180)
                     /locus_tag="CD36_26580"
                     /db_xref="GeneID:8049854"
     mRNA            complement(<371871..>374180)
                     /locus_tag="CD36_26580"
                     /product="cobalamin-independent methionine synthase,
                     putative"
                     /transcript_id="XM_002421707.1"
                     /db_xref="GeneID:8049854"
     CDS             complement(371871..374180)
                     /locus_tag="CD36_26580"
                     /EC_number="2.1.1.14"
                     /inference="similar to AA sequence:UniProt:Q5A9B4"
                     /inference="similar to AA sequence:UniProt:Q6GYJ7"
                     /note="methionine synthase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cobalamin-independent methionine synthase,
                     putative"
                     /protein_id="XP_002421752.1"
                     /db_xref="GeneID:8049854"
                     /db_xref="GOA:B9WKZ1"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="InterPro:IPR006276"
                     /db_xref="InterPro:IPR013215"
                     /db_xref="UniProtKB/TrEMBL:B9WKZ1"
                     /translation="MVQSSVLGFPRIGGQRELKKITEAYWSGKATVEELLAKGKELRE
                     NNWKLQQKAGVDIIPSNDFSYYDQVLDLSLLFNAIPERYTKFDLAPIDVLFAMGRGLQ
                     KKATETQAAVDVTALEMVKWFDSNYHYVRPTFSHSTEFKLNTDAGIKPVDEFNEAKAL
                     GIQTRPVILGPISYLYLGKADKDSLDLEPISLLPKILPVYKELLQKLKEAGAEQVQID
                     EPVLVLDLPEIVQSKFKEAYDALVGSNDDIPELILTTYFGDVRPNLKAIENLPVSGFH
                     FDFVRVPDQLDQVASILKNDQTLSVGVVDGRNIWKTDFAKASSVVQKAIEKVGKDKVV
                     VATSSSLLHTPVDLESETKLDGVIKDWFSFATQKLDEVVVIAKNVSGEDVSKELQANA
                     TSIKARSESSITNDPKVQERLTTINEALATRKAAFPERLTEQKAKYNLPLFPTTTIGS
                     FPQTKDIRINRNKFAKGQITAEEYETFINKEIETVVRFQEEIGLDVLVHGEPERNDMV
                     QYFGEQLNGFAFTTNGWVQSYGSRYVRPPIIVGDVSRPKAMTVKESVYAQSITSKPMK
                     GMLTGPVTILRWSFPRDDVSGKIQALQLGLALRDEVNDLESAGITVIQVDEPAIREGL
                     PLRAGKERSDYLNWAAQSFRVATSGVENSTQIHSHFCYSDLDPNHIKALDADVVSIEF
                     SKKDDPNYIQEFSEYPNHIGLGLFDIHSPRIPSKQEFVSRIEEILKVYPASKFWVNPD
                     CGLKTRGWPEVKESLTNMVDAAKEFRAKY"
     gene            complement(375332..376500)
                     /gene="ACU1"
                     /locus_tag="CD36_26600"
                     /pseudo
                     /db_xref="GeneID:8049855"
     misc_feature    complement(375332..376500)
                     /gene="ACU1"
                     /locus_tag="CD36_26600"
                     /inference="similar to AA sequence:UniProt:Q5A9B2"
                     /inference="similar to AA sequence:UniProt:Q5A9B3"
                     /note="appears to be a fusion of C. albicans orf19.2552
                     adn orf19.2553; these genes were originally merged into
                     one gene, prior to the assembly changes in late 2008"
                     /pseudo
                     /db_xref="GeneID:8049855"
     mobile_element  complement(377163..377405)
                     /mobile_element_type="retrotransposon:solo LTR, iota O"
     gene            <378325..>378987
                     /locus_tag="CD36_26620"
                     /db_xref="GeneID:8049669"
     mRNA            <378325..>378987
                     /locus_tag="CD36_26620"
                     /product="orotate phosphoribosyltransferase, putative"
                     /transcript_id="XM_002421708.1"
                     /db_xref="GeneID:8049669"
     CDS             378325..378987
                     /locus_tag="CD36_26620"
                     /EC_number="2.4.2.10"
                     /inference="similar to AA sequence:UniProt:P13298"
                     /inference="similar to AA sequence:UniProt:Q5A9B0"
                     /note="Similar to S. cerevisiae URA5"
                     /codon_start=1
                     /transl_table=12
                     /product="orotate phosphoribosyltransferase, putative"
                     /protein_id="XP_002421753.1"
                     /db_xref="GeneID:8049669"
                     /db_xref="GOA:B9WKZ2"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR004467"
                     /db_xref="InterPro:IPR023031"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:B9WKZ2"
                     /translation="MTSYKSSFLQLALDSQALKFGKFTLKSGRESPYFFNLGLFNTGK
                     LLSNLATAYAEAIIASKLKFDILFGPAYKGIPLTAITVVKLAELDPINYGNIGYSFNR
                     KEKKDHGEGGSIVGYNLKNKKILIIDDVITAGTAINEAFEIINNEKGQVVGCIIALDR
                     QETTTTTTGSTKSATQVVSEKYQIPVLSIVNLGEIISILNGKINDEDLKSIEQYRSKY
                     GA"
     gene            complement(<379090..>379974)
                     /locus_tag="CD36_26630"
                     /db_xref="GeneID:8049856"
     mRNA            complement(<379090..>379974)
                     /locus_tag="CD36_26630"
                     /product="signal recognition particle subunit sec65
                     homologue, putative"
                     /transcript_id="XM_002421709.1"
                     /db_xref="GeneID:8049856"
     CDS             complement(379090..379974)
                     /locus_tag="CD36_26630"
                     /inference="similar to AA sequence:UniProt:O14415"
                     /inference="similar to AA sequence:UniProt:P29478"
                     /note="Similar to S. cerevisiae SEC65"
                     /codon_start=1
                     /transl_table=12
                     /product="signal recognition particle subunit sec65
                     homologue, putative"
                     /protein_id="XP_002421754.1"
                     /db_xref="GeneID:8049856"
                     /db_xref="GOA:B9WKZ3"
                     /db_xref="InterPro:IPR002778"
                     /db_xref="UniProtKB/TrEMBL:B9WKZ3"
                     /translation="MSSNKRPILEEVDDDDDIDNMDMDIAEFDPNLTTPIAPKRPQPT
                     IVRSQDLDSNLNIEPPLFPNNIPLNQIQIQNQLSQKPSSNRNGIIDPNSFTPQEKEQF
                     NQFQIIYPCYFDINRSHKQGRRVSIDKAVENPLATTISDACKKLGLPVFLELDKTHPQ
                     DFGNPGRVKVLFKAVFDNGKLLNSKLSTKRILFNVICEYLNENPTTLESIEPKNNGIP
                     YPPEFNSSNNNSNDFQPEEIPKVKGFKMNTIVPIHSNLTLKHPMTKHIYDPEPEPPII
                     GKSNVPKLPKKKVMKIRG"
     gene            <380511..>382091
                     /locus_tag="CD36_26640"
                     /db_xref="GeneID:8049857"
     mRNA            <380511..>382091
                     /locus_tag="CD36_26640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421710.1"
                     /db_xref="GeneID:8049857"
     CDS             380511..382091
                     /locus_tag="CD36_26640"
                     /inference="similar to AA sequence:UniProt:Q5A9A7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421755.1"
                     /db_xref="GeneID:8049857"
                     /db_xref="GOA:B9WKZ4"
                     /db_xref="InterPro:IPR012935"
                     /db_xref="UniProtKB/TrEMBL:B9WKZ4"
                     /translation="MEEIFKLTMDEPIENSTHISSTSQILQDCLSIIESPSYDSYKPS
                     NSNNSLTTTTTTTTRRIKNNYSDHPDILYFQKIKQKNHFKFHKSKFQTKWNIDKVNSS
                     KMNSNFDPYDLNSLLLRLKSFNSLNWKSINNSSINELKCAINGWKCVSFGINQIETET
                     ETKNHLLCTYCNQQLILKFEDNEDNKVHTNMIESPFDFNVLNGKEIFNDESFQKKLIE
                     LYIKQIENIGHDINCLWKNFETPIDQIYYLKHYLPNTNQFLIEQYCKNLKNLIDNILI
                     LQEYSDCLKTDLQIINNNNNNNNNNNDFDEFIHISNEWLMAKFFPDNKENFIIGLTYN
                     NILPCWIYQLALYGWSLNVQNYAKDVILVMSCNMCNQRIFLNSHNHNHNHDHDHYEEC
                     MISTQLKLSSSKILTPVKYPMSNIGNDNTEFDTIIESSKFDPQIQHKPWCAYLHNNLP
                     IYFYQMLIKSKNNIGPIGDYIYNGNLMDMDMNMDININNTSIDSNQLLTKKRKNSFNV
                     NENLERLNKLRKLYLIDE"
     gene            complement(<382174..>384495)
                     /locus_tag="CD36_26650"
                     /db_xref="GeneID:8049858"
     mRNA            complement(<382174..>384495)
                     /locus_tag="CD36_26650"
                     /product="cell division control protein 4 homologue,
                     putative"
                     /transcript_id="XM_002421711.1"
                     /db_xref="GeneID:8049858"
     CDS             complement(382174..384495)
                     /locus_tag="CD36_26650"
                     /inference="similar to AA sequence:UniProt:P07834"
                     /inference="similar to AA sequence:UniProt:P53699"
                     /inference="similar to AA sequence:UniProt:Q5A9A6"
                     /note="Similar to S. cerevisiae CDC4; ubiquitin ligase,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cell division control protein 4 homologue,
                     putative"
                     /protein_id="XP_002421756.1"
                     /db_xref="GeneID:8049858"
                     /db_xref="GOA:B9WKZ5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:B9WKZ5"
                     /translation="MDKKSKLFKYPLSEETAKFEYKLSNPNGKISDIWLHKEYQKLSL
                     STIDKVSQQPSAVTAPPTHPHRENNRKRNAGDDDIYDQKSLPSCDDTASSDTDCQSQV
                     SSTAHLHSYRTNGLVHPPPKRRLTAPNETSLASAGVGAKDVSFQIESPGSISAVTTNN
                     SNTTSGGVNNSTSFSDQHSRHPRTPNAMNSPSHTPISDIEEDPIQQLPLPSPSASPIQ
                     SDTENEHVTTPDSLQGKVNLDTIENIMSNEPSTQFELVDLVEKLSGFLSETNRNHLVF
                     KLLQTTTRSTLSTFNGLIYDSLKRDILSNVPFEVTMKILSYLDYKTLLSLSQVCKKWF
                     EIINNPDIWIKLLKKDKLITDDGVIEYELQNSHQKLLQEWSTLSEINSAQILYKKRKI
                     IINRWMDSNYKPQRISVSGHGNKVVTCLQHDDEKIVTGVDDKCILIYSTQTGQLMRVL
                     EGHEGGVWALKYTGDTLVTGSTDRTVRVWNMKTGQCTHIFRGHTSTIRCLDIIHPTII
                     GKNQNGEDIIFPEYPLLITGSRDHNIHVWKLPLVNELENISETFDGEFDNPYLIAVLS
                     GHTQSVRSISGYGNIIISGSYDSTVRVWDLLDNGHCKHVLQGHQDRVYSTAMDFQSKT
                     CFSGSMDSNINVWNFETGELKQVLIGHSSLVGLLDLVDDVLVSAAADATLRIWNPKTG
                     ELKSKLKGHGAAITCFEHDGLRVVSGSEKMLKLWDVERGTFARDLLNDVTGGIWQVRF
                     DYKRCVAAVQRIINEEEGETFIEILDFSQPLIK"
     gene            complement(<385626..>388919)
                     /gene="CDC60"
                     /locus_tag="CD36_26670"
                     /db_xref="GeneID:8049859"
     mRNA            complement(<385626..>388919)
                     /gene="CDC60"
                     /locus_tag="CD36_26670"
                     /product="cytosolic leucyl-tRNA synthetase, putative"
                     /transcript_id="XM_002421712.1"
                     /db_xref="GeneID:8049859"
     CDS             complement(385626..388919)
                     /gene="CDC60"
                     /locus_tag="CD36_26670"
                     /inference="similar to AA sequence:UniProt:P26637"
                     /inference="similar to AA sequence:UniProt:Q9HGT2"
                     /codon_start=1
                     /transl_table=12
                     /product="cytosolic leucyl-tRNA synthetase, putative"
                     /protein_id="XP_002421757.1"
                     /db_xref="GeneID:8049859"
                     /db_xref="GOA:B9WKZ6"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR004493"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:B9WKZ6"
                     /translation="MSGPVTFEKTFRRDALIDIEKKYQKVWAEEKVFEVDAPTFEECP
                     IEDVEQVQEEHPKFFATMAYPYMNGVLHAGHAFTLSKVEFATGFQRMNGKRALFPLGF
                     HCTGMPIKAAADKIKREIELFGSDFSKAPVDDEDVEETQQPVKTQSKREDVTKFTSKK
                     SKAAAKQGRSKFQFEIMMQLGIPREEVAKFANTDYWLEFFPPLCQKDVTAFGARVDWR
                     RSMITTDANPYYDAFVRWQINRLRDVGKIKFGERYTIYSEKDGQACLDHDRQSGEGVG
                     PQEYVGIKIRLTDVAPQAQELFKNENLDVKENKIYLVAATLRPETMYGQTCCFVSPKI
                     DYGVFDAGNGNYFITTERAFKNMSFQNLTPKRGYYKPLFTINGKVLIGSKIDAPYAVN
                     KNLRVLPMETVLATKGTGVVTCVPSDSPDDFVTTRDLANKPEYYGIEKDWVQTEIVPI
                     VHTEKYGDKCAEFLVNDLKIQSPKDSVQLANAKELAYKEGFYNGTMLIGKYKGDKVED
                     AKPKVKQDLIDEGLAFVYNEPESQVISRSGDDCCVSLEDQWYIDYGEEVWLGEALECL
                     KNMETYSKETRHGFEGVLAWMKNWAVTRKFGLGTKLPWDPQYLVESLSDSTVYMAYYT
                     IDRFLHSDYYGKTPGKFNIKPEQMTDEVFDYIFTRRDNVETDIPKEQLKEMRREFEYF
                     YPLDVRVSGKDLIPNHLTFFIYTHVALFPKRFWPRGVRANGHLLLNNAKMSKSTGNFM
                     TLEQIIEKFGADASRIAMADAGDTVEDANFDEANANAAILRLTTLKDWCEEEVKNQDK
                     LRTGDYDSFFDAAFENEMNDLIEKTYQQYTLSNYKQALKSGLFDFQIARDIYRESVNT
                     TGIGMHRDLVLKYIEYQALMLAPIAPHFAEYLYREVLSKDGSVQTSKFPRATKPVSKA
                     ILDASEYVRSLTRSIREAEGQALKKKKGKSDVDGSKPISLTVLVSNTFPEWQDNYIEI
                     VRELFEQNKLDDNNAIRQKVGKDMKRGMPYIHQIKTRLATEDADTVFNRKLTFDEIET
                     LKNVVEIVKSAPYSLKVEKLEILSFNNGETKGKNIISGEDNIELNFKGKIMENAVPGE
                     PGIFIKNIE"
     gene            complement(<389161..>391914)
                     /locus_tag="CD36_26680"
                     /db_xref="GeneID:8049677"
     mRNA            complement(<389161..>391914)
                     /locus_tag="CD36_26680"
                     /product="U4/U6 snRNA-associated-splicing factor,
                     putative"
                     /transcript_id="XM_002421713.1"
                     /db_xref="GeneID:8049677"
     CDS             complement(389161..391914)
                     /locus_tag="CD36_26680"
                     /inference="similar to AA sequence:UniProt:P49960"
                     /inference="similar to AA sequence:UniProt:Q5A9A2"
                     /note="Similar to S. cerevisiae PRP24; U4/U6 snRNP,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="U4/U6 snRNA-associated-splicing factor,
                     putative"
                     /protein_id="XP_002421758.1"
                     /db_xref="GeneID:8049677"
                     /db_xref="GOA:B9WKZ7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:B9WKZ7"
                     /translation="MESSEPLQQNQLNRYVLEDYDRMLKSVAEIDDAQRKCYMINEVY
                     KMKLKYFRLKQSELNNWLEAIHLIEDTHERVTSEFKFYDLVSSDYSNADITSGFLKHF
                     QEFKDFDESGSEARLLDGINISCHDFSRGNIIWKQLIDAAQDEYLKEDSDTNLMHLHQ
                     YQLDRLATPHSQLDESFNEYSSFISKYYSDDYDKYMEYMKSANKIYSSTKTKSIYYER
                     FEIAIKESPEEPQIWIDYMENVYSHQKRKDLNPILAIFERAISRNESWSQNWIKIWLA
                     FIYIIYGCNSDQKHDKLQFVFQKFLRTFPKSNHAYAESIRYCLTLNDSEIAVEEFQSI
                     ETRLNSTKDILQWDYQQWKSVHLAFVQFNFQIWKRNRTHKDKSIVEQNSNSIFMRAFS
                     VMESSDPSHSVEFLAVNMLTQMGAMNMAKDLIDLMLERFNTETEVLLFGLRYLVNNKI
                     DLDQIRSYFKSAIRKLDSFDHPEKISEEWLQFEQLYGDINNYMESVAKCEAALKTLSK
                     KRSRDITVDENNQSSKKRKREPTKDFDTETKSRETCTIKVKNLAANTTEDSIRNFFKD
                     CGEVGDISFVEAEGMRYAIFEFQNEQQVFSALTKNYKSLDGNKLEVSRLQNALLFVNN
                     YPSTFSQDTVKEMIEKIGPVAKIRFPNQTSKKIKRFCYVQMISHDDAQRVINQYHGQK
                     YEDPNLGGEFSWEIKFSNPEEKHERSSPISARKVKVSSISFNVSKEAFEKKFALCGEI
                     EQIVFPKAVYEEDGKLKSNGGLAIVTYKTTEGTENALKLNETKWMGRKLFVSKKHQQV
                     HYTPSDFDGVKTIGLCGLDPSLNFQQVKASLEDRFGKVAKVLLFPEDKQALVEFVKPG
                     DAGKVSMTNSFVKLGESEAKIVTKEEIIIIGKSAISNTTTTTTSSAPFTMIPTTVRRK
                     KFM"
     gene            <392151..>392891
                     /locus_tag="CD36_26690"
                     /db_xref="GeneID:8049860"
     mRNA            <392151..>392891
                     /locus_tag="CD36_26690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421714.1"
                     /db_xref="GeneID:8049860"
     CDS             392151..392891
                     /locus_tag="CD36_26690"
                     /inference="similar to AA sequence:UniProt:Q03525"
                     /inference="similar to AA sequence:UniProt:Q5A9A1"
                     /note="possibly fungus-conserved"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421759.1"
                     /db_xref="GeneID:8049860"
                     /db_xref="UniProtKB/TrEMBL:B9WKZ8"
                     /translation="MNASIYLQSFGWKEGEALKKGGLKKPILVKHKKDTKGLGHDTND
                     SDMWWEKLFDGQLKNLEVNNNNKNGEVSFQTNEEKVVNAFQKSISPLYKMFVKGEGLE
                     GTVGKTDHTKESHREISSSKALEEMEKLTKKDTFSENIKDSDSSNNEKERKKKKSDKK
                     IKDVKKTKQDKSKVSLNSKSDKEKKKKSKKKSKDSILSKHEKEKKLSKSSKSKKDKDT
                     TSSKDSKKKKKRKSESKDETSKSKKRKV"
     gene            <393085..>396177
                     /locus_tag="CD36_26710"
                     /db_xref="GeneID:8049861"
     mRNA            <393085..>396177
                     /locus_tag="CD36_26710"
                     /product="structural protein mdm1 homologue, putative"
                     /transcript_id="XM_002421715.1"
                     /db_xref="GeneID:8049861"
     CDS             393085..396177
                     /locus_tag="CD36_26710"
                     /inference="similar to AA sequence:UniProt:Q01846"
                     /inference="similar to AA sequence:UniProt:Q5A9K1"
                     /note="Similar to S. cerevisiae MDM1"
                     /codon_start=1
                     /transl_table=12
                     /product="structural protein mdm1 homologue, putative"
                     /protein_id="XP_002421760.1"
                     /db_xref="GeneID:8049861"
                     /db_xref="GOA:B9WKZ9"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="InterPro:IPR013937"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="InterPro:IPR024066"
                     /db_xref="UniProtKB/TrEMBL:B9WKZ9"
                     /translation="MYDHLPSILKWSICLGVVFWCIHQNSILFVLTFICGIILLCFFM
                     VYYTTKVQLSRSSSIKRQHRRFNFTLSKNWTQEITQLQNEQLDVKRPIFSDSFLVSES
                     LQGFIDLIIQEFITPWYTQITQSTQVQTDISLELKEVIRNLQNRARSIDFAQLLVSDI
                     LPLIQEHFENYLRAEDIVKSQGKFSKFDSNEYHMAVACQFRRGKLHPAVTTSLVVNEE
                     TNFKEKQYLRKKMKTVLELVLSENEKSNDVGLSLVTEILACTVLCNVINLLTESDFYN
                     LIIVKLIGDNLRRRDQVKQLRAALQEHTQKSSKEISDNQMSDMTSALLTPDSNLQNQL
                     KLKINERKQQREKQENLNLKDILTDKTNFQVFKEFMESEGRSKLVEFWKAVEVIKAPL
                     EGEENDDETDPLALSLEFGNNDDVYNIYIKFIKTNEIPQPDTHILQVLSSSGNNANVR
                     TYQEARMHLFKMQRDYFDQMQSHDLPVFIKSDMYLRLVNRKESSDVNPEVINAVENAF
                     TLIMNKPESLDTRLDASDEFNSDQLLTTLQLKTDLFGDSSTNLSDGNHSNRNSRLFDD
                     FLSDEEQSDSDRDSLYSDKHSQSLNNSNSEVQFAAPGNLNLAEEIPKLSDEVDNLQKQ
                     ITILEPLLRKAELTNNLSELKVLQKSKIGLIREINVKELQKQQFIVQENDNSLFGKSR
                     VCIQSYINDNEKNGREFTLYIIEVQKFSNENPTIIKAGWVVARRFSQFYGLHEYLKLK
                     YPRVSYLKFPKKSISVLKFQQKQVAEIRMKQLEDYLQELIKIQEVCSDRAFRSFLSSE
                     NFNLKKNQRFEETRAKNYSDTNFQTLFGSKWYRGLSNFMTTTKNDDNHKDSTYIDTHI
                     MENLRDMESELKQFDEAASAKTPFVKPICDLLISVFKLHYSRSWLRGRALVVILQQIL
                     GTTVEKKVYDVVEGRLKTEENVLDLIMMLTNILFPNGKFKDPPVIRSLYQQANTRQEA
                     KVLSEIFIFETCSTIFGRHNSIFASTKIFSMIQNEYLNRNLVFEIVDEILEHMFAEMK
                     "
     gene            <396704..>397402
                     /locus_tag="CD36_26730"
                     /db_xref="GeneID:8049862"
     mRNA            <396704..>397402
                     /locus_tag="CD36_26730"
                     /product="WW domain-containing protein, putative"
                     /transcript_id="XM_002421716.1"
                     /db_xref="GeneID:8049862"
     CDS             396704..397402
                     /locus_tag="CD36_26730"
                     /inference="similar to AA sequence:UniProt:P43582"
                     /inference="similar to AA sequence:UniProt:Q5A9J9"
                     /note="Similar to S. cerevisiae WWM1"
                     /codon_start=1
                     /transl_table=12
                     /product="WW domain-containing protein, putative"
                     /protein_id="XP_002421761.1"
                     /db_xref="GeneID:8049862"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:B9WL00"
                     /translation="MSKNDSKNPPQVPNGWVAKFDEEYSTWYYVDMKTKKSQSEAPAG
                     TRFDSKPSGDDVPPPAYSPTDSKSRSNGPSGNQSRPAASNPNTQRGYNQGPPSGQNYQ
                     QGPPSGQYYQQGPPQGQYYQQGPPPGQYYQQGPPPGQYYQQGPPPGQYYQQGPPPGQY
                     YQQQPQKQSRFGGGGAGNMALGVGGGLLGGMLLGNAINSWEDHERMEGYEDGYQDGYD
                     NGGDFDGGDFGGDF"
     gene            <397680..>398099
                     /locus_tag="CD36_26760"
                     /db_xref="GeneID:8049863"
     mRNA            <397680..>398099
                     /locus_tag="CD36_26760"
                     /product="NADH dehydrogenase, putative"
                     /transcript_id="XM_002421717.1"
                     /db_xref="GeneID:8049863"
     CDS             397680..398099
                     /locus_tag="CD36_26760"
                     /EC_number="1.6.99.3"
                     /EC_number="1.6.5.3"
                     /inference="similar to AA sequence:UniProt:O94061"
                     /inference="similar to AA sequence:UniProt:Q4R5J1"
                     /note="NADH-ubiquinone oxidoreductase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="NADH dehydrogenase, putative"
                     /protein_id="XP_002421762.1"
                     /db_xref="GeneID:8049863"
                     /db_xref="GOA:B9WL01"
                     /db_xref="InterPro:IPR006806"
                     /db_xref="UniProtKB/TrEMBL:B9WL01"
                     /translation="MRFTPILRQIPKLKLSEVLVKAGDGVPTGLAGIYKHPDPRPALV
                     TLYNETLKTLKENFPADSVYRQSTEALTQNRLKIVEKEEIVENIENQIGGGLIEEIVI
                     QAADELSLASQLGGLKVWEELEEKPLDDQWVYFGKKI"
     gene            complement(<398473..>399105)
                     /locus_tag="CD36_26770"
                     /db_xref="GeneID:8049864"
     mRNA            complement(<398473..>399105)
                     /locus_tag="CD36_26770"
                     /product="Ras-related protein Sec4"
                     /transcript_id="XM_002421718.1"
                     /db_xref="GeneID:8049864"
     CDS             complement(398473..399105)
                     /locus_tag="CD36_26770"
                     /inference="similar to AA sequence:UniProt:O14462"
                     /inference="similar to AA sequence:UniProt:P07560"
                     /note="small GTPase of Rab family, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Ras-related protein Sec4"
                     /protein_id="XP_002421763.1"
                     /db_xref="GeneID:8049864"
                     /db_xref="GOA:B9WL02"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WL02"
                     /translation="MSGKGTSSRAYDMIMKLLLVGDSGVGKSCLLLRFVEDKFNPSFI
                     TTIGIDFKIRTIESKGKRIKLQVWDTAGQERFRTITTAYYRGAMGIVLIYDVTDSRSF
                     ENVENWFQTVTQHANEDAQIFLVGNKCDDEVNRQVSKEQGQELAAKLNVPFLEASAKS
                     NENVDSIFYELASIIQEKHVEENIGGVGGAGGAGGIDVSQNNSGAKNNCC"
     gene            complement(<399836..>401728)
                     /gene="FRS1"
                     /locus_tag="CD36_26780"
                     /db_xref="GeneID:8049865"
     mRNA            complement(<399836..>401728)
                     /gene="FRS1"
                     /locus_tag="CD36_26780"
                     /product="phenylalanyl-tRNA synthetase beta chain,
                     putative"
                     /transcript_id="XM_002421719.1"
                     /db_xref="GeneID:8049865"
     CDS             complement(399836..401728)
                     /gene="FRS1"
                     /locus_tag="CD36_26780"
                     /EC_number="6.1.1.20"
                     /inference="similar to AA sequence:UniProt:O13432"
                     /inference="similar to AA sequence:UniProt:P15624"
                     /codon_start=1
                     /transl_table=12
                     /product="phenylalanyl-tRNA synthetase beta chain,
                     putative"
                     /protein_id="XP_002421764.1"
                     /db_xref="GeneID:8049865"
                     /db_xref="GOA:B9WL03"
                     /db_xref="InterPro:IPR004531"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="UniProtKB/TrEMBL:B9WL03"
                     /translation="MHFSFTIESKFFSAPISTKAEIQVIYIYIYQHQPYTSAMPTIPV
                     DKEDLFKLLGRSYTTEEFDELCFQFGIELDEDTTEDVKGTDERPQLKIEVPANRYDML
                     CIEGIAQALNEFLGNTPAPNYKLNPSKPEISLTIKESTYPIRQYAASAILRNVNLDER
                     AYDSFIALQDKLHSNLCRNRTLVAIGTHDLDTLTPPFTYEALPPKDIVFKPLNQTKEI
                     NGEELMEFYEKDKNIGKFLHIIKDSPVYPVMLDANRTVASLPPIINSDHSKITLNTKN
                     VWIDVTGTDRTKTEIVINQLVAMFSRYCKEPFEIEPVQIISEHNKETRVCPNITPRTA
                     KAEISYINSCVGLDYSGDEISKLLKKMSLDATPSTEEKDILDVKIPITRSDILHQCDI
                     MEDVAIGYGYDNLKKTKPKAESLVAAPLPVNKVADILRLASSQAGYLEVMPLTLSSHD
                     ENFGWLKQKDDGTKAVKLENPKTIEYQVVRTTLLPGILKTVKENRKHSLPIKVFECGD
                     IVLKNPKLERGAFNQRNWAALYVGKTSGFEMVQGLLGKIMQTMRTPWLENPSKDQRRG
                     YWIEEDKENPTFFPGRGAKIYFRNADNAEAKAIGSIGVLHPEVMNNFDIPYAASSVEI
                     NAEVFL"
     gene            complement(<401909..>404632)
                     /locus_tag="CD36_26790"
                     /db_xref="GeneID:8049688"
     mRNA            complement(<401909..>404632)
                     /locus_tag="CD36_26790"
                     /product="hypothetical membrane protein"
                     /transcript_id="XM_002421720.1"
                     /db_xref="GeneID:8049688"
     CDS             complement(401909..404632)
                     /locus_tag="CD36_26790"
                     /inference="similar to AA sequence:UniProt:O94063"
                     /inference="similar to AA sequence:UniProt:P43564"
                     /codon_start=1
                     /transl_table=12
                     /product="hypothetical membrane protein"
                     /protein_id="XP_002421765.1"
                     /db_xref="GeneID:8049688"
                     /db_xref="InterPro:IPR007941"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WL04"
                     /translation="MGSNRNSFDRPLNYRMSIGESRESVISPTHEGYTKFSSKTSLTH
                     LPSLPYSQAATSPSSLQDNIEEVHGQNDDAYIEFDLSSPNPRNSTSDSFNRVTPRVHT
                     SSSVSTPIQEHGPEDLGDAKPQANECILEKPKDEDEDFFKSGTNWKSMKTISDMDYYN
                     EKGELEFNSKSGKDFIYDKNNQFGYTKIDTEEQVNKYAALDQKTDFLFRPRGETQKNN
                     AKYHKDDIFLEDDDSDYDEDDEIDSGETLTETKKMLNDSQKFAYIGIAKLLTVEMATD
                     LAKVQFGTSSKIAKQLSGSQKNFSNWIEYVMSKLYDHLTVEGAEKEMIENLSKHGVEV
                     NDLAKSLMEVGTKAVISGGNKSFISEDFDLRWVIICDMFLMLLSDGYYDARSRSLLLR
                     FGASVNITNLELFQFERRLIECLDMETKEKSIENKDEKLGDRSFVQQQIKKNKNKRIA
                     YIGLATLAGSLAIGLSAGLLAPVIGAGIAAGFTTIGISGTGGFLAGVGGSALITTSGV
                     AIGARVGSKAGSRRVGDVHTFEFKPLHNNKRTNLIVTVSGWMNGAMDDVRLPFSTVDP
                     VMGDMFSLLWEPEMLQSMGQTIGILASEALSTSIQQILGATILAALMSAIQIPMALSK
                     LSYLLDNPWNVSLDRAWKAGKILAETIISGNLGVRPITLVGFSLGSRLIYSCLIEMAR
                     RGGYGLIENVIILGSPITVDIDQMSEARSVVSGRFVNGYSKKDWILGYLFRATGGGIR
                     AVAGLSPLDNVHGVENIDCTDLVEGHMAYRKAIPKIMKTIGWEVLSEEFAEIEEPDPE
                     QGERQRQLIHEFDEARAKMEKEKNDNVEPKGWRKWFKPKKKDWWDIYGQPEGADKDEK
                     GEYVDENLEGNAVFDVDALVKEVNEIEHMADENTNKGTDLVSHQNDKNEEK"
     gene            <405718..>406677
                     /locus_tag="CD36_26800"
                     /db_xref="GeneID:8049866"
     mRNA            <405718..>406677
                     /locus_tag="CD36_26800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421721.1"
                     /db_xref="GeneID:8049866"
     CDS             405718..406677
                     /locus_tag="CD36_26800"
                     /inference="similar to AA sequence:UniProt:O94064"
                     /inference="similar to AA sequence:UniProt:Q12291"
                     /note="possibly fungus-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421766.1"
                     /db_xref="GeneID:8049866"
                     /db_xref="InterPro:IPR021463"
                     /db_xref="UniProtKB/TrEMBL:B9WL05"
                     /translation="MSRKPRRHNETKLTPDDENIGIDLFPFTTEDCMEPQKIIDLFEV
                     CFKHVLKSPDLQEHIQIVKGDLYNRDYLAAFNNDDNRFAYACRWSPARALAYSSVLAS
                     LQPIKSLLEDPETAKSVLCVGGGASSELVALGAVFCRLKEYYPSSSSKLNIKLIDIAD
                     WSKVVNNLTAYMKENWVYHPEKLNSQFICDDILTSSSESLSLGSLDLITLLFTTNELF
                     AEKRKETIKFLQLLNTSCRQGSLLLIAESAGSYSHIKIGDKNFPVQFLIDTILVGKPG
                     IDNGAWEIVSQSDSSWYRINQKEVDYPMKLENMRFFYRLYIKK"
     gene            complement(<406678..>409089)
                     /gene="MSH4"
                     /locus_tag="CD36_26810"
                     /db_xref="GeneID:8049867"
     mRNA            complement(<406678..>409089)
                     /gene="MSH4"
                     /locus_tag="CD36_26810"
                     /product="MutS protein homolog 4, putative"
                     /transcript_id="XM_002421722.1"
                     /db_xref="GeneID:8049867"
     CDS             complement(406678..409089)
                     /gene="MSH4"
                     /locus_tag="CD36_26810"
                     /inference="similar to AA sequence:UniProt:O94065"
                     /inference="similar to AA sequence:UniProt:P40965"
                     /codon_start=1
                     /transl_table=12
                     /product="MutS protein homolog 4, putative"
                     /protein_id="XP_002421767.1"
                     /db_xref="GeneID:8049867"
                     /db_xref="GOA:B9WL06"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WL06"
                     /translation="MDLESRIPATEDSAYGFITTNNEVISKKRKLAQTDDRFEVVMSI
                     YLQRADSMDVGISVLKLKTLELTLMSFCDSSTFVRTVNQIQVYEPTIIILPEAQLHSQ
                     IEKLKYIIHSNVSDKVKERFIKAKVFNAFDGMNNLKLYTDINDSTLEQVVCNRKLSVA
                     AANACIDYCVSTKLFRVTNKIILKHCICENTMLIDICTVRDLELVDSSSERGTTLYSF
                     LNCCLTKMGTRILRTSILQPSTHENSIILRSESVQELINDEDMLINIRSSLKHTCDLE
                     KVFSTFLEPRGTLNREQEINNIILLKTVLQNTFVIRKSIENVSSHLLVQVKQILEHEN
                     VQHLLAIINEYIRDDCQWANSSTELANQRANAIKSGVNGLLDVSRRIREALLEEVSEL
                     VAKLSEKLEILMEYRFEPSKGFFIKIKGDNTDINSLPEDLINRVKKRKTIECTTIELM
                     KQSSRYKDIVSEITILNSTIVQDMYTNINNYTPILLMVSEAIGTLDLLCSFAYFTSLQ
                     KSSYTCPEFAKEVTILRSFHPILGSNNSDFIANNYSCNQELSRIHVITGVNMSGKSVY
                     LRQIAYLVIMAQMGCFVPAEYAKMRVFNSLYSRLSSDTVDINASSFSKEMSETAVILN
                     DSDENSLILIDELGRGSSLTDGFSICLAILEDLICKGATVITTTHFRDIAQVLANKSC
                     VVTAHMETVETNGKLEMKYNLLLRRNDIVGYGIRFAETSNLLPQELIEDSRVIANILR
                     SRKPVHGDKELKLLSRRRKLVLELYFALNYVSKLNCEMNYKIQLLQTLQAKFVEEINA
                     APITE"
     gene            complement(<409233..>410240)
                     /locus_tag="CD36_26820"
                     /db_xref="GeneID:8049699"
     mRNA            complement(<409233..>410240)
                     /locus_tag="CD36_26820"
                     /product="NAD-dependent deacetylase, putative"
                     /transcript_id="XM_002421723.1"
                     /db_xref="GeneID:8049699"
     CDS             complement(409233..410240)
                     /locus_tag="CD36_26820"
                     /EC_number="3.5.1.-"
                     /inference="similar to AA sequence:UniProt:O94066"
                     /inference="similar to AA sequence:UniProt:P53686"
                     /note="Similar to S. cerevisiae HST2; homologous to sir
                     protein 2, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="NAD-dependent deacetylase, putative"
                     /protein_id="XP_002421768.1"
                     /db_xref="GeneID:8049699"
                     /db_xref="GOA:B9WL07"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR017328"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:B9WL07"
                     /translation="MPTLDDILKPVADAVRNGKKVTFFNGAGISTGAGIPDFRSPDTG
                     LYANLAKLNLPFAEAVFDIDFFKEDPKPFYTLAEELYPGNFAPTKFHYLIKLLQDQGS
                     LKRVYTQNIDTLERLAGVEDKYIVEAHGSFASNHCVDCHKEMTTETLKSYMKDKKIPS
                     CQHCEGYVKPDIVFFGEGLPVKFFDSWENDCDEVEVAIVAGTSLTVFPFASLPGEVNK
                     KCLRVLVNKEKVGAFKHEPRKSDIIALHDCDVVAEKLCALLGLDDKLNEVYDKGKNKY
                     NRAESKETKMHEIEDKLKEEAHLKEEKRISKVDNKQKQIDANDKDNEKELEQLIDKLK
                     I"
     gene            complement(<410426..>411421)
                     /locus_tag="CD36_26830"
                     /db_xref="GeneID:8049868"
     mRNA            complement(<410426..>411421)
                     /locus_tag="CD36_26830"
                     /product="NADPH-dependent methylglyoxal reductase,
                     putative"
                     /transcript_id="XM_002421724.1"
                     /db_xref="GeneID:8049868"
     CDS             complement(410426..411421)
                     /locus_tag="CD36_26830"
                     /EC_number="1.1.1.283"
                     /inference="similar to AA sequence:UniProt:O94067"
                     /inference="similar to AA sequence:UniProt:Q12068"
                     /note="Similar to S. cerevisiae GRE2"
                     /codon_start=1
                     /transl_table=12
                     /product="NADPH-dependent methylglyoxal reductase,
                     putative"
                     /protein_id="XP_002421769.1"
                     /db_xref="GeneID:8049868"
                     /db_xref="GOA:B9WL08"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B9WL08"
                     /translation="MSITVFVAGAGGYIGKHIVSQLLSKGYSVIGSVRSDEKGERLES
                     LFENNNFSYVVVEEAEVKGAFDKPLKDHPHIKVFIDTASPLPIGVNYEKQLIRRTAKG
                     IKYILSSIKDHGPNITKVVITSSIASCMNEKQSHDPNFVVDESKWNPDKHSAGKNNAT
                     SAYFYAKASAEHEAWEFMKKKTHFTLATILPGYTFGPQCFDEDVSDILEASVEIVTKL
                     FELNKNDPIPKDSGLFVDVRDVAAAHIKAFELNEAQNKRLLLVSEPFSGQEIVDILHE
                     MYPAVQLPLGHPGEKPNYKFNNSETKKILNTDFRSLRSSIKDDYDQYLRTHGIIS"
     gene            <411838..>414876
                     /locus_tag="CD36_26840"
                     /db_xref="GeneID:8049869"
     mRNA            <411838..>414876
                     /locus_tag="CD36_26840"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421725.1"
                     /db_xref="GeneID:8049869"
     CDS             411838..414876
                     /locus_tag="CD36_26840"
                     /inference="similar to AA sequence:UniProt:O94068"
                     /inference="similar to AA sequence:UniProt:Q12532"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421770.1"
                     /db_xref="GeneID:8049869"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="InterPro:IPR021846"
                     /db_xref="UniProtKB/TrEMBL:B9WL09"
                     /translation="MKQRITSLDLQILTSELSKELSNYRLQNIYNVASNSRQYLFKFS
                     IPDSKKVVVLEYGNRIHLTDFERPATQQPTNFVTKLRKHLKTRRLSGIKQISNDRILV
                     LEFSDGKYYLVLEFFSAGNVLLLDESQKILALQRLVSAKEENDRYAVNEEYKMFDKSL
                     FQQDFHYEKRLYTLDEVESWIQTHKLKLSQASDNKKAKVFSIHKLAFINASHLSGELI
                     QKWFFESGIDPSQSCLSFEDNQEALQQVVNALGVCEDKYIDLINGAIDNEGYIVAKKN
                     NKASENSELEYIYDEFDPFEPYKPNQEGLKFIPVSGYNKTLDKFFSNIESTKFSMKIE
                     QQKENAAKRLEKARSERDKQIDSLVAQQKLNAKKGELIQYHSELVEECRNYVQSFIDQ
                     QMDWTNIETVISLEQKKKNDLAKHIQLPLNLKENKIKVLLEDFDDYEESTESASATET
                     ESETESETDSDSSSESESDNDEDKIPVKRTQRKKNAKEKPKRKTVPTWIDLSQSAFAN
                     ARSYFDSKKTAETKQVKVESSTSMALKNAERKINQDLTRSLKQENETLKEIRPKYWFE
                     KFFWFVSSEGYLCLAGKDASQTDMIYYRHFSDNDSIVSADMEGSLKVFIKNPLKGEAL
                     PPSTLMQAGIFAMSTSSAWNGKVTTSAWVLHGTEISKRDYDGSIVPEGEFNYLVQKEY
                     LPPAQLVMGFGFYCLLDEESTKHYAEIRTKRELEHGFTIVVDNKKKELEDIKLAQQAN
                     SKETTTQEQCVDKSSDTDDDDDADNSESDTVSVTANIEEKSGISQQLPRGKRSKLKKI
                     AAKYRDQDEKERKLRMEALGTLKQVEERLSKTQIEDSEKSESVKKQQQKEMILERKKK
                     QKERELQKYLLGDDNDEETNEESHIVNYLEILDSFTAKPSTKDTIVGLVPVFAPWSAL
                     QKFKYKVKVQPGSGKKGKCIGDSINYFVNRKIDNCSSDVDLDLPQEREFIKNFKTNDI
                     VGIFTVGKVKLALPGGSGDSNKGGKSNNKKPASKKGNKKK"
     gene            complement(<415177..>417120)
                     /locus_tag="CD36_26850"
                     /db_xref="GeneID:8049870"
     mRNA            complement(join(<415177..415623,415696..>417120))
                     /locus_tag="CD36_26850"
                     /product="peptide permease, putative"
                     /transcript_id="XM_002421726.1"
                     /db_xref="GeneID:8049870"
     CDS             complement(join(415177..415623,415696..417120))
                     /locus_tag="CD36_26850"
                     /inference="similar to AA sequence:UniProt:P32901"
                     /inference="similar to AA sequence:UniProt:P46030"
                     /note="Similar to S. cerevisiae PTR2;
                     spliced gene; peptide transport protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="peptide permease, putative"
                     /protein_id="XP_002421771.1"
                     /db_xref="GeneID:8049870"
                     /db_xref="GOA:B9WL10"
                     /db_xref="InterPro:IPR000109"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR018456"
                     /db_xref="UniProtKB/TrEMBL:B9WL10"
                     /translation="MVSSDFENEKQPEVVQVLTDEKNISLDDKYDYEDLRNYSTNYVD
                     EYNPKGLRRPTPEESKTLRRVIGNIRYSTFMLCICEFAERASYYSTTGILTNYIQRRI
                     DPDSPHGWGAPPPGSPDASAGALGKGLQAASALTNLLTFLAYVFPLIGGYLGDSTIGR
                     WKAIQWGVFFGFVGHLFFIFASIPQAIENANAGLGLCVIAIITLSAGSGLMKPNLLPL
                     VLDQYPEERDMVKVLPTGESIILDREKSLSRITNVFYLAINIGAFLQIATSYCERRVG
                     FWLAFFVPMILYIIVPLFLFIVKPKLKIKPPQGQVMTNVVKILSVLFSGNFIKRLWNG
                     KFWDHAKPSHMEARGIVYYNTKKKSAITWSDQWILDVKQTFDSCKIFLYYIIFNLADS
                     GLGSVETSLIGAMKLDGVPNDLFNNFNPLTIIVLIPILEYGLYPLLNKFKIDFKPIWR
                     ICFGFVVCSFSQIAGFVLQKQVYEQSPCGYYATNCKNPAPITAWKASSLFILAAAGEC
                     WAYTTAYELAYTRSPPALKSVVYALFLVMSAFSAALSLAITPALKDPNLHWVFLAIGL
                     AGFLCAIVMLAQFWNLDKWMENETNERERLDREDEEEANRGIHDIDHPIEAITSIKS"
     gene            418551..418898
                     /locus_tag="CD36_26870"
                     /pseudo
                     /db_xref="GeneID:8049871"
     misc_feature    418551..418898
                     /locus_tag="CD36_26870"
                     /inference="similar to AA sequence:UniProt:P40897"
                     /inference="similar to AA sequence:UniProt:Q5YBA3"
                     /note="Similar to S. cerevisiae OPT1;
                     in-frame stop codon; partial sequence"
                     /pseudo
                     /db_xref="GeneID:8049871"
     gene            <420273..>421967
                     /locus_tag="CD36_26880"
                     /db_xref="GeneID:8049872"
     mRNA            <420273..>421967
                     /locus_tag="CD36_26880"
                     /product="5 aminolevulinic acid synthase, putative"
                     /transcript_id="XM_002421727.1"
                     /db_xref="GeneID:8049872"
     CDS             420273..421967
                     /locus_tag="CD36_26880"
                     /EC_number="2.3.1.37"
                     /inference="similar to AA sequence:UniProt:O94069"
                     /inference="similar to AA sequence:UniProt:P09950"
                     /note="5-aminolevulinate synthase, mitochondrial
                     precursor, putative; delta-aminolevulinate synthase,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="5 aminolevulinic acid synthase, putative"
                     /protein_id="XP_002421772.1"
                     /db_xref="GeneID:8049872"
                     /db_xref="GOA:B9WL11"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR010961"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:B9WL11"
                     /translation="MESITKVSMSVCPFVRSTSTQALRQLSQTSGALANQARQCPIVG
                     NAIRAKEISIRSYSSATKPVRATAATASTPEANFNVSPSFELGSKETAFDYDGYLGNE
                     LEKKRSDKSYRYFNNINRLANEFPKAHRTKEEDKVTVWCSNDYLGMGKNENTLKEMKR
                     VLDKYGSGAGGTRNIAGHNAHAIKLESELAALHKHDAALVFSSCFVANDAVLSLLGQK
                     IKDLVIFSDELNHASMIQGIRNSRARKHIFKHNDLADLESKLAQYPKSTPKLIAFESV
                     YSMCGSIAPIEAICDLAEKYGALTFLDEVHAVGMYGPHGAGVAEHLNFEAHLKSGIER
                     PEVTTVMSRVDMVTGTLGKAYGVVGGYITGKTNLIDWFRSYAPGFIFTTSLPPAIMAG
                     CSASIRYQRATLKDRISQQKNTRLVKRNLNELGVPVIPNPSHIVPVLVGNAADAKRAS
                     DLLLNKHDIYVQAINFPTVPIGEERLRITPTPGHGPELSRQLVEAIDSVFTELNLNRI
                     NDWKKLGGLLGVGVEGAAKVDHIWTDEQLALTDADLNPNVVNPAISPLDVSSGIST"
     gene            <422462..>424819
                     /locus_tag="CD36_26890"
                     /db_xref="GeneID:8049873"
     mRNA            <422462..>424819
                     /locus_tag="CD36_26890"
                     /product="spindle pole body component, putative"
                     /transcript_id="XM_002421728.1"
                     /db_xref="GeneID:8049873"
     CDS             422462..424819
                     /locus_tag="CD36_26890"
                     /inference="similar to AA sequence:UniProt:O94070"
                     /inference="similar to AA sequence:UniProt:P53540"
                     /note="Similar to S. cerevisiae SPC98"
                     /codon_start=1
                     /transl_table=12
                     /product="spindle pole body component, putative"
                     /protein_id="XP_002421773.1"
                     /db_xref="GeneID:8049873"
                     /db_xref="GOA:B9WL12"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="InterPro:IPR015697"
                     /db_xref="UniProtKB/TrEMBL:B9WL12"
                     /translation="MALNKVQLIKLYSNRLVKSLVPVEFGEAFIQSVINDLQTTLLNT
                     PSEEQNLSIIINKLKMQFLSNNLKNEWVEFQNIVNSLSKFKSLDQICNYLVFLDALRD
                     EKPEDILSTSSASLSPGKQTVTINTANTALTLSQLIEPYYDTLSEQTILTYLPYTMLG
                     SDSKIFTFSDNYTRLEIPRDINNSFSSLLREVFEFAILYKQLAIVVDKYKGTLVSAIK
                     TAYIAILEAQLNKYVNDINNIFSNKPNSILVVYNSAFPWISILRFLYRVSNRLNRLDG
                     YEFLTFIYSFTNHGDPKIRDIAVTAFTEVVKPYYNIVEHWIVKGELIDNNNEFFIVFD
                     QEQNEFNSIIKLLPKKIPAFIESSDRIFQIGKTLIFLNKYCRELKWVNQYNVKYSAIL
                     FNNHQGLSSMTTNEMIKLIDSQYNEILTFLTQIIQGNNKLFTHIYNFKRFYFMETNDF
                     IDAIMVKGKDVFNESSVNISSTYLRKVLQEAIQISSVKNFEYVDRLDSRVLNPQHGNL
                     GWESFTIEYKIDDLPMSYLFEGHQHLQYLKMFHFLWKLRQLNNLLNWHFEMFNELNHN
                     VVMKLTTRNRRPLLKSLSIITSIRFHFTQFLNELIAYLSYDVIEENFQQHIVRKLFYN
                     KNDQDLLLNKSFMNLSENQLTNNLPKFNVNLLTIDELVELHGTYIDSIINSSLLNEKV
                     KGNETNVSYIDQIFDILQTIFNFINTSQEFYSLVVNFGLLVKSDNNTSNIELEQDQED
                     LEFQLHKIKRKIYKDIYQHDYKRQLNDLKNDLNRDYNLKDLSKLL"
     gene            <425773..>426627
                     /locus_tag="CD36_26900"
                     /db_xref="GeneID:8049874"
     mRNA            <425773..>426627
                     /locus_tag="CD36_26900"
                     /product="mitochondrial ornithine carrier protein,
                     putative"
                     /transcript_id="XM_002421729.1"
                     /db_xref="GeneID:8049874"
     CDS             425773..426627
                     /locus_tag="CD36_26900"
                     /inference="similar to AA sequence:UniProt:Q12375"
                     /inference="similar to AA sequence:UniProt:Q5A967"
                     /note="Similar to S. cerevisiae ORT1"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial ornithine carrier protein,
                     putative"
                     /protein_id="XP_002421774.1"
                     /db_xref="GeneID:8049874"
                     /db_xref="GOA:B9WL13"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:B9WL13"
                     /translation="MDDVDSALVDNVKSFAAGGFGGICAVLTGHPFDLVKVRLQTGLY
                     NSSIQCIKQTIAKDGLTGLYRGVLPPLLGVTPMFAVSFWGYDVGKRLVSTYTGKSIDQ
                     FEIKEISTAGFISAIPTTLVAAPFERVKVMMQIQEGNKSKSMAGVVAEMYRTGGLRSI
                     FKGSVATLARDGPGSALYFATYEYLKKELSSPGQDLSLFAIMTAGGFAGVSMWLGVFP
                     IDTIKSTQQSSNVPISIIQTTKNIYAKGGIKAFFPGVGPALARSFPANAATFLGVELA
                     RKALDSVI"
     gene            <426952..>427711
                     /gene="VMA4"
                     /locus_tag="CD36_26910"
                     /db_xref="GeneID:8049875"
     mRNA            join(<426952..426972,427052..>427711)
                     /gene="VMA4"
                     /locus_tag="CD36_26910"
                     /product="vacuolar ATP synthase subunit, putative"
                     /transcript_id="XM_002421730.1"
                     /db_xref="GeneID:8049875"
     CDS             join(426952..426972,427052..427711)
                     /gene="VMA4"
                     /locus_tag="CD36_26910"
                     /EC_number="3.6.3.14"
                     /inference="similar to AA sequence:UniProt:O94072"
                     /inference="similar to AA sequence:UniProt:P22203"
                     /note="spliced gene; vacuolar proton pump subunit,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="vacuolar ATP synthase subunit, putative"
                     /protein_id="XP_002421775.1"
                     /db_xref="GeneID:8049875"
                     /db_xref="GOA:B9WL14"
                     /db_xref="InterPro:IPR002842"
                     /db_xref="UniProtKB/TrEMBL:B9WL14"
                     /translation="MALSDEQVKSELSKMQAFIEKEAKEKAKEIKLKADEEYEIEKAS
                     IVRSETAAIDSTYEQKLKKASLAQQITKSTIGNKTRLRILSTKDEVLHDIFDEAEAEL
                     KKITKDKKQYKPVLVGLIEEGVLALMEPKVSIKVREQDVDVAKEAITEAAKNFEEKAK
                     FKVEISIDDKNFLATDIAGGVVVVNGSGKIEVDNTLEERLKILSEEALPAIRLELFGP
                     STTRKFFD"
     gene            <428057..>429463
                     /locus_tag="CD36_26920"
                     /db_xref="GeneID:8050200"
     mRNA            <428057..>429463
                     /locus_tag="CD36_26920"
                     /product="magnesium transporter, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_002421731.1"
                     /db_xref="GeneID:8050200"
     CDS             428057..429463
                     /locus_tag="CD36_26920"
                     /inference="similar to AA sequence:UniProt:Q01926"
                     /inference="similar to AA sequence:UniProt:Q5A970"
                     /note="Similar to S. cerevisiae MRS2"
                     /codon_start=1
                     /transl_table=12
                     /product="magnesium transporter, mitochondrial precursor,
                     putative"
                     /protein_id="XP_002421776.1"
                     /db_xref="GeneID:8050200"
                     /db_xref="GOA:B9WL15"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="InterPro:IPR026573"
                     /db_xref="UniProtKB/TrEMBL:B9WL15"
                     /translation="MYHIHRLLVPIQSNSVFFSLSQLPKSSLIGCRYKSNNVRYQYSK
                     KPLKNSILHNLGSSSSSTESEILNKLKPITPNDLYVSCTSFDRLGNITAVSRKYPKMQ
                     FLKENHLFPRDLRKIDTSSIDVVPVIMIRPSSAILVNLLHIKAIIKKDNVMVFDTSKS
                     EVATKLGIFMYDLELKLKSPGNNVCYEFRALESILVSVTSYLEAEIKLHRQQCGIILA
                     ELEDEVDRTKLQELLIRSKKLSSFHQRAILIRDVLEELLENDEDLAGMYLTDLKRFEP
                     EEENYEEIESILESYYNQCDEYVQQAGSLLSDIKATEEIVNIILDANRNSLMLFELKI
                     TVYTLGFTVATLVPAFYGMNLKNYIEETNWGFGLVLVVSLLQGLAITWLNFRKLHKVQ
                     KLTMMGTSNTSKAGNSLSRHIPVGSHVDRWKRGSFLYRLFYGSGGKYSKSSKKFDMPT
                     NREKDAMWRMINDDKAIK"
     gene            complement(<429604..>430503)
                     /locus_tag="CD36_26930"
                     /db_xref="GeneID:8049876"
     mRNA            complement(<429604..>430503)
                     /locus_tag="CD36_26930"
                     /product="DNA-dependent RNA polymerase subunit, putative"
                     /transcript_id="XM_002421732.1"
                     /db_xref="GeneID:8049876"
     CDS             complement(429604..430503)
                     /locus_tag="CD36_26930"
                     /EC_number="2.7.7.6"
                     /inference="similar to AA sequence:UniProt:P46669"
                     /inference="similar to AA sequence:UniProt:Q5A972"
                     /note="Similar to S. cerevisiae RPA43"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-dependent RNA polymerase subunit, putative"
                     /protein_id="XP_002421777.1"
                     /db_xref="GeneID:8049876"
                     /db_xref="GOA:B9WL16"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="UniProtKB/TrEMBL:B9WL16"
                     /translation="MSVEVRKRPVDNFSSASKRRATVQSTNPKDGNGLSECFKTVSTS
                     LYVSLAPVHLQDPINGIKQQHLDPLIMTYFVKAKGIVVAYSNIKFLENNYNNEDSAYS
                     LAKIEGSSPFTFLWISVDFLCWCPEVGDVLEGDIYMQTPSHIGLLICDTFNASIKKYN
                     IPNTWAFVPNQIDEVSSDDKKTFGHWVDESETKVEGKLQFTIKAIHTTGRIVSVEGTL
                     ITPGEERNAQPVYKERSETKSTGKHMKFADDEVITTAEIAEPEENDELPAYIKDSDDE
                     DSGSDDNKVVNKSDLDEDKIESD"
     mobile_element  430681..430956
                     /mobile_element_type="retrotransposon:solo LTR, rho A"
     gene            complement(<431833..>433347)
                     /locus_tag="CD36_26940"
                     /db_xref="GeneID:8049877"
     mRNA            complement(<431833..>433347)
                     /locus_tag="CD36_26940"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421733.1"
                     /db_xref="GeneID:8049877"
     CDS             complement(431833..433347)
                     /locus_tag="CD36_26940"
                     /inference="similar to AA sequence:UniProt:Q5A962"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421778.1"
                     /db_xref="GeneID:8049877"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B9WL17"
                     /translation="MAYALTRNDDFKTQSKKKKCTKKKPKSTFSALISNSHLLYIPMK
                     LYFEAEKFLKPNKGTNGSLQSRIFNDKRLTNSPKHIFALVYSTLKYKEYIDVIIKKSK
                     IRQDLQFKKAKISNELLCLMIHDLLFSSKGRIQSGKHPLKDAFLSNKTRLQAEFIKLK
                     LKYKVKSVDQLPTKEADEDETPIRWFRINTIKIDKDRFYTKHPFFQKLQPVSSIDEIT
                     GTGMIYSDDYIPNLFGVHPREKITSTEAYRLGEIIIQDRASCFPSHILNSDPKDVHTQ
                     VIDACAAPGNKTTHAAAHLPNSDSVVYAFERDPKRVKILKTMCEKATGKAKKKLIQVT
                     HADFTTTKPDDFPDVTGLVVDPSCSGSGIFGRALEDSHNEEETENVNTERLNKLAGFQ
                     FAIMKHALSFPSAKKVVYSTCSIHAQENERVVVDLLSDPEVNRRGWKLADREVVLPKW
                     DRRGLEEEFVKMSRDPEECTRLAGGCVRANPKQDGGIGFFAACFVRPAQEDHEN"
     gene            <433743..>435827
                     /locus_tag="CD36_26950"
                     /db_xref="GeneID:8049878"
     mRNA            <433743..>435827
                     /locus_tag="CD36_26950"
                     /product="actin-regulating kinase, putative"
                     /transcript_id="XM_002421734.1"
                     /db_xref="GeneID:8049878"
     CDS             433743..435827
                     /locus_tag="CD36_26950"
                     /EC_number="2.7.11.1"
                     /inference="similar to AA sequence:UniProt:P53974"
                     /inference="similar to AA sequence:UniProt:Q5A961"
                     /note="Similar to S. cerevisiae ARK1"
                     /codon_start=1
                     /transl_table=12
                     /product="actin-regulating kinase, putative"
                     /protein_id="XP_002421779.1"
                     /db_xref="GeneID:8049878"
                     /db_xref="GOA:B9WL18"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:B9WL18"
                     /translation="MPQPPPNAYKSGTRLTVGSHQVSIIKYISEGGFAHVYTCTIDPP
                     FQGSNVACLKRVVVPSKWQLSLLRQEVDAMRRLRGNKHIVSYIDSHASRLGDSNTSGT
                     NNSHNQQQQYEVFLLMEYCENNGLIDFMNTRLVNKLTEKEIIDIMYQVTIGVAMCHHL
                     RPPLIHRDIKIENVLIDGKGVFKLCDFGSSVNYLPPPRNPQELQLMKDDLMQHTTPQY
                     RAPEMIDLSKGFPIDDKSDIWALGIFLYKLCYYTTPFERPNQSSLQELEHTILNCSET
                     LRFNDQPGSMFSPRLKNAIKVCLRGDPRRRPNAVQLLGEIAAMKGEKTIPNVIPYSVI
                     EQSRAKQTVAPEEDTKKGQVSHVEKNKITSKPKTDPFANIDKSKLLNKSGYKLSSVTA
                     ESRTVPARPLSAFFDDGNTSRIYSQGNRSTPSVQDYVKEELAKGESYEFNEPDGTLEF
                     LKSREEEKFHQRNDTGGSFKAAFKNGLRKISTGGNISANNTGSSVKSNRRASLKRIIT
                     GGSNHNKKNFEENTKYMEDSNPVSSAPKKLSIQHRMQQLLNQNEHQHIQKSAQGYGKY
                     TDTKASEDIDEINKPTHSKLVQKKLSPPAVPVNLSSQRNRAQQSSLQNTTKKYSVKDS
                     KPLSKVRNIPPKDTVKTKPPPPKPKKPVYLKSPTKLEITDQRRLSDASEISMPDLDDL
                     EKQFSKRFPSYV"
     gene            complement(<436040..>438649)
                     /gene="HDA1"
                     /locus_tag="CD36_26960"
                     /db_xref="GeneID:8049879"
     mRNA            complement(<436040..>438649)
                     /gene="HDA1"
                     /locus_tag="CD36_26960"
                     /product="histone deacetylase, putative"
                     /transcript_id="XM_002421735.1"
                     /db_xref="GeneID:8049879"
     CDS             complement(436040..438649)
                     /gene="HDA1"
                     /locus_tag="CD36_26960"
                     /inference="similar to AA sequence:UniProt:P53973"
                     /inference="similar to AA sequence:UniProt:Q96W49"
                     /codon_start=1
                     /transl_table=12
                     /product="histone deacetylase, putative"
                     /protein_id="XP_002421780.1"
                     /db_xref="GeneID:8049879"
                     /db_xref="GOA:B9WL19"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR017321"
                     /db_xref="InterPro:IPR019154"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:B9WL19"
                     /translation="MSTDKEEHLDSNPENLIPEEEHESQGFSTATEDSTQASFEEVSE
                     VDYETNPIEMEELSEVDDETNPIEMEELSEVDDETNPIEMEELSEVDDETNPIEMEEE
                     VTTTTAGTYDTVHPQEPSTKKIKLEEPETESDSNGIIVNEPQVVVVPPKKPQLFYTPL
                     KTGLVYDVRMRYHAKVFTSYSEYIDPHPEDPRRIYRIYKKLVEAGIVLDPSLAGINEI
                     GPFMLKIPIREATAEEILEVHSEDHLKFIQSTEDMSRDQLLKETETGDSIYVNNDSYL
                     SAKLSCGGTIEACKAVIEGRVKNSLAIVRPPGHHAEPNTPAGFCLFSNVAVAAKNMLK
                     TYPESVRKIVIVDWDIHHGNGTQKAFYNDPRVLYISLHRFENGRFYPGTKYGDSNQVG
                     EGPGEGFTINIPWRSYGMHDGDYVYAFNKIIQPVISEFDPDLIIVSSGFDAADGDVIG
                     ACHVTPAGYGYMTHTLKGIARGKLAVILEGGYNLDSISKSALAVAKVLVGEPPENTIT
                     LRPHLETIEVVDEVMKIQSKYFKCLREGFPNSIFEDVYDLPDIEKANYKLVNIADPIR
                     SHQVEKLFNEKEFINIPIISSVPNGEKSPFTTDIPDQLEDLVVASPDIYDCTTIILTI
                     HDPPEIWANINPTNGVIETNSTMILEHPLVQIMDKIQKEKDSDNQEKFGYLDINIPSF
                     QLPIPGTTSESSTYNPIIFAQEVLLYIWDNYITYFQQLKNLVLVGFGDSYQAIVNLYG
                     KRPSNEVKDLVKGTVAFLNRTTLKPLIPVMDESMVDWYYQNSVIFTSNFNTCWTGGGT
                     GNGTNGNGSNGGGNKPAESNGHDDFSKRPRKKFGRVIKTTSDGLCDVIQEKFDEGVDF
                     ILDSIEDYSSSED"
     gene            <439761..>440684
                     /locus_tag="CD36_26980"
                     /db_xref="GeneID:8049690"
     mRNA            <439761..>440684
                     /locus_tag="CD36_26980"
                     /product="phosphoglycerate mutase, putative"
                     /transcript_id="XM_002421736.1"
                     /db_xref="GeneID:8049690"
     CDS             439761..440684
                     /locus_tag="CD36_26980"
                     /inference="similar to AA sequence:UniProt:A1CFH0"
                     /inference="similar to AA sequence:UniProt:Q5A9G1"
                     /note="Similar to C. albicans PMU4; phosphomutase,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphoglycerate mutase, putative"
                     /protein_id="XP_002421781.1"
                     /db_xref="GeneID:8049690"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:B9WL20"
                     /translation="MSLLIPTLRDQHDAHGDLEEDEAYQNLLIKEQNSTNNKYIWKFE
                     AVKGFFKQTDEQTDDMAFRYTEQKLGRLDDWETIVTNLQSLNRDSPDNETYKLIFLAR
                     HGQAKSNVASQKYSKEEWMRKWRFLGTDGELTWGPDADLTELGLKQAAENHQCWKQQL
                     LEGAPYPKRFYVSPLQRSIKTHNITWPNTKPIVLENVRETIGLHLCHKCSNKSSLEER
                     FPNLVFEDGFTEEDLLFDKYLPRKEHLHEQFLRINGVLQDIFSSDEEDILCITSHAGT
                     IRAFITVLGHRKFTIPTGGMIPVVIKGTRTC"
     gene            complement(<440814..>441893)
                     /locus_tag="CD36_27000"
                     /db_xref="GeneID:8049880"
     mRNA            complement(<440814..>441893)
                     /locus_tag="CD36_27000"
                     /product="NADP-dependent alcohol dehydrogenase, putative"
                     /transcript_id="XM_002421737.1"
                     /db_xref="GeneID:8049880"
     CDS             complement(440814..441893)
                     /locus_tag="CD36_27000"
                     /EC_number="1.1.1.2"
                     /inference="similar to AA sequence:UniProt:Q04894"
                     /inference="similar to AA sequence:UniProt:Q5A958"
                     /note="Similar to S. cerevisiae ADH6"
                     /codon_start=1
                     /transl_table=12
                     /product="NADP-dependent alcohol dehydrogenase, putative"
                     /protein_id="XP_002421782.1"
                     /db_xref="GeneID:8049880"
                     /db_xref="GOA:B9WL21"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B9WL21"
                     /translation="MSLLLKRLSPIKQSYSKALAIRTMSIPSTQYGFFYNKSSGLNLK
                     KDLPVNKPGAGQLLLKVDAVGLCHSDLHVLYEGLDCGDNYVMGHEIAGTVAELGEEVS
                     EFSVGDRVACVGPNGCGLCKHCLTGNDNVCTKSFLDWFGLGYNGGYEQFLLVKRPRNL
                     VKIPDNVTSEEAAAITDAVLTPYHAIKSAGVGPASNILIIGAGGLGGNAIQVAKAFGA
                     KVTVLDKKDKARDEAKAFGADQVYSELPESVLPGSFSACFDFVSVQATYDLCQTYCEP
                     KGTIVPVGLGASSLNINLADLDLREITVKGSFWGTSMDLREAFELAAQGKVKPKVAHA
                     PLTELPKYLEKLRAGGYEGRVVFNP"
     gene            complement(<443806..>445371)
                     /gene="CET1"
                     /locus_tag="CD36_27010"
                     /db_xref="GeneID:8049606"
     mRNA            complement(<443806..>445371)
                     /gene="CET1"
                     /locus_tag="CD36_27010"
                     /product="mRNA 5'-triphosphatase, putative"
                     /transcript_id="XM_002421738.1"
                     /db_xref="GeneID:8049606"
     CDS             complement(443806..445371)
                     /gene="CET1"
                     /locus_tag="CD36_27010"
                     /EC_number="3.1.3.33"
                     /inference="similar to AA sequence:UniProt:O13297"
                     /inference="similar to AA sequence:UniProt:O93803"
                     /note="mRNA capping enzyme subunit beta, putative;
                     polynucleotide 5' triphosphatase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="mRNA 5'-triphosphatase, putative"
                     /protein_id="XP_002421783.1"
                     /db_xref="GeneID:8049606"
                     /db_xref="GOA:B9WL22"
                     /db_xref="InterPro:IPR004206"
                     /db_xref="InterPro:IPR023577"
                     /db_xref="UniProtKB/TrEMBL:B9WL22"
                     /translation="MNVGSILNDDPPSNGNGNGNDENAKITKSPTAYHKPSVHERHSI
                     TSMLNDTPSDSTPTKKPEPSISPEFRKPSISSLTSPSVAHKPPPPLPPSSSSVGSSEH
                     SSARSSPAITKRNSIANIIDAYEEPVTKTEKKTEQNLPNLNQSTPVPKLEEHDSNVNK
                     VEKVADSVPEPKLKKEPQPVFDEQDDDLTKIKKLKESKKPRRYETPPIWAQRWVPPNR
                     QKEENNVDDGNEVITRLSEKPVFDYTTTRSVDLECSITGLIPPSSITRKIAEWVYANF
                     SNVEEKSKRNVELELKFGKIIDKRSGNRIDLNVVTECIFTDHSSVFFDMQVEEVAWKE
                     ITKFLDELEKSFQEGKKGRKFKILESDNTDSFYQLGRKGEHPKRIRVSKDNLLSPPRL
                     VAIQKERVADLYIHNPGSLFDLRLSMSLEIPVPQGNIDSIITKNKPEMVREKKRISYT
                     HPPTITKFDLTRVIGNKTEDKYEVELEAGVMEIFAAIDKIQNGVDNLRLEELIEVFLN
                     NARTLNNRLNKIC"
     gene            complement(<445733..>446092)
                     /locus_tag="CD36_27020"
                     /db_xref="GeneID:8049679"
     mRNA            complement(<445733..>446092)
                     /locus_tag="CD36_27020"
                     /product="amino acyl-tRNA synthetase complex component,
                     putative"
                     /transcript_id="XM_002421739.1"
                     /db_xref="GeneID:8049679"
     CDS             complement(445733..446092)
                     /locus_tag="CD36_27020"
                     /inference="similar to AA sequence:UniProt:P46672"
                     /inference="similar to AA sequence:UniProt:Q5A956"
                     /note="Similar to C. albicans ARC2"
                     /codon_start=1
                     /transl_table=12
                     /product="amino acyl-tRNA synthetase complex component,
                     putative"
                     /protein_id="XP_002421784.1"
                     /db_xref="GeneID:8049679"
                     /db_xref="GOA:B9WL23"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:B9WL23"
                     /translation="MQNRKVVVVTNMRTRKLRGEKSMGMILAAEKEINDHLNVEPVIP
                     PTTSIIGERLHFGIADNFEPPKLKDKVWEYIQPRLKTTADKKVVFVDEEDKELVLQGS
                     DPSDAAYVSSLDGAKIL"
     gene            <446609..>449257
                     /locus_tag="CD36_27030"
                     /db_xref="GeneID:8049607"
     mRNA            <446609..>449257
                     /locus_tag="CD36_27030"
                     /product="DNA replication licensing factor, putative"
                     /transcript_id="XM_002421740.1"
                     /db_xref="GeneID:8049607"
     CDS             446609..449257
                     /locus_tag="CD36_27030"
                     /inference="similar to AA sequence:UniProt:P53091"
                     /inference="similar to AA sequence:UniProt:Q5A955"
                     /note="Similar to S. cerevisiae MCM6; minichromosome
                     maintenance protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA replication licensing factor, putative"
                     /protein_id="XP_002421785.1"
                     /db_xref="GeneID:8049607"
                     /db_xref="GOA:B9WL24"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008049"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:B9WL24"
                     /translation="MSNFVSSPGRIPSDAAQLLNSQTSSSFGRDNSTPAQPILYSEDL
                     PPHLQLQQQQQQRAVAGRRRQIAVPKVVDVTSEKVRESFETFIEEFIDPEQADDDWDG
                     KIYLAQIEAMKTYEYSTLYVDYQHLLSRENGVLATAISEQYYRFSPFLLKGLHRLLKK
                     YAPSLLHTNLLHNAAEETVSETSTSSQANERVFQISFFNLPTVQRIRDIRSNKIGSLM
                     SISGTVTRTSEVRPELYRACFTCDLCSAVIEGVEQVFKYTEPTACPSCENQSYFTLNV
                     SKSQFIDWQRIRIQENANEIPTGSMPRTLDVILRGETVERAKPGDKCKFTGCEIVIPD
                     VSQLGLPGVKPQSVKESARGSELSSGVTGLKSLGVRDLTYKLAFGACHVASMVNKAGG
                     NEQLEVDLNDQEVFLTSLSDAEVLQLKEMVKDEHIYDKLVNSIAPAVFGHEVIKKGIL
                     LQLLGGVHKQTVDGIKLRGDINICIVGDPSTSKSQFLKYVCGFSPRAVYTSGKASSAA
                     GLTAAVVKDEESGEYTIEAGALMLADNGICAIDEFDKMDITDQVAIHEAMEQQTISIA
                     KAGIHATLNARTSILAAANPIGGRYNRKLGLRSNLNMTAPIMSRFDLFFVVLDDCNER
                     IDTQLASHIVDLHMLRDDAIDPPYSAEQLARYIKYAKTFKPKMTKEARDFLVTRYKEL
                     REDDAQGLGRSSYRITVRQLESMIRLSEAIARANCTEEITPSFVAEAYDLLKQSIIRV
                     EMDDIEMEDEERPAGESEEEAQEQDQPQEQDAQQLQSSERAPPVSISYDKYVSIMNML
                     VKKITEDEKNGGDGLSADTLVEWYLLQKEDEISSEQEYLQERKLAYKVIKRLVRDKIL
                     MSVTEGTNVVYIIHPNCAILDFFERD"
     gene            complement(<449357..>450109)
                     /locus_tag="CD36_27040"
                     /db_xref="GeneID:8049608"
     mRNA            complement(<449357..>450109)
                     /locus_tag="CD36_27040"
                     /product="zinc finger-containing transcription factor,
                     putative"
                     /transcript_id="XM_002421741.1"
                     /db_xref="GeneID:8049608"
     CDS             complement(449357..450109)
                     /locus_tag="CD36_27040"
                     /inference="similar to AA sequence:UniProt:Q00947"
                     /inference="similar to AA sequence:UniProt:Q5A954"
                     /inference="similar to AA sequence:UniProt:Q9UIH9"
                     /note="Similar to S. cerevisiae STP1"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc finger-containing transcription factor,
                     putative"
                     /protein_id="XP_002421786.1"
                     /db_xref="GeneID:8049608"
                     /db_xref="GOA:B9WL25"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:B9WL25"
                     /translation="MAKQEQKVIKLKGEPNQQTLPSGSTLPIPNMSEGKPSETQSSST
                     YIPYQLHSQESQYQHQEQKPIEETIPLQSKISSQLESQVSTRSSPPVIVFRRDKPKKI
                     LPKKPVKPYVCTHPGCTWAFARHSDLTRHSKSHAEPQYKCPYWKNDPTCHKKNGAFNR
                     LDVLKRHLRLIHYVKDKQPIAALNPGEDPGWCRSCQRMFPNSKAFVEHCHDCAQNTVP
                     TEWIDIKREKTGIPNQTTFRVKLDQINKTKST"
     gene            <450732..>451819
                     /locus_tag="CD36_27050"
                     /db_xref="GeneID:8049609"
     mRNA            join(<450732..450740,450824..>451819)
                     /locus_tag="CD36_27050"
                     /product="predicted glutathione s-transferase"
                     /transcript_id="XM_002421742.1"
                     /db_xref="GeneID:8049609"
     CDS             join(450732..450740,450824..451819)
                     /locus_tag="CD36_27050"
                     /inference="similar to AA sequence:UniProt:Q2MGR6"
                     /inference="similar to AA sequence:UniProt:Q2TZB7"
                     /inference="similar to AA sequence:UniProt:Q5A953"
                     /inference="similar to AA sequence:UniProt:Q6EQX0"
                     /note="spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="predicted glutathione s-transferase"
                     /protein_id="XP_002421787.1"
                     /db_xref="GeneID:8049609"
                     /db_xref="GOA:B9WL26"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR016639"
                     /db_xref="UniProtKB/TrEMBL:B9WL26"
                     /translation="MTDKIEILKFAGEDGAYKRRPSSFREFISSKPGARFPPEAGRYH
                     LYVSFACPWAHRTLITRRLKGLTSIIGLSVVHWHMDDKGWRFPTKEELKSLKTEDDIS
                     LGTPDHNYDFSRLRELYFKAEPDYEGRFTVPVLWDKKEGTIVNNESAEIIRMLNTEFN
                     GILPSEYAEVNLVPKDLESQIDELNSWIYDNINNGVYKAGFASKQEVYSKECQNVFDH
                     LDKVEALLEKNHNGSKKGEFLLGNQLTEADIRLYTTIIRFDPVYVQHFKCNIGMIRTH
                     YPYIHNWLRLLYWKIPGFQETTNFEHIKYHYTKSHIKINPYGITPLGPVPNILPLEEK
                     "
     gene            <452426..>453244
                     /gene="RSR1"
                     /locus_tag="CD36_27060"
                     /db_xref="GeneID:8049610"
     mRNA            join(<452426..452431,452504..>453244)
                     /gene="RSR1"
                     /locus_tag="CD36_27060"
                     /product="Ras-related protein, putative"
                     /transcript_id="XM_002421743.1"
                     /db_xref="GeneID:8049610"
     CDS             join(452426..452431,452504..453244)
                     /gene="RSR1"
                     /locus_tag="CD36_27060"
                     /inference="similar to AA sequence:UniProt:P13856"
                     /inference="similar to AA sequence:UniProt:P52498"
                     /note="From CGD: RAS-related protein; GTP/GDP cycling
                     required for wild-type polar bud site selection, hyphal
                     growth guidance; role in systemic virulence in mouse;
                     geranylgeranylation predicted; suppresses S. cerevisiae
                     cdc24-4 mutant heat sensitivity;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="Ras-related protein, putative"
                     /protein_id="XP_002421788.1"
                     /db_xref="GeneID:8049610"
                     /db_xref="GOA:B9WL27"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WL27"
                     /translation="MRDYKVVVLGAGGVGKSSITVQFVQGVYVESYDPTIEDSYRKQI
                     EVDGRACDLEILDTAGVAQFTAMRELYIKSGKGFLLVYSVTDENSLKELLALREQVLR
                     IKDSDNVPMVLVGNKCDLEDDRVLSIEDGVKVSQDWGLVPFYETSAMYKTNVDEAFID
                     VVRQIMRKEAAISAEKKQQKELQKQQQQQQQQQAAEGQQQQQKSGKSKSSASQKDSAT
                     DGQSDVNARLKQSINDHPKSSSGSKCCTIM"
     gene            <454211..>456265
                     /gene="MDL1"
                     /locus_tag="CD36_27070"
                     /db_xref="GeneID:8049706"
     mRNA            <454211..>456265
                     /gene="MDL1"
                     /locus_tag="CD36_27070"
                     /product="ATP-dependent permease, putative"
                     /transcript_id="XM_002421744.1"
                     /db_xref="GeneID:8049706"
     CDS             454211..456265
                     /gene="MDL1"
                     /locus_tag="CD36_27070"
                     /inference="similar to AA sequence:UniProt:P33310"
                     /inference="similar to AA sequence:UniProt:P97998"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP-dependent permease, putative"
                     /protein_id="XP_002421789.1"
                     /db_xref="GeneID:8049706"
                     /db_xref="GOA:B9WL28"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WL28"
                     /translation="MIRMNRLVFSKVFTTSCKSVGKIPFAKSTTRVNTRHFKPTSILQ
                     QIRFNSNSSTTANTEVNSNDSTNTQSNAKKPRPKLTSEIFKLLRLAKPESKLIFFALI
                     CLVTTSATSMALPLMIGKIIDTTKKDDDDHEKDKEDKDDTQPGDKLIFGLPQPQFYSA
                     LGVLFIVSASTNFGRIYLLRSVGERLVARLRSRLFSKILAQDAYFFDLGPSKTGMKTG
                     DLISRIASDTQIISKSLSMNISDGIRAIISGCVGLSMMCYVSWKLSLCMSLIFPPLIT
                     MSWFYGRKIKALSKLIQENIGAMTKVTEEKLNGVKVIQTFSQQHSVVHSYNQEIKNIF
                     NSSMREAKLAGFFYSTNGFIGNVTMIGLLIMGTKLIGAGELTVGDLSSFMMYAVYTGS
                     SVFGLGNFYTELMKGIGAAERVFELVEYQPKISNHLGKKVDELNGDIKFKGIDFTYPS
                     RPDSSIFKNLNLHIKQGENICLVGPSGSGKSTVSQLLLRFYDPEKGTIQIGDDVIADF
                     NLNHYRSKLGYVQQEPLLFSGTIRDNILFGKEDATDEEINNALNLSYASNFVRHLPDG
                     LETKIGASNSTQLSGGQKQRVSLARTLIRNPKILILDEATSALDSVSEEIVMQNLIQL
                     NKNKGVTLISIAHRLSTIKNSDRIIVFNQDGQIVEDGKFNELHNDPNSQFNRLLKSHS
                     LE"
     gene            <457500..>462056
                     /gene="ATG26"
                     /locus_tag="CD36_27080"
                     /db_xref="GeneID:8049697"
     mRNA            <457500..>462056
                     /gene="ATG26"
                     /locus_tag="CD36_27080"
                     /product="UDP-glycosyltransferase, putative"
                     /transcript_id="XM_002421745.1"
                     /db_xref="GeneID:8049697"
     CDS             457500..462056
                     /gene="ATG26"
                     /locus_tag="CD36_27080"
                     /EC_number="2.4.1.173"
                     /inference="similar to AA sequence:UniProt:Q06321"
                     /inference="similar to AA sequence:UniProt:Q5A950"
                     /note="autophagy-relate protein, putative; sterol
                     3-beta-glucosyltransferase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="UDP-glycosyltransferase, putative"
                     /protein_id="XP_002421790.1"
                     /db_xref="GeneID:8049697"
                     /db_xref="GOA:B9WL29"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002213"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="InterPro:IPR004276"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:B9WL29"
                     /translation="MSFYKKVTKGLVTPLQGPINLFSGSPNVSGDEGTNTDNENPDHK
                     TTYRSLSGRVNHDDDDEDVAKLEDIVGFFTGLLDTTTLCAGLGSLNNLKKHYLDEFIK
                     KSALNPLRPQNYGPETNSKLNNNSIEELLNNGDASLEKVRKMSLYDFDEHTSDSEEED
                     SADEEEESIAENLKPGKSEKVKNHVKGSGNTTAAATLVATGITPTTTTTTTATPTPTP
                     TSSVETALTDVTEPIGKVITEIPEEQLQGLNPLQKSVVKNLDPHHIREGVLIKVKNSE
                     TPLKNNRQELLEKIQLRLKIADKLQRVFNLSDDDTFYGNFSAWLIKDVLLQGHVYLTK
                     DALLYFAFLPKRFSLENSSEVLDEDNSSSIVYSGNLGLKSAKYGEVVLNTVLQHRYWA
                     VLRAETLSIYSSSTNLYFPVLVIDIKKCLYAEVIDKEKFNREAISPVNRGTYSPNGGL
                     SGTATPRTSTLENTASELNSMLSGDSYSPTEDNVETTATTVWFKLVTKKKTYKFSCDS
                     SFSARQWCNNITKLIFQHNNANSNGEVLIKIPISKIIEYNKRALFSEEEEEEKNLDAA
                     MNDIPLNVTIKYLGDNENERKRDKLKRKYKGEESTTEEVHFLFPKSGIEFFETFDNLM
                     NPVVSDNDNQSSRSSITSTNFSEKAISTLSKSPNHLVQTVLDFNKPVDDDISPFKKLG
                     TTITSPTRIFKATITSPEMTSIDATSLRESFDGDRLHLPREMSERALKNLEVSFVTSL
                     KKLEDASKRYEKPHMDYNQTNSASILSDPSEVKKQSKTAISKSIKALYSVGTHWSATP
                     NHYFELGKYYVSKVQDRDSSQRNFQSHFSTNSKLLASYYGHLLRTVPVYGKIYVSDTD
                     VCFRSLLPGVSTKMVLPMTDIEEVRASRGSRLTYHGLRLIARGSEELDLEFGSSKSRD
                     DFQKVVLSVLEKLHSKEGFRPEPYQWGSNFEVELYKTRMEYSDSENREIQRYDNSIDI
                     KFAEKRIEMARVRMFEDRLMAASGLDVPIILEDSPFFKTELRPSTSYNVTLLTIGSRG
                     DVQPYIALGIGLVKEGHNVTIATHAEFGDWIKTFGLGFKEIAGDPAELMSFMVTHNSM
                     SVGFLKNAQQKFRSWISKLLTTSWEACQGSDILIESPSAMSGIHIAEALGIPYFRAFT
                     MPWTRTRAYPHAFFVPDQKKGGSYNYLTHVLFENIFWKGISGQVNKWRVEELDLPKTN
                     LYRLQQTKVPFLYNVSPAILPPSVDFPDWIKVTGYWFLDEGSGDYKPPEELVQFMKKA
                     SRDKKKIVYIGFGSIVVKDAKSLTKAVVSAVRRADVRCILNKGWSDRLDHKDKNEVEV
                     SLPPEIYNSGTIPHDWLFPRIDAAVHHGGSGTTGATMRAGIPTIIKPFFGDQFFYATR
                     IEDLGAGIALKKLTARTLADALIKATHDLKIIDKAKRVSQQIKHEHGVLSAIESIYSE
                     LEYSRNLILIKDIHNQNYKRHHPVPSGVQTPAYDTDSDDYVEEDDDFDEDDDSDEEEG
                     DKENLQDDYVGNRVNLSPKETLSN"
     mobile_element  complement(462147..462449)
                     /mobile_element_type="retrotransposon:solo LTR, vau G"
     gene            <462901..>464130
                     /locus_tag="CD36_27110"
                     /db_xref="GeneID:8049672"
     mRNA            <462901..>464130
                     /locus_tag="CD36_27110"
                     /product="homoserine o-acetyltransferase, putative"
                     /transcript_id="XM_002421746.1"
                     /db_xref="GeneID:8049672"
     CDS             462901..464130
                     /locus_tag="CD36_27110"
                     /EC_number="2.3.1.31"
                     /inference="similar to AA sequence:UniProt:P08465"
                     /inference="similar to AA sequence:UniProt:Q5A948"
                     /note="Similar to S. cerevisiae MET2; homoserine o-trans
                     acetylase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="homoserine o-acetyltransferase, putative"
                     /protein_id="XP_002421791.1"
                     /db_xref="GeneID:8049672"
                     /db_xref="GOA:B9WL30"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR008220"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WL30"
                     /translation="MTYKDVTEEQLQTNPYVKLVPGQTIVEIPEYTLECGETLHNFPV
                     AYKTWGKLNETADNALVICHALSGSSDVDDWWGELLGTDRAFDPSRFLIICINFLGSP
                     YGSCSPVTIDKSTGKPYGPSFPLVTFKDDVKIQRLILDSLNVKRLAAVVGGSMGGMLA
                     LEYSAIYNNTGYVQKVVALATAARTSAWCISWNETQRQCIFSDPFYDDGYYYETGNKP
                     DSGLSAARMAALLTYRSRNSFESRFGRKLGKRSPSDGSASPRTKHEEHSLLHNDGSKL
                     VNGAPVNEKYPPTYFSAQSYMRYNGSKFINRFDANCYIAISRKLDTNDLSRGRVEAPN
                     DANGDPLVHVLKGLSTPTLVIGIESDHLFTITEQKLLADNIPNAIFETLDSEEGHDAF
                     LLEFEKINSFITSFLNN"
     gene            <465308..>466696
                     /locus_tag="CD36_27120"
                     /db_xref="GeneID:8049611"
     mRNA            <465308..>466696
                     /locus_tag="CD36_27120"
                     /product="acid phosphatase precursor, putative"
                     /transcript_id="XM_002421747.1"
                     /db_xref="GeneID:8049611"
     CDS             465308..466696
                     /locus_tag="CD36_27120"
                     /EC_number="3.1.3.2"
                     /inference="similar to AA sequence:UniProt:P35842"
                     /inference="similar to AA sequence:UniProt:Q59UY6"
                     /note="Similar to S. cerevisiae PHO11"
                     /codon_start=1
                     /transl_table=12
                     /product="acid phosphatase precursor, putative"
                     /protein_id="XP_002421792.1"
                     /db_xref="GeneID:8049611"
                     /db_xref="GOA:B9WL31"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR016274"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:B9WL31"
                     /translation="MVSVSKLLNNGLLLAGQSVFQDVATPQQASVQQYNIINFLGGSA
                     PYLQRNGYGISTDIPAGCEIAQVQLYSRHGERYPSKSNGKSLEAIYAKFKDYNGTFKG
                     DLAFLNDYTYFVTDKNNYEKETSPKNSEGTYAGTSNALRHGAAFRAKYGSLYKENSTL
                     PVFSSNSGRCYQTSRYFARGFLGDDFEEGKTVKFNIISEDADVGANSLTPRSACSKNT
                     ESSSSTAKKYNTTYLNAIVERLVKPNPGLNLTTSDVSNLFGWCAYEINVRGSSPFCDL
                     FTNEEFIRYSYGNDLSNYYSNGAGNNYTRIIGSVILNSSLELLKDTKNSNQVWLSFAH
                     DTDLEIFHSALGLLEPAEDLPTSYIPFPNPYVHSSIVPQGARIYTEKLQCGNDAYVRY
                     IINDAVVPIPKCATGPGFSCKLDDFENFVKERIGDVDFVKQCGVNSTYPSELTFYWDY
                     KNVTYNAPLGDF"
     gene            complement(<466959..>469739)
                     /locus_tag="CD36_27130"
                     /db_xref="GeneID:8049612"
     mRNA            complement(<466959..>469739)
                     /locus_tag="CD36_27130"
                     /product="suppressor of essential function protein 1
                     homologue, putative"
                     /transcript_id="XM_002421748.1"
                     /db_xref="GeneID:8049612"
     CDS             complement(466959..469739)
                     /locus_tag="CD36_27130"
                     /inference="similar to AA sequence:UniProt:P34228"
                     /inference="similar to AA sequence:UniProt:Q59UY7"
                     /note="Similar to S. cerevisiae SEF1; suppressor protein
                     sef1 homologue, putative; transcription factor with zinc
                     cluster DNA-binding motif, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="suppressor of essential function protein 1
                     homologue, putative"
                     /protein_id="XP_002421793.1"
                     /db_xref="GeneID:8049612"
                     /db_xref="GOA:B9WL32"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:B9WL32"
                     /translation="MKFEKGKVRILPKPSPTPTNPQTPLPLLPAQSKPVTTKRKSASN
                     TPTNESKKSKKSNSTASTPNSATPTSIGTPPQKPSKATGHRPVTSCTFCRQHKIKCNA
                     SDNYPNPCERCKKMGLKCEIDPEFRPRKGSQIQSLKSDVDELKAKIEMLTKNESLLTQ
                     ALNQHNLNHTPQQQQQSPGSQSQQHPPNPQRALSYTSTNSSPQVAFSNASPIPSVTSI
                     QHNAPLTHENSDNSPYALNTPENIEELQPISEFILGDVTLPLNKANELHDKFMTIHLP
                     FLPIIISRSATELYHKSQLLFWAVILTASLSEPDPKLYMSLASLIKQLAIETCWIKTP
                     RSTHVIQALIILSIWPLPNEKVLDDCSYRFVGLAKNLSLQLGLHRGGEFIQEFSRNQV
                     SLGPDAERWRTRSWLAVFFCEQFWSSLLGLPPSINTTDYLLENARVDKSLPKNFRCLI
                     SLSIFQCKLVNIMGISVTRPDGLLEPSNRAGSLSLLDRELERLRFKLQFEEGGPIEVY
                     YLYIKLMICCFAFLPGTPIEDQVKYVSFAYLSATRIVTIVSQMVNDISLIELPIYIRQ
                     AVTYSVLMLFKLHLSRYLIDKYVDSARQSIVTVHRLFRNTLSSWKDLQNDISRTAKVL
                     ENLNMVLYNYPEIFLNDSENEDSSIITRMRSHLTASLFYDLVWCAHEARRRSVLDKGK
                     RQAKPNKKILPLPFYNQITKDDFKTITTTSPNGTTITTLVPTDQAMNQAKSKSFDSSK
                     PLEINGIPLPMLEATGSTKEVLDTLPSQSLPSQAPALQQYPMQQQQQPQQEPLPSKKQ
                     QQQQQQQQQHQQQPQQYQQPSQPNQQQPYLQHQRQFQQSPPPQFSMISSTPPLSQPPF
                     ILANSPIPQTYLPKIDEMNVSPEVKQEHPVAPFASQITNFFDQQTSGWFNNDNQDDDF
                     LGWFDVNMMQEK"
     gene            complement(<471349..>472434)
                     /locus_tag="CD36_27150"
                     /db_xref="GeneID:8049613"
     mRNA            complement(<471349..>472434)
                     /locus_tag="CD36_27150"
                     /product="DNA repair protein rad51 homologue, putative"
                     /transcript_id="XM_002421749.1"
                     /db_xref="GeneID:8049613"
     CDS             complement(471349..472434)
                     /locus_tag="CD36_27150"
                     /inference="similar to AA sequence:UniProt:P25454"
                     /inference="similar to AA sequence:UniProt:Q59UY8"
                     /note="Similar to S. cerevisiae RAD51"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA repair protein rad51 homologue, putative"
                     /protein_id="XP_002421794.1"
                     /db_xref="GeneID:8049613"
                     /db_xref="GOA:B9WL33"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010995"
                     /db_xref="InterPro:IPR011941"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR016467"
                     /db_xref="InterPro:IPR020587"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WL33"
                     /translation="MTQTEIDQAELTEEGSHPQNINADAEVEAEEDEDILNGPLLIEQ
                     LEGNGINASDIKKLKAEGFHTIESIAYTPKRHLMTVKGISENKAEKISAEAAKLVPLG
                     FTTASEFHSRRSELICLTTGSKQLDTLLGGGIETGSITEVFGEFRTGKSQLCHTLAVT
                     CQLPIDMGGGEGKCLYIDTEGTFRPNRLVSIAQRYGLNPNDCLDNVAYARAYNAEHQL
                     NLLNIASQMMAESRFSLLIVDSIMSLYRTDYAGRGELSARQTHVARFMRTLQRLADEF
                     GIAVIITNQVVAQVDGMSGMFNPDPKKPIGGNIIAHASTTRLSFKKGRGETRICKIYD
                     SPCLPESECVFAIYEDGIGDPKVEDDE"
     gene            <477775..>480783
                     /locus_tag="CD36_27170"
                     /db_xref="GeneID:8049614"
     mRNA            <477775..>480783
                     /locus_tag="CD36_27170"
                     /product="serine/threonine-protein kinase, putative"
                     /transcript_id="XM_002421750.1"
                     /db_xref="GeneID:8049614"
     CDS             477775..480783
                     /locus_tag="CD36_27170"
                     /EC_number="2.7.11.1"
                     /inference="similar to AA sequence:UniProt:Q01919"
                     /inference="similar to AA sequence:UniProt:Q59UZ0"
                     /note="Similar to S. cerevisiae KIN4"
                     /codon_start=1
                     /transl_table=12
                     /product="serine/threonine-protein kinase, putative"
                     /protein_id="XP_002421795.1"
                     /db_xref="GeneID:8049614"
                     /db_xref="GOA:B9WL34"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:B9WL34"
                     /translation="MSTIPSQVEINFNKIHQRSNSSSSTSTSSYRIPSGNSCIPRTVE
                     IPSLPHTSSHQQYQNHQQMPSSSSHAHIAKKIHREVRFGAYILGSTLGEGEFGKVKLG
                     WRKDGKHPSQVAIKLIKRSSITKDSDSEIKIHREINSLKLLNHPNIVNLVEVMKSGKY
                     IGIVLEYASGGELFDYILQHKYLKENVAKKLFAQLVSGVDYMHAKGLIHRDLKLENLL
                     LDKHRNVIISDFGFVNSYNRDKNDLMKTSCGSPCYAAPELVLSQTAYEGRKVDIWSLG
                     VILYAMLAGYLPFDDDPENEDGSDIIKLYHYICKTPLTFPEYVSPLARDLLRKIIVSD
                     PKKRIGIDDIRNHPWLSSHANLLSIRQPEWDKVHNEKQQPIVVEPPQPNKRYSMINER
                     TNSSSLMSPAPRVTHTQPLSSHARSYSSTSISLLYSSPSATPSMANAVTNGEGATGGS
                     INESNDTLQLSGTPSPKKPNTVSPVRGHQKSASISNSYSSASVALKAVVYEENRLHNH
                     QQQQSQSQSQQYIPRSSTISTIVESPTKASTTTETEATDGKKVLLPPPSKDAQKLPHA
                     TKRPRPTSYHPSSMSSTLIHNNQNPTDVLKIPSPINFPMTQFISTSPPKSNGSLNDSG
                     SFNNCSPKATSRRNSVVTHVHVNGVLSKENLIHSSSSPDNKRNSVLSYLEDKIDTLEL
                     TESHSPSKLTFEEIVDAAIATPEINQVPVFDSQTSPNGIGLDIKTKEFDETRLVEEKK
                     SKETVSDSKSEESTKDTQPEENVVIYEPIVPVEEYIKKPEHVNTIEAEQPEEVKIEDK
                     DLQNQKPPQQQAEGKHSPELGKSKIDLKKSVSQKKKVKEESIKKQKDVDSKPIERRHT
                     IAARRHHNDENKENKDVKKRNRFSLLSFYSSYNSSNSNISLATSKVPSNSENNTTNNA
                     VLKPTNINTTRKVLEPSNETNIIRKESKQSNSNGSTTSKSTTSSSSSSSAPTASSTSS
                     SSKRASTATKETSAARKVMDFFKRRSVRVG"
     gene            complement(<481419..>484133)
                     /locus_tag="CD36_27190"
                     /db_xref="GeneID:8049615"
     mRNA            complement(<481419..>484133)
                     /locus_tag="CD36_27190"
                     /product="oligopeptide transporter, putative"
                     /transcript_id="XM_002421751.1"
                     /db_xref="GeneID:8049615"
     CDS             complement(481419..484133)
                     /locus_tag="CD36_27190"
                     /inference="similar to AA sequence:UniProt:Q06593"
                     /inference="similar to AA sequence:UniProt:Q59UZ1"
                     /note="Similar to S. cerevisiae OPT2"
                     /codon_start=1
                     /transl_table=12
                     /product="oligopeptide transporter, putative"
                     /protein_id="XP_002421796.1"
                     /db_xref="GeneID:8049615"
                     /db_xref="GOA:B9WL35"
                     /db_xref="InterPro:IPR004648"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:B9WL35"
                     /translation="MDEKNPTELSVPNIEAVGSHLQVQDHEIDLQAITSNPLSIGQVA
                     TTLTESQKWFVLKRLHFDALVSLEELPPQASFIFEKIEQMTTEEAVEILEKNIKEHET
                     DVNIPENDLILWKELVERSHKFTKVQLQEKLGNNSSSSLENERIGDVEQGHEIVDWDL
                     QVRLEAVLVAYWSPYPEVRAVTFPYDDPTIPAETFRVYLIAIIWTAIGAVINQFFAER
                     RPAISLSMAVVQVFLYPSGILCQWILPNWEFQIWKLTINLNPGPYTYKEQMLATIFCG
                     VTGGGTSYVSSNILMQKSEIFYDNKWVDFGYQVLLILSTNFLGVGLAGIMRKFAVYPT
                     KAVWPSILPGLALNKTLLTPAKKEIINGWKISGYNFFFIAFVASFLYFWIPDYLFQAL
                     STFNWMTWIKPDNQNLAVITGSVGGLGLNPITTFDWNYFSSMLQPLQVPFFYPVNNII
                     GMAIAFFCIIGVWYSNYKWTGYLPINDNGLYTNTGEPYSVRSVVDTNSLFDKKKYAEM
                     GPPFYTAANLVVYGAFFAIYPFHFVYELGMNYDQMWDACKSFWRVIKDYKKSTYDGFD
                     DPHSTMMKAYPEVPEWAYLIIVVISLVLAILCVKVYPAETPVWGIFFALGINFIFLIP
                     LTTIYARTGFAFGLNVLVELIVGYAIPGNGLALAFIKALGYNIDGQAQNFVNDLKQGH
                     YAKLPPRAVYRVQLLSIFISSFIQLGILNFQINGGIKDYCEPGNTQKFTCPNSRTFYS
                     ASVLWGVIGPKRVFNGLYPILRWCFLIGFLIAFPCIAIKKWGPRKYVKYFEPSIIIGG
                     FLNYAPYNLSYYIPGLYVSYAFMSYIKRKYEAWWQKYTYVLSTGLNAGIAFSSIIIFF
                     AVMYHEKDINWWGNTVSYSGVDYGMTGWLNATVDAPDGYFGPRVGHFP"
     gene            485364..485548
                     /locus_tag="CD36_27195"
                     /pseudo
                     /db_xref="GeneID:8049616"
     misc_feature    485364..485548
                     /locus_tag="CD36_27195"
                     /inference="similar to AA sequence:UniProt:Q59UZ3"
                     /pseudo
                     /db_xref="GeneID:8049616"
     gene            complement(<487240..>489948)
                     /locus_tag="CD36_27200"
                     /db_xref="GeneID:8049617"
     mRNA            complement(<487240..>489948)
                     /locus_tag="CD36_27200"
                     /product="oligopeptide transporter, putative"
                     /transcript_id="XM_002421752.1"
                     /db_xref="GeneID:8049617"
     CDS             complement(487240..489948)
                     /locus_tag="CD36_27200"
                     /inference="similar to AA sequence:UniProt:Q06593"
                     /inference="similar to AA sequence:UniProt:Q59UZ4"
                     /note="Similar to S. cerevisiae OPT2"
                     /codon_start=1
                     /transl_table=12
                     /product="oligopeptide transporter, putative"
                     /protein_id="XP_002421797.1"
                     /db_xref="GeneID:8049617"
                     /db_xref="GOA:B9WL36"
                     /db_xref="InterPro:IPR004648"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:B9WL36"
                     /translation="MTEKDLAGQPTIQSIGSHLQVQDHEVNLQAIISNPLSIGEVATT
                     LTESQKWFVLKRLHFDALVSLEELPPQASFIFEKIEQMNTKEAVEILQKAIEEHSTDV
                     NIPELDLDLWRELVDNSHKFTKVQLQEKLGNNSSSSVEGEKTADVEQGHEIVDWDLQV
                     RLEAVLVAYWSPYPEVRAVTFPYDDPTIPVETFRVYLIGIVWTAIGAVINQFFTERRP
                     SITLAMSVVQVFLYPSGLLCEWVLPKWKFKIWKLSIDLNPGPYTYKEQMLATIFCGVT
                     GGGTSYVAWNILMQKSPVFYDNKWVDFGYQVLLILSTNFLGVGLAGIMRKFAVYPTKA
                     VWPSILPGLALNKTLMTPARKEIINGWKISSYNFFFITFVASFLYFWIPDYLFQALST
                     FNWMTWIKPDNQNLAVVTGSVGGLGLNPIATFDWNYFSSMLQPLQVPFFNPVNNIIGM
                     AIAFFCIIGVWYSNYKWTGYLPINDNGLYSNTGEPYSVRSVVDANSLFDQAKYDEIGP
                     PFYTAANLVVYGAFFAIYPFHFVYEIGMNYDQMWDACKSFWRVIKDFKKSTYDGFDDP
                     HSTMMKAYPEVPEWAYLIIVVISLVLAILCVKVYPAETPVWGIFFALGINFVFLIPLT
                     TIYARTGFAFGLNVLVELIVGYAIPGNGLALAFIKALGYNIDGQAQNFVNDLKQGHYA
                     KLPPRAVYRVQLLSIFIASFIQLGILNFQVNGGIKDYCDPKNTQRFTCPNGRTFYSAS
                     VLWGVIGPKKVFNGLYPILRWCFLIGFLIAFPCIAIKKWGPRKYVKYFEPSIIIGGFL
                     NYAPYNLSYYIPGLYVSYAFMSYIKRKYEAWWQKYNYILSTGLNAGIAFSSIIIFFAV
                     MYHAKDINWWGNNVMYEGMDGSMTGWLNATVDAPDGYFGPRVGHFP"
     gene            complement(<492097..>494337)
                     /locus_tag="CD36_27210"
                     /db_xref="GeneID:8049618"
     mRNA            complement(<492097..>494337)
                     /locus_tag="CD36_27210"
                     /product="protein kinase, putative"
                     /transcript_id="XM_002421753.1"
                     /db_xref="GeneID:8049618"
     CDS             complement(492097..494337)
                     /locus_tag="CD36_27210"
                     /inference="similar to AA sequence:UniProt:Q4WTE1"
                     /inference="similar to AA sequence:UniProt:Q59UZ6"
                     /codon_start=1
                     /transl_table=12
                     /product="protein kinase, putative"
                     /protein_id="XP_002421798.1"
                     /db_xref="GeneID:8049618"
                     /db_xref="GOA:B9WL37"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B9WL37"
                     /translation="MEFFTKTLSSFTGGSIPYKLKVKVVDPLAPTTSLDRNSIWTLHD
                     GINPKDNSPVSVFEFNLKDPANQQRIGLARNSFKKLKLIKFPGVISIIDFIENDYSLY
                     IITEPVKPLSIYLEQTGLKGDTLVAGIYSVAQSISFINEAANSLYGGLNYFSSVFVTL
                     AGDWKLMGFELLTNLTSDPDQPIYRLAGYMPISWKEYSNDLDSETIRKDPKKFDSYRF
                     GSFIMTVFNNGVIDTNYSKLPPKMAASVKRLLSQKPNLRSTVTMYLKDLESWHKQNSV
                     IKFTEQVNELKFLQESEKIAFFKHELPEYIKDDSSFPPGLLSYKLLPELINQYKQLSK
                     SPTTDPGRQETLSTILDLTIKFGTKLDTDEFNKTIKPIIIDSFALADRSIRLVLLTHL
                     PDYQHFLTETDIQYKIFNQLITGFQDTNFMIRETTLKSITIIIDKISVKQVNQELLRI
                     LAKSQMDPKPSIRVNTVILIIKISSKIYKSSKNNVLITALSKSLRDTFIPCKMTALQG
                     FESLIDEFSLEEICSKILGHLAISLMDRKSSKVRKEAKRIFQLYLDSVESHANSLPEG
                     DDDEDEEEREFFKKFSPANVPSTNTDTDGVASTTNTNNNTASSFGWGMVSKFTSLGGE
                     MNKDFNRSTPDITRATSPTLATGDSVATTKIDDNGWDDFNDEWVNDEPDVVDEPDVII
                     EPTRKINLGKSTDTTTPKKLSSKPTPRKTTSLKLGSKATKPKQTLQLNLKVDDDGNDD
                     NWGDGW"
     gene            complement(<494753..>495772)
                     /locus_tag="CD36_27230"
                     /db_xref="GeneID:8049619"
     mRNA            complement(<494753..>495772)
                     /locus_tag="CD36_27230"
                     /product="leucine rich repeat protein, putative"
                     /transcript_id="XM_002421754.1"
                     /db_xref="GeneID:8049619"
     CDS             complement(494753..495772)
                     /locus_tag="CD36_27230"
                     /inference="similar to AA sequence:UniProt:Q59UZ7"
                     /note="possibly Candida-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="leucine rich repeat protein, putative"
                     /protein_id="XP_002421799.1"
                     /db_xref="GeneID:8049619"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:B9WL38"
                     /translation="MLSVLCLPDEIVLKIFKHLPPQECIEIITNIQDIHIAKPFVDKL
                     YQRLLSGKLLITNDEPHQQFPSDYQLTLEKFQNKFQDTSVEGLIFQSIRPNYMEFNFT
                     RQHGDYMNFIYNLKQFHELLRDPNCQDYFRKVLQVNMYLDANLVLIENPDNLTAIVIK
                     SVLELSNHPELAGKVRHLTIKAGDIGNMCVPQWSLLLPKFTSLVSLNMSQNLLKSNYG
                     QYLDVWGRQKKFPNGLKLLNLDYNMLTYVSKHFLSCLPDSLEELLMNQNDIVLIEKCD
                     LRLLLPNLRRWELNYTKLNVINPEMIISCKAGFTLELISTYLPQPDIKELQRIAKEKS
                     LHIIV"
     gene            complement(<495937..>496665)
                     /locus_tag="CD36_27240"
                     /db_xref="GeneID:8049620"
     mRNA            complement(<495937..>496665)
                     /locus_tag="CD36_27240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421755.1"
                     /db_xref="GeneID:8049620"
     CDS             complement(495937..496665)
                     /locus_tag="CD36_27240"
                     /inference="similar to AA sequence:UniProt:Q59UZ8"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421800.1"
                     /db_xref="GeneID:8049620"
                     /db_xref="UniProtKB/TrEMBL:B9WL39"
                     /translation="MHMTKNSKKHSRSDDDEDDNLRDHSGKRVKLDSLLKNLSLEDQE
                     NENRYIINPKITYENIFSKSGSRYSTLTESQLASNLNEKLTRSFKNSLESGLRLILWY
                     NAKFLIMYRYQKWFVKLFNRFIKKYNEKNRVSISTFHSFTEIMKLVRDRLITLKDLAN
                     IIDQENQLEIKRLELKQEMRRSEKRFEEVTAEQDAYQDLKYNYWDNLKFDKDLDMLDV
                     SDCEPDNSKFEELDNDDTVMEQDL"
     gene            <497853..>498653
                     /locus_tag="CD36_27260"
                     /db_xref="GeneID:8049621"
     mRNA            <497853..>498653
                     /locus_tag="CD36_27260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421756.1"
                     /db_xref="GeneID:8049621"
     CDS             497853..498653
                     /locus_tag="CD36_27260"
                     /inference="similar to AA sequence:UniProt:Q59V37"
                     /note="possibly fungus-conserved"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421801.1"
                     /db_xref="GeneID:8049621"
                     /db_xref="UniProtKB/TrEMBL:B9WL40"
                     /translation="MRVSTLVLSTSIIPIATALNISPFHANQKKDILADAASAAGGAA
                     AVVTSGAAGAANTATSAVAGAADAAASGAAGAGKTATSGAAGAADTAASGAAGAGKTA
                     TSGAAGAADTAASGAAGAASGVETADVGQETSGAGSLGGGSSSSNSTSPVGGSGASNS
                     TSPSGGSGASNGTSSGSGSGVGAGSGSGSDSGSGSGSGSRGSITGNSIATGASSGPEG
                     LGISSSISQSTTKQLQTSGGSSNSSSSAGMGNVVVGMNAVALAALVLI"
     gene            <499055..>499552
                     /locus_tag="CD36_27270"
                     /db_xref="GeneID:8049622"
     mRNA            <499055..>499552
                     /locus_tag="CD36_27270"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421757.1"
                     /db_xref="GeneID:8049622"
     CDS             499055..499552
                     /locus_tag="CD36_27270"
                     /inference="similar to AA sequence:UniProt:Q59V02"
                     /note="possibly Candida-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421802.1"
                     /db_xref="GeneID:8049622"
                     /db_xref="UniProtKB/TrEMBL:B9WL41"
                     /translation="MKYSILTWLVIASYTVLAQDGTTATGYTTTIVIPGSPPGGTATQ
                     NGGTENTGTVHTTEHLTTGTEETHTTGTTPETTTIVVPTTTFENTTTHETSAENTTTV
                     HHNTTTIHPNATGTGTETETETRTGTLTGTGTEGPALTTTTVAEAFSLAAGASLGYLV
                     ALLFL"
     gene            complement(<499800..>502181)
                     /locus_tag="CD36_27280"
                     /db_xref="GeneID:8049623"
     mRNA            complement(<499800..>502181)
                     /locus_tag="CD36_27280"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421758.1"
                     /db_xref="GeneID:8049623"
     CDS             complement(499800..502181)
                     /locus_tag="CD36_27280"
                     /inference="similar to AA sequence:UniProt:Q59V03"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421803.1"
                     /db_xref="GeneID:8049623"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="UniProtKB/TrEMBL:B9WL42"
                     /translation="MDPSYPLLSRLEEDVKTNLILHPQISSFVQLFLRYLKEPRYQAP
                     LTITELSNLFKKFYQDLNVLTICIFTQSNSTKKQLISHCDYFNENPKVFDYLLAIANY
                     STSSIRLLKRSDNDALYQLRVFNYYKLLTIFESIHLAELELFQSVSLGDDICLYDKIF
                     RFDQKDTIYQEFLQEKLNCLRQLNLSFKHFIDQDLGNQDKLVNIIDNLNKQELISLQE
                     DLTSLNTEITPYAKLKKIVSLHKNLIKLFAQKGFENKEINNDLLLPALIYLLVYKLET
                     KDLYLSFLFIRNFLNLIDSSPIELYQINLYLSYNPAQERAPLSSSKYKKSDILGYLNL
                     SNSQDLPQEQSHIVSDEFKFFTNDKDLISYINQKFLNTGELNYYLTNFEAMIVYLSNM
                     TITELLSNSETEISSDLRNSSVLNHPIDKLVDEELLTHFQFPDGELANEMKANENRIK
                     EEETGRSRSSSLLNTISNKINETRSRSSSLRKEKFPSLPTPTEELEENSGFAMMRNIL
                     GRFSSASGTTEGVYDEEENDSPQSNLKKTNSFISKVSPIHSRTRSSSLENATANPGHY
                     KRNSITAKFTSGVSEFMTKLNQPAIPSHLHQDNNVSNVSLQSIEDGDSDATMNKRPTA
                     GRNRTTSIQILDKWFGNLSPSQTNSQPLTAQQAEAIPAPTISSVQPAIPSKSKPEVLS
                     EELIVDIEQLTKFHNSNFESLSISDLRELKNYYDQLCQDLLSNGNHESNGKIYVNSRN
                     NSIDKVESHANSLDKFIGKETTEAGDLNSKAESVESGDMFGTATIITSSNNSL"
     gene            complement(503026..503099)
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CD36_tRNA_0091"
                     /db_xref="GeneID:8049624"
     tRNA            complement(503026..503099)
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CD36_tRNA_0091"
                     /product="tRNA-Val"
                     /anticodon=(pos:complement(503063..503065),aa:Val,seq:aac)
                     /db_xref="GeneID:8049624"
     gene            complement(<504054..>505178)
                     /locus_tag="CD36_27290"
                     /db_xref="GeneID:8050197"
     mRNA            complement(<504054..>505178)
                     /locus_tag="CD36_27290"
                     /product="karyogamy protein kar4 homologue, putative"
                     /transcript_id="XM_002421759.1"
                     /db_xref="GeneID:8050197"
     CDS             complement(504054..505178)
                     /locus_tag="CD36_27290"
                     /inference="similar to AA sequence:UniProt:P25583"
                     /inference="similar to AA sequence:UniProt:Q59V40"
                     /note="Similar to S. cerevisiae KAR4"
                     /codon_start=1
                     /transl_table=12
                     /product="karyogamy protein kar4 homologue, putative"
                     /protein_id="XP_002421804.1"
                     /db_xref="GeneID:8050197"
                     /db_xref="GOA:B9WL43"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="UniProtKB/TrEMBL:B9WL43"
                     /translation="MYTYNKFGSRASSSTSSTNNTISSSTYATQASSRTTESNEKSNL
                     VKVTKETVDYCNHYVHTGEPGVKLIRNVKNPLEGYPKLAKLHHLKRLQIKKHTSQAYG
                     ARCTTGEIVPTLNRWIENYNIRFDVIMIGALAENQFILPILNSIPIHQLCSKPGFLFI
                     WATTQKIQELTRLLNNDNFNKRFRRSEELIFLPIDDKSPYYPHNSGATEVIPLFERQQ
                     WHCWMCITGTVRRSTDNHLIHCNIDTDLQIESPNDKTRQKSTYNAVPEAIYRVAENFS
                     NSNRRLHLVPSKLGYSTPIRLRAGWVIMGPDVLINNFDPVKYNEELYAKSMIKYKSNN
                     GIGANTNPNTTTTATTTQFLVPQTNEIEDLRPKSPIISAK"
     gene            <505881..>507392
                     /locus_tag="CD36_27300"
                     /db_xref="GeneID:8049625"
     mRNA            <505881..>507392
                     /locus_tag="CD36_27300"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421760.1"
                     /db_xref="GeneID:8049625"
     CDS             505881..507392
                     /locus_tag="CD36_27300"
                     /inference="similar to AA sequence:UniProt:Q59V41"
                     /note="possibly Candida-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421805.1"
                     /db_xref="GeneID:8049625"
                     /db_xref="UniProtKB/TrEMBL:B9WL44"
                     /translation="MIEIDVYMMLARIQTTDYNLFNQLTIYFKRLVNYTLQEDCVNYF
                     HQIGETLGYYLHGFTKYPSLVAFQLPYLNRLVANTIKICNKYPVILQFWLLPECNSSF
                     GNLFQSLPNNSRLPLYQIIKNFLIVDSPLDQTENVIELISLTKMSPCLDEWFSQNKDL
                     AYLLSNKCSTIIVQMENLDPRFHNVTEFAKYFKMFCLIVENCTPTIAHSYYKIFETQI
                     LNVVLSNKTGHNQFVFSVLQTIADITTTNKTILRVFDNEYFTNWIRFIFEERENLRNL
                     FILLNALFSKHEDILVKLVTTKSKPEDEAYSIEELRLKAMKICKGGTTAISSFMVTTL
                     KYQFKDMEMYSINTSAPIIKGYLQVLPEYFQNTPAMNEALNTISSILMLKLNFLDSKY
                     TQIVIEFLFESYFNLRLLLEDYMLYRFDSIELKNHQIYQDCFKQYHKSSEPQLNDDNT
                     INNTLKDINYLMLEQNLQLFETFTIQLYVYCKLKHIAHNWAMEIPDYSVLLLR"
     gene            complement(<507368..>510292)
                     /locus_tag="CD36_27310"
                     /db_xref="GeneID:8049626"
     mRNA            complement(<507368..>510292)
                     /locus_tag="CD36_27310"
                     /product="voltage-gated chloride channel, putative"
                     /transcript_id="XM_002421761.1"
                     /db_xref="GeneID:8049626"
     CDS             complement(507368..510292)
                     /locus_tag="CD36_27310"
                     /inference="similar to AA sequence:UniProt:Q59V42"
                     /inference="similar to AA sequence:UniProt:Q790S0"
                     /note="Similar to Mus musculus Clcn3"
                     /codon_start=1
                     /transl_table=12
                     /product="voltage-gated chloride channel, putative"
                     /protein_id="XP_002421806.1"
                     /db_xref="GeneID:8049626"
                     /db_xref="GOA:B9WL45"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:B9WL45"
                     /translation="MSSDQSTSNHLNQNSKTRLQNPNLTFAPDIKHPPHSSFIKDQTN
                     TIRTVPNSPYFDSCSSPPSSNAFTSGSRPLTKVKSLGKIDIRSPIPINSVLQTPRIPT
                     LDQLQDETYSLRTTQTNESMRSRFFGKVHDTFISIRIFYNDFTTIDWTKAYLKGNQFN
                     FSIEKKQWVGDDCINDGQAIPFFHRAYYTLGKWFLILIIAFFFSIIAFCIDKVEILLV
                     GFKHGYCRTNWFASQISCCIDNSKKLNVFKSGYVTDDTCDDWVSWNKFFHEHWLNAVR
                     FDFIIYVVLTILLAIFACLITLSTKITGGSIPEDQSNLGKETPVDNENTTNQGRSVLV
                     KPRVIYTATGSGVPEVKTILSGFVIRRFLGTYTLIAKTVALVFAIASGMSLGKEGPYV
                     HLATCVGNITSRFFPFIYENDFFEKQILSASASAGVALAFGSPLGGVLFILEEINNYL
                     PSNQLFQIFFCAIISTLFLKFLNPYGTGKTVLFELEYFSDWSPIELIFFVVIGIMGGV
                     FGASFIKFSQWWAKKFRSSKHIKTHPIFEVFLVAAVTGIISFWNPYTKQASAELVLDL
                     ATPCSGGELDRSLCPQTEKQLINELTSLLFAFVVKVLLTFITFGLKLPCGIYVPSMVC
                     GALFGRIFALFIRWLEFLSRKSSSSSSSSLSLFAQPAPPLKFGLLCSSAGPHCVDMGI
                     YAMISAGAFMAGVTRMNITLVTILFELTSSYTYVLPISIAIAVANWSGGLLEKNSLYE
                     SLLISNDYPFMAPETEPIDPYVSAGEIINQDSVPTTRISRHIPPDRQLYIDVSDSGYV
                     PVSTLESKLQMLADRCLLDGCIALIKNQLCVGLLFFSELEICLDQIRAFTLKHDVKDE
                     LYCNLFDDGDDKSLSNSRATHNDKVVKNILNQSLDYFNYGAINEDEYLEMKASIDLLT
                     NLTNFVDRVPMFINYDTELCFAHLIFDRIGNRVIVLIKDGKYYGVLHKKVLIDYLRRR
                     TE"
     gene            <512710..>513948
                     /locus_tag="CD36_27320"
                     /db_xref="GeneID:8049627"
     mRNA            <512710..>513948
                     /locus_tag="CD36_27320"
                     /product="isocitrate dehydrogenase, putative"
                     /transcript_id="XM_002421762.1"
                     /db_xref="GeneID:8049627"
     CDS             512710..513948
                     /locus_tag="CD36_27320"
                     /EC_number="1.1.1.42"
                     /inference="similar to AA sequence:UniProt:P41939"
                     /inference="similar to AA sequence:UniProt:Q59V07"
                     /note="Similar to S. cerevisiae IDP2; oxalosuccinate
                     decarboxylase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="isocitrate dehydrogenase, putative"
                     /protein_id="XP_002421807.1"
                     /db_xref="GeneID:8049627"
                     /db_xref="GOA:B9WL46"
                     /db_xref="InterPro:IPR004790"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:B9WL46"
                     /translation="MGEIQKIKVKNPIVEMDGDEMTRIIWQFIKDKLISPYLDVDLKY
                     YDLGIEYRDQTDDKVTTDAANAILKYGVGVKCATITPDEARVKEFNLKKMWLSPNGTL
                     RNILGGTVFREPIVIDNIPRIVPSWEKPIIIGRHAFGDQYKATDIIVPGAGELKLVFK
                     PKDGGEVQEYPVYNFEGPGVGLSMYNTDASIQDFAESSFQLAIERKLNLFSSTKNTIL
                     KKYDGRFKDIFEGLYASKYKTKMDELGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDG
                     DVQSDIVAQGFGSLGLMTSVLVTPDGKAFESEAAHGTVTRHYRQHQQGKETSTNSIAS
                     IYAWTRGLIQRGKLDETPEVVKFAQDLEQAIIDTVGKDNIMTKDLALTQGKTDRSSYV
                     TTEEFIDAVANRLNKNLGYA"
     gene            <514753..>515679
                     /locus_tag="CD36_27330"
                     /db_xref="GeneID:8049628"
     mRNA            <514753..>515679
                     /locus_tag="CD36_27330"
                     /product="C-4 methylsterol oxidase, putative"
                     /transcript_id="XM_002421763.1"
                     /db_xref="GeneID:8049628"
     CDS             514753..515679
                     /locus_tag="CD36_27330"
                     /EC_number="1.14.13.72"
                     /inference="similar to AA sequence:UniProt:O59933"
                     /inference="similar to AA sequence:UniProt:P53045"
                     /note="methylsterol monooxygenase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="C-4 methylsterol oxidase, putative"
                     /protein_id="XP_002421808.1"
                     /db_xref="GeneID:8049628"
                     /db_xref="GOA:B9WL47"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:B9WL47"
                     /translation="MSSISNVYHDYSSFSNATTFSQVYQNFNQLDNLNVLEKLWGSYY
                     YYMANDLFATGLLFFLTHEIFYFGRCLPWAIIDRIPYFRKWKIQDEKIPSDKEQWECL
                     KSVLTSHFLVEAFPIWFFHPLCQRIGISYQVPFPKITDMLIQWAVFFVLEDTWHYWFH
                     RGLHYGVFYKYIHKQHHRYAAPFGLAAEYAHPVEVALLGLGTVGIPIVWCLITGNLHL
                     FTVSIWIILRLFQAVDSHSGYEFPWSLHNFLPFWAGADHHDEHHHYFIGGYSSSFRWW
                     DFILDTEAGPKAKKGREDKANQTAERIQKKNL"
     gene            complement(<515873..>516280)
                     /locus_tag="CD36_27340"
                     /db_xref="GeneID:8049629"
     mRNA            complement(<515873..>516280)
                     /locus_tag="CD36_27340"
                     /product="killer toxin resistance protein precursor,
                     putative"
                     /transcript_id="XM_002421764.1"
                     /db_xref="GeneID:8049629"
     CDS             complement(515873..516280)
                     /locus_tag="CD36_27340"
                     /inference="similar to AA sequence:UniProt:P40540"
                     /inference="similar to AA sequence:UniProt:Q59V10"
                     /note="Similar to S. cerevisiae KRE27;
                     Protein similar to S. cerevisiae Kre27p, which has a role
                     in resistance to killer toxin; predicted Kex2p substrate"
                     /codon_start=1
                     /transl_table=12
                     /product="killer toxin resistance protein precursor,
                     putative"
                     /protein_id="XP_002421809.1"
                     /db_xref="GeneID:8049629"
                     /db_xref="InterPro:IPR018937"
                     /db_xref="UniProtKB/TrEMBL:B9WL48"
                     /translation="MSSSTHQYILYFVGTLILIHSGYSSFEFHKISTHYHTDYRLPPL
                     DIILESVIGIILLLIGSIVSIQNQPFLSINKDTHNKIIKNDSKYLKFIEMKDAVQLSE
                     KVGITDYEEYTSRACFIDINQKRKEYNDWLEKE"
     gene            <517071..>519701
                     /locus_tag="CD36_27350"
                     /db_xref="GeneID:8049630"
     mRNA            <517071..>519701
                     /locus_tag="CD36_27350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421765.1"
                     /db_xref="GeneID:8049630"
     CDS             517071..519701
                     /locus_tag="CD36_27350"
                     /inference="similar to AA sequence:UniProt:Q59V49"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421810.1"
                     /db_xref="GeneID:8049630"
                     /db_xref="GOA:B9WL49"
                     /db_xref="InterPro:IPR026241"
                     /db_xref="UniProtKB/TrEMBL:B9WL49"
                     /translation="MDHSSVSSEVVEKKSGSISDNGTTNDENASKPKVQQTSTHYDPK
                     LITSLDCKILQYQYNIYKLQKSISHIRKLQTECQSSPNLPLLHYIVLLVGCTFSINDK
                     AFDAKLDILSNFHLFRNTTINITAATSHIPYDTPDLPITPLNDIPEVSTSIKCLKQLE
                     SLCNTCLQGYKKKLEQAKVEKSNEVGNIDTIDAYYSTIEKIISSVIFNNDIDLVFSDS
                     TFTLPIDNVELMANENFQEATLIDMDIKELFIIVKQIERSLNFLKSTIVKLKQPQCAD
                     PYALHKIFLITQRLNDIYTIVRRYGRKIYLSNYQHLTDSKFLFHCKNPQFFKNNILKD
                     MNDFFNSMKKNGTLIANLTRFVRQDSRFETNSKNITNNMNFTNQGLLTVETTLTKLKE
                     FGMSWIVSELKFRRVYQLPKKNLFDIYQSVPDFKQRTNAAASITGPNTSSATATTSAN
                     KSKTENSTPNGGQPVKKTLDKSETNNEGTKSRSRSSSVSSITSNGSSSGLMRRGSISS
                     PAKPSPLSLSQNGRNSPRTSRPNSMLFLNPNSSTSNLESDPEKKSSAPLSPSTGAGTI
                     ARRRSNSQPIGRDAIIATSGAATALSRNSSLSSHTSPLRSPSTNNNMTAVPTEKASSP
                     TPSKITQKLLMVQEEETPSLAQKSASAATKLSASQRFQQRVREAAKNGDLVTQKKETF
                     TSVTFDPNDTSKLSIRKYSDIPTSPDIEAESKEEEPEKEKVAVAPQRRTRDQVTRHNT
                     QRNSHIPIPKNTDTKSSSSSIDQSSGSNNSTGSVSNSTSTTTTTTATISKKVRFTGVP
                     EWTEAEDAPTKYSHAILRNFAVFRHPIKTAKAHNSKSDQLLHEESISFKTSTVVVNDN
                     EVTIAPKPKSGFSRIKSRLI"
     gene            <520674..>522062
                     /locus_tag="CD36_27360"
                     /db_xref="GeneID:8049631"
     mRNA            <520674..>522062
                     /locus_tag="CD36_27360"
                     /product="constitutive acid phosphatase precursor,
                     putative"
                     /transcript_id="XM_002421766.1"
                     /db_xref="GeneID:8049631"
     CDS             520674..522062
                     /locus_tag="CD36_27360"
                     /EC_number="3.1.3.2"
                     /inference="similar to AA sequence:UniProt:P24031"
                     /inference="similar to AA sequence:UniProt:Q59V50"
                     /note="Similar to S. cerevisiae PHO3"
                     /codon_start=1
                     /transl_table=12
                     /product="constitutive acid phosphatase precursor,
                     putative"
                     /protein_id="XP_002421811.1"
                     /db_xref="GeneID:8049631"
                     /db_xref="GOA:B9WL50"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR016274"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:B9WL50"
                     /translation="MVSVSKLINNGLLLAGQSVFQDVATPQQASVQQYNIINFLGGSA
                     PYIQRNGYGISPDIPAGCEISQIQLYSRHGERFPTESSGKDYEKIYAKFENYNGTFKG
                     DLAFLNDYTFFVTDKSNYAKETSPKNSEGTYAGTSNALRHGAAFRAKYGSLYKENSTL
                     PVFTSNSNRVHETSKYFARGFLGDDYEEGKTVKFNIISEDADLGANSLTPRSACSKYD
                     KSANKNIIKKYDTSYLDTIVKRLVKPNPGLNLTTSDVDNLFSWCAYEINVRGSSPFCD
                     LFTNEEFIKNSYGNDLSKYYANGAGNNYTRIIGSVILNSSLELLKDTKNSNQVWLSFA
                     HDTDLEIFHSALGLLEPAEDLPTSYIPFPNPYVHSSIVPQGARIYTEKLQCGNDAYVR
                     YIINDAVVPIPKCATGPGFSCKLDDFENFVKERIGDVDFVKQCGVNSTYPSELTFYWD
                     YKNVTYNAPLEL"
     gene            <522387..>523187
                     /locus_tag="CD36_27370"
                     /db_xref="GeneID:8049632"
     mRNA            <522387..>523187
                     /locus_tag="CD36_27370"
                     /product="rRNA-processing protein, putative"
                     /transcript_id="XM_002421767.1"
                     /db_xref="GeneID:8049632"
     CDS             522387..523187
                     /locus_tag="CD36_27370"
                     /inference="similar to AA sequence:UniProt:Q12339"
                     /inference="similar to AA sequence:UniProt:Q59V16"
                     /note="Similar to S. cerevisiae UTP23"
                     /codon_start=1
                     /transl_table=12
                     /product="rRNA-processing protein, putative"
                     /protein_id="XP_002421812.1"
                     /db_xref="GeneID:8049632"
                     /db_xref="GOA:B9WL51"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:B9WL51"
                     /translation="MRQKRAKAYKKQMSVYVHAFKFREPYQIIVDNELITTCQSASFD
                     INKGFTRTIQAENKPMITQCCIQALYDTKNQLAIDIAKSFERRKCNHREAIDPSQCIE
                     SIVNINGQNKHRYIVASQDLQLRKKLRKIPGVPLIYMNRSVMVMEPISDVSNQYNMNY
                     ESKKLTGGLNDIEAGKLDKQNEGEDKDESEVKRKKRKGPKEPNPLSVKKKKTGNTTTT
                     NTQHQKKKSNRRKRHSKSKVEDKEEQQEEKVKEATNNEDTQETTTPAE"
     gene            complement(<523282..>526200)
                     /locus_tag="CD36_27380"
                     /db_xref="GeneID:8049633"
     mRNA            complement(<523282..>526200)
                     /locus_tag="CD36_27380"
                     /product="ring finger protein, putative"
                     /transcript_id="XM_002421768.1"
                     /db_xref="GeneID:8049633"
     CDS             complement(523282..526200)
                     /locus_tag="CD36_27380"
                     /EC_number="6.3.2.-"
                     /inference="similar to AA sequence:UniProt:P53971"
                     /inference="similar to AA sequence:UniProt:Q12986"
                     /inference="similar to AA sequence:UniProt:Q59V55"
                     /note="transcription factor, putative; transcriptional
                     repressor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ring finger protein, putative"
                     /protein_id="XP_002421813.1"
                     /db_xref="GeneID:8049633"
                     /db_xref="GOA:B9WL52"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:B9WL52"
                     /translation="MESDVESHDRGSKLEESTSSKDKSETNIDESSQEQHQHHRHQIA
                     NEVTDTDELDDYHYEEEDDDDNLEVVADESLGTTILREIQDGTYVCLVCTGEINKDSQ
                     IWTCNECFRVYDLDCIQDWAIRGSSTNKTSKEWRCPSCNHATKVIPRVFTCWCGQQTN
                     PDHNVLMPFSCGNTCNYKYPDCIHNCLSICHPGKHPICGAMGPPMKCHCGKETKQLPC
                     LITPYNKGWHCDQDCNSILCDMGHKCIKGCHSGYCQLCMIIIKISCYCSSESKEIACH
                     EKKLMDCGDRIGGYSCGKMTRYYYQCKQHYELKSCQPPPSSLMICKYSPDVITTCYCG
                     KTKVDLHNRTKCTDPIPECSNICGKLLPCGCRCKFKCHEGDCECISIHEIKCACGHES
                     YLAPCKFIQSGIKPKCNHKCSVLLNCRKHYHRLECCPDEQIGLARERDRKKAIRNNIR
                     SNFRQDVMSIEASHICTKTCNRLKPCGKHTCHALCHNGPCEVCLESTNEDLVCHCGKT
                     VIPAPVRCGTKLVCHEQCTRVPLCGHRPEPHECHDDSINCPKCTALVVRKCDCGATSD
                     IPGILCSQERVSCGKMCMVAKDCGHPCLRTCSSQCTKESIHNSSRNCQSYCKKIRNSC
                     PHLCKLKCHFNKVGKSSNCDVVACTSEITVHCECGRLEKKIKCGASVDQPSNIGTVLE
                     CDSSCVAAKRDAALRAAFIGTPEPETAEEDNMPYSDLVLSVFVKQRAWCSKIEAQIRQ
                     LIADYNSQIENGINSPRKSHHFPPMSSPQRQFIHELGKAFQAYTESQDDEPKRSVFLV
                     ITNSTTIPAMKIEEAVDYKRELESEKNKVQQLTQEQIDESLYNAIIIQDLFFGLVKDD
                     LDRELKPLYQDKMENYEIQWLKDSSFIFYSPEKFKNMDVEEENKLYLLLKSFRRVLRE
                     KSLAFDCKLCLIDDSATFVLKMDNSGTNNASQSESSSIQDVSETKKSQNGFDVLQTDD
                     "
     mobile_element  complement(527097..527489)
                     /mobile_element_type="retrotransposon:solo LTR, psi C,
                     truncated"
     gene            <528039..>530198
                     /locus_tag="CD36_27400"
                     /db_xref="GeneID:8049566"
     mRNA            <528039..>530198
                     /locus_tag="CD36_27400"
                     /product="cyclic nucleotide-binding domain protein,
                     putative"
                     /transcript_id="XM_002421769.1"
                     /db_xref="GeneID:8049566"
     CDS             528039..530198
                     /locus_tag="CD36_27400"
                     /inference="similar to AA sequence:UniProt:Q4WI41"
                     /inference="similar to AA sequence:UniProt:Q59V20"
                     /codon_start=1
                     /transl_table=12
                     /product="cyclic nucleotide-binding domain protein,
                     putative"
                     /protein_id="XP_002421814.1"
                     /db_xref="GeneID:8049566"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018488"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:B9WL53"
                     /translation="MSYKRKSYNPSPLSSPKSNASLRHDIAVTSSEYNNSDDYEVDDN
                     VPTIFLNQLATFPLFKNAPTNFHKQVAANLRLIHYRPQEFIIKKGDLSKSMYWILKGT
                     VSVTSTDGEEVYAELNQGEFFGEIGILYNRPRTATVIAKTRILLGVLTAESLNRVLKN
                     FPLIERRIRDEAQERLAMQDKKNKEPLSIQSFITNLPLFQFLPPDIIHKLALSVEPLV
                     FSPFEYILRKGDTCGDIYFIIEGEVEVLNQEGVIEIPLARLSRGSYFGEMSFLNYLQN
                     KPRVRTATIRSVTYCELMVIKSEYLEKLCDDYPAIIEDMKITAEERKIVKPAQGIFRP
                     NWSINPTRTIPPQKRQRENENIDYVPFTKRMRIASMKRRRSSTLAIVEPLPETILMKI
                     FGYLSLPDLMKLRRVNKRWRKLVTTTAPLDVLDLSQFGTTINNKALMAITDFAGSRPK
                     VIDISGCFHITDEGFSHMVNEIGIGGRLEVLRMASVWEVTGMAIMDLCFPGQKLEEID
                     LTNCRKVDDNVVQRLLQKCQLKVLNLSYCKGISDSVVPYFNNLESLDLTRCSGITDTG
                     LAQLPFSPSLRKLSLKQCSYLTDNAVYSIANAARNLEILDLNFCCGLTDGSISAIAMG
                     FPYLREIDLSFCGSAVSDSSVASLSVLHYLERVLVRGCVRLTRAGLDTLFGGPCPLNY
                     IDISQCRNAHVYPGNYPAPPFQSNLVRVSNKIIYIVV"
     gene            531522..531954
                     /locus_tag="CD36_27410"
                     /pseudo
                     /db_xref="GeneID:8049567"
     misc_feature    531522..531954
                     /locus_tag="CD36_27410"
                     /inference="similar to AA sequence:UniProt:Q59V21"
                     /pseudo
                     /db_xref="GeneID:8049567"
     gene            <532594..>535308
                     /gene="OPT4"
                     /locus_tag="CD36_27420"
                     /db_xref="GeneID:8049568"
     mRNA            <532594..>535308
                     /gene="OPT4"
                     /locus_tag="CD36_27420"
                     /product="oligopeptide transporter, putative"
                     /transcript_id="XM_002421770.1"
                     /db_xref="GeneID:8049568"
     CDS             532594..535308
                     /gene="OPT4"
                     /locus_tag="CD36_27420"
                     /inference="similar to AA sequence:UniProt:Q06593"
                     /inference="similar to AA sequence:UniProt:Q1KY75"
                     /codon_start=1
                     /transl_table=12
                     /product="oligopeptide transporter, putative"
                     /protein_id="XP_002421815.1"
                     /db_xref="GeneID:8049568"
                     /db_xref="GOA:B9WL54"
                     /db_xref="InterPro:IPR004648"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:B9WL54"
                     /translation="MNNKNAATQLNLPNVQSIGSHLSIQDHEIDLQAISSNPLSIGEV
                     ATTLTESQKWFVLKRVHFDALVSLEELPPQATFMFEKIEQMNTKEAVEILQKAIEEHS
                     TDVNIPELDLDLWRELVDNSHKFTKVQLQEKLGNNSSSSLENERIGDVEQGHEIVDWD
                     LQVRLEAVLVAYWSPYPEVRAVTFPYDDPTIPAETFRVYLIAIIWTAIGAVINQFFVE
                     RQPAITLAMAVVQVFLYPSGLLCEWFLPKWKFKIWKYTIDLNPGPYTYKEQMLATIFC
                     GVTGGSTSYVSSNILMQKSEIFYDNKWVDFGYQVLLILSTNFLGVGFAGIMRKFAVYP
                     TKAVWPSILPGLALNKTLLTPAKKEIINGWKISGYNFFFITFVASFLYFWVPNYLFQA
                     LSTFNWMTWIKPDNQNLAVITGSVGGLGLNPITTFDWNYFSSMLQPLQVPFFYPVNNI
                     IGMIIAFFCIIGVWYSNYKWTGYLPINDNGLYSNTGEAYSVRSVVDANSLFDQAKYDE
                     VGPPFYTAANLVVYGAFFAIYPFHFVYEIGMNYDQMWDACKSFWRVIKDYKKSTYDGF
                     DDPHSTMMKAYPEVPEWAYLIIVIISLVLAILCVKIYPAQTPVWGIFFALGINFIFLI
                     PLTTIYARTGFAFGLNVLVELIVGYAIPGNGLALAFIKALGYNIDAQAQNFVNDLKQG
                     HYAKLPPRAVYRVQLLSIFISSFIQLGILNFQINGIKDYCEPGNTQKFTCPNGRTFYS
                     ASVLWGVIGPKKVFNGLYPVLAWCFLIGFLLAFPCIAIKKWTPRKYVKYFEPSIIIGG
                     FLNYAPYNLSYYIPGLYVSYAFMSYIKRKYEAWWQKYTYVLSTGLNAGIAFSSIIIFF
                     AVMYHEKAINWWGNTVMYSGVDYAMTGWLNATVDAPDGYFGPRIRHFP"
     gene            <535741..>537204
                     /locus_tag="CD36_27430"
                     /db_xref="GeneID:8049702"
     mRNA            <535741..>537204
                     /locus_tag="CD36_27430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421771.1"
                     /db_xref="GeneID:8049702"
     CDS             535741..537204
                     /locus_tag="CD36_27430"
                     /inference="similar to AA sequence:UniProt:Q59KB7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421816.1"
                     /db_xref="GeneID:8049702"
                     /db_xref="InterPro:IPR021750"
                     /db_xref="UniProtKB/TrEMBL:B9WL55"
                     /translation="MSPHDIIEDKHKSFIHASPLDSTYPTPKNVPIISTAEIFKKSDP
                     NANFITPTKPSRSADSNEDSIGKNDIEHVNGNGNVRQVSDNSDRLSLKHDRVPSTAPT
                     TPKLNSIGQNKENLDFFHDYVKEISSLKAQNEVWKSKFENLNDCYQQELQQHEKQNIE
                     YGKLKEMYNKELEEKNQLKKEIQLMNSRIEILEYGEENLKLLVDKYKEIATQIKENNI
                     RSPSPLNNQDLEYTEELVNDLISFDNLNEEVKASTPPKKINHGVQTELKNFNVTAPST
                     KPNYTHISNKETQTSNNSSMKINKAVQTIQIQEKTSQPSEQISNPTIASPTEPTPTPT
                     SLPSSPPVTASKIDNQTFSKESQESSSVSVFPEFSLSSYSSKFHNYYKQLHLDQIDEL
                     SKRDLQYLIKTTMCQFMIDYYNIDTSLTRYARFLSIVYQFLNELHLIIYPGQILKSSD
                     YYRGRVYRDGKIDEEMIGLKECLNGMQDKIRETFGQL"
     gene            <540151..>543450
                     /locus_tag="CD36_27450"
                     /db_xref="GeneID:8049569"
     mRNA            <540151..>543450
                     /locus_tag="CD36_27450"
                     /product="transcription factor with zinc finger
                     DNA-binding motif, putative"
                     /transcript_id="XM_002421772.1"
                     /db_xref="GeneID:8049569"
     CDS             540151..543450
                     /locus_tag="CD36_27450"
                     /inference="similar to AA sequence:UniProt:P41696"
                     /inference="similar to AA sequence:UniProt:Q59LT8"
                     /codon_start=1
                     /transl_table=12
                     /product="transcription factor with zinc finger
                     DNA-binding motif, putative"
                     /protein_id="XP_002421817.1"
                     /db_xref="GeneID:8049569"
                     /db_xref="GOA:B9WL56"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:B9WL56"
                     /translation="MGKTAVSSSNQQQQQQQPQQQSREQLQQLQHQQLVQQHSNRLQQ
                     VEQPYQSLQFARLTRPPRINSPKTKDRTLSTLTQSANDDQKFLFSNLNNNSNNNSANT
                     YNNPQTSTYTLTSTKETNYPHQPSFSGPSLNNNFAYLNPTNNRTSIFTNSFLQQPQPQ
                     PQPQPQPQPQPQQTQVRNNNISPQDLNNKNNTMMHYQQQQHPQQPSQPQQPQQAQQQA
                     QQQSQQQSQQPHSLQQSFNPISTSNQQYQQYQQPSQLFNPQQSVQQYLQQPIRPRGDS
                     IVLPPPIRSSGEHLFENGTNSNPIPSTSRSNSIFSSLINLPGSSGNSISEPSLSNSGS
                     ASGKIDAPFNTTNGNKNNNGAPLLPPTTRSRQMSLVQSQDFTMEDLENFLNKESMSNI
                     FNWQNDPKLSISGGTGGSSGNGIKSKGNSIDFANWNEGNNNTGYNNSITELLQNMISN
                     GSIDFNSFSNMSNQQRRDSILKIINDQNSLRSQRSSSDQSRNTNASLREDIFDRRNPS
                     QSQQQSIEKTPQQQSASSSLSKQKTSPRQRKSPQQRQTLQQNQRGQVNALAVPGDKDN
                     VSPTSSSHTSPKFQEEPQSPKASPVAYGNVRVNEPFASSGYQQVQQQPISLSQQQQQQ
                     QQQQQQSRQQQQQQPQRLFQNYSVSPQNQYQYSAYPNYSQLGYSNVQQQLPNARNNSF
                     SNYIYPVQQQQQFYPPQQQQQYIPPTATTTKPPGYLPQQQLQQPQQQQQQQQKQLQSN
                     QQPSKTPEQQKRKPSVKRTRRTKRDQNSNSSSTTNLMNPQNMSSPESRNLVPAQQFAQ
                     SEDGRPLLGATKIDQLMLVIQARDKGITNTIEQGPDGSILASPDNFSLGRNKAELDSG
                     ILPRPVSLVGGVDKPHKREEDDNEEGDVNHHKRRKHKNQQCPYCFKFFTQSTHLEVHI
                     RSHIGYKPFECTYCHKKFTQGGNLRTHLRLHTGEKPFTCDICKRSFNRKGNLAAHKLT
                     HDNLKPFECKLDNCDKSFTQLGNLKSHQNRFHLDKLNELTHRLAELSGPALNNLPPEE
                     KDLLLYFKDLYKNSNKGIRGRGKAHKEDNNNNNNQGNSNGKQSSNVGQTSGSSLSPQF
                     TNGQSSGQFSG"
     gene            <543993..>544385
                     /locus_tag="CD36_27470"
                     /db_xref="GeneID:8049570"
     mRNA            <543993..>544385
                     /locus_tag="CD36_27470"
                     /product="DNA-directed RNA polymerase subunit, common to
                     RNA polymerases I and III, putative"
                     /transcript_id="XM_002421773.1"
                     /db_xref="GeneID:8049570"
     CDS             543993..544385
                     /locus_tag="CD36_27470"
                     /EC_number="2.7.7.6"
                     /inference="similar to AA sequence:UniProt:P28000"
                     /inference="similar to AA sequence:UniProt:Q59LT9"
                     /note="Similar to S. cerevisiae RPC19"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-directed RNA polymerase subunit, common to
                     RNA polymerases I and III, putative"
                     /protein_id="XP_002421818.1"
                     /db_xref="GeneID:8049570"
                     /db_xref="GOA:B9WL57"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:B9WL57"
                     /translation="MSAAVEDIPMEDTSNSEQEQEQEYDINKIKILPGASEDGTSASF
                     QIIDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENKLNIRIQTYGNISAVEALHQGL
                     DNLSELCSAIEDKFDEAVKAGGYSTKEP"
     gene            <544991..>547732
                     /locus_tag="CD36_27480"
                     /db_xref="GeneID:8049571"
     mRNA            join(<544991..546275,547344..>547732)
                     /locus_tag="CD36_27480"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_002421774.1"
                     /db_xref="GeneID:8049571"
     CDS             join(544991..546275,547344..547732)
                     /locus_tag="CD36_27480"
                     /EC_number="3.6.1.-"
                     /inference="similar to AA sequence:UniProt:P24783"
                     /inference="similar to AA sequence:UniProt:Q59LU0"
                     /note="Similar to S. cerevisiae DBP2;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_002421819.1"
                     /db_xref="GeneID:8049571"
                     /db_xref="GOA:B9WL58"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WL58"
                     /translation="MSYNNGGYNNRNGGSYGGGYGGGSSSRGGGYGGGGRGGRDQGGY
                     RGGRFSGGGGRFNDAPRQELTAPQWDLEQLPKFEKNFYSEHPDVAARSDRDIEAFRKE
                     NEMTVKGHDIPHPITTFDEAGFPDYVLQEVKDQGFPKPTAIQCQGWPMALSGRDMIGI
                     AATGSGKTLSYCLPSIVHINAQPQLQYGDGPIVLVLAPTRELAVQIQTECAKFGKSSR
                     IRNTCVYGGAPKGPQIRDLARGVEICIATPGRLIDMLEAGKTNLKRVTYLVLDEADRM
                     LDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVQQLARDYLNDPIQVTIGSLELAASH
                     TITQLVEVIDEFSKRDRLVKHLESALNERENKILVFASTKRTCDEITTYLRSDGWPAL
                     AIHGDKDQSERDWVLDEFRKGKTSIMVATDVAARGIDVKGITHVINYDMPGNIEDYVH
                     RIGRTGRGGASGTAISFFTDGNSKLGGDLCKIMREAHQTIPPELQRYDRRSYGSHMRF
                     GSGRGGRGGRGGYGGYGGGRGGGRGGRGGYGGHRTTGSNTAPLGGNRRY"
     gene            <548932..>551595
                     /locus_tag="CD36_27490"
                     /db_xref="GeneID:8049572"
     mRNA            <548932..>551595
                     /locus_tag="CD36_27490"
                     /product="phosphatidylethanolamine N-methyltransferase,
                     putative"
                     /transcript_id="XM_002421775.1"
                     /db_xref="GeneID:8049572"
     CDS             548932..551595
                     /locus_tag="CD36_27490"
                     /EC_number="2.1.1.17"
                     /inference="similar to AA sequence:UniProt:P05374"
                     /inference="similar to AA sequence:UniProt:Q59LV5"
                     /note="Similar to S. cerevisiae CHO2"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphatidylethanolamine N-methyltransferase,
                     putative"
                     /protein_id="XP_002421820.1"
                     /db_xref="GeneID:8049572"
                     /db_xref="GOA:B9WL59"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="InterPro:IPR016219"
                     /translation="MTSIINNTNSTVFDSTNNGNMAILEPVQPVSKGPKGITFSGQTF
                     VVPETHDMVKTLFDPTVRKSNFELIILGCLFSNLLVFLIPNNQIRIYIFIALYIFWRL
                     SYNFGIGWLLQNQSNHNLLVSWSQKYKLFEPGNTSFLAKSIQNEIKSQRGENYDIKSM
                     PVEFNTWLIFRKFVDLILMSDFITFCCVVYCSAIKNNYQFFNNQSSWLVYSRIVFGTG
                     LILFNLWVKVNAHNTIKDYAWYWGDFFFRQINNEELIFDGVFEMVPHPMYSVGYVGYY
                     GFALIAKSYVVLAIAIFGHFLQMIFLHYIENPHIDKIYGPSKNEINLIKILKLKDLKN
                     FDNLKPLVGLTNFNWMRASDIVNLVLSLTYGIIIPLFANSIKSLFILTVGMKLFESIS
                     INLLLTLQSYFKVVTKWSLSNDIPVEKSLSNWAVLYNSLINLTYSSLFGMNLGYFLQK
                     SSSSSSSSSSSGLLFSDWFYLRIFLGLLLVYTQFWINFSIIDSIGYFGWFYGDFFIPK
                     SQSSIKNITTAGVYRYLNNPEQIFGVCGVMGIFMIYPTVENFICVGLWVVNNFIRINF
                     IEKSHMVKLYGEQEVNRDSGVTKTVKKHLLPEVIQRRMSNDEAYARTNGISNGRRKSS
                     NNSHSNSVADSLDNFIRDLRNSSTKLSQQKLIELSQNLSFANSDYKLTIDGLMQSTEG
                     ELKYTTIGTPVTISWTSPEKNHSVRDWVGLYKIVQTSYSRNKTILSSAGRWTWCKEAN
                     GTFIFDREKLFWEEGVYEFRYHLDGKHEVAYISEPFEIKSVELDVPAIEEYANEFAEN
                     LKLEIFDKVINLTNINEAISPIANQSDNVIEVYKLISSMISKSTKINITYKIFLNHDL
                     LSIKDVAIKLINIKHVLEELSFNITTDKKDI"
     gene            complement(<551704..>552585)
                     /locus_tag="CD36_27500"
                     /db_xref="GeneID:8049573"
     mRNA            complement(<551704..>552585)
                     /locus_tag="CD36_27500"
                     /product="exosome complex exonuclease, putative"
                     /transcript_id="XM_002421776.1"
                     /db_xref="GeneID:8049573"
     CDS             complement(551704..552585)
                     /locus_tag="CD36_27500"
                     /EC_number="3.1.13.-"
                     /inference="similar to AA sequence:UniProt:P48240"
                     /inference="similar to AA sequence:UniProt:Q59LU3"
                     /note="Similar to S. cerevisiae MTR3; mRNA transport
                     regulator, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="exosome complex exonuclease, putative"
                     /protein_id="XP_002421821.1"
                     /db_xref="GeneID:8049573"
                     /db_xref="GOA:B9WL60"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:B9WL60"
                     /translation="MSDRRRLLGPSGMIIPNIPHQSPQPQPQPDTTTSTSIPSFFLKH
                     SIIDNANGSAYLEINNTIIEVSIFGPRPIRGSFIDRASVSIDCKFLPHIIPPMTNIFN
                     NDSNNNNNNNTISRGYRTGMNNIEHKLSSYLETCVLSSLILEKYPKSTIDIQVSIISI
                     DKNVGNGGNGGNGSLLWLLQWITCCCSIALIDSGIEMKDIISSGQVRITKQGEILIGG
                     SSSSNSINAEEGIDGLVSFMNLKNDEIVGIWLEGDNNDNENSLLNESNMEKLIIECNK
                     MSKIIRANLNSYLINSM"
     mobile_element  complement(552698..553421)
                     /mobile_element_type="LINE:RD, Zorro3-like, 5' truncated
                     in ORF2"
     gene            complement(<553791..>556790)
                     /locus_tag="CD36_27510"
                     /db_xref="GeneID:8049574"
     mRNA            complement(<553791..>556790)
                     /locus_tag="CD36_27510"
                     /product="transcriptional regulatory protein, putative"
                     /transcript_id="XM_002421777.1"
                     /db_xref="GeneID:8049574"
     CDS             complement(553791..556790)
                     /locus_tag="CD36_27510"
                     /inference="similar to AA sequence:UniProt:P40467"
                     /inference="similar to AA sequence:UniProt:Q59LU4"
                     /note="Similar to S. cerevisiae ASG1;
                     In S. cerevisiae: putative transcriptional activator of
                     the Gal4p family of zinc cluster proteins;
                     possibly fungus-specific; zinc finger-containing
                     transcription factor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="transcriptional regulatory protein, putative"
                     /protein_id="XP_002421822.1"
                     /db_xref="GeneID:8049574"
                     /db_xref="GOA:B9WL61"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:B9WL61"
                     /translation="MVKREPEDTQSPYSSTGIVSTGGSPKTSTSTPTSSSTNNRITTT
                     TTSLLKSNSNLQPIAMTPSGSSTSSTINKPKSQENKRRRVTRACDTCRQKKVKCDGKQ
                     PCIHCTVYSYKCSYDQPNIRNKKNSGIPIPSQPSPAILQVAAQAAVAFGSNNNNNNNN
                     KSNNEQLQLQLQSPPHQQQQQQQQYQPLLADEPIPKTNLIIFQQIINSLLPKLQLNGF
                     DPNLQFDLNKFQKVVQYVMGKSQTFTLNLNEITELMQDPDSQIPPPPPQQQQQQQSAS
                     ASSNPHHHRRTLSVGSFDESSNSAVSSPREVGLHLPSKEVALNLIYTTWNKACVLFRF
                     YHRPSLLEEVDLLYSLDPMNYGDRQQKFLPFLYSILACGSLFSKTPYTMGTPNENEKN
                     LEDDGFKYFLEARKLIDISNVGDINSIQTVVMMIIYLQCSARLSTCYSYIGIALRSAL
                     KEGLHRNLTLFQNSKKKLDPIEEDTRKRLFYTIYKMDIYINSLLGLPRSLNEDEFDQL
                     LPVELDDENVTRTDYLFDKQQGRLSSSGCANQHTKLMFILSHIIKKMYPIKVKPEEAE
                     NSSNVNYSRDRIHAKVTELEVELKNWLDNLPQELKPIDPSSTTKDVIDEVPEKFRLAN
                     YYLHLAFLNCQIILYRPFIHFISDSMDGSSSDPRSLIRGRNCIKVARMVVKLANKMID
                     HKLLLGTYWFSMYTIFFSIACLIYYFHFANYNNNGQGFNYVGILFDDDLNIDMIKKDI
                     EIGKKVLDNLKNSSNSSLRIYNILNTMFEQLNRRTASRSRQANATTTTTTTTTTTTTN
                     GNSQPVTLPANFQNVNVKNTFENFDNMNHFIKKEKENLSQLFDNTSMAKFESSSEIPK
                     NVANIQRVTTPLEENNKEIGEVSGGNLTSNYMPGVFDKLDTQIFGKILPPYMLEKNEP
                     MNYNNNNNNNNNNSNNINNNNNNNLNNNSGGVSNGVSYNNDNAANWPINNGEDGLNLE
                     DLFGSLANNGNGGGSSSSNGLEYLDPF"
     gene            complement(<558677..>559882)
                     /locus_tag="CD36_27530"
                     /db_xref="GeneID:8049575"
     mRNA            complement(<558677..>559882)
                     /locus_tag="CD36_27530"
                     /product="peroxisomal matrix lipase, putative"
                     /transcript_id="XM_002421778.1"
                     /db_xref="GeneID:8049575"
     CDS             complement(558677..559882)
                     /locus_tag="CD36_27530"
                     /inference="similar to AA sequence:UniProt:Q12405"
                     /inference="similar to AA sequence:UniProt:Q59LU6"
                     /note="peroxisomal membrane protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="peroxisomal matrix lipase, putative"
                     /protein_id="XP_002421823.1"
                     /db_xref="GeneID:8049575"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WL62"
                     /translation="MSFSIEKKITLAHPFRAPGSTLINSDQSNLKLVYNKYKTNSPLP
                     NSNNQLRFNFIFCHGTGFNKSIWKYHIKKLYQLSQSGQVPWFLDSVIAIDMVGHGDSS
                     LENQGKLGTIFRWDDGAKDVITIIKHEISTTGDFENNLQSRNLIIGHSMGGFNSLYAT
                     FLEPSLFDSVIPIEAVIYGAPGGLEKFSKKFSKISKLLIDTFDSKDDINFFFKEFSFF
                     KNMQNQISDDFINDEVYEIKDKETGVIKYKLKCNTLHQMAAYYGAFMSISFGMFAIPQ
                     IRVPICHVIGSKAVWNPPESITWIRGAINNEFLSDTIDVAKGEHLLNVELPDETIDII
                     QNFTTKRTQTFINHRNNLPEIKLNKNKPAIAKQEFQNLIDLKFDQVYGYFVEDRNDKY
                     EALQKLTKL"
     gene            <560980..>561933
                     /locus_tag="CD36_27540"
                     /db_xref="GeneID:8049576"
     mRNA            <560980..>561933
                     /locus_tag="CD36_27540"
                     /product="pantoate--beta-alanine ligase, putative"
                     /transcript_id="XM_002421779.1"
                     /db_xref="GeneID:8049576"
     CDS             560980..561933
                     /locus_tag="CD36_27540"
                     /EC_number="6.3.2.1"
                     /inference="similar to AA sequence:UniProt:P40459"
                     /inference="similar to AA sequence:UniProt:Q59LU7"
                     /note="Similar to S. cerevisiae PAN6; pantoate-activating
                     enzyme, putative; pantothenate synthetase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="pantoate--beta-alanine ligase, putative"
                     /protein_id="XP_002421824.1"
                     /db_xref="GeneID:8049576"
                     /db_xref="GOA:B9WL63"
                     /db_xref="InterPro:IPR003721"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:B9WL63"
                     /translation="MTVSNTIKILRTVQQVRQWRAQCFLRNESVGFVPTMGALHAGHC
                     SLINQSIKENDKTVVSIFVNPSQFAPNEDLDNYPRTLDQDLQILQNNNNNNHQKKIVD
                     AVFVPKISEMYPSGISLDISKQRGAFVTVHGSSEQLEGITRPQFFRGVATVVTKLLNI
                     VQPTNIYFGQKDAQQCVVIQNLVKDLIINTNVRIMPTLRESNGLAMSSRNQYLSSKMK
                     DKSSLIYKSLKAGENYYLNHSNSNTNGKVLASEILQQIKPIINSDPDFDIEYIAISHP
                     ETLEDLDYVVPGIGAIVSTAVKVPKENSDEKARLIDNIILH"
     gene            complement(<562054..>565206)
                     /locus_tag="CD36_27550"
                     /db_xref="GeneID:8049577"
     mRNA            complement(<562054..>565206)
                     /locus_tag="CD36_27550"
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase, putative"
                     /transcript_id="XM_002421780.1"
                     /db_xref="GeneID:8049577"
     CDS             complement(562054..565206)
                     /locus_tag="CD36_27550"
                     /EC_number="3.6.1.-"
                     /inference="similar to AA sequence:UniProt:P15938"
                     /inference="similar to AA sequence:UniProt:Q5A227"
                     /note="Similar to S. cerevisiae PRP16"
                     /codon_start=1
                     /transl_table=12
                     /product="pre-mRNA-splicing factor ATP-dependent RNA
                     helicase, putative"
                     /protein_id="XP_002421825.1"
                     /db_xref="GeneID:8049577"
                     /db_xref="GOA:B9WL64"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WL64"
                     /translation="MNILDDLDDELDQLETNIKPKVKLLNQKKENKLIDDDLDNDLDD
                     EDDLNLPKIKPSTKFKKMKKEHALRIKNETPSSPLLSQGVSSRISSTPATPSVSEPSI
                     YKQNNEIINDINDINDINLDNFSNIEADREWYNIDEESALIRDEEIIEDPPPQNHRKR
                     FRNTKHPKRPATTTTTSSSSSSLSSSFNETGATFNEFGEYIDYDHQQSLNELNRIPII
                     SHIFIPPFLENSKQYLQLQISGSSIRGIGPTVNPIKDPTSELASMAKQGSFIVQNRRS
                     KRERALQAKEAAGIDNSNIGSIIDTHNTKKEEEQPKGKNLNNNETTTTYQDIQQQRKL
                     LPAFAVRNDLLTTIRDNQVTIVIGETGSGKTTQLTQFLYEDGFGSNIDKNGEKKIIAC
                     TQPRRVAAMSVAKRVSEEMNCKLGEEVGYSIRFEDKTNNKKTIIKYMTEGILLREILV
                     DPLLINYSCIIMDEAHERSLNTDILLGLFKNLLSKRKDLKLIITSATMNANRFTKFFG
                     AAPQFHIPGRTFPVEIFFNRDVNMDYVEMAVKQILTIHLGRWNINATNGNGNDGDILV
                     FMTGQEDIEITCDLIKEKLDLLEDPPPLDIYPIYSTMPQDLQKKIFNKMNLQRRKVVV
                     ATNIAETSLTVDGIKYVIDCGLVKVKVYNPKLGMDTLQMVPISLANADQRSGRAGRTG
                     AGIAYRLYTEKATDPNNMYIQPIPEIQRSNLSNIMLLLKSLKINDINSFPFLDPPPKD
                     LLNCSLHDLWAIGALDNLGQLTKLGQSMIQFPIEPTLAKLILLSTQSEFHCSEEIITI
                     VAMLSVPNIYNRPKERSNEADMAREKFIISESDHLTLLNIFNQWEINLNKFKGDYNKI
                     NNWCNKNFLQLKSLYRVKDIKYQLKLIMQKNKLTILKSKNDNDIRKCLCASFYQQSAK
                     LIKMNLNGQPEFINLRHSYMKMFLHPTSCLLDSNLSTNYVIYHELILTKKEYMNYVTT
                     VDPIWLLEYGYKFFGIADSYQSNKIGADLISYKQEFENQLLKDKKIYEDIVKQQSKRR
                     SNEISSTNKVSSLFKKRRGI"
     gene            <565353..>566105
                     /locus_tag="CD36_27570"
                     /db_xref="GeneID:8049578"
     mRNA            <565353..>566105
                     /locus_tag="CD36_27570"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421781.1"
                     /db_xref="GeneID:8049578"
     CDS             565353..566105
                     /locus_tag="CD36_27570"
                     /inference="similar to AA sequence:UniProt:Q5A224"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421826.1"
                     /db_xref="GeneID:8049578"
                     /db_xref="UniProtKB/TrEMBL:B9WL65"
                     /translation="MKPKLSITIMMNKKKLSQTISKYFANTIGFSCRITPAPNTSLEL
                     DYLLQNFQKLAPLDNFQTSSDSIRDHDHHDYHHHQNGFFINAIYNPCQNESWFKLIKL
                     DENHQLFKQIDNKLINNYNNNNNNNNNNNQTIKNDFIKILTSLVAIPRYSYIENNQQF
                     QNYKLQLRFDHNLQRSITNYKGKYNLTTSTIDNPFISIINNKNDKNGKDDEVQIDYEK
                     LRVNLRHNFQKFHKFDKIEIITNPNRLINKLK"
     gene            complement(<566188..>568038)
                     /locus_tag="CD36_27580"
                     /db_xref="GeneID:8049579"
     mRNA            complement(<566188..>568038)
                     /locus_tag="CD36_27580"
                     /product="nuclear pore protein, putative"
                     /transcript_id="XM_002421782.1"
                     /db_xref="GeneID:8049579"
     CDS             complement(566188..568038)
                     /locus_tag="CD36_27580"
                     /inference="similar to AA sequence:UniProt:P48837"
                     /inference="similar to AA sequence:UniProt:Q5A223"
                     /note="Similar to S. cerevisiae NUP57; nucleoporin,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="nuclear pore protein, putative"
                     /protein_id="XP_002421827.1"
                     /db_xref="GeneID:8049579"
                     /db_xref="GOA:B9WL66"
                     /db_xref="InterPro:IPR024864"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="InterPro:IPR025712"
                     /db_xref="UniProtKB/TrEMBL:B9WL66"
                     /translation="MFGNTNNTSSGGGGGGLFGSSNTASSTGGGGGGGLFETNKPTTT
                     TTTTTGFGSQPQQGSNLFGSSSNTSGGLFGNQQQQQQQQQQQQQSNTSGGLFGNKPAT
                     GTTTGGGGGLFGGQTNTSGSGGGLFGGQSNNTTNNTGGGLFGGQSNSTGTNTGGGLFG
                     GQSNSTGTNTGGGLFGGQQQQQQQQSNTTSGSGGGLFGNKPATGGGLFGGSSNTTNTG
                     STTFGSNQATTGGLFGNKQPATSGGLGLFGNTQQQQQQQSSSSGLFSNNTTNNAQPSF
                     SWSQPPPQSSSSTTISGNTNQISNLTNGPFGSNTNQQVNNNTNTYTPAINDQLTKIWE
                     QWDPNSSKCALKTYIYNKFSDQEINVLLNQPRPINESAEDWENAMISRPGPNYYPIKV
                     NSFNDVGQRIETQLDYVAKSRILLNNINENLNNLSSQHDLENTTRIMKAKSRHIKLSR
                     RLLRLATILAIVKLKGYPLLPEEEEISKQFELLTSKLNDPNSSIGKLSDVFARLAILK
                     ERAEEFNYQCENSVNLLNNTLIEEDNDDDDDESKKLNKGSVTTRTRTTTTTEQSDNNN
                     NNNNNNNNNNNIEEAIHKLSKVLLKQQMGLNYLNDILEKDIEAVNKITKK"
     mobile_element  complement(568385..570241)
                     /mobile_element_type="transposon:Cirt transposon C
                     (degenerate)"
     gene            complement(<568969..>569445)
                     /locus_tag="CD36_27590"
                     /db_xref="GeneID:8049580"
     mRNA            complement(<568969..>569445)
                     /locus_tag="CD36_27590"
                     /product="transposable element protein, putative"
                     /transcript_id="XM_002421783.1"
                     /db_xref="GeneID:8049580"
     CDS             complement(568969..569445)
                     /locus_tag="CD36_27590"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="transposable element protein, putative"
                     /protein_id="XP_002421828.1"
                     /db_xref="GeneID:8049580"
                     /db_xref="UniProtKB/TrEMBL:B9WL67"
                     /translation="MMIQIGIKQHLKRGFTTTNWLSWCWLKDIFITPPPSSSPPQSKR
                     KNKSRKSHAYNGWTIKPATNSMEFKETYEKNNFIPLYICHLILRICCTTTLDFGIFDP
                     NEISIRNKIVKIWPGARIIMDRPIRQRLFISEISRIKETKQKKKKKKKKVNQGENN"
     gene            complement(<570964..>571515)
                     /locus_tag="CD36_27600"
                     /db_xref="GeneID:8049581"
     mRNA            complement(<570964..>571515)
                     /locus_tag="CD36_27600"
                     /product="NADH dehydrogenase [ubiquinone] 1 alpha
                     subcomplex subunit, putative"
                     /transcript_id="XM_002421784.1"
                     /db_xref="GeneID:8049581"
     CDS             complement(570964..571515)
                     /locus_tag="CD36_27600"
                     /EC_number="1.6.5.3"
                     /inference="similar to AA sequence:UniProt:Q5A222"
                     /inference="similar to AA sequence:UniProt:Q9DCJ5"
                     /note="Similar to Mus musculus Ndufa8; NADH-ubiquinone
                     oxidoreductase subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="NADH dehydrogenase [ubiquinone] 1 alpha
                     subcomplex subunit, putative"
                     /protein_id="XP_002421829.1"
                     /db_xref="GeneID:8049581"
                     /db_xref="GOA:B9WL68"
                     /db_xref="InterPro:IPR016680"
                     /db_xref="UniProtKB/TrEMBL:B9WL68"
                     /translation="MLGLGGYFYGGKQWENKEETPMPKDVPDVDEIGATSAPLLSASY
                     YIGDKCKPFNDDFLLCKQEHNGGTLECMKEGRRVTRCAISVLKDINKYCFDEFKLHYE
                     CLEQNNQYFNRCRSSEGILSKCVFNNMKLIKKIPDVEQQIQNKKNPIYPIDPNDIKNT
                     KEFLKSKELANTSTSTSTTIEQS"
     mobile_element  complement(572058..572672)
                     /mobile_element_type="retrotransposon:solo LTR, psi E"
     gene            complement(<572764..>573585)
                     /locus_tag="CD36_27620"
                     /db_xref="GeneID:8049582"
     mRNA            complement(<572764..>573585)
                     /locus_tag="CD36_27620"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421785.1"
                     /db_xref="GeneID:8049582"
     CDS             complement(572764..573585)
                     /locus_tag="CD36_27620"
                     /inference="similar to AA sequence:UniProt:Q5A272"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421830.1"
                     /db_xref="GeneID:8049582"
                     /db_xref="InterPro:IPR024602"
                     /db_xref="UniProtKB/TrEMBL:B9WL69"
                     /translation="MNHQEFDILNGTDEFPYPISIIQTDFKNFNTNNHEIDLFLYKNY
                     RFNNLDSIIKELNQLSQNLNQNLLDLINNDYHEFIELGKSINNGLNLINNIIEDLKNF
                     QIDLINNYYKKFFKLDNQLFEILQNRQILNNLKTCIKLNLILHDQIIEFDNCINNINN
                     NQLIENLNQLKILTSLYLSINNIEIFLNKFIQLSNINNDNHNKNYFNSPFHDNYINNK
                     ISSIKLEFKSFLDQLIRKELNQKKNLRNSQMIFELLNIYKLIGEEKNIMNIINNK"
     mobile_element  578152..578965
                     /note="partial and rearranged element"
                     /mobile_element_type="retrotransposon:kotuku L and M,
                     Tcd32, LTR"
     gene            <589873..>591825
                     /locus_tag="CD36_27640"
                     /db_xref="GeneID:8049583"
     mRNA            <589873..>591825
                     /locus_tag="CD36_27640"
                     /product="heme-dependent repression factor, putative"
                     /transcript_id="XM_002421786.1"
                     /db_xref="GeneID:8049583"
     CDS             589873..591825
                     /locus_tag="CD36_27640"
                     /inference="similar to AA sequence:UniProt:P25042"
                     /inference="similar to AA sequence:UniProt:Q5A271"
                     /note="Similar to S. cerevisiae RFG1; hypoxic function
                     repressor, putative; repressor rox1 homologue, putative;
                     transcriptinal regulator of filamentous growth and hyphal
                     genes, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="heme-dependent repression factor, putative"
                     /protein_id="XP_002421831.1"
                     /db_xref="GeneID:8049583"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:B9WL70"
                     /translation="MSTAIYYSTHNMHANDDITNSGSTTATTTTTTTTSSGNSGTNST
                     NSNQINPTTTVNNPNNGLNSTNKNHTTLLPSLAHIMPSNSTNNTNNNGSSIDITSTLI
                     NPYSSGAAAAAAIVGNGGNGGNGGYYHPPPPHSQQQQQFDTSYSNQTTPTSAYTNFNN
                     DSTHSPTDISMQQNMNNLTSSSTGNMSMGISGIDGTFSHHNNNNNSINNNNNNNNNKC
                     ICKSKVNKIPRPRNAFILFRQKYHQMVLDEGTVIRTNPEVSRELGRRWRALSPQEKEH
                     WNNLAEEEKKNHAKKYPGYRYTPRRNGRNKNCPVCKNKPITTTTTNNSNNNNKAASIS
                     GMSINGGNNSISGVSSSGSSSILSGGLTSRDNSINNPNGIDYQQQLQLQQQAIQFQSL
                     PPDQYQQLLKQQQQQLQLQAQLNGSGGGGGGGGGSSGIITNPQTIPQYITNGNYPSYI
                     ISPNPYSTISTTGPSTTTTTNTSSSLSSSIGLSVPPTATTATTNTNTNTHTSSSSQPT
                     SANSQLHFYEAEKLSPVSSTHHQSSISEITQQQQQQQQQQFLYNANYSTLPPTTNNNT
                     TNTTTTMQQQHSASTGNEYSLNGGNNNNGNTTGYDNRFSYGQPMIITGQPQQQQGHHG
                     QHYNNGLHHTTQHYQHQHHHHQQPPQ"
     gene            complement(<598079..>599236)
                     /locus_tag="CD36_27670"
                     /db_xref="GeneID:8049584"
     mRNA            complement(<598079..>599236)
                     /locus_tag="CD36_27670"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421787.1"
                     /db_xref="GeneID:8049584"
     CDS             complement(598079..599236)
                     /locus_tag="CD36_27670"
                     /inference="similar to AA sequence:UniProt:P36152"
                     /inference="similar to AA sequence:UniProt:Q2U5K2"
                     /inference="similar to AA sequence:UniProt:Q5A218"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421832.1"
                     /db_xref="GeneID:8049584"
                     /db_xref="GOA:B9WL71"
                     /db_xref="InterPro:IPR007785"
                     /translation="MTSSINILLLLHPTVVTDAHSVEQIKSKIYQSHNNDINSININQ
                     QIIDRITKGVIELPNDYYDEIIYINPNDEPQYREIPISLMQLIYKLLKSNGKFKGDLP
                     LDQNLDVLMTGFIIEEEEQEQQEQQSGLNEGTVYVWVKPIPVDEPVVTLLKKKTTNNT
                     KKSLPLFKKLNKNDMTINVPQEIDNITNNKRKLVETKLTYFSSDDENSSDGSLSDNAN
                     EEEEDDDELIDENDLLKYNNHNNNNNNNGEQSFSDKLITPRKCELSLNGGKKRKKACK
                     DCTCGLKELEELEVSNQQNLQDQILGKLAQSATLEAIKIEERLKQQSQKKIKFTEEDL
                     SEIDFTVQGKTGGCGSCALGDAFRCDGCPYLGLPPFKPGEVVKLDGFGEDI"
     gene            complement(<600483..>601760)
                     /locus_tag="CD36_27680"
                     /db_xref="GeneID:8049585"
     mRNA            complement(<600483..>601760)
                     /locus_tag="CD36_27680"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421788.1"
                     /db_xref="GeneID:8049585"
     CDS             complement(600483..601760)
                     /locus_tag="CD36_27680"
                     /inference="similar to AA sequence:UniProt:Q5A217"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421833.1"
                     /db_xref="GeneID:8049585"
                     /db_xref="UniProtKB/TrEMBL:B9WL72"
                     /translation="MSLSKPTTPVSSPKAQKALPIVVQEPPPQPTTPPSPQKPQTTFF
                     HRQTKRSSSSFLSTPDQEQQQQQQQVSGVKDKESNLDSHVPSLPYTPSSKRRSYGIFE
                     SPVGKSPYGVALRTPRNEDNDSPEQRSKRYGIVERDDDDDDDDEDQGHSGYTPVGSGG
                     GGNEDEEARRLKLQRTPQFHSAKRLYDTLNSVMLNNQNSAHNRYMNGIINSGNGQSIS
                     DNSNNSLSNINKSPNLKSSRHSWSANVNLQFSPPRPQSQFSQHKLPPPPPQPKFTPLT
                     SNEQQNQNPNQIRENQIPPSWSLSSTPVTTSISPVYLPPQSSPTKLIIEPNDEEISAK
                     DAIRKIIQKNRHSGVNNNKDNERPASTSTTDAADAAAARTLNFKNRTKHSRNDSYSTK
                     DETEAAFSLVKLHTAAGGDDGDDTEDETEDDKE"
     gene            <603098..>605392
                     /locus_tag="CD36_27700"
                     /db_xref="GeneID:8049586"
     mRNA            <603098..>605392
                     /locus_tag="CD36_27700"
                     /product="kinetochore protein, putative"
                     /transcript_id="XM_002421789.1"
                     /db_xref="GeneID:8049586"
     CDS             603098..605392
                     /locus_tag="CD36_27700"
                     /inference="similar to AA sequence:UniProt:P40460"
                     /inference="similar to AA sequence:UniProt:Q5A216"
                     /note="Similar to S. cerevisiae TID3"
                     /codon_start=1
                     /transl_table=12
                     /product="kinetochore protein, putative"
                     /protein_id="XP_002421834.1"
                     /db_xref="GeneID:8049586"
                     /db_xref="InterPro:IPR005550"
                     /db_xref="UniProtKB/TrEMBL:B9WL73"
                     /translation="MSQASNPIYGLRRNNGFVGSSNSAATNNNNNNVNNHNGNRISLG
                     SATRTSSIISNNLPFRQSLLHGNYENAINTPSTSQQQSQQGISTSQTKRRSTLLSTPA
                     TTTKRRQSMIGSNLQQQQQQQYGSTAFRHSTQPSSTSMNSQFNQALQRVSPYYNPASY
                     SSQTPSSQPSSQQQQSQQSVIPTSASSSQQQQQSMDPRPLKDKKYQELIQKEIIRYLI
                     DYKFEIKTNIALTENILKSPTQKNFNAIFKFLYNQLDPNYIFIKSSIEQEIVTLLKLL
                     NYPYMHTITRSHFSAVGGNNWPTFLGILYWLVELNLSLSTLNDDDFLADDDFDKIFIE
                     YIWKSYSLFINDEEEDEESNGGDKFYNDMKIKFDQLQEKLNQELNNVEQQHENLINKY
                     HELNNQLKIRDDALKKTVALEEDYMKLKSYNQNVEKMMPEWNKKLEQLSNEVISYEEQ
                     MNKLQDQKKSIEIDLQQRGISIDKVNELYIKRDQLSKSIETMSNKIDDLKEKLSGRSY
                     DLEKNFDNLESLTNQYNEITNKFNYYYYQQQQQQQQQQTQQSQQPNNDNQLIPQFGLK
                     LDENIKTTYEQQFTRDEIFININVKQERTNLLNFRNELDHQILNDRSLAMKFNEKCDI
                     EQDKIKDQQSIIEELKIQDSLMKRKLDDLKQQIFQIQSEFNSQIESLDQQIRETKSNI
                     QSDILQLERKLRDVNLNKSLIQEQLIGKRQKIDEDVINLTSFILKFKTNIQEKLINIA
                     DIVQDQLKKEQQQQQQQQEQQELE"
     gene            <605944..>606747
                     /locus_tag="CD36_27710"
                     /db_xref="GeneID:8049587"
     mRNA            <605944..>606747
                     /locus_tag="CD36_27710"
                     /product="alpha tubulin formation protein, putative"
                     /transcript_id="XM_002421790.1"
                     /db_xref="GeneID:8049587"
     CDS             605944..606747
                     /locus_tag="CD36_27710"
                     /inference="similar to AA sequence:UniProt:P53904"
                     /inference="similar to AA sequence:UniProt:Q5A215"
                     /note="Similar to S. cerevisiae ALF1; tubulin folding
                     cofactor, putative; tubulin-specific chaperone, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="alpha tubulin formation protein, putative"
                     /protein_id="XP_002421835.1"
                     /db_xref="GeneID:8049587"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:B9WL74"
                     /translation="MSDLNIFITSNLTSSERRISPQWNLKYLKQKLESITGISPQNQI
                     LQYYPNNHSNEYKLIPFPETTTSDVNDEQILLSSLNLQSYSRIHVLDSDPNSDINKLQ
                     EEPQTNEEEEGGDGGGFTEFKLSEEDYKTRQDSVLNWKKTNKLGRFDPKFQSLQEKLQ
                     HETEIKLQTMSIGSRCRLINIENNERRGVIRFIGKIIPLDKGENDWVGIEFDEPVGKN
                     NGSIDGIKIFECKPNHGSFVRPRLVEVGDFPELDPFADEDMDDDDDEEL"
     gene            <607092..>607475
                     /locus_tag="CD36_27720"
                     /db_xref="GeneID:8049588"
     mRNA            <607092..>607475
                     /locus_tag="CD36_27720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421791.1"
                     /db_xref="GeneID:8049588"
     CDS             607092..607475
                     /locus_tag="CD36_27720"
                     /inference="similar to AA sequence:UniProt:P53903"
                     /inference="similar to AA sequence:UniProt:Q5A214"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421836.1"
                     /db_xref="GeneID:8049588"
                     /db_xref="InterPro:IPR016809"
                     /db_xref="UniProtKB/TrEMBL:B9WL75"
                     /translation="MAAFDEIFDYVDKDTFFQYFRLTLVVCTYLIFRKYYSAWAIKKQ
                     TATQLAQDQKQQAEKSERDAKESKEKFDTISNEAKEFGWGKKTRNNVKLTEAVLAEYS
                     EQQRQRNQTSYDAQEDADIDDLLED"
     gene            <607902..>609521
                     /locus_tag="CD36_27740"
                     /db_xref="GeneID:8049589"
     mRNA            <607902..>609521
                     /locus_tag="CD36_27740"
                     /product="ribosomal RNA-processing protein, putative"
                     /transcript_id="XM_002421792.1"
                     /db_xref="GeneID:8049589"
     CDS             607902..609521
                     /locus_tag="CD36_27740"
                     /inference="similar to AA sequence:UniProt:Q06506"
                     /inference="similar to AA sequence:UniProt:Q5A213"
                     /note="Similar to S. cerevisiae RRP9"
                     /codon_start=1
                     /transl_table=12
                     /product="ribosomal RNA-processing protein, putative"
                     /protein_id="XP_002421837.1"
                     /db_xref="GeneID:8049589"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:B9WL76"
                     /translation="MAGDPFLSDPSKKRKRSNKLTSKTKRTKSSTSTPTPTPTANLQD
                     DEISSGSDSENENEHVNGGEDHNDSELSSDEEFADETVNDKRRRLAKQYLENLKQNEQ
                     ELYDEFDAKDLDDDILARRLQKDVAETKGYVYKFIGDKIKDQLDEEYPLQLITTRIGC
                     KNLTSMTINYPYLYTVSKDIEIIKWDISETHKKPKRIKHTKGGNKYFEINSINPQSNH
                     HWQQINCIAASPDGKYIVTGGDDSRLIIWSSENLTCLKILQTRASVNSIVFRRNSDQL
                     FAACADLRIRTYSINQFTQLEILYGHQDNISDISALAKETCVSVGSRDKTAMFWKIAE
                     ESRLTFRGGDSLEKTKSKKKMRQQDENNETPFYNEGSIDVVSMIDESHFVTGSDNGNV
                     ALWSLAKKKPLTTQRLAHGLQPQFTPIQASSEANEELALQQIPKPQPYWITAIHGVPY
                     SDIFITGSFNGTIKIWKLEEPSLRSFKLLGEIKQNNFNGCIVKIDSVEIPGTIKKLKI
                     FVLLSKEHKFGRWLGKLPGARNALVNFTVNL"
     gene            complement(<609719..>610558)
                     /locus_tag="CD36_27770"
                     /db_xref="GeneID:8049590"
     mRNA            complement(<609719..>610558)
                     /locus_tag="CD36_27770"
                     /product="DNA-directed RNA polymerase III subunit,
                     putative"
                     /transcript_id="XM_002421793.1"
                     /db_xref="GeneID:8049590"
     CDS             complement(609719..610558)
                     /locus_tag="CD36_27770"
                     /EC_number="2.7.7.6"
                     /inference="similar to AA sequence:UniProt:P17890"
                     /inference="similar to AA sequence:UniProt:Q5A212"
                     /note="Similar to S. cerevisiae RPC8"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-directed RNA polymerase III subunit,
                     putative"
                     /protein_id="XP_002421838.1"
                     /db_xref="GeneID:8049590"
                     /db_xref="GOA:B9WL77"
                     /db_xref="InterPro:IPR016264"
                     /db_xref="InterPro:IPR024661"
                     /db_xref="UniProtKB/TrEMBL:B9WL77"
                     /translation="MSFRGGGSGGGRSTQRTILPFGLDYADIISSTQETEKPQLLLPI
                     NGDITEIESIIAKQSMNFTKLMSEGPFFTGNLDSIEITKKRQNNDSDEEEEDDDNEGG
                     GGRDKRKKSKTKTITSSSGGDGIERYSDRYKKIQKIGRTIDEHPYQPEYFPSELYSIM
                     GITNKRDKKKFLLLSKFKSNGGLKQILSNEKLENLDEQSKLDSMKEKMLSMIDNTVNM
                     NEDDDGKGRNNNSGDEQEIDEDDIDDEFEDEDDDDYNAEKYFDDGDDDDGGDDGGDDE
                     AAF"
     mobile_element  610887..611167
                     /mobile_element_type="retrotransposon:solo LTR, kotuku P"
     gene            <612662..>614641
                     /locus_tag="CD36_27780"
                     /db_xref="GeneID:8049591"
     mRNA            <612662..>614641
                     /locus_tag="CD36_27780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421794.1"
                     /db_xref="GeneID:8049591"
     CDS             612662..614641
                     /locus_tag="CD36_27780"
                     /inference="similar to AA sequence:UniProt:P53901"
                     /inference="similar to AA sequence:UniProt:Q5A211"
                     /note="possibly fungus-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421839.1"
                     /db_xref="GeneID:8049591"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:B9WL78"
                     /translation="MYPSLNGSTIGSIRQEDDADYTATADGTLVVMVIRAKHLPNRRK
                     LDKQSPYVVARIGTVAKKTSAAFRAGQTPEWTHEMRFELSREKKPILKIDVLDETKND
                     PTPIGNVEIDASVIFTNPENNENGKYIYDKWYDLTLNGRRAGMIYLEMTFYPTAPVLP
                     PKIPIPHEEVVVINEQDDYDTASAMGQSMRSTISSKHKDLPTPPFNQQQQLQQSHMSG
                     THSHSVADDVFVNSENSNSSKTSSIFSKKFSKYSGSGGGVNSTNSTNIDREVFVSSES
                     DKNHDNSKKGAKKYTSKLAKFTDKFQSKQPISTLWKNSEAMSDNINAEQSTTTSIGTT
                     GTAPKVFSSFNTRRSVSPLSDYGSNDLDQLQRDLSHTQLSDDYNNNNNNKEHTNFDKN
                     IYEPLPEIEFNSPPVPPPHLIISNTEDTYYKSNNDNDNINTSSRLSSTSPRRKPPPPL
                     SSSPKTNNAKSSPSTTNGFNPKFDLSKSTAIPFSADTIGIDDDDDDNHTLNKNNKDIL
                     PTQVYLLDQPVKSLSIPSNTHDGLPPVNINSDEIDPKYYAPTPSEHFNRSQRFNNNSI
                     TKDDLKIDFRTNQTGYLGNGNFSPSIFQRAVKHNWDDSSTMEDIDYNEFSRSGVCDSS
                     LKPEVPPKIPKGLTESEYYILEKEKYLRDLRGNRI"
     gene            complement(<615206..>615817)
                     /locus_tag="CD36_27800"
                     /db_xref="GeneID:8049592"
     mRNA            complement(<615206..>615817)
                     /locus_tag="CD36_27800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421795.1"
                     /db_xref="GeneID:8049592"
     CDS             complement(615206..615817)
                     /locus_tag="CD36_27800"
                     /inference="similar to AA sequence:UniProt:Q5A210"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421840.1"
                     /db_xref="GeneID:8049592"
                     /db_xref="UniProtKB/TrEMBL:B9WL79"
                     /translation="MKYTNLICSSILLAIPTILADDVASSDTTIVNTITITKTLYTPE
                     ESSSLLSVQLESEASVASVASVASEAAILAAASAASVASVASEASAASVASDLSVLAK
                     ATEIKADLVNNYNSTINSTLTSSTIAPKTSSSASSSSSSKKHESITSVITSTTNDNAS
                     AAVTTKTGSVSSKAGAAAIAGPVPILTNSIFTAGLIAIAAVLL"
     gene            complement(<618180..>619610)
                     /locus_tag="CD36_27810"
                     /db_xref="GeneID:8049593"
     mRNA            complement(<618180..>619610)
                     /locus_tag="CD36_27810"
                     /product="histone deacetylase, putative"
                     /transcript_id="XM_002421796.1"
                     /db_xref="GeneID:8049593"
     CDS             complement(618180..619610)
                     /locus_tag="CD36_27810"
                     /inference="similar to AA sequence:UniProt:P32561"
                     /inference="similar to AA sequence:UniProt:Q5A209"
                     /note="Similar to S. cerevisiae RPD3"
                     /codon_start=1
                     /transl_table=12
                     /product="histone deacetylase, putative"
                     /protein_id="XP_002421841.1"
                     /db_xref="GeneID:8049593"
                     /db_xref="GOA:B9WL80"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:B9WL80"
                     /translation="MYQELPFDELKVDSRKRRVAYFYDQDVGNYFYGTGHCMKPHRIR
                     MAHSLIMNYELYKKMEIYRAQPATNLELTQFHTDEYIDFIDRVTPDNLHLFEREQVIF
                     NVGDDCPVFDGLGEFCKISCGGSMEGAARLNRGQADIAINYAGGLHHAKKSEASGFCY
                     TNDIVLGIIELLRYHPRVLYIDTDVHHGDGVEEAFYTNDRVMTCSFHKFGEFFPGTGN
                     LTDIGIGKGKYHAINIPLRDGIDDASYKSIFEPIITKIMEWYQPSAIVLQCGGDSLSG
                     DRLGPFNLSMRGHANCVNFVRSLGVPMMVLGGGGYTIRNVARTWAFETGICNGEILPK
                     ELPYNGYYEYYAPTYELDVRSANMNNANSKDYLDKILTQVISNLDNTKHAPSVQMNEV
                     PLDMEDLGDVDEDMPDAIDTKGGSQFAKDKLIQTDGEFYDDDEKDKGEKNIQENGNVN
                     INGNGNGNVTITEEEQAELDKLNNNV"
     gene            complement(<620169..>621260)
                     /locus_tag="CD36_27820"
                     /db_xref="GeneID:8049594"
     mRNA            complement(<620169..>621260)
                     /locus_tag="CD36_27820"
                     /product="DNA damage tolerance protein, putative"
                     /transcript_id="XM_002421797.1"
                     /db_xref="GeneID:8049594"
     CDS             complement(620169..621260)
                     /locus_tag="CD36_27820"
                     /inference="similar to AA sequence:UniProt:Q06624"
                     /inference="similar to AA sequence:UniProt:Q5A208"
                     /note="Similar to S. cerevisiae AOS1"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA damage tolerance protein, putative"
                     /protein_id="XP_002421842.1"
                     /db_xref="GeneID:8049594"
                     /db_xref="GOA:B9WL81"
                     /db_xref="InterPro:IPR000011"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B9WL81"
                     /translation="MSDELSPDEIALYDRQIRLWGTSTQLKLRSTKILLINLGAIGSE
                     IVKNLVLGGINTIEILDNSTIKPQDFAAQFFLPNEEDSACIGQLKLPLVIEKIRELNN
                     RVNLSINTDMTIDQLESNYLKKFDLIIATEINNKSEIFQLNKLTRNLNIPMYLTGMHG
                     LFGYIITDLIEHESILTKPKGNVARQSGVQLSPNKTIINVTSTNNNDHDNNNDNGSGK
                     NELITIKDQFVPIDSIFVSKKLPTQFTKKQLTKKISPILPLIFALFEIDLPTIDNKEV
                     LPSIDIEILKAKSIEICHKFEIPHEIITQQYYEMFSKCAFTEFAPISAILGGTVAQDV
                     IQFLSGKESPINNVLVLDSITSEMPIYSL"
     gene            <622138..>622629
                     /locus_tag="CD36_27840"
                     /db_xref="GeneID:8049595"
     mRNA            <622138..>622629
                     /locus_tag="CD36_27840"
                     /product="carbonic anhydrase, putative"
                     /transcript_id="XM_002421798.1"
                     /db_xref="GeneID:8049595"
     CDS             622138..622629
                     /locus_tag="CD36_27840"
                     /inference="similar to AA sequence:UniProt:Q4WPJ0"
                     /inference="similar to AA sequence:UniProt:Q5A207"
                     /codon_start=1
                     /transl_table=12
                     /product="carbonic anhydrase, putative"
                     /protein_id="XP_002421843.1"
                     /db_xref="GeneID:8049595"
                     /db_xref="GOA:B9WL82"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="UniProtKB/TrEMBL:B9WL82"
                     /translation="MSVAQEFEKANTNYSSNFTKGDLPLPPARKVAVVICMDARIDPA
                     ASLGLTEGDAHVIRNAGGRASDALRSVIISQRLLGTREIVVVHHTDCGMLTFSDNDLR
                     GIVAKETGHNVDHFAFLPFGDLEKSVKDDVEFFKKNPLVLDVPVTGYIYDVKSGAINK
                     VES"
     gene            complement(<622800..>623771)
                     /locus_tag="CD36_27850"
                     /db_xref="GeneID:8049596"
     mRNA            complement(<622800..>623771)
                     /locus_tag="CD36_27850"
                     /product="dolichyl-phosphate beta-glucosyltransferase,
                     putative"
                     /transcript_id="XM_002421799.1"
                     /db_xref="GeneID:8049596"
     CDS             complement(622800..623771)
                     /locus_tag="CD36_27850"
                     /EC_number="2.4.1.117"
                     /inference="similar to AA sequence:UniProt:P40350"
                     /inference="similar to AA sequence:UniProt:Q5A206"
                     /note="Similar to S. cerevisiae ALG5"
                     /codon_start=1
                     /transl_table=12
                     /product="dolichyl-phosphate beta-glucosyltransferase,
                     putative"
                     /protein_id="XP_002421844.1"
                     /db_xref="GeneID:8049596"
                     /db_xref="GOA:B9WL83"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:B9WL83"
                     /translation="MIYYILAFFIFISLSIYATVIFFSHKPRKPFPSELTYKTNDSTD
                     KTHPLPPRINTNSSFQDDGIDISLVIPCYNETERLGKMLDEAIDYLETNHRSKYEIIV
                     VDDGSSDGTDKYALEKANEFKLLPHIMRVVQLKQNRGKGGAVTHGSLHSRGKYVLFAD
                     ADGATSFPDAAKLIDYLANTNGRASIAIGSRAHMVNTDAVVKRSFIRNFLMYGLHALV
                     FVFGIRDIRDTQCGFKMFNFEAVKNIFPHMHTERWIFDVEVLLLGEIQKFNMKELPVN
                     WQEIDGSKVDLARDSIAMAIDLVVTRLAYLLGVYKLDECGRSNKKEQ"
     gene            complement(<624132..>626579)
                     /locus_tag="CD36_27860"
                     /db_xref="GeneID:8049597"
     mRNA            complement(<624132..>626579)
                     /locus_tag="CD36_27860"
                     /product="beta-mannosidase precursor, putative"
                     /transcript_id="XM_002421800.1"
                     /db_xref="GeneID:8049597"
     CDS             complement(624132..626579)
                     /locus_tag="CD36_27860"
                     /EC_number="3.2.1.25"
                     /inference="similar to AA sequence:UniProt:Q5A205"
                     /inference="similar to AA sequence:UniProt:Q8K2I4"
                     /note="Similar to S. cerevisiae ALG5"
                     /codon_start=1
                     /transl_table=12
                     /product="beta-mannosidase precursor, putative"
                     /protein_id="XP_002421845.1"
                     /db_xref="GeneID:8049597"
                     /db_xref="GOA:B9WL84"
                     /db_xref="InterPro:IPR006102"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR013812"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR028369"
                     /db_xref="UniProtKB/TrEMBL:B9WL84"
                     /translation="MAVDLTNWQFRQISNHIKSPLISNQWYDTKNFSSHQIHVDLLYA
                     NIIPDPFIDDNEIHVQWIGELDWQYRCIFDVPGTSIGNASLIFEGIDTFADIQLNNKT
                     ILTTENYFQKHIIPITVNSHNELIITFNSSLKVGQELEQEYGKLQVWNGDSSRVYVRK
                     PQFQYGWDWGPTLNTCGFESIKLITEKDHVNDFFIRYNLNQEMNIAELSIEIDFLFDD
                     YPESLEIKIKDDADVVIDSIVPTSSITNYNISNVKLWYPRNQGEQPLYTFSLFVNGMC
                     KTTLKVGFRKIELVQLNDKYGKSFYFKINNIPTQIFGTNWIPAHSFQSQLTDLEYQQW
                     INLIVNGGYNLIRIWGGGQYEKDILYSLCDEVGILIWQDFMFACGIYPQTIIESVTQE
                     VEDQLIRLRQHCSIVIYAGNNEDYQIAESINLDTNNFTQFPAKHIYEHIIPAKINKLC
                     NLTPYHYGSPYSDHSHKSSNPTIGDLHQWNVWHGTHEPYQNWPQLSGRFVSEFGMLSY
                     PSLNTLAKYINESQLSINSTLLNFHTKAAGKEQLNNYLWNNFPKPKSLEISHYIYLTQ
                     LLQSEAMSLAYRYWRQNWKDYKTGGIIMWQLNDCWPSISWSSIDFLKVPKLAYYGVKR
                     EISQIGIACRRFQIKQQTYKQQNVFEVKQCLDIWGVGEFSKIDVEIEFYNEHGELYFS
                     KSINSCVFLKNKVNMVAEKLCFDNLNDNSIIYLKLIQNGRTIAQSSDWPQPLKKLSWN
                     QMATNITLEYLGEGNFQVSTTKPVKGLEFYFDSIDNYLFDDNGIDLFPNDPQIIHVNG
                     FDNLDVSKIRYRHLVSI"
     gene            <627033..>628054
                     /locus_tag="CD36_27870"
                     /db_xref="GeneID:8049598"
     mRNA            join(<627033..627140,627155..627304,627366..627737,
                     627758..>628054)
                     /locus_tag="CD36_27870"
                     /product="cirt family transposase, pseudogene, putative"
                     /transcript_id="XM_002421801.1"
                     /db_xref="GeneID:8049598"
     CDS             join(627033..627140,627155..627304,627366..627737,
                     627758..628054)
                     /locus_tag="CD36_27870"
                     /inference="similar to AA sequence:UniProt:Q5A204"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="cirt family transposase, pseudogene, putative"
                     /protein_id="XP_002421846.1"
                     /db_xref="GeneID:8049598"
                     /translation="MSKHEVEEIAMQAAINDIKSGAISALRKAARKYGLCETLRKRLQ
                     GVLPQKMAHSKQQLFSPLQEDMIAEWILESEKEGTPRTGKDMVGLEDLKKRHSEIHTV
                     DKKLVSSLTMKSTSRNQAEKFFNNFNQLINDNNIRHENVFRVDVTKYIMGKRNSLKSV
                     IPGDDNKIYVQSFEGYDTCTVIEAVGMTGNDGPIGIVFSGTDLKSKWINGGYFKARHQ
                     LNISPEKIIDCWATTGMYPNNIRKVVSLSRDLVAKLNTETEKKKRRANTTTSKGHETP
                     WVEDIHEHTQEVMAKLEIMENCKRVSRKKERK"
     gene            <629153..>630835
                     /locus_tag="CD36_27900"
                     /db_xref="GeneID:8049599"
     mRNA            <629153..>630835
                     /locus_tag="CD36_27900"
                     /product="glucose phosphomutase, putative"
                     /transcript_id="XM_002421802.1"
                     /db_xref="GeneID:8049599"
     CDS             629153..630835
                     /locus_tag="CD36_27900"
                     /EC_number="5.4.2.2"
                     /inference="similar to AA sequence:UniProt:P37012"
                     /inference="similar to AA sequence:UniProt:Q5A253"
                     /note="Similar to S. cerevisiae PGM2; phosphoglucomutase,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="glucose phosphomutase, putative"
                     /protein_id="XP_002421847.1"
                     /db_xref="GeneID:8049599"
                     /db_xref="GOA:B9WL86"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:B9WL86"
                     /translation="MSELSIKTIETKPFQDQKPGTSGLRKKVTVFQQPHYTENFIQSI
                     LDAIPEGAQNSTLVIGGDGRFYNDVVIQLIIKIAAANGVKKLILGQNGILSTPATSHV
                     IRIRQATGGIILTASHNPGGPENDLGIKYNLGNGGPAPESVTNKIFEISKKLTQYKLI
                     ELPTVDLSKIGSIVIGPIEIEIIDSTKDYVDMLKSIFDFPLIKSFLDKATKEQDFKVL
                     FDALNGVTGPYGYEIFINELGLPESSIQNYKPLPDFGGLHPDPNLTYAHTLVERVDKE
                     NIAFGAASDGDGDRNMIYGAGTFVSPGDSVAIISEYADSIPYFQKQGVYGLARSMPTS
                     GAIDLVAANKNLQCYEVPTGWKFFCSLFDAKKLSICGEESFGTGSNHIREKDGLWAIV
                     AWLNVLAGYNKQNPNSKTSIEIVQNSFWEKYGRTFFTRYDYENVSSEGAGQLMDLLQS
                     IVNEKSVGDELSPGYIIKQADNFSYTDLDGSVSPNQGLFIKFTNGLRFIVRLSGTGSS
                     GATVRLYLEKHCDDKSKYHLKVDEYLANEIQFVLELLKFKQFLNKEQPDVRT"
     gene            complement(<631178..>633166)
                     /locus_tag="CD36_27910"
                     /db_xref="GeneID:8049600"
     mRNA            complement(<631178..>633166)
                     /locus_tag="CD36_27910"
                     /product="GATA zinc finger protein, putative"
                     /transcript_id="XM_002421803.1"
                     /db_xref="GeneID:8049600"
     CDS             complement(631178..633166)
                     /locus_tag="CD36_27910"
                     /inference="similar to AA sequence:UniProt:P42944"
                     /inference="similar to AA sequence:UniProt:Q5A201"
                     /note="Similar to S. cerevisiae GZF3; protein gzf3
                     homologue, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="GATA zinc finger protein, putative"
                     /protein_id="XP_002421848.1"
                     /db_xref="GeneID:8049600"
                     /db_xref="GOA:B9WL87"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:B9WL87"
                     /translation="MMSMSDIQQRPQIPTTTVNVSTAAVNTTSGTTPTTTPTSPIDNI
                     AKHEVQVKPSEDQPVKPKLEQHPDQPSKPPPEQQQQQQQLPTPPTKPPKTTANTSATS
                     TKMSMSGPVCGNCQTQTTPLWRRDETGQVLCNACGLFLKLHGRARPISLKTDTIKSRN
                     RVKQNGSNSQSSKSSGANTPELKSKEGKSGKKSPKSKKKSLTNGNSNGNTSHEHNTLT
                     PLLPATSNNTPTFKSTTNQQQQQQQSQSQSQQHQQQHHHHHNHHYLPNHVLQTHQVPL
                     HYPSSTPTQFAPGLQRITSPLLLSTTSSSSSIRTEPNNNSKLTPIQAAAGALENMSNE
                     LGPSATFKKGNNINGVSLMNKTKKDISSISGSSSIFSSVAPSSSSLSSTSSTSIMTTN
                     NPAPKLPSLGSKISSPSSQPFTRSTTPLQTLPPLHKIASHESSLPPLHNISNYNNNSS
                     GSGDGSGQQSMPTNSQTGQSPINGNQDNNNNNNNNSNNNNNNNNGNNFTTSAHEVTLL
                     KTRISELELVNDLYRTRIMELEAMEQAARLRESSMKKRLDEVMNLQINYQNLLNNGVS
                     SQQQPPPQPQTSGQYYNNNNNNDQGSQSISPNVSITGSTTITSPNSRSKIISETTPTH
                     QQQLGVQVNNNESIILPPLKRERTDELKDGNDNKKVKI"
     gene            <637376..>637972
                     /gene="RHO1"
                     /locus_tag="CD36_27930"
                     /db_xref="GeneID:8049601"
     mRNA            <637376..>637972
                     /gene="RHO1"
                     /locus_tag="CD36_27930"
                     /product="protein Rho1 homologue, putative"
                     /transcript_id="XM_002421804.1"
                     /db_xref="GeneID:8049601"
     CDS             637376..637972
                     /gene="RHO1"
                     /locus_tag="CD36_27930"
                     /inference="similar to AA sequence:UniProt:O42825"
                     /inference="similar to AA sequence:UniProt:P06780"
                     /note="small GTPase of Rho family, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="protein Rho1 homologue, putative"
                     /protein_id="XP_002421849.1"
                     /db_xref="GeneID:8049601"
                     /db_xref="GOA:B9WL88"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WL88"
                     /translation="MVNGPAELRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFE
                     NYVADVEVDGRKVELALWDTAGQEDYDRLRPLSYPDSNVILICFSVDSPDSLDNVLEK
                     WISEVLHFCQGVPIILVGCKSDLRDDPHTIEALRQQQQQPVSTAEGQQVAQRIGAADY
                     LECSAKTGRGVREVFEAATRASLRVKEKKEKKKKCVVL"
     gene            <638618..>641122
                     /locus_tag="CD36_27940"
                     /db_xref="GeneID:8049705"
     mRNA            <638618..>641122
                     /locus_tag="CD36_27940"
                     /product="clathrin Adaptor Protein complex large chain,
                     putative"
                     /transcript_id="XM_002421805.1"
                     /db_xref="GeneID:8049705"
     CDS             638618..641122
                     /locus_tag="CD36_27940"
                     /inference="similar to AA sequence:UniProt:Q12028"
                     /inference="similar to AA sequence:UniProt:Q5A1Z9"
                     /note="Similar to S. cerevisiae APL4; gamma-adaptin, large
                     subunit of the clathrin-associated protein (AP-1) complex,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="clathrin Adaptor Protein complex large chain,
                     putative"
                     /protein_id="XP_002421850.1"
                     /db_xref="GeneID:8049705"
                     /db_xref="GOA:B9WL89"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017107"
                     /db_xref="UniProtKB/TrEMBL:B9WL89"
                     /translation="MASLRSFIKSVRKAKTIADERSVVQKESAAIRTSFRDPGLDQTT
                     RRINISKLLYLYIMGEKTHFGQVECLKLLASPRFADKRLGYLACMLILDENQEVLTLL
                     TNSLDNDMQHPNSFIVGLALCCLGNIASPELARDLYTNVETIIDSKNVYLKKKACIVA
                     AKLIEKEPELAEFFITKINSLINEKQPSLLLGTIRLIQALYFASEESRPILIKTIPKL
                     VADLKRTTTSGYQPDYDVTGTTDPFLQVSLLETLRILARDEQCPPQYLEQINDILTQV
                     ASNLDSGKNAAHAILYECVKTIFAIQSDQSLKILGVNILGKFLSTKDNNTRYVALDTL
                     LTVVTIEPMAVQRHRSTIVNCLSDGDISIRRRALELSFGILNEQNIRVLAREILTFLE
                     RCNDQELKSYVTSQLTIAANKYSPNDKWHFDTLIRMLKVGGNALTPDIISNILALILQ
                     CNDSELKKHIASKLVASCLETTNQYGLALITSWTMGEYGDLILGNTVEVNGKTITITE
                     QKLSQLIDDLINNTNFSESETIQLTSYILTSIIKLSIKFKDNQVIEHLRLILNGKTHD
                     PNLEIQTRAVEYQQIFGQDSTLKRGLLARMPPPPVKQRQALTLHKSTANASTTTTNKS
                     LKKSTNETTGGGSDNLLLDLMDDIVSTPTNQQQQGDVISDIFGGGSSSTNSGSNTNKS
                     TINNAAILDLFNSTTTTTTSSINPAGGSIQEIPAFENNDVRISFIPKSFPQTGEAIIE
                     AIIRSKINDNIDQFQLLIAVPKSQKLTISSTSGGDSLIGGSATTTNESIRQTLKIVGK
                     QGAKIKLRVKVKYHINNNENNSVEDQFDFAGFENNL"
     gene            <641595..>642008
                     /locus_tag="CD36_27950"
                     /db_xref="GeneID:8049602"
     mRNA            <641595..>642008
                     /locus_tag="CD36_27950"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421806.1"
                     /db_xref="GeneID:8049602"
     CDS             641595..642008
                     /locus_tag="CD36_27950"
                     /inference="similar to AA sequence:UniProt:Q5A1Z7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421851.1"
                     /db_xref="GeneID:8049602"
                     /db_xref="UniProtKB/TrEMBL:B9WL90"
                     /translation="MFRLKPIQSTILKKPTSHYTSFPSKRLISHSVGNGTKGQPTWPS
                     FQSLTNSFSRESIKLFGWSMALSVALLIWPIGIVDLSNKIDHVPKDKGAQVQLHRIEG
                     TIDKYDATVEIPQTFVSLDKSDEEEAEDVTVDDEE"
     gene            complement(<642084..>643916)
                     /locus_tag="CD36_27960"
                     /db_xref="GeneID:8049636"
     mRNA            complement(<642084..>643916)
                     /locus_tag="CD36_27960"
                     /product="DNA-directed RNA polymerase III subunit,
                     putative"
                     /transcript_id="XM_002421807.1"
                     /db_xref="GeneID:8049636"
     CDS             complement(642084..643916)
                     /locus_tag="CD36_27960"
                     /EC_number="2.7.7.6"
                     /inference="similar to AA sequence:UniProt:P32349"
                     /inference="similar to AA sequence:UniProt:Q5A1Z6"
                     /note="Similar to S. cerevisiae RPC3"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-directed RNA polymerase III subunit,
                     putative"
                     /protein_id="XP_002421852.1"
                     /db_xref="GeneID:8049636"
                     /db_xref="GOA:B9WL91"
                     /db_xref="InterPro:IPR008806"
                     /db_xref="InterPro:IPR013197"
                     /db_xref="UniProtKB/TrEMBL:B9WL91"
                     /translation="MDEIQMETARTQSPKSYLYTTLATTHLGEIASCIISILISNGRL
                     TAKEISNRTKIPFKNIKSALVSLIQLNCIYYWQEDKNGKFYYSLKETGLLLFVYSGDI
                     INHIKRQYGDEEAEIIQNILIHGHVKIEDYLNQFNQQDDKSKSNSMKINQENKFLKLF
                     NDNWLIKLQDFHFHSLDDIWNKIFQECLKETPRSSVTSEIKRVAEAQAKAKIKLNTLL
                     ESGGSGGDVYTEINGIKKLKPELVVTFNLSRFQKHLRTNAFVNMVRSKIGVLTAIIYN
                     AALKYIEIKSPSLEYPLLNIPGLINDPKDVKEYILSMENKLVNEKKITFSARDIQRLL
                     PKEIDFKSSIITPTFAKPKRPLENGDNSNNNNNTSSSPTSKKIKLEDGIASSVSTSTS
                     SSSSSSNGSLVDLNIIEQHLKLLLNGTNTPFVNEISPGNYTIPFSHLTNILKQNNFES
                     LVKATLGDYAFRILRCVKSMKLCDEKTISNGALLKEKTVRSELYHLIKANIIEIQEVP
                     RSADRAASKTFYLFRYKNNNNSFNYLINCLIYDMAEILNRIQDFKSEHKILLEKYKLV
                     EGQEDQYLLDRELKLLNDLQLREIKNLVKFQRIKSLYSLYNLVD"
     gene            <645250..>648015
                     /locus_tag="CD36_27970"
                     /db_xref="GeneID:8049967"
     mRNA            <645250..>648015
                     /locus_tag="CD36_27970"
                     /product="oligopeptide transporter, putative"
                     /transcript_id="XM_002421808.1"
                     /db_xref="GeneID:8049967"
     CDS             645250..648015
                     /locus_tag="CD36_27970"
                     /inference="similar to AA sequence:UniProt:Q06593"
                     /inference="similar to AA sequence:UniProt:Q59UZ4"
                     /note="Similar to S. cerevisiae OPT2;
                     one of a number of putative oligopeptide transporters on
                     chromosome R; this gene not present in Candida albicans at
                     this locus"
                     /codon_start=1
                     /transl_table=12
                     /product="oligopeptide transporter, putative"
                     /protein_id="XP_002421853.1"
                     /db_xref="GeneID:8049967"
                     /db_xref="GOA:B9WL92"
                     /db_xref="InterPro:IPR004648"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:B9WL92"
                     /translation="MTQEPIIPVISQIKTIQSHLQTQDHEINLDIITSQQFSLGDIAT
                     SLTNDQKWFVLKRLHFDTLVSFKNLPTSAIFILEKLENLSIEEAIELLKSAILEHNND
                     VNIPENDLILWRKLIEWNDKIAEKNSIDSNNNTSSSNNEKDLINSKIDINSIEKGNGN
                     NTANGNFSYHQIVDWELQIRLEAVLVAYWSPYPEVRAVTFPFDDPKIPVETFRVYLIG
                     FIWTAIGAVINQFFAERRPAISLSMAVVQVFLYPSGILCQWILPNWEFQIWKLTINLN
                     PGPYTYKEQMLATIFCGVTGGGTSYAAWNILMQKSSLFYNNQWVDFGYQVLLILCTNF
                     MGIGLAGIMRKFAVYPTKAVWPSVLPNLALNKTLLTPGKKEIINGWTIPSYNFFFITF
                     IISFIYFWIPDYLFQALSTFNWMTWIKPDNLNLAVITGSVGGLGLNPITTFDWNYLSA
                     LLQPLQVPFFNTASNLVGMFIAFFCIIGVWYSNYKWTGYLPINDNGLFTNTGQRYSVS
                     SVVNKNSLFDNAKYQEIGPPFYTAGNLVVYGAFFALYPFHIVYEIGMNYEQMWDACTS
                     FWRVIKNYKKSTYDGFNDPHCTMMKAYPEVPEWAYLIIVVIALVLAILCVKLYPAETP
                     VWGIFFALGTNVVFLIPLTTIYARTGFSFGLNVLVELIVGYAIPGNGLALAFIKALGY
                     NIDGQAQNFVNDLKQGHYAKLPPRAVYRAQILSVFIASFIQLGILNFQINGGIKDYCD
                     PKNTQKFTCPNARTFYSASVLWGVIGPKRVFNGLYPILRWCFLIGFLIAFPCIIIKRW
                     GPRKYVKYFEPSIIIGGFLNYAPYNLSYYIPGFYVSFVFMSYIKKNYEAWWQKYNYIL
                     STGLNAGIAFSSIIIFFAVMYHAKDINWWGNNVMYEGMDYLMSGWLNATIDAPDGYFG
                     PRVGHFP"
     gene            <650634..>652898
                     /locus_tag="CD36_27980"
                     /db_xref="GeneID:8049968"
     mRNA            <650634..>652898
                     /locus_tag="CD36_27980"
                     /product="autophagy-related protein, putative"
                     /transcript_id="XM_002421809.1"
                     /db_xref="GeneID:8049968"
     CDS             650634..652898
                     /locus_tag="CD36_27980"
                     /inference="similar to AA sequence:UniProt:Q06628"
                     /inference="similar to AA sequence:UniProt:Q5A1Z5"
                     /note="Similar to S. cerevisiae ATG13"
                     /codon_start=1
                     /transl_table=12
                     /product="autophagy-related protein, putative"
                     /protein_id="XP_002421854.1"
                     /db_xref="GeneID:8049968"
                     /db_xref="GOA:B9WL93"
                     /db_xref="InterPro:IPR018731"
                     /db_xref="UniProtKB/TrEMBL:B9WL93"
                     /translation="MLSDFKQQQQKHHSQHPSHNHEDSQTKLQIAKLTQVIQKFFTKA
                     AQIILESRAYPETSTPSLYPTKEESSKINKWFNLYMTNIPDSCRDDLKLWKAAGLTTI
                     PPMIIETYLDLRNLPANQTLVLIDDEKHPWTVAKSRGKKQEVVLERWLIEFEPNTTDA
                     TVMVDELPLSYKQAIILFRSIYGFTRLMPAFKVKRNLQNKLPLGNKILDGNQPISSKG
                     RIGLSKPIINTRANESHMTQKYFQPVHTSLGTLKISVAYRIDSEFCLHENEELLSTHF
                     HKHDEEEETKKKVSSSVSPLSSGTSLKETSTSPRKSQPPIRIQPFKVGSMSTSPPVQS
                     PALSQPGTATIQNQPSMPSSSLERRVSITSNKSTSNASLAAFLRNARSSTPSTNTIPI
                     MNANPISGTSVPRSFSSSTGHEDSIFVNPDSASNTPRFASSFGSRASRRYSSTSIRQQ
                     TPQSDLMGHTNSVDAALSGIDVDDDDISDFVRMIDSKSDLRLGGGGGGSGGHSSVHNI
                     GANESSYHGDALNKFQSMRSQYQQLSDSVSASLILQSRHSSRKSSLNSPAGSFDSRHH
                     QQQQNQQQLQSQHTNIIASIHSYSHSRIKDARPKSEDHQQTKFSSARRSSNISPTTAV
                     PSSTGTPSSINSRLPQVSTIISSSDVSSTGGNRTKSAATTAIVSGMATTPSIYDYRSP
                     RYQNVFDDEEEDDNEEEEGHHEGHQSREGRDSTESSQNQSKRIMKHTKKDEEDSEDDE
                     DLLFTMSDMNSRNF"
     gene            complement(<653687..>654508)
                     /locus_tag="CD36_27990"
                     /db_xref="GeneID:8049969"
     mRNA            complement(<653687..>654508)
                     /locus_tag="CD36_27990"
                     /product="aquaporin water channel, putative"
                     /transcript_id="XM_002421810.1"
                     /db_xref="GeneID:8049969"
     CDS             complement(653687..654508)
                     /locus_tag="CD36_27990"
                     /inference="similar to AA sequence:UniProt:P53386"
                     /inference="similar to AA sequence:UniProt:Q5A1Z4"
                     /note="Similar to S. cerevisiae AQY1"
                     /codon_start=1
                     /transl_table=12
                     /product="aquaporin water channel, putative"
                     /protein_id="XP_002421855.1"
                     /db_xref="GeneID:8049969"
                     /db_xref="GOA:B9WL94"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:B9WL94"
                     /translation="MVAESSSIDNTANDVEAQRPVYEPKYDDSVNVSPLKNHMIAFLG
                     EFFGTFIFLWVAFVIAQIANQDPTIPDKGSDPMQLIMISFGFGFGVMMGVFMFFRVSG
                     GNLNPAVTLTLVLAQAVPPIRGLFMMVAQMIAGMAAAGAASAMTPGPIAFTNGLGGGA
                     SKARGVFLEAFGTCILCLTVLMMAVEKSRATFMAPFVIGISLFLGHLICVYYTGAGLN
                     PARSFGPCVAARSFPVYHWIYWVGPILGSVIAFAIWKIFKILNYQTCNPGQDSDA"
     gene            <659022..>664754
                     /locus_tag="CD36_28000"
                     /db_xref="GeneID:8049525"
     mRNA            <659022..>664754
                     /locus_tag="CD36_28000"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421811.1"
                     /db_xref="GeneID:8049525"
     CDS             659022..664754
                     /locus_tag="CD36_28000"
                     /inference="similar to AA sequence:UniProt:Q5A243"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421856.1"
                     /db_xref="GeneID:8049525"
                     /db_xref="UniProtKB/TrEMBL:B9WL95"
                     /translation="MGDSEQFPSPFNINPIYPNNNNNKHKRQEKLLSTNTKSTPSPTP
                     QSHSTPLPSFLNNTNGKSINNSNVITTTNNLTASISNTGILSNTKFKAKDADDVIDWI
                     DSLKSRYEQLIIHQKNELNEITNDELMRKQQQATIEKYSSMHFDQDYEKLGYLLKSQD
                     IHHPQNESQQKEMIDSDHEEEEKEDEEEEEEEEIIEILSSEPEDERLEQATIQEDYSR
                     FNEHLQYPQMTHDYSNNLQISGIDYGTHFNQNIEYDEEEDSENNEDEGEEEEFEGYID
                     DQVHEVQGSSNYEYDEDEDEIIDEGDEVEEEEENVGQYNYRVDIQNQQRGYGTTNVPG
                     YTVVNGRPRLSDNLGYGHAETFDNKSQDSEEDEQEEEETDQEEHSEEEANYFAQNIHH
                     GMPIETIDLGDSEDDSNESGSGNDDSENGLSNEDELHSGSDNLNDSGFEGYEAGREEQ
                     EEGEIGIGHGYYSNNELLDFAATALLQGKIHEHKSKHSQSGYIADSEFTDNNLPVLQT
                     PNTETEEGQGGYLNKHNNIGNDHGLEENNNSSARISYRSEGLAPVPDPFYAHELSNEK
                     MVGVVNDFDENRSEGSLADESQFESMKPNVNLPTQDNPTDNDQHHQENQHHDQESEYS
                     SSDEINPPIPVFKTIEEEEPEVVLQKLKETEKKYNIKLDAVEELQRDLNLAIEHSNDG
                     SLVPPMESHNSKSIQSKEEEEEEEKKQEQENEPIIEYDTSEEEDEDWEHGVEKIEEIV
                     DIEEVNDIEEVEVIKETVEMKIAEDFEIQEVDEDEEHSEVDAIEEVELSDEENDIEIE
                     NEEVQELATAIEKEEPQEYAAVEESLASSVLIDPELQDAMEICEDIETIEQPPAETDT
                     TTMDQTENLTIIEPPVVQDYKLPLSESQHATDEEKQTLEPDSIDEEKHEVNENSILHN
                     FQDYNISVPTIEKIPEEETVDLESANQASQTYFDESDKDREQELQVQGKDSDEEDEEE
                     EEEEEEEEEVEEGDGEEEGQVDKEYVEEIQDQEEYLEQHRYVISIQDEEEDKEEDEDQ
                     EEQQYDMSIQDEDDNVRQDLEDENILVTNEEQEPQPHVESEKFELTESLKTDDKKETT
                     NDIEESGVSDNPEEKDDEEKVVLESIETPELASIVQDESESSESVSAEEEESESSTGD
                     ESPQPDDDLTRISTPEAQSQQINLQDEQESGSEEKSVASETEAAMDTTSLVNDAEIPE
                     SADSENLLSEDSASSQSERHSEVNEENSLDDEQFERINLENIFKTSFNDTSEEEEDKM
                     EDTVKDLVEEKIVNGQSTATANQEEVVLEVVNQEDDTDEEDMEPLVQEVKIDMNLNDQ
                     YEVEAESNSEPESESDSESSSDSHVDVIHNDIQVPKLEDIEDSQASSSNDEADHISST
                     NKIDEEDLDEQTTSDYSDHDLAPESSDEEVQSSNESLEEEVIEHEFNSVEEQSVEDSF
                     DESAQNNNANNDFNKVELEHQSIEGSANKSDIEDVKNNQIVKQEYTPVKSIEEDHEAE
                     YPEEPESFEDETDEEFPQLNAIADELDNHYDTVEETTLPRKRPNENNSEPVSSMKRLR
                     TAVGSFVCGIFQSNQEAEEINQNSENSSEESSPNHIDTDYETGTEISITTKIEIPTLE
                     RESESSEVIEETDREEFQSDEIGQIYRSSDDVKFPLEQDTNASFNEENLTGLASIISS
                     KNIFEYRRPVIMKRRNRRRGRRTVKWSHMITNELELIQAEKLNVSTLIENQEPSDIAN
                     DRETVVKTNNLVEESNASDNSVGNNKVTSVIKKEPQNNVDTDSDIQNEQQTISLPKTR
                     NTSKRKPSSRQRFMGLVPEELEELGLDPNTVSEDNNEADSTYNGRRLRSQGGKHSLSL
                     QSSPVDSIELKDRPASRTRSKSPLKQSMKDLLELEKDTKAGNERKPRVNSGSRSQYKN
                     DDLRGRSRER"
     gene            complement(<664914..>666005)
                     /locus_tag="CD36_28010"
                     /db_xref="GeneID:8049526"
     mRNA            complement(<664914..>666005)
                     /locus_tag="CD36_28010"
                     /product="mitochondrial carnitine/acylcarnitine carrier
                     protein, putative"
                     /transcript_id="XM_002421812.1"
                     /db_xref="GeneID:8049526"
     CDS             complement(664914..666005)
                     /locus_tag="CD36_28010"
                     /inference="similar to AA sequence:UniProt:Q5A1Z2"
                     /inference="similar to AA sequence:UniProt:Q8N8R3"
                     /note="Similar to Homo sapiens SLC25A29"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial carnitine/acylcarnitine carrier
                     protein, putative"
                     /protein_id="XP_002421857.1"
                     /db_xref="GeneID:8049526"
                     /db_xref="GOA:B9WL96"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:B9WL96"
                     /translation="MSSDIEQTNNPPMRGIPAITGPIDYTKAFHVFPKELQPFRGSIL
                     AYGASLFSTLVGFPLDTVKTRMQTHKNFASYFDCVKKTYAKEGVRGFFRGIWAPIIST
                     SLSKSLSVSLFTTVKPYTYTLLYETPWTKNIENSHPFLRNIPVCFLSGLIAGGGVSLF
                     ACPFEFTKVYAQLEKLVASKSLKELSNLNNGNGNGTGGSSAAQLAQFNSIKTPSTAVI
                     VKEILKYEGIRGLYSGYKYHLMRDSISTGFYYSIYESMKWSINNFINKDPSVSSPFSV
                     LLAGGMSGVLSWVLIFPIDTTKSLVQKDAVTNILRRSHGLEPLPPKHRKLQKFEKRAY
                     RGLGISVTRSFIVNMVFFGVFELGMTYLA"
     gene            complement(<666620..>667198)
                     /locus_tag="CD36_28020"
                     /db_xref="GeneID:8049527"
     mRNA            complement(<666620..>667198)
                     /locus_tag="CD36_28020"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421813.1"
                     /db_xref="GeneID:8049527"
     CDS             complement(666620..667198)
                     /locus_tag="CD36_28020"
                     /inference="similar to AA sequence:UniProt:P38175"
                     /inference="similar to AA sequence:UniProt:Q5A1Z1"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421858.1"
                     /db_xref="GeneID:8049527"
                     /db_xref="GOA:B9WL97"
                     /db_xref="InterPro:IPR001911"
                     /db_xref="UniProtKB/TrEMBL:B9WL97"
                     /translation="MMKSILGSGLINNIVKSSLNKAVLRPSFTPIRFNSNNANLDQLK
                     SIFNQPSEKSTTKDSQSKSTLNIDDLLSNSILETRERPQSNSFGVYDKFGFEQTRQPT
                     PREVAKNIREFGVNAGRTVDVNYNNISRSLAQIKRVVNDNKIRYLQRIQSRFIRPAKY
                     RKQLKREWWRRRFSQGFKELLHEVNDARRRGY"
     gene            <667675..>668535
                     /locus_tag="CD36_28040"
                     /db_xref="GeneID:8049528"
     mRNA            <667675..>668535
                     /locus_tag="CD36_28040"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421814.1"
                     /db_xref="GeneID:8049528"
     CDS             667675..668535
                     /locus_tag="CD36_28040"
                     /inference="similar to AA sequence:UniProt:Q5A1Y9"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421859.1"
                     /db_xref="GeneID:8049528"
                     /db_xref="UniProtKB/TrEMBL:B9WL98"
                     /translation="MMRSDPKTYRSKVLYECRDGASLYSIPCTDNLSTIKFTERNKIW
                     QGSLLFIEKEQLSNSYMEGFEQTKNDKFIIHPFLKMKSKLEFRNGQYLWGETWYCPVV
                     EDLSLSSTTATNIDVQKISKISHDGTSTIQQVSSNRFKVIVQLPNSGYKPYYPDHSPN
                     DLPQVALGLEFEDPDMAAQFEYMLAVYDARFKYESQSYYYDRMVYAINIINFKTIMQE
                     QDEEEEEDIHELTEEFKNQSITDEFSYYEKTSRELQEFEKDNADDFVHDDDDDDVNDD
                     DDDFGDFIAC"
     gene            complement(<668676..>671216)
                     /locus_tag="CD36_28050"
                     /db_xref="GeneID:8049529"
     mRNA            complement(<668676..>671216)
                     /locus_tag="CD36_28050"
                     /product="DNA repair helicase, putative"
                     /transcript_id="XM_002421815.1"
                     /db_xref="GeneID:8049529"
     CDS             complement(668676..671216)
                     /locus_tag="CD36_28050"
                     /EC_number="3.6.1.-"
                     /inference="similar to AA sequence:UniProt:Q00578"
                     /inference="similar to AA sequence:UniProt:Q5A1Y8"
                     /note="Similar to S. cerevisiae RAD25"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA repair helicase, putative"
                     /protein_id="XP_002421860.1"
                     /db_xref="GeneID:8049529"
                     /db_xref="GOA:B9WL99"
                     /db_xref="InterPro:IPR001161"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WL99"
                     /translation="MSSRNRERVNYADLEDENFSDEDVYVSNKTGAKDNDDDEYNSPS
                     QKSRKQTGSSTNNSKKRKAQESVDSLKQNLDETNYSDNELIELTPDIPADYIPDAVSK
                     NFGKGDFSYLKLKPDHFSRPIWISPNDGRIILESFSPLAEQAQDFLITIAEPISRPSH
                     IHEYRITAYSLYAAVSVGLETDDIISVLNRLSKVPVAESILNFIKAATVSYGKVKLVL
                     KHNRYFVESTQADILQMLLKDPVIGPLRIQSSDNTVTSNGLITSASAPADIVIPGTKK
                     NDSTKEDPSGNGAEDIFASVVGSRDDDDDMDTIHSFEIAHDSVEIVKRRCQDIEYPVL
                     EEYDFRHDARNPDLEIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVG
                     ITAACTIRKSVIVLCTSSVSVMQWRQQFLQWCTIQPENVAVFTSENKEMFASESGLVV
                     STYSMVANTRNRSHDSQKVMDFLRSREWGFIILDEVHVVPAQMFRRVVTTIAAHAKLG
                     LTATLVREDDKIDDLNFLIGPKLYEANWMDLAQKGHIANVQCAEVWCPMTAEFYQEYL
                     RESARKRMLLYIMNPTKFQACQFLIHYHEKRGDKIIVFSDNVYALQEYALRLGKPFIY
                     GSTPQQERMKILQNFQHNDQINTIFLSKVGDTSIDLPEATCLIQISSHYGSRRQEAQR
                     LGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYSTKRQAFLVDQGYAFKVITHLSGMEQ
                     LPDLAYSSARERRELLQQVLLKNEDAAGLEIGDDADTNFISKEKRMRLEQERNGGGAT
                     YTSGSLAGLAGGEDMAYIEYGKNKNKELRESHHPLIQKMYYKQSKAKK"
     gene            complement(<671554..>672525)
                     /locus_tag="CD36_28070"
                     /db_xref="GeneID:8049530"
     mRNA            complement(<671554..>672525)
                     /locus_tag="CD36_28070"
                     /product="chaperone of small nucleolar ribonucleoprotein
                     particles (snoRNPs), putative"
                     /transcript_id="XM_002421816.1"
                     /db_xref="GeneID:8049530"
     CDS             complement(671554..672525)
                     /locus_tag="CD36_28070"
                     /inference="similar to AA sequence:UniProt:P32583"
                     /inference="similar to AA sequence:UniProt:Q5A235"
                     /note="Similar to S. cerevisiae SRP40;
                     nucleolar protein involved in pre-ribosome assembly or
                     transport, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="chaperone of small nucleolar ribonucleoprotein
                     particles (snoRNPs), putative"
                     /protein_id="XP_002421861.1"
                     /db_xref="GeneID:8049530"
                     /db_xref="GOA:B9WLA0"
                     /db_xref="InterPro:IPR007718"
                     /db_xref="UniProtKB/TrEMBL:B9WLA0"
                     /translation="MSLNTQDLVLAYINDYVSRNEKLSKLKKPLSKLLAGKELPKVSK
                     QLESIIKEVEDLEKEHNSNSSSSESESSSSDSESSSSDSESSSSDSESSSSDSESSSS
                     DSESSSSDSESSSSDNESSSSDSESSSSDSEDSEDSEDKKVKKDNKDSSPASSSDSDS
                     DSSSDSSSNSDSESDDKSSESSSEDEDSSSDSESEEEQKQPKDKKRKHTNDAKEEKSI
                     KKFKNDSESTASSSTESIPATPEPELKPGQRKHFSRIDRSKVTFQSSVLQDNTYKGAA
                     GTWGEKASEKLLQVRGKDFTKNKNKMKRGSYKGGSITLASGSYKFED"
     gene            complement(<672883..>673911)
                     /locus_tag="CD36_28080"
                     /db_xref="GeneID:8049531"
     mRNA            complement(<672883..>673911)
                     /locus_tag="CD36_28080"
                     /product="GTP cyclohydrolase, putative"
                     /transcript_id="XM_002421817.1"
                     /db_xref="GeneID:8049531"
     CDS             complement(672883..673911)
                     /locus_tag="CD36_28080"
                     /EC_number="3.5.4.25"
                     /inference="similar to AA sequence:UniProt:P38066"
                     /inference="similar to AA sequence:UniProt:Q5A1Y2"
                     /note="Similar to S. cerevisiae RIB1"
                     /codon_start=1
                     /transl_table=12
                     /product="GTP cyclohydrolase, putative"
                     /protein_id="XP_002421862.1"
                     /db_xref="GeneID:8049531"
                     /db_xref="GOA:B9WLA1"
                     /db_xref="InterPro:IPR000926"
                     /db_xref="UniProtKB/TrEMBL:B9WLA1"
                     /translation="MTSIKHPQPSAASTNSQGIRTPPTLSTSPDLDVNRIPMVTPKPS
                     TNSLPVTTPQPPPAITQSMRNKSGLPDSLPHVKCLARARIPTTQGPDIFLHLYENNID
                     NKEHLAIVFGEDIRSRSLFKHYPGETQQDRMTRGAYIGRLTPGRTIADSDGTDELKFD
                     KEGNLIIDSLTYTDPTLVRIHSECYTGETAWSARCDCGEQFDEAGRIMGEAGHGCMVY
                     LRQEGRGIGLGEKLKAYNLQDLGADTVEANLILRHPADGRNFSLATAILVDLGLVEIK
                     LLTNNPDKIVAVEGKHQEVKVLERVPMVPLSWGKDGKNGIRSKEIEGYLSTKIERMGH
                     LLEKPIKI"
     gene            complement(<675593..>676093)
                     /locus_tag="CD36_28090"
                     /db_xref="GeneID:8049532"
     mRNA            complement(<675593..>676093)
                     /locus_tag="CD36_28090"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421818.1"
                     /db_xref="GeneID:8049532"
     CDS             complement(675593..676093)
                     /locus_tag="CD36_28090"
                     /inference="similar to AA sequence:UniProt:Q5A1Y0"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421863.1"
                     /db_xref="GeneID:8049532"
                     /db_xref="UniProtKB/TrEMBL:B9WLA2"
                     /translation="MFSRQLARHIERNKHIRSFSLTQWFKSWKEAAQSQRLVYPPPAS
                     QFTTQNRIIDTYITNKQELYTYLSVKPPLLLNFTFATEENNKVTQASFDVLSDKSKYP
                     NTEPVYLVNILADSEGGRELMLDYVVGPKIPSIVVLKHQLPSGKYVPNLETFTEQDLV
                     EWLKHI"
     gene            complement(<676319..>676930)
                     /locus_tag="CD36_28100"
                     /db_xref="GeneID:8049533"
     mRNA            complement(join(<676319..676769,676833..>676930))
                     /locus_tag="CD36_28100"
                     /product="mitochondrial FAD-linked sulfhydryl oxidase,
                     putative"
                     /transcript_id="XM_002421819.1"
                     /db_xref="GeneID:8049533"
     CDS             complement(join(676319..676769,676833..676930))
                     /locus_tag="CD36_28100"
                     /EC_number="1.8.3.-"
                     /inference="similar to AA sequence:UniProt:P27882"
                     /inference="similar to AA sequence:UniProt:Q6FTP2"
                     /note="Similar to S. cerevisiae ERV1;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial FAD-linked sulfhydryl oxidase,
                     putative"
                     /protein_id="XP_002421864.1"
                     /db_xref="GeneID:8049533"
                     /db_xref="GOA:B9WLA3"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:B9WLA3"
                     /translation="MSTTETKEKTESGGKPEVGVTGRKIVYDKDGKPCRTCNSLLDFQ
                     FASGKIKKSPVLHESKKENKPELESYPQDEPPDVTELGKSSWTLLHSIAATYPETPTT
                     KQQQDMKSFINLFSGFYPCWFCAEDFQKYITKNEPKTGNQEELGRWLCEAHNEVNKKL
                     NKPQFNCDLWKKRWKDGWDNEE"
     gene            complement(<677240..>678022)
                     /locus_tag="CD36_28110"
                     /db_xref="GeneID:8049534"
     mRNA            complement(<677240..>678022)
                     /locus_tag="CD36_28110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421820.1"
                     /db_xref="GeneID:8049534"
     CDS             complement(677240..678022)
                     /locus_tag="CD36_28110"
                     /inference="similar to AA sequence:UniProt:Q59UD8"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421865.1"
                     /db_xref="GeneID:8049534"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="UniProtKB/TrEMBL:B9WLA4"
                     /translation="MISFLRKRNILDNFIKAHIGPTRQSPRSFHHSTRIMNSIKDLSE
                     NVWQPQDALPKHIKDLLTPGTQPVNYMFAFLQIIRSLKYQKRTGWLDHGIPAEATESI
                     ADHMYRMGVISMLVPKEVDSNKCVKIAIVHDIAECLVGDITPYAGITKAEKHRRELAT
                     INYLSELIKPYNEEFSKEMLELWLDYEEIRNLEARYVKDIDKYEMIQTAWEYELQFGL
                     KHNLDQFYTARQAIKTSEIGELCDALLEKRDELIKQLKAQES"
     gene            complement(<678559..>679362)
                     /locus_tag="CD36_28120"
                     /db_xref="GeneID:8049535"
     mRNA            complement(join(<678559..678959,679314..>679362))
                     /locus_tag="CD36_28120"
                     /product="60S ribosomal protein L28"
                     /transcript_id="XM_002421821.1"
                     /db_xref="GeneID:8049535"
     CDS             complement(join(678559..678959,679314..679362))
                     /locus_tag="CD36_28120"
                     /inference="similar to AA sequence:UniProt:P02406"
                     /inference="similar to AA sequence:UniProt:Q6BY35"
                     /note="Similar to S. cerevisiae RPL28;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L28"
                     /protein_id="XP_002421866.1"
                     /db_xref="GeneID:8049535"
                     /db_xref="GOA:B9WLA5"
                     /db_xref="InterPro:IPR001196"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="UniProtKB/TrEMBL:B9WLA5"
                     /translation="MPTRLTKTRKHRGNVSAGKGRIGKHRKHPGGRGKAGGQHHHRTN
                     LDKYHPGYFGKVGMRYFHKQQNHFWRPEINLDKLWTLVDSEKKDEYLSKSSASAAPVI
                     DTLAHGYGKVLGKGRLPEVPVIVKARFVSKLAEEKIRAVGGVVELVA"
     gene            complement(<679686..>681167)
                     /locus_tag="CD36_28130"
                     /db_xref="GeneID:8049536"
     mRNA            complement(<679686..>681167)
                     /locus_tag="CD36_28130"
                     /product="glucose transporter of the major facilitator
                     superfamily, putative"
                     /transcript_id="XM_002421822.1"
                     /db_xref="GeneID:8049536"
     CDS             complement(679686..681167)
                     /locus_tag="CD36_28130"
                     /inference="similar to AA sequence:UniProt:P38142"
                     /inference="similar to AA sequence:UniProt:Q59UD9"
                     /note="probable metabolite transport protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="glucose transporter of the major facilitator
                     superfamily, putative"
                     /protein_id="XP_002421867.1"
                     /db_xref="GeneID:8049536"
                     /db_xref="GOA:B9WLA6"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WLA6"
                     /translation="MTISIPSGLTLNLISSVSVICLGSLQFGYHMAELNSPELVLSCK
                     RSQPGAVPYEDSFFGRNGFKQCIPMTPDQIGLATSIFSIGGLFGSFYVGHLADKYGRK
                     KTSLLHCLLYIIGSFINGLSNTYASLLLGRFICGLGAGSALVITSIYINEVSPIETKG
                     LLGSMNQFSINIGILFTQLLSLKWSNDNDWRWLLFMASFIAIANVIVVSSYLNESPVW
                     LANQGNTTQAFTILHGLRGGSYSVATDEVNSWKSQGRGTTPESDTLLEEGNGSEHSSS
                     GATAGGSSNKNLVTVVDYVSLPEYRNSLIASTGILVLQQFDGINSIIFYGVSVLVSIF
                     PNHSIIINCLISLVNVIVTFISATIVDKLGRKPLLLLSVSFLGIATVLMGLGIIWTSS
                     VLSIAGTFTYITFFAIGMGPIPFLLVGEVTQPIAKASAQSWGTSMNWIATFIVGYTFP
                     VLKEWLGGSVYFIFTVMCCVSVWFIKTKVPETKGKHSYQEVWS"
     gene            complement(<681517..>683301)
                     /locus_tag="CD36_28150"
                     /db_xref="GeneID:8049537"
     mRNA            complement(join(<681517..683124,683227..>683301))
                     /locus_tag="CD36_28150"
                     /product="transcriptional regulatory protein, putative"
                     /transcript_id="XM_002421823.1"
                     /db_xref="GeneID:8049537"
     CDS             complement(join(681517..683124,683227..683301))
                     /locus_tag="CD36_28150"
                     /inference="similar to AA sequence:UniProt:P38140"
                     /inference="similar to AA sequence:UniProt:Q59UE1"
                     /note="spliced gene; zinc cluster domain-containing,
                     DNA-binding transcription factor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="transcriptional regulatory protein, putative"
                     /protein_id="XP_002421868.1"
                     /db_xref="GeneID:8049537"
                     /db_xref="GOA:B9WLA7"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR013767"
                     /translation="MNIEQENITNTTLTNTNNVNDKPKPKRKKTSRACNHCHKAHMTC
                     DPGRPCQRCIQRGLGSTCEDAPRKRKKYLEDVPNSSLMSSHSINSSDHLDSNGVTPMQ
                     STLSLPMPPVQESPFSTSAPTQSQVPAYTPSTVPQRQPSYSPQVASNYSPNHKTYSAT
                     LFQHSATSPELMQTVPEYFPELHNQHYQPSANPNQKRRTNFLSTAADLEYSTLSNILQ
                     ENFGHHTTSNEGTPNSHNFSPALSPHNMPTTDTNAPPPSIQLASNDQRQVTSFNNHTK
                     HSTPSPLNTSQTKLYEDARYPKCDETINQYFLGDTESGKMVVFPDVLTAIENMKNNDP
                     AVYVERNSKSTLSFAMSISHESNSNNGKDGQLFKEPEEIYEKVKKPFSYTPGYHSLIA
                     YLRKRFTKPMLVKMAESMATYRPSFIACTNSLKEHDLIFMEQCFQRTLLTYDNYIKIS
                     GTPTIVWRRTGEVAYVGNEFCVLTGWPKEELIGKDKRKFIVELLDDKSVLQYFQVFSR
                     IAFGDFLGATMTECTLLTPNPNVKIRTGCMWTLKRDVFGIPMMIVGNFLPIL"
     gene            <684200..>685312
                     /locus_tag="CD36_28170"
                     /db_xref="GeneID:8049538"
     mRNA            <684200..>685312
                     /locus_tag="CD36_28170"
                     /product="amino acyl-tRNA synthetase complex component,
                     putative"
                     /transcript_id="XM_002421824.1"
                     /db_xref="GeneID:8049538"
     CDS             684200..685312
                     /locus_tag="CD36_28170"
                     /inference="similar to AA sequence:UniProt:P46672"
                     /inference="similar to AA sequence:UniProt:Q59UE4"
                     /note="Similar to S. cerevisiae ARC1"
                     /codon_start=1
                     /transl_table=12
                     /product="amino acyl-tRNA synthetase complex component,
                     putative"
                     /protein_id="XP_002421869.1"
                     /db_xref="GeneID:8049538"
                     /db_xref="GOA:B9WLA8"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:B9WLA8"
                     /translation="MSDLIAKFSKISLADISKSDSSKFPELSAEQKALASQFETLAKR
                     LDEPESLIALNDSLRTKTFIVGNIPSHSDLVVFEKVFSLASQWTSKNDIAKYRHILRW
                     VDLVQNTLVSVPEPIKIDYDIDIPREVKEKKKPAKEAEKSATPEPKAKATPDAAQGQR
                     KELTEEEKKAKAAAKEAKKAAKAKANAEKNKQPQQAAVATPPNPSMIDFRVGFIEKAE
                     KHPNADSLYMSTIDMGDAEGPRIVCSGLVKYIPIEEMQKRYVVVVANLKPVTMRGVKS
                     CAMVLCASDAEKVEFVNPPAGSKPGDKIFFEGYNGTPEKQLNPKKKIWEAVQPHFSTN
                     ENYEVTYTEEGKEPKRLVNEKGELCKNSSIVKADVK"
     gene            <685572..>686753
                     /locus_tag="CD36_28180"
                     /db_xref="GeneID:8049539"
     mRNA            <685572..>686753
                     /locus_tag="CD36_28180"
                     /product="RNA-binding protein required for meiotic cell
                     division, putative"
                     /transcript_id="XM_002421825.1"
                     /db_xref="GeneID:8049539"
     CDS             685572..686753
                     /locus_tag="CD36_28180"
                     /inference="similar to AA sequence:UniProt:P33309"
                     /inference="similar to AA sequence:UniProt:Q59UE5"
                     /note="Similar to S. cerevisiae DOM34"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA-binding protein required for meiotic cell
                     division, putative"
                     /protein_id="XP_002421870.1"
                     /db_xref="GeneID:8049539"
                     /db_xref="GOA:B9WLA9"
                     /db_xref="InterPro:IPR004405"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:B9WLA9"
                     /translation="MQVKNKVKLKDKNVAITLVPEDSEDLWYLYNLLKKGDTVQLVTH
                     RNVKKGNQAQITKGKSKMEKIVVRLKLLVEDIDYIASDQTMRINGKSLVQQEYIPLNS
                     FHTAEVELNKELTILKDNWDEYDMTLLNELCSIENKADIGAVVFQEGVAHICYVADSM
                     TVLKAKVEKSIPRKNNEYGTRDLEKAMNSFFNMIISSMTRHFDFEKLKVVILASPGFL
                     AKTLYDRLIQECLNLQNSGKESKVYSSILKNKGKFLIAHASTGYLQGLEEVLNDPQTK
                     KRLADTKFLEESEALQRFQRALNDDDGRAWYGLDEITKALNMDAVRYLMVSDALFRSD
                     DIEERRHYIDLTEQAKNLGAKVYIFSSLHESGEQLNQLTGIAALLKYPVPDLDESDEE
                     D"
     gene            complement(<686777..>687352)
                     /locus_tag="CD36_28190"
                     /db_xref="GeneID:8049540"
     mRNA            complement(<686777..>687352)
                     /locus_tag="CD36_28190"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421826.1"
                     /db_xref="GeneID:8049540"
     CDS             complement(686777..687352)
                     /locus_tag="CD36_28190"
                     /inference="similar to AA sequence:UniProt:Q59UE6"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421871.1"
                     /db_xref="GeneID:8049540"
                     /db_xref="UniProtKB/TrEMBL:B9WLB0"
                     /translation="MSESITITANSIDSSDTDVRRNERFHLVPRKRLEALVTTSGLIG
                     GMIGFYDGVKISSLRYLTENAHRMPKTVGGWYFYHKKKNYVMIVAGVKKAIATSFKYG
                     AAVGGFFGLEYLLDISRGNTIDFLNTTTAAFLTSTFYAKYNKLSSMQTRKMIFKGTAL
                     GLTLGLIQDYLIHARKGRVWYLDRYTQQKLV"
     gene            complement(<687626..>688131)
                     /locus_tag="CD36_28200"
                     /db_xref="GeneID:8049541"
     mRNA            complement(join(<687626..688054,688129..>688131))
                     /locus_tag="CD36_28200"
                     /product="calmodulin-like myosin light chain, putative"
                     /transcript_id="XM_002421827.1"
                     /db_xref="GeneID:8049541"
     CDS             complement(join(687626..688054,688129..688131))
                     /locus_tag="CD36_28200"
                     /inference="similar to AA sequence:UniProt:P53141"
                     /inference="similar to AA sequence:UniProt:Q09196"
                     /inference="similar to AA sequence:UniProt:Q6BY41"
                     /note="Similar to S. cerevisiae MLC1;
                     spliced gene; myosin light chain, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="calmodulin-like myosin light chain, putative"
                     /protein_id="XP_002421872.1"
                     /db_xref="GeneID:8049541"
                     /db_xref="GOA:B9WLB1"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:B9WLB1"
                     /translation="MSQNTKTYRDAFALFDKKGTGKIPVEHLGDLLRSVGQNPTLAEI
                     ADLQKTIKGSEFDFETYQEIINRPDGFKPLGLPEDYIKGFQVFDKDHTGYIGVGELRY
                     ILTSIGEKLTDSEVDELLKGVNVTSDGNVDYVEFVKSILDQ"
     gene            <688747..>691968
                     /locus_tag="CD36_28220"
                     /db_xref="GeneID:8049542"
     mRNA            <688747..>691968
                     /locus_tag="CD36_28220"
                     /product="structural maintenance of chromosomes protein,
                     putative"
                     /transcript_id="XM_002421828.1"
                     /db_xref="GeneID:8049542"
     CDS             688747..691968
                     /locus_tag="CD36_28220"
                     /inference="similar to AA sequence:UniProt:Q08204"
                     /inference="similar to AA sequence:UniProt:Q59UE8"
                     /note="Similar to S. cerevisiae SMC5"
                     /codon_start=1
                     /transl_table=12
                     /product="structural maintenance of chromosomes protein,
                     putative"
                     /protein_id="XP_002421873.1"
                     /db_xref="GeneID:8049542"
                     /db_xref="GOA:B9WLB2"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR027131"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WLB2"
                     /translation="MSLESNGPASKRRKVLEPSKFRPGFIRKVRVWNFTTYSYTEFNL
                     SSTLNMIIGPNGSGKSTLVASICIGLAGSINLIKRKNLKSMIKTGQEKSSVEITIENY
                     EGQSPLVVKREFTAKESNWTVNNKRSTEAKVKDIRAKFNIQLDNLCHFLPQERVAEFA
                     GLSPEKLLMETERTLGDGHLLVMHEDLISKDNESQQLGNKIKDIEGRLAKLHEDRSKL
                     EEEARKLEEYDKKSQEVDNHRLLIPYAKYQDLKNQRTHLKRLRDEAKHKLRTFQANFK
                     PLENDITNAEKSINDESEKYSELKNSLKQTLNEINKHKNTQKQVTTEISELRANLKSY
                     QTRAEQKKKELQEIKKEIAELQEKQKGLPQVDQEEIQNLTSELTSKRHELRDLEEQLQ
                     EVNSQRNEIGRELTHLTEQLRGAEKRLSTKDKLDMLVSDSRQNGRSYRLRDEAFEVHK
                     RLRNEPEYEGRYFEAPVISCNVPDRNYAAAAEKIIDNNTLFAFTVTTQSDFDFLSKFS
                     QHTNTNTPLRLVNSVVSSTHEYNKQQLREFGFEGYLSDYIVGPKEVLSMLYSTSKIHT
                     IPVSKHQLSSEQVRRLTNISGNDRLPFTKFVAGDTLYNIQRSKYGTQQAFYITEKIGR
                     SQYFGVQGLSQEAKDAINEEISKFRERIEQKKRAYEGHRNSIDSFNERLTEIKHHMQD
                     IKRKQQELQEASRRAGQLQTKIELKKEREQKLEKDSKRDYSSKIRMFEQKIDEKYLAS
                     GQTFASLSNCVLELAHKENQMKLKKLEIIGYKNKKLTAESLLDELGARQEKLKNDYNR
                     YKREYDEIKQSEAFKEIERQNEAYTDEERSRLADLAQVYVENGTFTEATIRSKIDLLE
                     DELSLLTTADRGSIDALKQKLQDIQLAETNLPLLQTEKERLDNRIKGIQEEYEGELTS
                     LVNKISLAFNKRFTKVASDGRVQLAKSERFKDWKLQILVKFRQESELKVLDHQSQSGG
                     ERAVSTIFFIMSLQGLTDAPFRIVDEINQGMDPKNEQMAHRYLVHTACQNSKSQYFLV
                     TPKLLTGLYYHPDMVVHCIFTGPYITDNEEKRDNSIGLLDFAV"
     gene            <692203..>693732
                     /locus_tag="CD36_28230"
                     /db_xref="GeneID:8049543"
     mRNA            <692203..>693732
                     /locus_tag="CD36_28230"
                     /product="glutamyl-tRNA synthetase, mitochondrial,
                     putative"
                     /transcript_id="XM_002421829.1"
                     /db_xref="GeneID:8049543"
     CDS             692203..693732
                     /locus_tag="CD36_28230"
                     /EC_number="6.1.1.17"
                     /inference="similar to AA sequence:UniProt:P48525"
                     /inference="similar to AA sequence:UniProt:Q59UE9"
                     /note="Similar to S. cerevisiae MSE1"
                     /codon_start=1
                     /transl_table=12
                     /product="glutamyl-tRNA synthetase, mitochondrial,
                     putative"
                     /protein_id="XP_002421874.1"
                     /db_xref="GeneID:8049543"
                     /db_xref="GOA:B9WLB3"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR004527"
                     /db_xref="InterPro:IPR008925"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="InterPro:IPR020751"
                     /db_xref="UniProtKB/TrEMBL:B9WLB3"
                     /translation="MKLSFPIIRNYSKAGSLLKDSLAELATNSSHLSRQPKSPARTRF
                     APSPTGFLHLGSLRTALYNYLLAKSTGGKFILRIEDTDRNRLVPGAEDNIIHTLKWCN
                     LQIDEGPVEGGPYGPYRQSDRKHIYQKYANEMLSKGLAYKCYCSKDRLLELRESAQRL
                     KPPTNVTYDRKCISEKEHEGLPYVIRFKSPNKYPPFKDLLHGELNLQPQYNDKDRRFD
                     DFVIVKNDGMPTYHFANVIDDHLMKITHVVRGEEWLPSTPKHIAMYHAMGWEPPQYIH
                     IPLLTSLKDKKLSKRSGDLNILKLKDEGILPEALVNFVALFGWSPVRNNGEKFNEVMD
                     LCDIVELFSIDQLTKGNAKVNDSKLYYFNKLHLAKKLESAEGMETLVEEYYPHFKQFS
                     HQSKDYLYKLLTFMGPNLTSIHEIETDHQYLFQEIDYSMVKVPSEQTKGVLEYVLSHG
                     YYDAVDKLPHQGIPKKNIFMSLRYALSGGKSGLAIPHFIELLGEDEFNRRLQNSLKSL
                     M"
     gene            <693973..>694938
                     /locus_tag="CD36_28240"
                     /db_xref="GeneID:8049544"
     mRNA            <693973..>694938
                     /locus_tag="CD36_28240"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421830.1"
                     /db_xref="GeneID:8049544"
     CDS             693973..694938
                     /locus_tag="CD36_28240"
                     /inference="similar to AA sequence:UniProt:Q59UK1"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421875.1"
                     /db_xref="GeneID:8049544"
                     /db_xref="UniProtKB/TrEMBL:B9WLB4"
                     /translation="MSNKKDQDSLGIDNNSNNSTKDSEKYTESIDRIVSNLGALTHSI
                     LDVTKDVGKDLNAKAKKLSESWFSNDYDEDEARFFEYPSFYQNRGYLEDEVKSHPIFG
                     DLWNAFPFSQFGQFSGSFKSGSTPFGYYAYHGPSIRNYNECLTKNGKSVWDDQGYWRC
                     LFPNSEVPVELLNFKKKYLKDEILTKEDFMSAMRKNSALDSFQGDGMVDLKEHGRFFD
                     SYDKYLNWKNEQYNQRVKEREAKWKQLSLDKGDNFATNSSSFSTSIKSDMYTDSETNE
                     VRFTKVKTECDADGNCTVTRITKSKPVGSSVWTNEEENVEHVKKS"
     gene            <695361..>695795
                     /locus_tag="CD36_28250"
                     /db_xref="GeneID:8049545"
     mRNA            <695361..>695795
                     /locus_tag="CD36_28250"
                     /product="late endosomal protein involved in late endosome
                     to vacuole trafficking, putative"
                     /transcript_id="XM_002421831.1"
                     /db_xref="GeneID:8049545"
     CDS             695361..695795
                     /locus_tag="CD36_28250"
                     /inference="similar to AA sequence:UniProt:P47111"
                     /inference="similar to AA sequence:UniProt:Q59UF2"
                     /note="Similar to S. cerevisiae VPS55; vacuolar protein
                     sorting-associated protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="late endosomal protein involved in late endosome
                     to vacuole trafficking, putative"
                     /protein_id="XP_002421876.1"
                     /db_xref="GeneID:8049545"
                     /db_xref="InterPro:IPR007262"
                     /db_xref="UniProtKB/TrEMBL:B9WLB5"
                     /translation="MNPLNKIIFLSAFLASGFLSILLSCALYNNYHTLWVILIFLLAP
                     LPNLIANSIESARDYNFLTFNDYGNSNNSTQSPLQEFGKYITGFLIVSGIALPLTFYH
                     CGLIELGATIMSIIGGLIVYSDIIIFIWFFNTEEEEHDDFNF"
     gene            complement(<695983..>696783)
                     /locus_tag="CD36_28260"
                     /db_xref="GeneID:8049546"
     mRNA            complement(<695983..>696783)
                     /locus_tag="CD36_28260"
                     /product="endosomal SNARE protein related to mammalian
                     syntaxin 8, putative"
                     /transcript_id="XM_002421832.1"
                     /db_xref="GeneID:8049546"
     CDS             complement(695983..696783)
                     /locus_tag="CD36_28260"
                     /inference="similar to AA sequence:UniProt:P31377"
                     /inference="similar to AA sequence:UniProt:Q59UK4"
                     /note="Similar to S. cerevisiae SYN8; syntaxin, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="endosomal SNARE protein related to mammalian
                     syntaxin 8, putative"
                     /protein_id="XP_002421877.1"
                     /db_xref="GeneID:8049546"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:B9WLB6"
                     /translation="MTVKDIKLTISKIKFNLDEISNLQEERSNIYDLDLTPSKNDNFE
                     MISLISKTRQYFTFIEQDMNEYLDDLEKNGILDEFMNLVNQYTKMFEELSKDSNIDIS
                     EYKYVYKRPTSSQNGTEPNPVQKSVRFRDTPDDNDASELMGTRQTFQPYKDDPDEDSS
                     AAHEDITDHQMFAQHQQTLMRQDQDLDVLHQSISRQHMMGQDINQELDDQLIILNDLE
                     QGVDSSLGRLHTASTRLRHFRTLMRENGSLVTICTLTVILILLLVVLN"
     gene            <697166..>699787
                     /locus_tag="CD36_28270"
                     /db_xref="GeneID:8049547"
     mRNA            <697166..>699787
                     /locus_tag="CD36_28270"
                     /product="endosome-Golgi transport protein, putative"
                     /transcript_id="XM_002421833.1"
                     /db_xref="GeneID:8049547"
     CDS             697166..699787
                     /locus_tag="CD36_28270"
                     /inference="similar to AA sequence:UniProt:Q06704"
                     /inference="similar to AA sequence:UniProt:Q59UF5"
                     /note="Similar to S. cerevisiae IMH1; golgin IMH1
                     homologue, putative; vesicular transport protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="endosome-Golgi transport protein, putative"
                     /protein_id="XP_002421878.1"
                     /db_xref="GeneID:8049547"
                     /db_xref="GOA:B9WLB7"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="UniProtKB/TrEMBL:B9WLB7"
                     /translation="MFSKLKNFSEDVMNELNNLSDQNLKSPKSTTSSESLNQLQKSAK
                     VLATETPDVSKLTQPCDEEISNNVSTGEDSEKATSPPIDNATTNNESAVGAVAPQSDL
                     DNLPAPIKSKLKKFAKYEEKYPILLDAYKIEKKKNEIIKIFEKVLQENTPVSSLSEGK
                     LLVEYLNGLNEKTKLLNGEIRKLTKDNNNMNFKLVKLEESNKELNNDVKRLDTIQKEK
                     EVMGQKVDSMSEELERINNHNDKLTKDLKGKEDEIENLKLEITERDNKIKELEFTVST
                     SAKELTTESEKVPTEKEDTDKDSTSDNINNNSDTVNTEILQLKSQLSAKEVEVEELTE
                     EITTLKDQLKDKNEEIQDLRDSVKEIGNELVTSKDEIKSLKSSQKSTDSEDSTIKEDI
                     NLQIKDWESKYKSKVKENGNLKEELDLATRESKEKETEQKKSEEQLRKQIQTLKQKLE
                     TTENKLESKSKDLKNLSDEKEKLEKRISELSKFKSNDSSLKLEISSLKSSLTNKDNSI
                     TELKTQVDELQKSNKSLNSKIEELSKSNNNLQSNSIGLLKDKNELLTKQEVLMENTKS
                     LNSQVTKLQQEKQDVITELEKTKNKLDIVITDKSQSANDMISCKKQHEELMMKSKEYS
                     LRIESLEDDLTEARNLLQERTRETSNMRRLLVDAEEMLKQQKQDSKLEIARVLEDKAE
                     IERNNMSLVKRKQRELDELKESIQEYKLKVEKLENKVTALENEDKSKESVSTDNQTQI
                     NKELSTTIETLRTALNNSTNKIRDLENYNNNLKKLSEDNTLRFERLSKNYKILNQQYQ
                     YMKERKGSESSAKQNTPVESTTESNNKQATNVAYLKNVLLGFFQHKEQRDRLLPVLKT
                     LFDFNKEDEEKFLMALK"
     gene            <699949..>700776
                     /locus_tag="CD36_28300"
                     /db_xref="GeneID:8049548"
     mRNA            <699949..>700776
                     /locus_tag="CD36_28300"
                     /product="Trna-YW synthesizing protein, putative"
                     /transcript_id="XM_002421834.1"
                     /db_xref="GeneID:8049548"
     CDS             699949..700776
                     /locus_tag="CD36_28300"
                     /inference="similar to AA sequence:UniProt:P53177"
                     /inference="similar to AA sequence:UniProt:Q59UF6"
                     /note="Similar to S. cerevisiae TYW3"
                     /codon_start=1
                     /transl_table=12
                     /product="Trna-YW synthesizing protein, putative"
                     /protein_id="XP_002421879.1"
                     /db_xref="GeneID:8049548"
                     /db_xref="InterPro:IPR003827"
                     /db_xref="UniProtKB/TrEMBL:B9WLB8"
                     /translation="MQDSFDQKKKSILSEISSNSPDNLDASPKGTIDEYCLPIINTIN
                     SHGDMVTTSSCSGRVSIFLEGVKTNNSTSVVAKGHEGRWLFVTHEPNDLNNWYDSIDF
                     KYDTSNFPKDFSSRSILYKFEPLILHVKCRNETMAQKLYVLAMNNGFRESGIGNNFNV
                     AIRINIKLDIPIGFQSIDGDDLNCFVTEQYLKYITDISHERFKENFKKLEQLHRAIGR
                     MMEEETKGIETSKKKYKESKEERRQRMIKEGLQRQQELRELKEKQEKEQNGIQQVDT"
     gene            <701040..>702776
                     /locus_tag="CD36_28310"
                     /db_xref="GeneID:8049549"
     mRNA            <701040..>702776
                     /locus_tag="CD36_28310"
                     /product="aspartyl-tRNA synthetase, cytoplasmic, putative"
                     /transcript_id="XM_002421835.1"
                     /db_xref="GeneID:8049549"
     CDS             701040..702776
                     /locus_tag="CD36_28310"
                     /EC_number="6.1.1.12"
                     /inference="similar to AA sequence:UniProt:P04802"
                     /inference="similar to AA sequence:UniProt:Q59UF7"
                     /note="Similar to S. cerevisiae DPS1"
                     /codon_start=1
                     /transl_table=12
                     /product="aspartyl-tRNA synthetase, cytoplasmic, putative"
                     /protein_id="XP_002421880.1"
                     /db_xref="GeneID:8049549"
                     /db_xref="GOA:B9WLB9"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004523"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:B9WLB9"
                     /translation="MSVEKQVEELSISENPAASIANESAPATTATNSKNVEGEEVVLG
                     EDGQPLSKKALKKLLKEKEKAAKKAEREAQLAKEKAAREAEAANDPAKENYGKLPLIN
                     SSTRNADEKRILFKDLSVANDGETVIFRARVHNTRQQGATMVFLTLRQQSELIQALLK
                     TNKDTDSTAVSKQMVKWTGSVNLESIVLVEGKVAKVEEKIKSATVQDVEILISKIYTI
                     QETPEQLPLLIEDASRSEKESEELGLPGVNLDTRLDARVIDLRTPTNQAIFKIQSGVC
                     QLFREFLIKKGFTEIHTPKIIGAASEGGSNVFEINYFKGSAFLAQSPQLYKQQLIAAD
                     FEKVFEIAPVFRAENSNTHRHMTEFTGLDLEMAFEQHYDEVLEVLEELFVFIFTELKT
                     RFSKEIATVRKQFPVEEFKIPKDGKMVKLHFKEGIAMLREAGKDVDDFEDLSTENEKL
                     LGRLVREKYDTDFYILDKFPLAVRPFYTMPDSEDPRYSNSYDFFMRGEEILSGAQRIH
                     DPKLLTQRMKEHEVDPNVPGLNDYVDAFTYGCPPHAGGGIGLERVVMFFLDLKNIRRA
                     SLFPRDPKRLTP"
     gene            <703121..>704239
                     /locus_tag="CD36_28320"
                     /db_xref="GeneID:8049550"
     mRNA            <703121..>704239
                     /locus_tag="CD36_28320"
                     /product="GTP-binding protein, putative"
                     /transcript_id="XM_002421836.1"
                     /db_xref="GeneID:8049550"
     CDS             703121..704239
                     /locus_tag="CD36_28320"
                     /inference="similar to AA sequence:UniProt:P53290"
                     /inference="similar to AA sequence:UniProt:Q59UF8"
                     /note="Similar to S. cerevisiae GTR2"
                     /codon_start=1
                     /transl_table=12
                     /product="GTP-binding protein, putative"
                     /protein_id="XP_002421881.1"
                     /db_xref="GeneID:8049550"
                     /db_xref="GOA:B9WLC0"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WLC0"
                     /translation="MEATLIPNPKDNNATILLMGLRRSGKSSICKVVFHNMQPYDTLY
                     LESTSKPTTEQFSSLIDLSVMELPGQLNYFEPNYDSERLFSSVGALVYVIDSQDEYLN
                     AITNLSMIIDYAYKVNPKINIEVLIHKIDGLSEDYRIDAQRDIMQRTGDELLDLGVEG
                     VELSFYLTSIFNHSIYEAFSRIVQKLIPEVSSLENMLDNLVEHSSIDKVFLFDVNSKI
                     YVATDSSPVDIQTYEVCAEFIDITIDLDDLYVENDKNKNGNGGIGGKQKEVKSISHLS
                     NGSVLYLKQMIRGLALVALIRNDDTKEIQQDDDNTIGITAENIQSADGSVFDSNQEKS
                     LTVIDHNVNLFKKSLMKIWKNSKLTNVNSNVSQPQSIK"
     gene            complement(<704817..>707153)
                     /locus_tag="CD36_28330"
                     /db_xref="GeneID:8049551"
     mRNA            complement(<704817..>707153)
                     /locus_tag="CD36_28330"
                     /product="RNA-processing protein, putative"
                     /transcript_id="XM_002421837.1"
                     /db_xref="GeneID:8049551"
     CDS             complement(704817..707153)
                     /locus_tag="CD36_28330"
                     /EC_number="3.1.26.5"
                     /inference="similar to AA sequence:UniProt:P41812"
                     /inference="similar to AA sequence:UniProt:Q59UG0"
                     /note="Similar to S. cerevisiae POP1;
                     In S. cerevisiae: subunit of both RNase MRP, which cleaves
                     pre-rRNA, and nuclear RNase P, which cleaves tRNA
                     precursors to generate mature 5' ends; RNases P/MRP
                     subunit, putative; ribonucleases P/MRP protein subunit
                     POP1 homologue, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA-processing protein, putative"
                     /protein_id="XP_002421882.1"
                     /db_xref="GeneID:8049551"
                     /db_xref="GOA:B9WLC1"
                     /db_xref="InterPro:IPR009723"
                     /db_xref="InterPro:IPR012590"
                     /db_xref="UniProtKB/TrEMBL:B9WLC1"
                     /translation="MSTNSKQLNKKKTRLYNSRTIKSQLNDPAYDKKQRVLDVNSFIH
                     SRNFEIRSFEQSQLNSKNASSTRVFQDLPRVLRRRAASHNVKRIPKRLRKRAKQEMSA
                     NLPVKKMPRGRRLYKLLVRNRLLKVATKMKKNKYDPLENLLNKKNIRKQFKAIRDEIK
                     KIHKENLKSSTLEDFTKLNNSVGSRDNTGINEFAPRPKGSIKYYKRQREFVWIPTHIW
                     HVKRFHMSKKYGYQIPYTPTQKCFKLMNRWNRQKAVCFDTSYFPTFILFIGDAAKFAD
                     IAKQLCGKKVGKQILNGKKSYNGWVHIDGETKLCPGFVYMNHSLNTIMVRVVPSVYEK
                     LFQSYKEKIENIPNSTIHDCRYALGSIELSGPLSMKCLSKIFHFHNISPDLKNTWASL
                     SKIKDSDLVPVGTTFTFNLHDPRIWQRPTKLPHNRKEDQDIYDIIIALNSSPRVNQDI
                     VKKLSTPEGRYDSYKDQLSIKQLGRFHGNMNKKPSDISHSQIPVLLSKTDSQKWLLIL
                     PWHWILPFWIQITKVTDIKPGGSKQMHQFQFENHKPYYPQDYPWSYDGWQFNKLVGEA
                     NQLKAAKLPKSQVSVEKSEKNYSSIFNANKCDWRNLRNLTFLLNYSKLDRKTLEQGLA
                     PDFAQYDGPERIINSVHDLLQTTKSLEKDVTDVNEPIVELYTNHKTQVDFYNNAYKIA
                     QLPDILHKKLPVVQIGLSVINDGTIDDNARLYSDPSATDIHCVGFVTTGAMNLNVGKY
                     SGIGTIIAQKWLIEESGHKLYVRNPGKSKVYNVSFRVV"
     gene            complement(<707403..>708083)
                     /locus_tag="CD36_28340"
                     /db_xref="GeneID:8049552"
     mRNA            complement(<707403..>708083)
                     /locus_tag="CD36_28340"
                     /product="RNA polymerase II subunit A C-terminal domain
                     phosphatase, putative"
                     /transcript_id="XM_002421838.1"
                     /db_xref="GeneID:8049552"
     CDS             complement(707403..708083)
                     /locus_tag="CD36_28340"
                     /EC_number="3.1.3.16"
                     /inference="similar to AA sequence:UniProt:P53538"
                     /inference="similar to AA sequence:UniProt:Q59UG2"
                     /note="Similar to S. cerevisiae SSU72;
                     transcription/RNA-processing factor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase II subunit A C-terminal domain
                     phosphatase, putative"
                     /protein_id="XP_002421883.1"
                     /db_xref="GeneID:8049552"
                     /db_xref="GOA:B9WLC2"
                     /db_xref="InterPro:IPR006811"
                     /db_xref="UniProtKB/TrEMBL:B9WLC2"
                     /translation="MSKHIDDSLKICTVCASNNNRSMESHKQLMDAGYDVHSFGTGTA
                     VRLPGPSVDKPNVYDFGTPYQVMYDDLISQKSRKLYESNGLIHMLERNKSVKEAPEKW
                     HRNASLGKFDLVITCEERCFDSVIEDLMHRMYDRDPSDNDDIKRLVHVINIDIKDDNE
                     NAIMGGKGILKLVNMIHDFRRKRKQELGHDIEDESDIILEDQMMSIITEWQRDHTNLP
                     TLYSVSYY"
     gene            complement(<708269..>709600)
                     /locus_tag="CD36_28350"
                     /db_xref="GeneID:8049553"
     mRNA            complement(<708269..>709600)
                     /locus_tag="CD36_28350"
                     /product="cysteine protease, putative"
                     /transcript_id="XM_002421839.1"
                     /db_xref="GeneID:8049553"
     CDS             complement(708269..709600)
                     /locus_tag="CD36_28350"
                     /EC_number="3.4.22.-"
                     /inference="similar to AA sequence:UniProt:P53867"
                     /inference="similar to AA sequence:UniProt:Q59UG3"
                     /note="Similar to S. cerevisiae ATG4"
                     /codon_start=1
                     /transl_table=12
                     /product="cysteine protease, putative"
                     /protein_id="XP_002421884.1"
                     /db_xref="GeneID:8049553"
                     /db_xref="GOA:B9WLC3"
                     /db_xref="InterPro:IPR005078"
                     /db_xref="UniProtKB/TrEMBL:B9WLC3"
                     /translation="MDQQNLNNQPDVEASPEQTSNEEVDTVLGRFTLFVKDLSNGLNG
                     SQEVPTSQESASEEAELINRKIVILGQIFDNSNAANNYIESKLWLSYRCGFEPIPKSI
                     DGPQPIHFFPSIIFNRTTIYSNFANLKSLFDKENFTSDAGWGCMIRTSQNLLANTLLK
                     LYPKNEQEIVKLFQDDTKSPFSIHNFIRVASSSPLHVKPGEWFGPNAASLSIKRLTNE
                     LQDQEINGINPPRVFISENSDLFDDEIRDVFAKEKSNSVIILFPIRLGIDKVNSYYYN
                     SIFHLLSSKYSCGIAGGKPSSSFYFLGYEDTDLIYFDPHLPQIVETPFNMDSYHSTNY
                     NTLNISLLDPSMMIGILVTNIDEYIDFKTSCIDNNNKIVHFHPHTLPVQQDSIINQSW
                     EEVQDEEEEFVNLNVSKIENEQQQEEVTDTPDEFIDIGNQSSSVVSVPSNV"
     gene            <709882..>712011
                     /locus_tag="CD36_28360"
                     /db_xref="GeneID:8049554"
     mRNA            <709882..>712011
                     /locus_tag="CD36_28360"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421840.1"
                     /db_xref="GeneID:8049554"
     CDS             709882..712011
                     /locus_tag="CD36_28360"
                     /inference="similar to AA sequence:UniProt:Q59UG4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421885.1"
                     /db_xref="GeneID:8049554"
                     /db_xref="GOA:B9WLC4"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:B9WLC4"
                     /translation="MPKRGVRRKRGGSGRGGRGGGRGGGGRSLSGANRGRFPSRGNRR
                     RSPKTVSQYGELMDDDNIYIPKTMSELASNMGRRKYGRMFEEIEYTESHQEDLMVRQL
                     RNRPVEFVKAKEVYDPNVILYKLAKLNKKDDDDDGGIDIAVQSISLEDSEDENNESLN
                     NGDELSLSSEESKEIEESEDEYEDEDEDWDEEELDNEISTKLQALEEAMNRVPDDSDS
                     EESVIDRQEEQNEEVESHISVPQSSDVAEETFQESNELESKDQMESEDCTNTTPSKLT
                     QDIETLDIIIDLPSNKVEQHSSHPHSLPQSKPPSKSNDDNNPELELESEPEYGYLEED
                     YEFDVSKIEVSNVRFGIENQYYIKCMELTGSNDNEYIWIDENDVIEYALDNGVKEHRL
                     NKFLSYITKGMIDEQQPEPEPEPEVYISDTNSESEDEEEEEDDEEADDYPYDSDDNLQ
                     DLIEYSKTSTQGLIPFEDRDFSNKNIPAKKRRTFDDLDLDDELQESLIRQLQNYKTNK
                     KNKKHQWEQQKLEESILHNDMLIKYPIHLHIKDIKYEFEQFLKDESRQSLSFPTLDTH
                     GHKTIQKLADCYHMSVIKSGKQGIRKYLKIVKNKSTFKYYPNYEIIDKILRGRPIFHR
                     IDQKPSHSKKNEKKSNRGNSSSSKTRFKEGDIVGAEAPEIDSSNLGRQMLEKLGWIQG
                     QGLGIEGNKGINEPILAKVKTSKTGIK"
     gene            complement(<712120..>713925)
                     /locus_tag="CD36_28370"
                     /db_xref="GeneID:8049603"
     mRNA            complement(<712120..>713925)
                     /locus_tag="CD36_28370"
                     /product="transcription factor with zinc finger
                     DNA-binding motif, putative"
                     /transcript_id="XM_002421841.1"
                     /db_xref="GeneID:8049603"
     CDS             complement(712120..713925)
                     /locus_tag="CD36_28370"
                     /inference="similar to AA sequence:UniProt:P53863"
                     /inference="similar to AA sequence:UniProt:Q59UG5"
                     /note="Similar to S. cerevisiae JJJ1;
                     similar to bacterial DnaJ"
                     /codon_start=1
                     /transl_table=12
                     /product="transcription factor with zinc finger
                     DNA-binding motif, putative"
                     /protein_id="XP_002421886.1"
                     /db_xref="GeneID:8049603"
                     /db_xref="GOA:B9WLC5"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:B9WLC5"
                     /translation="MKTCYYELLEVSSTATETELKKAYRKKALQLHPDKNPDNVEEAN
                     HKFSLVRAAYEVLSDPQERTWYDNHKQSILNDEDEIIEGESYLPSISTEEIYRFFNPG
                     MYTEMNDSISGFYQIVTRIFGRLAHEEIQHGKYSKVPGYDKYHDDDDKNINVIDPSLL
                     MYPRFGNSQSSYVDQVRQFYNIWGSFQTCKTFNWKDEYRYSIAPDRRTRRMMERENKK
                     LRDEARKEYNEAIKKFVNFIKKRDPRVKSGQEELNKLNKRKQLQEYENQIRQQQHLNK
                     LKNNGANKFTEQDWQKLTPEELQEFEQMLQEEYEGEGEEEDDDSTDSEFEQYKNGNSN
                     ENNYEIHEFECIVCDKIFKNETQFQIHEDSKKHKKNVRQLQWEMKQEGIELGIDKHDD
                     NDLSEFETASSEFHSDYSEEELEEVEEYKEDQEDQDVEVKPSKDNIVEESKSKIDLDN
                     LEVDDEIDEDSVINTTTTATATSKKGSKASLNKVEEDLAKLLGQTSLTTNNNDESDDD
                     DDDDDWSDNKKKSKKGKKTKKKSQTNSKESTPNNNTESKPVINPNTEKCSVCGTIFQS
                     RNQLFNHVKSEGHAAPPPPPPPKSKSKSKKKNKRK"
     gene            complement(<714231..>715115)
                     /locus_tag="CD36_28380"
                     /db_xref="GeneID:8049604"
     mRNA            complement(<714231..>715115)
                     /locus_tag="CD36_28380"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421842.1"
                     /db_xref="GeneID:8049604"
     CDS             complement(714231..715115)
                     /locus_tag="CD36_28380"
                     /inference="similar to AA sequence:UniProt:Q59UG6"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421887.1"
                     /db_xref="GeneID:8049604"
                     /db_xref="UniProtKB/TrEMBL:B9WLC6"
                     /translation="MDSRKPSLFNQLEPQNDDSDSTDISDISEDEDWEDDPPVSPKSQ
                     PLEFPKLDHDVPLPRPPSLLSCLLYNNGNNGTNGNNNNNNNSHSNNLHATNNNTPNAN
                     ENNHIYKPRLLRSFTTPTALPPLHTPLVKQKSVVGISDINVSISSLTTTSSHLSMKNL
                     LSKSSVNLYSAGSTTTATTTTASRPNKRLSQPDQLKPSPSSLTSSILFMSQPPDSATT
                     PPPPILPRITTTDSDLTDKLINNDELSKSLKESLLIDNRLAKIPLPEKVIDAGIFLKR
                     ESRLADEDDFDDYHSKGW"
     gene            <717600..>718589
                     /locus_tag="CD36_28400"
                     /db_xref="GeneID:8049605"
     mRNA            <717600..>718589
                     /locus_tag="CD36_28400"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421843.1"
                     /db_xref="GeneID:8049605"
     CDS             717600..718589
                     /locus_tag="CD36_28400"
                     /inference="similar to AA sequence:UniProt:P53275"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421888.1"
                     /db_xref="GeneID:8049605"
                     /db_xref="InterPro:IPR008551"
                     /db_xref="UniProtKB/TrEMBL:B9WLC7"
                     /translation="MCIAIATTNHPDYPFILLSNRDEFFKRPTMPAHFRDVGNGVKLL
                     SPLDLARQEHGTWIGVTTNGKIAVLVNYRENDEKEAISEVSRGILPLDYLCGKESDNE
                     WKDNLASTFRDGRTTIDLKKIGGFSLLYGKLTINPETGKIHHLNILSNRGDQGKVFKS
                     KANSKDIANGSIDVSDDIPHKTTFGLSNSLYNKPWDKVKLGELLLSNLIDESITNNYS
                     QDELIEKCFQLLSHDTYNSKILNSNDFEKKFSELKYSIFIPPLIRNNYETDSIAVGKY
                     YGTRTQTIILLDKYGNLNYYEKNIHNSDDIDEKIVDITSHYKFNIFNDQKNGC"
     gene            <719907..>721412
                     /locus_tag="CD36_28410"
                     /db_xref="GeneID:8049934"
     mRNA            <719907..>721412
                     /locus_tag="CD36_28410"
                     /product="Major Facilitator Superfamily (MFS) transporter
                     protein, putative"
                     /transcript_id="XM_002421844.1"
                     /db_xref="GeneID:8049934"
     CDS             719907..721412
                     /locus_tag="CD36_28410"
                     /inference="similar to AA sequence:UniProt:O13880"
                     /inference="similar to AA sequence:UniProt:Q59UG7"
                     /codon_start=1
                     /transl_table=12
                     /product="Major Facilitator Superfamily (MFS) transporter
                     protein, putative"
                     /protein_id="XP_002421889.1"
                     /db_xref="GeneID:8049934"
                     /db_xref="GOA:B9WLC8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WLC8"
                     /translation="MSNSNSNSNSNSNSEVESRGKSLEIEEYQIDNNYQSSETLDIHQ
                     LNKVYRKLDLRIIPALWCLYFLTSFGSNCYGLTLTMNRSEGHSLAQQLHLTSKDISTA
                     SALYYVGYIIFDVPMNLIMTKVSPQTWLARIVITVGLVYTCYHVLYNSGGVIAVRFIS
                     GVVGAGTWPGLSYYVSLWYPNDRSTRRIGYYFTAAQISAAVAGLVSAGFQKMDGVHGY
                     TGWQWMYLVYGVITMAVGISLLWWLPDRPFIGVKQQSNKFVEIYRKFTTPPHPLNEQE
                     KELHRKDLQHRYKLLKWTWKDVINIITDLRIWPLIIMYFGVVGTGFGLAVFGSTIIAT
                     NNPNLTSIQVSLLYAPIWLFDLGGILIITPFADRFKKFRALIFSGACVIIIVGMIVTT
                     FAHGSWNKYAGLLIAGFGLGPTVPICMSWSAEIFQQRYGDVGCAVSAALVSGLGNLGS
                     VTSTYALYSGWPEDKARLYRNSNMMLVLMLGVSIIASGVCQLIKDKVRQPK"
     gene            <722550..>723626
                     /locus_tag="CD36_28420"
                     /db_xref="GeneID:8050204"
     mRNA            <722550..>723626
                     /locus_tag="CD36_28420"
                     /product="zinc-binding dehydrogenase, putative"
                     /transcript_id="XM_002421845.1"
                     /db_xref="GeneID:8050204"
     CDS             722550..723626
                     /locus_tag="CD36_28420"
                     /inference="similar to AA sequence:UniProt:Q4WD36"
                     /inference="similar to AA sequence:UniProt:Q59UG8"
                     /note="zinc-binding oxidoreductase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc-binding dehydrogenase, putative"
                     /protein_id="XP_002421890.1"
                     /db_xref="GeneID:8050204"
                     /db_xref="GOA:B9WLC9"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B9WLC9"
                     /translation="MKAAVVPESVTETKLAEIKEIPKPTIGDDQILIKAEAAAVNPTD
                     WKHILFQMSKPGDVIGSDVSGTVEEVGSKVTNFKKGDTVSSFIVGNSSPESGAFGEYV
                     IAYPQATIKYDHSLSHSSSTSSSTIKSYEGAASVTLGLSTIGISFSHYLNIGKHKKEG
                     DSILIWGGATATGILAIQVAKLAYNLNVITTASPKNHAFLKELGADHTLDYNDPNVIE
                     NLKALGPIKFGLDTIANTTTFQSLYDATAGTPEVYLDSLLGLDGKSIKTDPSRENSVH
                     WGYTLAYLCIIKEKSFGPTKFVQTPELLNDYLKWWDEVLPTFIDTIKHANLKILGDGL
                     ASTNEALQLSRDSKVSAQKIVFTV"
     gene            complement(<723862..>725424)
                     /locus_tag="CD36_28430"
                     /db_xref="GeneID:8050205"
     mRNA            complement(<723862..>725424)
                     /locus_tag="CD36_28430"
                     /product="meiosis induction protein kinase, putative"
                     /transcript_id="XM_002421846.1"
                     /db_xref="GeneID:8050205"
     CDS             complement(723862..725424)
                     /locus_tag="CD36_28430"
                     /EC_number="2.7.11.1"
                     /inference="similar to AA sequence:UniProt:P32581"
                     /inference="similar to AA sequence:UniProt:Q59UG9"
                     /note="Similar to S. cerevisiae IME2"
                     /codon_start=1
                     /transl_table=12
                     /product="meiosis induction protein kinase, putative"
                     /protein_id="XP_002421891.1"
                     /db_xref="GeneID:8050205"
                     /db_xref="GOA:B9WLD0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:B9WLD0"
                     /translation="MSRHQSFPLDYDSPPKHLTVHSYHSKYQTINTLGNGSFGTVDLA
                     KIKFFKFDLLNSHKNKSGTLLCPLEDSKCNTSNLVAIKTMKKKLPLLQEYSNVKEVKF
                     ILSVPSHPCLVQIYEMFIDDIQYQLHISMEALNQNLYQLIRSRRNIKFSPVTLKSILS
                     QLLCAIRHIHKCNYFHRDVKPENILVIPTLHFYGSKAAIPPYRKNDNFIIKLGDYGLA
                     RHVSNIKPYTAYVSTRWYRSPEILLRQKWYSRPIDIWAFGAVAVETANFVPLFPGSNE
                     LDQIWKILKILGTPFVPEPKSINSSYIVPLGGYWTEALFLTNKLGIKLPDETGTTIEE
                     IVQHPDSLALIEVIQSCLKWDPSARADATEIAKMQYFKESIAMMDTYFETDTVTMNTA
                     LNKLAGIPNSPSRKLLTPLKLQKNSTGICNTTGSVPVFQDSDDGYENYFGEYIAKQPE
                     RNSSGNESYKLFAQPWLLKVNEVLGTRESEMEPRRAGNGTSDLKKKQSKAAGTKRSFT
                     TFSLDSEEVVNL"
     gene            complement(<726197..>727282)
                     /locus_tag="CD36_28440"
                     /db_xref="GeneID:8050206"
     mRNA            complement(<726197..>727282)
                     /locus_tag="CD36_28440"
                     /product="zinc-binding dehydrogenase, putative"
                     /transcript_id="XM_002421847.1"
                     /db_xref="GeneID:8050206"
     CDS             complement(726197..727282)
                     /locus_tag="CD36_28440"
                     /inference="similar to AA sequence:UniProt:Q4WMF1"
                     /inference="similar to AA sequence:UniProt:Q59UM3"
                     /note="zinc-binding oxidoreductase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc-binding dehydrogenase, putative"
                     /protein_id="XP_002421892.1"
                     /db_xref="GeneID:8050206"
                     /db_xref="GOA:B9WLD1"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B9WLD1"
                     /translation="MKAAIISGSFEPNHLAEIKDIPQPEIKENEILIKAVAFAINPTD
                     WKHIVYQLGSPGDVVGCDVSGTVEEVGSQVTGFEKKDIVSAFVTGNRSPRTGAFAEYV
                     AVDPATAVKYTQSFDDSTNLKVSEVRSFEGAASINLGLVTVGLSFSHYLQIENKKQPG
                     DGILIWGGATATGILAIQIAKLVYSLSVITTASPKNHSLLKQLGADYVFDYKDTDVVN
                     KVKRVGQIKFALDTIATPETFQKVYDSTEGSQEVFIDSLAGLDYRSITANDARGDQVH
                     WGHTIACLASLKEKAVFNENYVQTPELLVDFTQWWQNVVPQIIDQIKHTNLRLLNKGL
                     DSVNQGLELSRNNKLSGEKAVFRVSDS"
     gene            complement(<727621..>728328)
                     /locus_tag="CD36_28450"
                     /db_xref="GeneID:8050207"
     mRNA            complement(<727621..>728328)
                     /locus_tag="CD36_28450"
                     /product="CCCH zinc finger protein"
                     /transcript_id="XM_002421848.1"
                     /db_xref="GeneID:8050207"
     CDS             complement(727621..728328)
                     /locus_tag="CD36_28450"
                     /inference="similar to AA sequence:UniProt:Q4WC72"
                     /inference="similar to AA sequence:UniProt:Q59UH1"
                     /note="transcription factor with zinc finger DNA-binding
                     motif, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="CCCH zinc finger protein"
                     /protein_id="XP_002421893.1"
                     /db_xref="GeneID:8050207"
                     /db_xref="GOA:B9WLD2"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:B9WLD2"
                     /translation="MCEKGMNCKYDHDKEKIRICPLFLLGKCYSKNCLLSHSPNDNNT
                     PQCRYFLGKSCQNPNCKYRHFKPANYNDPNYEIWTCRPFAIGGFCSRGKKCPFLHLLN
                     CPDFEEDNYCYLGRECPLTHQFTLKTQDSIATKSNKYIRDETVVTEESTPTPVKTIIN
                     SYTVDPKLLFVVDETGNYQFYIDNNGGENNQFDSNFGSSNEFLIELSSSSEESGLDDS
                     QDEGDDDIEENEDYVGV"
     gene            complement(<728539..>729189)
                     /locus_tag="CD36_28460"
                     /db_xref="GeneID:8050208"
     mRNA            complement(<728539..>729189)
                     /locus_tag="CD36_28460"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421849.1"
                     /db_xref="GeneID:8050208"
     CDS             complement(728539..729189)
                     /locus_tag="CD36_28460"
                     /inference="similar to AA sequence:UniProt:Q59UH2"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421894.1"
                     /db_xref="GeneID:8050208"
                     /db_xref="UniProtKB/TrEMBL:B9WLD3"
                     /translation="MSSQGPESEALKIKYKEIAALKKAIQEKQDLKRQQQQNASKIQK
                     QAYKRILKLPVNPNAFIPQKPKFSNMTLVVNNTGSDSNGTASTTEEGTSSADQQGYVS
                     VQSSGGKSFYNINVYQQEAEKLKAKILLKKKQVQEQKRLEKIRNQIPKFRTMSDNCDR
                     IKINGDKYAVTENGRALVPIRMIQLTNPTECIWNGNKYQRNSHGVFKLSTPVRRKR"
     gene            <729478..>730551
                     /locus_tag="CD36_28480"
                     /db_xref="GeneID:8050209"
     mRNA            <729478..>730551
                     /locus_tag="CD36_28480"
                     /product="C2HC5 finger protein, putative"
                     /transcript_id="XM_002421850.1"
                     /db_xref="GeneID:8050209"
     CDS             729478..730551
                     /locus_tag="CD36_28480"
                     /inference="similar to AA sequence:UniProt:Q4WCR9"
                     /inference="similar to AA sequence:UniProt:Q59UH3"
                     /note="zinc finger-containing protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="C2HC5 finger protein, putative"
                     /protein_id="XP_002421895.1"
                     /db_xref="GeneID:8050209"
                     /db_xref="GOA:B9WLD4"
                     /db_xref="InterPro:IPR009349"
                     /db_xref="UniProtKB/TrEMBL:B9WLD4"
                     /translation="MSTNKSKTTSQLLKSKSPAPDATDKRSQKKKLVNLQDIDSILSQ
                     LETESSQTDSKIKRVCNCMARRHPLFEFAPNCLNCGKIICTKEGLQPCSFCGSDIIPP
                     KDRDAIIKLLEKEKEELVTKRQESNTSSLQKTKKKIVVKMNAGEKFWDAQDRAFKLAE
                     KELQSKKNMGAVAENASESKETKDRDLQKAKERLETLLDYQATGEERTKIIDNASDFE
                     MPSQSLWLTPEERALNLKKQQRLMRENLVNTERKLRGEKTVEMTIKDGKVTMVEKYVT
                     HTEGTSQEENELEKSIKEKKVQSQTSISVWDYEMDKSKWEKPIYFASKDIPQVDKSEL
                     KITKNRVQFPKEDASEVIATVIN"
     gene            complement(<730577..>731623)
                     /locus_tag="CD36_28490"
                     /db_xref="GeneID:8050210"
     mRNA            complement(<730577..>731623)
                     /locus_tag="CD36_28490"
                     /product="DNA replication and checkpoint protein,
                     putative"
                     /transcript_id="XM_002421851.1"
                     /db_xref="GeneID:8050210"
     CDS             complement(730577..731623)
                     /locus_tag="CD36_28490"
                     /inference="similar to AA sequence:UniProt:P34252"
                     /inference="similar to AA sequence:UniProt:Q59UH5"
                     /note="Similar to S. cerevisiae SLD2; DNA replication
                     regulator, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA replication and checkpoint protein,
                     putative"
                     /protein_id="XP_002421896.1"
                     /db_xref="GeneID:8050210"
                     /db_xref="InterPro:IPR021110"
                     /db_xref="UniProtKB/TrEMBL:B9WLD5"
                     /translation="MDIIEIKSKIKEWEYAFRKQHNKLPSKSDIKDDVEIHKLYSLYK
                     SIKSGQSQKPSKQETTEEPASTQSSPVKKNEYSPRGELGPTPQANGRVLSIFDLKMTP
                     PESSPLKHKSDKTSPLSFTMPPPQSPVKNIIETPTKSKNKSFTTPIKGRKIVFETPSY
                     LNKHRQNPQTPDSHKNNAVINFSVSPSPFKTQRGIGKRLTEVYNTSLKEAEDLKSFNL
                     EEEFQNEEKEESEAIETMNNNDEKIAPRNKRTQKRSTRRVKMAPRPVDSRPSLDNVNL
                     QDHMTKLEEGERKQLAAYMDSDEEDDSKDRENDIASVFESPTKKTRMPVSNNFKRLKI
                     NDPRSRRFKQRMRR"
     gene            complement(<731835..>733577)
                     /locus_tag="CD36_28500"
                     /db_xref="GeneID:8050211"
     mRNA            complement(<731835..>733577)
                     /locus_tag="CD36_28500"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421852.1"
                     /db_xref="GeneID:8050211"
     CDS             complement(731835..733577)
                     /locus_tag="CD36_28500"
                     /inference="similar to AA sequence:UniProt:Q59UH7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421897.1"
                     /db_xref="GeneID:8050211"
                     /db_xref="GOA:B9WLD6"
                     /db_xref="InterPro:IPR025656"
                     /translation="MIVRGRCLSRSISKLVSLSSRPVGIISAKSFVTTTNLLQNSKND
                     STEASIPWYMREENSSPVEVLNDVEVPELPDNSPQSLQEFVNLLTSEYGLTDLEIFDL
                     SQLPEDHPKSLEEQNDENYVILATGKSEKHIYKAAYELRLYIKHTYEHLPIIEGMSSN
                     SISKVTRRRLAKRVRRGPPATASTFGIGANTWVSCGTGIDGIVIHLLSRERRKSLNLE
                     QLYSDEHENEESYSSPDIDQDRLFFGDRRGFHTSCRKLNSNVLSKIYDSYVLNGNFDT
                     SQKFKAQFDLSFKGSSIEEYNKKFDLYRAINLVNANVVNVNEIEQIIWDKYSSLDLAS
                     QSGIDWNTEIIHDTIKYMEYLVDLKTRHSPKEKLHKLSNFISNIMCFSGDSIDLFTID
                     KFGALLWRLTWVSKDNNALDSANLNDIIKRRGDSEPSTNTISFDNELGRNVRELLRQN
                     KYSSNKETFPLWLREQMMYTFGQAGLWDRFWRDWHSILQSLNKTNERIYFWVITVLFL
                     SKVDNRDALRHLLTKYWSNPSGVSFVADYTKNNNQFNSDNERMALKNVLGHIGEKYNT
                     SPWAREAAQFADSL"
     gene            <733796..>734539
                     /locus_tag="CD36_28510"
                     /db_xref="GeneID:8050212"
     mRNA            <733796..>734539
                     /locus_tag="CD36_28510"
                     /product="U3 small nucleolar RNA-associated protein,
                     putative"
                     /transcript_id="XM_002421853.1"
                     /db_xref="GeneID:8050212"
     CDS             733796..734539
                     /locus_tag="CD36_28510"
                     /inference="similar to AA sequence:UniProt:P34247"
                     /inference="similar to AA sequence:UniProt:Q59UH8"
                     /note="Similar to S. cerevisiae UTP11; U3 snoRNA-associate
                     protein, putative; nucleolar protein, component of the
                     small subunit (SSU) processome containing the U3 snoRNA
                     that is involved in processing of pre-18S rRNA, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="U3 small nucleolar RNA-associated protein,
                     putative"
                     /protein_id="XP_002421898.1"
                     /db_xref="GeneID:8050212"
                     /db_xref="GOA:B9WLD7"
                     /db_xref="InterPro:IPR007144"
                     /db_xref="UniProtKB/TrEMBL:B9WLD7"
                     /translation="MAKLVHNVQKKQHRERSQKQSRARYGLLEKKKDYRLRAADYHKK
                     QAALKALKEKAKSHNPDEYYHAMTRKKTDDKGILISDRDSEVLSVEQAKLLKTQDVNY
                     IRTMRLNELKKIEKEKEGKLFGASGKHTVFVDSIEEQESFSPEEFFDTDAALLDNREN
                     RVRMNQLYDNSGLLKSNDIDIDTKNRLDLKKLKQYKLLQRRMKKEKELKEVESIMSRN
                     LEKMKKGNKKKIVDSNGKVHFKWKNQRKR"
     gene            complement(<734548..>735414)
                     /locus_tag="CD36_28520"
                     /db_xref="GeneID:8050213"
     mRNA            complement(<734548..>735414)
                     /locus_tag="CD36_28520"
                     /product="RNA Pol II elongator-associated protein,
                     putative"
                     /transcript_id="XM_002421854.1"
                     /db_xref="GeneID:8050213"
     CDS             complement(734548..735414)
                     /locus_tag="CD36_28520"
                     /inference="similar to AA sequence:UniProt:P34253"
                     /inference="similar to AA sequence:UniProt:Q59UH9"
                     /note="Similar to S. cerevisiae KTI12; chromatin
                     associated protein Kti12 homologue, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA Pol II elongator-associated protein,
                     putative"
                     /protein_id="XP_002421899.1"
                     /db_xref="GeneID:8050213"
                     /db_xref="InterPro:IPR013641"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WLD8"
                     /translation="MPLIIFTGYPCSGKTKWAKLLQKELEIRIQKAKENSEAGQNYTV
                     TYHSDETLGINHETYRDSNKEKLARGSQISAVKRDISRTNIVILDALSYIKGFRYQLF
                     CEAKGNVTPHCIVHVIAPIEKCIQWNNAKESENKWDPVLMQQLQMRFEEPNSDTRWDS
                     PLFTILSEDSQEKIPIDEIWNALVLKKAAPPNAATLIKPTSGNSFLQELDKKTQEVVT
                     KILQQQQITPGDVVIDKNLIVAIPTGTASTAQLQRIRRSYIGLNRMRSIDVDRIVPLF
                     VDYLNRSLNSED"
     gene            <735654..>736760
                     /locus_tag="CD36_28530"
                     /db_xref="GeneID:8050214"
     mRNA            <735654..>736760
                     /locus_tag="CD36_28530"
                     /product="mitochondrial GTPase, putative"
                     /transcript_id="XM_002421855.1"
                     /db_xref="GeneID:8050214"
     CDS             735654..736760
                     /locus_tag="CD36_28530"
                     /inference="similar to AA sequence:UniProt:Q4WUJ5"
                     /inference="similar to AA sequence:UniProt:Q59UI0"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial GTPase, putative"
                     /protein_id="XP_002421900.1"
                     /db_xref="GeneID:8050214"
                     /db_xref="GOA:B9WLD9"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WLD9"
                     /translation="MTFVPRKTFPNYNIPLNNFKGHHQKALSKFGHLAPQLDLILEVR
                     DSRAPISTTNVLFDKVLPSKKKLILYSKKDLSILKPRLLEKWHKSKNEQYMFVDCRSK
                     RDGKKIITEIKKLYDSMETPPPLGLRTMIIGMPNVGKSSLVNTLRYVGLSEGESAIST
                     KIRKVARTGGQPGVTRNTSEIIRLSRDPEIMVYDTPGVFLPTTKNAETMLSLALVGCI
                     NESFIDPVILADYLLYVLNLQDPTGKLYTDYIDHPTNNVYELLESINQKRNVLKIDKR
                     FDECGLANHWISKWKQGKSSKYRGLFDVAAIQEINVKDFGDLANAERERIGLSNVQQR
                     LQDRFGDDGTSTSKHRKRTAKDREFDMKNRLFKL"
     gene            complement(<736757..>738589)
                     /locus_tag="CD36_28540"
                     /db_xref="GeneID:8050215"
     mRNA            complement(<736757..>738589)
                     /locus_tag="CD36_28540"
                     /product="high affinity DNA-binding factor subunit,
                     putative"
                     /transcript_id="XM_002421856.1"
                     /db_xref="GeneID:8050215"
     CDS             complement(736757..738589)
                     /locus_tag="CD36_28540"
                     /inference="similar to AA sequence:UniProt:Q04437"
                     /inference="similar to AA sequence:UniProt:Q59UI1"
                     /note="Similar to S. cerevisiae YKU80; protein Ku DNA
                     binding protein subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="high affinity DNA-binding factor subunit,
                     putative"
                     /protein_id="XP_002421901.1"
                     /db_xref="GeneID:8050215"
                     /db_xref="GOA:B9WLE0"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="InterPro:IPR024193"
                     /db_xref="UniProtKB/TrEMBL:B9WLE0"
                     /translation="MSKEFTIFVVDASKYMGITDRDATASDFSRASKFAIDFFNQQLM
                     KNRKSDRYCLVVYSGNTIKVLYDNAPLSLTQVKTYRSTMIEIHENDAGAAPKYDLVDA
                     LFRALDQFKINSHYKFTRNIYLITNGVLPIGKNKSVPEYVDMVSNLNINITFVLINND
                     GNEHAQNSLRNLCGNFKNSNLVSFKELMTAGPALRLITPKCITEGYFGFGELGNTSEI
                     KNMVHLNIQVYPAVRVQSQMSGHEYYVDPKSKQRSKIERSTYYYTRTEDNLDEDEDEE
                     EDGVETSDTSERTIVPRAECTPGFKYSHRDILALTLELTEVATLPTYPSINVLGFMKT
                     NNFCYAYFTQDAMYVIPHQKDSERNRLTFNSMVTAMIELNYIALVRFVQKPDGEVQVC
                     AAFPKKVALGNQIGEVLLLVRIAMKEDEKIGRFPDLNNTDDNSVDELMESFISSKKLR
                     DEHFDADIIDNHMIGLLNSTSTSKPSSKDTTLDNLLLSSNPAARRFNYYFRKILDKSL
                     QEESLETFLQKDKFVERYLSIDEPHTLFNLDSILDCKEELLYTSDSTKADTITMNLQK
                     KLDVKYKTQHKSEKKSKPFNATSKPQPNDGKFGEYFDIEDILEN"
     gene            <738829..>741750
                     /locus_tag="CD36_28550"
                     /db_xref="GeneID:8050216"
     mRNA            <738829..>741750
                     /locus_tag="CD36_28550"
                     /product="isoleucyl-tRNA synthetase, mitochondrial,
                     putative"
                     /transcript_id="XM_002421857.1"
                     /db_xref="GeneID:8050216"
     CDS             738829..741750
                     /locus_tag="CD36_28550"
                     /EC_number="6.1.1.5"
                     /inference="similar to AA sequence:UniProt:P48526"
                     /inference="similar to AA sequence:UniProt:Q59UN5"
                     /note="Similar to S. cerevisiae ISM1"
                     /codon_start=1
                     /transl_table=12
                     /product="isoleucyl-tRNA synthetase, mitochondrial,
                     putative"
                     /protein_id="XP_002421902.1"
                     /db_xref="GeneID:8050216"
                     /db_xref="GOA:B9WLE1"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023585"
                     /db_xref="UniProtKB/TrEMBL:B9WLE1"
                     /translation="MLRFKARVRTFATSSAVLEKKSFSKTLLLPKTDFGPKIPRGDIR
                     EALIKQSSQDIYKWQKENKANKGEFVLHDGPPYANGDLHLGHALNKITKDIINRFELL
                     FHDRLIKYIPGWDCHGLPIEMKVETLGKKYESAIEIRKACREWANTMINKQRESFKEY
                     AIMTDFDKPYITMNHDYEINQLKVFSKLIENGLLSQQLKPVWWGCDTQTALAEAELEY
                     NEKHRSVAVHVKFPVVSENLYKYIESKGHTVGFGKLKLLIWTSTPWTIPLNRAICVNN
                     NMIYTLIQNESEALVVAKSLVEQVLKIDPNYKIANIDIPGSVLTGTFYTNPASNSSEE
                     YPVLHGDHVIETAGTGLVHNAPAHGREDYIVGRKHGLSVESAVDNNGKYIAKYLPPGF
                     QKLGDAKVTDVKTNVICANILNENGMLFHLDKKFVHSYPYDWRSKTPVIQRATPQWFV
                     NVEKIKPYAKEALSKVEFYPQSGSNRLTSFVENRSEWCISRQRVWGVPLPIVYEQASG
                     EAVLDLKLINYIIEKIDEFGTDEWFVEETDISRWLPDEMDGSKYFKGKDTMDVWFDSG
                     TSWSTLKSSLQECATISEPLADIYLEGSDQHRGWFQSSLLNKIIYSGSNGTSFQPVAP
                     FKKVITHGFITDGKGQKMSKSLGNVFSPREAIEGCKKPLTPYLGTDGLRLWVASSNYK
                     QDVSFSPEVLTRVSEVAKKYRVTFKYLLGNLHDFEVPVEYDQMNALDKYILHTLFKLQ
                     QACLDFYHDFNFSRVVSSINTHVNSISSAIYFDVSKDCLYTDSADSVRRRSIQTVLNE
                     MMKTYLGLLAPIQPLLTQEVWSEYVKFANLKEDSVFKVDSEFFKLGVKYENEAVEKSF
                     NEFLELRDDIFRSIESLKQQKFFKNKLELEVLLSVKEGTHICSFLRENSSYLDDLFLV
                     SSVKLVDGDLDYTYRVNGEPVSIRIQHSSKCKCPRCWKYTSESPEILCEKCDKVVETL
                     N"
     gene            <742084..>743022
                     /locus_tag="CD36_28560"
                     /db_xref="GeneID:8050217"
     mRNA            <742084..>743022
                     /locus_tag="CD36_28560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421858.1"
                     /db_xref="GeneID:8050217"
     CDS             742084..743022
                     /locus_tag="CD36_28560"
                     /inference="similar to AA sequence:UniProt:Q59UI3"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421903.1"
                     /db_xref="GeneID:8050217"
                     /db_xref="UniProtKB/TrEMBL:B9WLE2"
                     /translation="MSSVRKIAAYLERKEDLTQQYNSLKEAFKDEPDYEGLINVFEIL
                     KFLDELIYEYHVHKSYLQSTKGPINDFERKLLGEMEKTIKQLEDDVSLPYLIENAQNL
                     ALIRRELFENAHEGGRLIHAYELQNPSSKMMIRSSQPLSPSSVSLNSSPSSKSSQSQS
                     KSPLRLSNNPSEQYSLRQIPKDIQNPARAMTWSKRCTEIVFEAGKLNGTRTQKYDYIS
                     SQIEKEFGYQFRAHFSRYLYLHYIEGDAAKFRADFDKAYTKYMNLPTDKASELIEKEL
                     QVHRNVCRYGIWLREIFQRTYGKITEPAENFSYANY"
     gene            complement(<743068..>744893)
                     /gene="NOT4"
                     /locus_tag="CD36_28580"
                     /db_xref="GeneID:8050218"
     mRNA            complement(join(<743068..744760,744844..>744893))
                     /gene="NOT4"
                     /locus_tag="CD36_28580"
                     /product="general negative regulator of transcription
                     subunit, putative"
                     /transcript_id="XM_002421859.1"
                     /db_xref="GeneID:8050218"
     CDS             complement(join(743068..744760,744844..744893))
                     /gene="NOT4"
                     /locus_tag="CD36_28580"
                     /inference="similar to AA sequence:UniProt:P34909"
                     /inference="similar to AA sequence:UniProt:Q9P927"
                     /note="spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="general negative regulator of transcription
                     subunit, putative"
                     /protein_id="XP_002421904.1"
                     /db_xref="GeneID:8050218"
                     /db_xref="GOA:B9WLE3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:B9WLE3"
                     /translation="MIQADDTFISDDEEEYCPLCVEEMDISDKNFKPCPCGYQICQFC
                     YNNIRQNPELNGRCPGCRRLYDDESVEYKTVSAEEYKLMQLKKEKRDREKKQKEKEKK
                     EMEMVNKKHLAGLRVVQKNLVYVTGLNPPCNPDDLHSVLRSDKYFGQYGKISKIVINK
                     KTPTTQTSTHHHQNPGLVVYVTFTRKEDALKCITELDGSLCDGRVLRAAHGTTKYCSS
                     YLRGQPCPNPNCMFLHEPGEEADSYTRKDLSTQQGIKMGMTARSHTTSFGEESSSSGQ
                     TNHTVSDDDHHEVHKEHLPSTAHWAAPGTTSGSNSPLVNNNIPLANSAAFPTLGEIAR
                     DQKQQQKKEIKPRSKTTKANNALVPDELDSGDNSVFKFVETTTEQLRGLEDIRNIRFK
                     GCENGKVLPLFSFKGNFSNDTQLEDEKVIAREVIERFLLRPIKNYHLAYQNHPITQQQ
                     AILQRQQQQQQQQQQQQQQQTPALQVAQLQQNKNDEQQKQAQQQLLLLQLQHQQQLQQ
                     QQQRQLQQQQQQHQPHQLNILKTSDRVNTSTPPPPGLFAGKDVATSSDMPNTGSALPS
                     SSSQLLTQLMSGKR"
     gene            <745162..>745515
                     /locus_tag="CD36_28590"
                     /db_xref="GeneID:8049700"
     mRNA            <745162..>745515
                     /locus_tag="CD36_28590"
                     /product="V-type ATPase assembly factor, putative"
                     /transcript_id="XM_002421860.1"
                     /db_xref="GeneID:8049700"
     CDS             745162..745515
                     /locus_tag="CD36_28590"
                     /inference="similar to AA sequence:UniProt:Q03880"
                     /inference="similar to AA sequence:UniProt:Q59UI7"
                     /note="Similar to S. cerevisiae PKR1"
                     /codon_start=1
                     /transl_table=12
                     /product="V-type ATPase assembly factor, putative"
                     /protein_id="XP_002421905.1"
                     /db_xref="GeneID:8049700"
                     /db_xref="InterPro:IPR013945"
                     /db_xref="UniProtKB/TrEMBL:B9WLE4"
                     /translation="MSFFVELWESVFTPGTTPALITATHVSFILLIISLLVLIFLTKS
                     IHFINLLVIAVLLYASVFWFINELQQVKLKSNDELSKKESENHSKAGKLSADATESSK
                     TTATPEDIKPKKRKV"
     gene            <745668..>746429
                     /locus_tag="CD36_28600"
                     /db_xref="GeneID:8050219"
     mRNA            <745668..>746429
                     /locus_tag="CD36_28600"
                     /product="histidine triad (HIT) family nucleotide-binding
                     protein, putative"
                     /transcript_id="XM_002421861.1"
                     /db_xref="GeneID:8050219"
     CDS             745668..746429
                     /locus_tag="CD36_28600"
                     /inference="similar to AA sequence:UniProt:Q08702"
                     /inference="similar to AA sequence:UniProt:Q5A005"
                     /note="Similar to S. cerevisiae HNT3;
                     similar to Aprataxin, a Hint related protein that is
                     mutated in individuals with ataxia with oculomotor
                     apraxia"
                     /codon_start=1
                     /transl_table=12
                     /product="histidine triad (HIT) family nucleotide-binding
                     protein, putative"
                     /protein_id="XP_002421906.1"
                     /db_xref="GeneID:8050219"
                     /db_xref="GOA:B9WLE5"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR026963"
                     /db_xref="UniProtKB/TrEMBL:B9WLE5"
                     /translation="MSFRDAFQQYIDHPEKHDIVVFYDENVIIIKDIFPKSTRHLLVI
                     PRNRQVSRTHPLDAFCTDYPEFSGDKLYKMVSEYVEKAKDLIVDELLHYSDVKDKSQL
                     SEFRNTFINAGVHSIPSLNNLHVHVITQDFHSPKMKNKKHYNSFTTKFFVPFEELNPE
                     LNEGYCSRRTSQPFLETGSVQRNTQYIVHERSKEAMDKLIKTSPFKCTSCSKTFGNSM
                     VKLKAHLHDEYIRRYASFIDPNILIPNGVSAQCTN"
     gene            <747467..>749256
                     /locus_tag="CD36_28610"
                     /db_xref="GeneID:8050220"
     mRNA            join(<747467..747939,748041..>749256)
                     /locus_tag="CD36_28610"
                     /product="proton-coupled fructose symporter, putative"
                     /transcript_id="XM_002421862.1"
                     /db_xref="GeneID:8050220"
     CDS             join(747467..747939,748041..749256)
                     /locus_tag="CD36_28610"
                     /inference="similar to AA sequence:UniProt:Q5A001"
                     /inference="similar to AA sequence:UniProt:Q6BKP4"
                     /note="spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="proton-coupled fructose symporter, putative"
                     /protein_id="XP_002421907.1"
                     /db_xref="GeneID:8050220"
                     /db_xref="GOA:B9WLE6"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WLE6"
                     /translation="MSSVSSEKNSGLFGKDVYDETKENKPKYEHDEGLEFGSDFDFDG
                     EFEKYAAMGAAEKQSGAWMTNFKNLEFPLGVSPSTLVTTLGIFAAFCGILSGVDQSLI
                     SGASIGMDKSLHFNSHENSLVSSLMPLGAVAGSILLTPLQKFGRKKALMASCILYTIG
                     AILCAAAPIPKELADGTFNNHRSRDVMYAGRFILGIGVGIEGGGVGVYISESVPSSKR
                     GSLVSLYQLSIALGEVLGYAIAAIFYEVHGGWRFMVGSSLVFSTIVLIGLFFLPESPR
                     YLVFKGKFGEAFNVFARLRDLGDRHSKIEFVQMVQAAEAERELRLTQNKSKVWFELVT
                     VPRNRRALVYGVVMITLGQLTGINAVMYYLSTLMSRIGFSTKNSVFMSLVGGGSLLLG
                     TIPAILYMDKFGRRVWGYNLVGFFIGLVLVGVGYSIDIETNLAAAEGVYLTGLILYMG
                     FFGSYACLTWVVPAESFSLGTRSQGMTICSALLYLWAFTVTYNFNRMKEAMTYTGLTI
                     GFYGGIAFLGFFYQVLFMPETKGKTLEEIDEIFEKPSRQLIKENLSGLKRFWGR"
     gene            <749769..>750734
                     /locus_tag="CD36_28620"
                     /db_xref="GeneID:8050221"
     mRNA            <749769..>750734
                     /locus_tag="CD36_28620"
                     /product="dual specificity phosphatase
                     (phosphoserine/threonine and phosphotyrosine phosphatase),
                     putative"
                     /transcript_id="XM_002421863.1"
                     /db_xref="GeneID:8050221"
     CDS             749769..750734
                     /locus_tag="CD36_28620"
                     /EC_number="3.1.3.48"
                     /inference="similar to AA sequence:UniProt:Q02256"
                     /inference="similar to AA sequence:UniProt:Q59ZY7"
                     /note="Similar to S. cerevisiae YVH1; tyrosine-protein
                     phosphatase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="dual specificity phosphatase
                     (phosphoserine/threonine and phosphotyrosine phosphatase),
                     putative"
                     /protein_id="XP_002421908.1"
                     /db_xref="GeneID:8050221"
                     /db_xref="GOA:B9WLE7"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR016278"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:B9WLE7"
                     /translation="MSVTRILGGLYLSSIDPILKEIDLKTEYGISHIVSVVPGAMKES
                     YSSDYEWKQIEITDEETTNVIQYFPESYNFIDSGLFKNSNNKKHQGCVLVHCSQGISR
                     SATFIIAFLMQKYHLSIDQALHAVRRKCPDAEPNPGFMNQLRLYREMEFKIDETNQKY
                     NELLKNNALKADPTGRGLRNMIMDKSESPKEVKEEQAYELRCKRCRQILAGSAHIEDH
                     DIPESDSRQASFIKTAPNSRRIISIERASSDCSHYFFKEPVKWMKQELDKSDMEGKFQ
                     CPKCSSKVGGYSWRGSRCSCGKWMVPAIHLQEAKVDYIKKENYSS"
     gene            complement(<750741..>751556)
                     /locus_tag="CD36_28630"
                     /db_xref="GeneID:8050222"
     mRNA            complement(<750741..>751556)
                     /locus_tag="CD36_28630"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421864.1"
                     /db_xref="GeneID:8050222"
     CDS             complement(750741..751556)
                     /locus_tag="CD36_28630"
                     /inference="similar to AA sequence:UniProt:Q59ZY8"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421909.1"
                     /db_xref="GeneID:8050222"
                     /db_xref="GOA:B9WLE8"
                     /db_xref="InterPro:IPR008402"
                     /db_xref="UniProtKB/TrEMBL:B9WLE8"
                     /translation="MYSSNPFPSDLYSLWNRKTRDSKMSSKGEQEHVKNLYAPPLSAY
                     SSDFPGGSLYQLEYTINTTTKSSPLFTNTPLTQSKHAQLAKIRNTGYATIRPIGIVQT
                     MEEIELEKVYYSSDEQTMDPAVVAIENSSDAIVGANASTISIQQQIQQPEIDLDAQVF
                     NADEIYTGTDDERDSLDESDVQHMHGQVGITMDDEGFMAAEVEYQEDHSLDSVPNTGI
                     LINSSNSGTSTTFNSNTNTGRTVTTNPTTTSGSLLPIDEQNENEYSEQDMIVD"
     gene            complement(<751882..>753240)
                     /locus_tag="CD36_28640"
                     /db_xref="GeneID:8050223"
     mRNA            complement(<751882..>753240)
                     /locus_tag="CD36_28640"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421865.1"
                     /db_xref="GeneID:8050223"
     CDS             complement(751882..753240)
                     /locus_tag="CD36_28640"
                     /inference="similar to AA sequence:UniProt:Q59ZY9"
                     /inference="similar to AA sequence:UniProt:Q66R25"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421910.1"
                     /db_xref="GeneID:8050223"
                     /db_xref="GOA:B9WLE9"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR019407"
                     /db_xref="UniProtKB/TrEMBL:B9WLE9"
                     /translation="MPEAIEYLTGTEICQKCKTENAIIHARVEKLCSNCYIRFIRGKL
                     RKQMHDERYKVKFGRAIEQYGTQRILLALSGGESSLVLLDILGSLLQEQNELHKGKQG
                     FELVVVNLDEYELSSLNNRIKYTIPGLLKTYQPVKIDLKVLSLDSYIDEDCLHRISLT
                     PDFKALSKRINPTRVTLTEILQLCPNKSSAEDLLTVVYNDLILRVAAKENCQTVVYGH
                     CMTRLANEIIALTVKGRGSIIHKSIADHIEIVADREIKVMFPLREILQAEISAYVKLA
                     ELNKYVISSTIAKSKINKNLTIRDLTTNYFKQLDATGYASTASTVAKTGEKLGSPSNV
                     LCQCQICGADIHQNPSNWLKRITVTDPAPIITSEEKEYYEMFQASLSLGKEDKTDGAD
                     PIDICFGCTVTLGGVKGDTGFVWPLHGSSELKYEYLNDDQERQKVLNEFVLTDDESET
                     EV"
     gene            complement(<753381..>754421)
                     /locus_tag="CD36_28650"
                     /db_xref="GeneID:8050224"
     mRNA            complement(<753381..>754421)
                     /locus_tag="CD36_28650"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421866.1"
                     /db_xref="GeneID:8050224"
     CDS             complement(753381..754421)
                     /locus_tag="CD36_28650"
                     /inference="similar to AA sequence:UniProt:Q59ZZ0"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421911.1"
                     /db_xref="GeneID:8050224"
                     /db_xref="InterPro:IPR019363"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WLF0"
                     /translation="MKFFGRRASATETYGEEYLQLQMTVTYLNTTPKTPVYHKPPLER
                     FATTNIFVLIPGNPGLVDFYISYLDSIRKHFPQFETLCIGHVGFLDSTKRKTYDVSYQ
                     IEHKYDVLKQLILTKNESNIIPNLYFLHHSMGSFVYQRTIRRLYHDKNLNGKFNIKFS
                     GFVTPTIHNISASSSGRVLSGLMQKKVPIVSIVLVFRFFVSLIPALILRKLLYYHLLG
                     NKTGNGFENSVEGAYKIVKSGTVVKQALEMAKEEMLVIDTQDDINDWYFKHSDNGIKN
                     WLFFARDDHWVANETREYLINKYGNSDNTICEVCDDEVNPISHSFCVAQSEQFANITV
                     ERIKEICNVDLD"
     gene            complement(<754790..>756484)
                     /locus_tag="CD36_28660"
                     /db_xref="GeneID:8050225"
     mRNA            complement(<754790..>756484)
                     /locus_tag="CD36_28660"
                     /product="mitochondrial protein, putative"
                     /transcript_id="XM_002421867.1"
                     /db_xref="GeneID:8050225"
     CDS             complement(754790..756484)
                     /locus_tag="CD36_28660"
                     /inference="similar to AA sequence:UniProt:P36112"
                     /inference="similar to AA sequence:UniProt:Q59ZZ2"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial protein, putative"
                     /protein_id="XP_002421912.1"
                     /db_xref="GeneID:8050225"
                     /db_xref="GOA:B9WLF1"
                     /db_xref="InterPro:IPR019133"
                     /translation="MIRITSRSVKGAVNIRSVSTSTVRFNNAPKVVSPPVPPTVKPQG
                     SEIPPPPPPPPKTKKFSLFGFLFKTTLLATVVYGGTLYAATKNDKVMDFVIDKQLPFH
                     EELIDFIENGSTEDLEEAWENLKSKFTNVKLPTKDDIDELTQKLEHRGEDIIKETKKK
                     IASTHIGHKSGTDLTPAEQLQRGVEIESVKKDFAHLPLIELNSDLGKSVDDTVKQTIT
                     SFNNFIQSIDASSLANKDDKLVASVNTSVNQLASRLNSLTKDFDNELQKKLKVSQTEL
                     FSSFTRKELELTENLLHQFSTEKQQLESKLNQKLNQEIQAARAAISQAASNAVAMVRI
                     EQTKNFEKLVSEKLNEERTGRLANLEKLNDRIIELEKFAEGFETQIVSNHKKAIIHQT
                     VSKLKSLLLAPTAGDKPQPIKPYLDELTKIASDDEVLKLAIKDLSPLVTNESTHSILT
                     NAQLLSRWEQLAPELRSASLLPPNAGLLGHLASIVFSKLLLPVKGIKEDGKDIESVIG
                     RVESSLARGELDIAVEEAANLKGWSRKLANDWVVEGRKRLEIEFLLGLIESESRII"
     gene            <756962..>758803
                     /locus_tag="CD36_28670"
                     /db_xref="GeneID:8050226"
     mRNA            <756962..>758803
                     /locus_tag="CD36_28670"
                     /product="actin-interacting protein, putative"
                     /transcript_id="XM_002421868.1"
                     /db_xref="GeneID:8050226"
     CDS             756962..758803
                     /locus_tag="CD36_28670"
                     /inference="similar to AA sequence:UniProt:P46680"
                     /inference="similar to AA sequence:UniProt:Q59ZZ3"
                     /note="Similar to S. cerevisiae AIP1"
                     /codon_start=1
                     /transl_table=12
                     /product="actin-interacting protein, putative"
                     /protein_id="XP_002421913.1"
                     /db_xref="GeneID:8050226"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:B9WLF2"
                     /translation="MSIQPLSITVPHPSTQRGHATHISYDPVNERLAYVNGKSVIIRP
                     VDFKAIAPTVVFSKHIHPTTAVKFSPSGYYVASGDEAGHIKIWDASPKSEPDFEQPVI
                     KSEFQVMSGPIRSIAWDADNSRIIAVGQGKEKFGHAFSWDSGNSIGDIQGHSSPINSV
                     DIKPQRPYRAATVGDDHALVFFTGPPFKFDKSLRGNHNNVVRDVKFSPDGEHIVSVGS
                     DRVITIYQGKTGEFVKKIEKAHEGGIFAVAWLSDSKHFITASADNTLKKWTLEGETTQ
                     TFEISSTPSIANQQVGLALTKEFVVSLSGNGNLNYFDYKGNLVQIVQGHQSPITKVEF
                     HKGFLLSGGSDGKLFKWEVATDGPKALPILQDDDEHSNYVVDILTVDDVTYTAGWDDT
                     LKSWRDGKVVSSVELPSQPKQLGSMKDAVFVLFESALQLYTEVNFELIAETKFDFTAT
                     CAAPINDTCILIANTTSNTVEEFQVENGQISKTSKEFPKSRSPPTFITVSPSREFFAV
                     ADSAGKYTLFNALDSTVVSTRWAFHNSKVFDAKWTPDSKYLISGGLDSSLLLYSVEKP
                     SRVIKYLLAHPSGISSLAWVEYDSEKKTGTFVSAGLDATIRSWNISI"
     gene            complement(<758812..>760464)
                     /locus_tag="CD36_28690"
                     /db_xref="GeneID:8050227"
     mRNA            complement(<758812..>760464)
                     /locus_tag="CD36_28690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421869.1"
                     /db_xref="GeneID:8050227"
     CDS             complement(758812..760464)
                     /locus_tag="CD36_28690"
                     /inference="similar to AA sequence:UniProt:Q59ZZ4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421914.1"
                     /db_xref="GeneID:8050227"
                     /db_xref="UniProtKB/TrEMBL:B9WLF3"
                     /translation="MQNQPSKQSVYPRDRLLGAENSGHSHKKILPNTDYKNEHYVSGP
                     SASTQGFIPNTTQLPFALQYPTILRQPDGVSSSIPAQVQQRHINNSLPVYSPNFNLLH
                     SKQPSPPGPNTTTFQKHKNNSKSSKAKSSETFIPVQTKGNPKPKIHRMKENHTTEKNL
                     ESYSLYEIRILFKNKTGLNDVHLARNRIEDARENQLLGYFNCLVGKALDVFASLEIFS
                     QIFIELALLDDTQVILNGIYCLTEYELSKSDFTRCIHYYQTTIAIIHNQSRDNNPSRS
                     LQYRCLMAMMLLCIFESKFPQVESSHLQHYKNMSVELCKNQPSNEIGLDPILDCCFWT
                     VLRTSFLHSSLAGQNSSQFIPDSTFFNLQKDLLGSSTFQVSNVWHYKNVLVNLINIWN
                     FTYDISSTNQKGHKVYDYYQWKIHKIDILTEIPTALRSGIHQQSYNLPFPIFYYHDEL
                     IAVINVLHRLALLFLHEGLSQRVSTEDRLKESLLFPLNSPYFVSQEIIGILKPYENSP
                     FISSVGLFAIKHVWKYLQHDSNLTPFLRDMFSDMSLRSKIRI"
     gene            complement(<761444..>762953)
                     /locus_tag="CD36_28700"
                     /db_xref="GeneID:8050228"
     mRNA            complement(join(<761444..762757,762864..>762953))
                     /locus_tag="CD36_28700"
                     /product="citrate synthase, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_002421870.1"
                     /db_xref="GeneID:8050228"
     CDS             complement(join(761444..762757,762864..762953))
                     /locus_tag="CD36_28700"
                     /EC_number="2.3.3.1"
                     /inference="similar to AA sequence:UniProt:P00890"
                     /inference="similar to AA sequence:UniProt:Q59ZZ5"
                     /note="Similar to S. cerevisiae CIT1;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="citrate synthase, mitochondrial precursor,
                     putative"
                     /protein_id="XP_002421915.1"
                     /db_xref="GeneID:8050228"
                     /db_xref="GOA:B9WLF4"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR010109"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="UniProtKB/TrEMBL:B9WLF4"
                     /translation="MSAFRSIQRSSNVAKSTFKNSIRTYASAEPTLKQRLEEILPAKA
                     EEVKQFKKEHGKTVIGEVLLEQAYGGMRGIKGLVWEGSVLDPIEGIRFRGRTIPDIQK
                     ELPKAPGGEEPLPEALFWLLLTGEVPTEAQTKALSEEFAARSALPKHVEELIDRSPSH
                     LHPMAQFSIAVTALESESQFAQAYAKGVNKSEYWKHTYEDSIDLLAKLPTIAAKIYRN
                     VFHDGKLPAAIDPKLDYGANLASLLGFGDNKEFVELMRLYLTIHSDHEGGNVSAHTTH
                     LVGSALSSPFLSLAAGLNGLAGPLHGRANQEVLEWLFKLREELNGDYSKEAIEKYLWE
                     TLNSGRVVPGYGHAVLRKTDPRYTAQREFALKHMPDYELFKLVSNIYEVAPGVLTKHG
                     KTKNPWPNVDSHSGVLLQYYGLTEQSFYTVLFGVSRAFGVLPQLILDRGIGMPIERPK
                     SFSTEKYIELVKNINKA"
     gene            complement(<765711..>767585)
                     /locus_tag="CD36_28710"
                     /db_xref="GeneID:8050229"
     mRNA            complement(<765711..>767585)
                     /locus_tag="CD36_28710"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421871.1"
                     /db_xref="GeneID:8050229"
     CDS             complement(765711..767585)
                     /locus_tag="CD36_28710"
                     /inference="similar to AA sequence:UniProt:Q59ZZ6"
                     /inference="similar to AA sequence:UniProt:Q6CVT0"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421916.1"
                     /db_xref="GeneID:8050229"
                     /db_xref="GOA:B9WLF5"
                     /db_xref="InterPro:IPR019190"
                     /translation="MSRFWHFKKFYFSSCFSKQRMSRRIIKNELLVPMKVTSKHEQEQ
                     PITNDEPRSLLSEDANPSPDVESEPELESEQSENREDVHEIIRSMVLGTGTTLPRLSN
                     DSLTGIYNYWKLNPNDDLPLYNPTKYTPFEFHSQYNQDRSYISTPRLSVTKLLVFSWC
                     ELRSFYQVYSGSVRLPSTQAMTQGTKLHSKLEAEIHPEIDTTEIEQFLLSNAMSLGEL
                     QKAVPIEEDKVVFYLGEVERLAVDWAEMLIERLFSLIMGAEAREILLHGYLNFNNRSF
                     VTNKDEIRDPSSVLVSGIVDYVKLQNLTNPSDGTLFDDIHGFVDDNFDQVDNVPLVDL
                     SKFLPEAKQILQHYDFRLTFTDVKTRSAPQIPRQESVLEAAKFQTFYYRHFFQLLSRD
                     SRFTYFSLIENAERRGHDVDKPLSILTTICLLRKHYHILFKDFVRLANGEPIGFAPFD
                     DSAKSMAYDFVSVFQSSDEFSLANPNHTHFFEQLREIDGIEYDSILSPLLKVWKTPPT
                     LRYLAARASQLFGVFEENLGDVTSVEYRLNKTSQLLSENVYEYDFSEFQVEVESASKF
                     WNGEREAVPTEDLSRCSFCEFQSKCMVAGGNTTEAVEKKTIGPKIRHFLNECESSSKG
                     "
     gene            complement(<768131..>770239)
                     /locus_tag="CD36_28730"
                     /db_xref="GeneID:8050230"
     mRNA            complement(<768131..>770239)
                     /locus_tag="CD36_28730"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421872.1"
                     /db_xref="GeneID:8050230"
     CDS             complement(768131..770239)
                     /locus_tag="CD36_28730"
                     /inference="similar to AA sequence:UniProt:Q59ZZ7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421917.1"
                     /db_xref="GeneID:8050230"
                     /db_xref="InterPro:IPR009836"
                     /db_xref="UniProtKB/TrEMBL:B9WLF6"
                     /translation="MTFFHNINHFAHSGMDTSVPPSPTINMSQEFAEIICNSQDTDYS
                     SYKYVIGVNDPPVDIEVTNAAKYLPNEIETIAHLKLMRAFSVMKKKVVGLTDSNNAGK
                     LWGAFVARAVRRFIVFVTAIKKTVASSGKAYDEPSIFALANVKNSELVATVNQLLPPL
                     DVIMVWHAFLLNPKSFYDTFVRCNFLDFANFPLPLHNINKCIDDSSFEFKVSQIFKRN
                     YLDLIKKYTSYSLDLQYDTNEIRSYYDETLFIYCPNCYEKLSGGVSWINNENTGFANS
                     DLRATNINFAQSSECYCTNFPIITHEELRKLQLFADATKAGTLQGVYKHFSKVMSAPG
                     LIDRDPSNLSIEMALKIQEIWETHKYEEFPTMVKSIISQLKNPLTGVLLVEYLNNQTI
                     SMTVPGGIEIGYDLVSAVMQQERFVNKMNNINWLQSPHIKQILTESCSRYANFFTMLT
                     DPCLTQEMLIPTLDIDLVWRTHRLHLSGYVFDCRSSACHSVIDGSLHEGRLDNSFKTT
                     ADTYQFRFGESYNICYCQQCIISKSDTALATNKSIVAESNMEVKSLFNFETSPSFVGA
                     TSVRSMKNKVAKKRSRSKSSSNLSTSLSFSSNSFCTVDSVMDDPLTPIEEKLEDLISP
                     ISRSGLSSPSWMPLSLCQSMSSSDFSLFETGTTIGEDLNCPSGDFDAGFDDQAITFGD
                     IRNELLDSTLSTIFGAVPEL"
     gene            complement(<771735..>773234)
                     /locus_tag="CD36_28740"
                     /db_xref="GeneID:8050231"
     mRNA            complement(<771735..>773234)
                     /locus_tag="CD36_28740"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421873.1"
                     /db_xref="GeneID:8050231"
     CDS             complement(771735..773234)
                     /locus_tag="CD36_28740"
                     /inference="similar to AA sequence:UniProt:Q59ZZ8"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421918.1"
                     /db_xref="GeneID:8050231"
                     /db_xref="UniProtKB/TrEMBL:B9WLF7"
                     /translation="MLNKNLNLSLKLNKLDFVPPNSNFGGGSSPFTPVDQTLKTPLEA
                     PQHQTEFPLPHQFQSQHQGYHGNGNQSSLYQNPEVNESDDILTDIDEPYNMARRNFTL
                     FFTNQFDQVLISIYSSILSLPTTTPFSGNIPPSGLVSKVANETIKELIRVTSGSKNTP
                     VYDQFNIINSDCLRSHEYQPIILQLIRKRLLEICHSKNNTVNKLPESTSISLNSTVTR
                     NSSVSNLSLSDMNLMNYNSSSQNNATVNLARSRSSSINLRKQSLTRNNSNNWLHVGNI
                     NNLRPNGNPDFNMSTDSLQSFQDFVPQSIINRTSNGNGNVSVTNTSNNFVSSASNVGQ
                     LNSMMMDYHITPPTSHKGSVSSTNSPYNIVHNPCTSDSEEFQFLQRSRSSSRGNNLPQ
                     ALNINTDMSNLQALNSLQGNSNNSKNVQSGLSLDSPFLSATTPGDEYFSGTSFANSSN
                     NSTVAGVSAGANSVEGTETGCDTSKANLPNQYSLSEKKRDSLKMKRGIH"
     gene            complement(<775220..>776314)
                     /locus_tag="CD36_28750"
                     /db_xref="GeneID:8050232"
     mRNA            complement(<775220..>776314)
                     /locus_tag="CD36_28750"
                     /product="TBP-associated factor, putative"
                     /transcript_id="XM_002421874.1"
                     /db_xref="GeneID:8050232"
     CDS             complement(775220..776314)
                     /locus_tag="CD36_28750"
                     /inference="similar to AA sequence:UniProt:Q12297"
                     /inference="similar to AA sequence:UniProt:Q5A000"
                     /note="Similar to S. cerevisiae TAF3; transcription
                     initiation factor TFIID subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="TBP-associated factor, putative"
                     /protein_id="XP_002421919.1"
                     /db_xref="GeneID:8050232"
                     /db_xref="GOA:B9WLF8"
                     /db_xref="InterPro:IPR006565"
                     /db_xref="UniProtKB/TrEMBL:B9WLF8"
                     /translation="MDDSFYFALLRISIAQILKANGFDKCKPSTLNVMTDLYLQTFQN
                     AIKESLKCSNMRTNSNSPELQDITQALINISLFKANEVTKIHDEYFEESRYNTKSIEA
                     FYQWCKKSEPLAIEKKLNEVPNTLIKNLIEKRKLDIDDGESDLAKRKRKHKERQEFYN
                     QLKLNDDQRHRVDEDELDEDVITEKDKLTWFNYLIEKDLKLGHDLKYLHTDPIIVKEF
                     LKYQNNYKFHPVGVNNDKETNTNWDRIQNHLKHLNKTDHIVCEVSPEEVAPNESDKDI
                     LKSLTNVSSLLPYNLKYDENLLEEDLTTFNRAEVMSNEEEGKNDEPRPLDDEVEQTSH
                     VMTLNEGEVNNDGLLIDDAGIGGENSLIFM"
     gene            complement(<776781..>778566)
                     /locus_tag="CD36_28770"
                     /db_xref="GeneID:8049555"
     mRNA            complement(join(<776781..777996,778094..>778566))
                     /locus_tag="CD36_28770"
                     /product="proton-coupled fructose symporter, putative"
                     /transcript_id="XM_002421875.1"
                     /db_xref="GeneID:8049555"
     CDS             complement(join(776781..777996,778094..778566))
                     /locus_tag="CD36_28770"
                     /inference="similar to AA sequence:UniProt:Q5A001"
                     /inference="similar to AA sequence:UniProt:Q6BKP4"
                     /note="spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="proton-coupled fructose symporter, putative"
                     /protein_id="XP_002421920.1"
                     /db_xref="GeneID:8049555"
                     /db_xref="GOA:B9WLE6"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WLE6"
                     /translation="MSSVSSEKNSGLFGKDVYDETKENKPKYEHDEGLEFGSDFDFDG
                     EFEKYAAMGAAEKQSGAWMTNFKNLEFPLGVSPSTLVTTLGIFAAFCGILSGVDQSLI
                     SGASIGMDKSLHFNSHENSLVSSLMPLGAVAGSILLTPLQKFGRKKALMASCILYTIG
                     AILCAAAPIPKELADGTFNNHRSRDVMYAGRFILGIGVGIEGGGVGVYISESVPSSKR
                     GSLVSLYQLSIALGEVLGYAIAAIFYEVHGGWRFMVGSSLVFSTIVLIGLFFLPESPR
                     YLVFKGKFGEAFNVFARLRDLGDRHSKIEFVQMVQAAEAERELRLTQNKSKVWFELVT
                     VPRNRRALVYGVVMITLGQLTGINAVMYYLSTLMSRIGFSTKNSVFMSLVGGGSLLLG
                     TIPAILYMDKFGRRVWGYNLVGFFIGLVLVGVGYSIDIETNLAAAEGVYLTGLILYMG
                     FFGSYACLTWVVPAESFSLGTRSQGMTICSALLYLWAFTVTYNFNRMKEAMTYTGLTI
                     GFYGGIAFLGFFYQVLFMPETKGKTLEEIDEIFEKPSRQLIKENLSGLKRFWGR"
     gene            complement(<779604..>780365)
                     /locus_tag="CD36_28780"
                     /db_xref="GeneID:8049556"
     mRNA            complement(<779604..>780365)
                     /locus_tag="CD36_28780"
                     /product="histidine triad (HIT) family protein, putative"
                     /transcript_id="XM_002421876.1"
                     /db_xref="GeneID:8049556"
     CDS             complement(779604..780365)
                     /locus_tag="CD36_28780"
                     /inference="similar to AA sequence:UniProt:Q08702"
                     /inference="similar to AA sequence:UniProt:Q5A005"
                     /note="Similar to S. cerevisiae HNT3;
                     similar to Aprataxin, a Hint related protein that is
                     mutated in individuals with ataxia with oculomotor
                     apraxia"
                     /codon_start=1
                     /transl_table=12
                     /product="histidine triad (HIT) family protein, putative"
                     /protein_id="XP_002421921.1"
                     /db_xref="GeneID:8049556"
                     /db_xref="GOA:B9WLE5"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR026963"
                     /db_xref="UniProtKB/TrEMBL:B9WLE5"
                     /translation="MSFRDAFQQYIDHPEKHDIVVFYDENVIIIKDIFPKSTRHLLVI
                     PRNRQVSRTHPLDAFCTDYPEFSGDKLYKMVSEYVEKAKDLIVDELLHYSDVKDKSQL
                     SEFRNTFINAGVHSIPSLNNLHVHVITQDFHSPKMKNKKHYNSFTTKFFVPFEELNPE
                     LNEGYCSRRTSQPFLETGSVQRNTQYIVHERSKEAMDKLIKTSPFKCTSCSKTFGNSM
                     VKLKAHLHDEYIRRYASFIDPNILIPNGVSAQCTN"
     gene            complement(<780795..>781397)
                     /locus_tag="CD36_28800"
                     /db_xref="GeneID:8049557"
     mRNA            complement(<780795..>781397)
                     /locus_tag="CD36_28800"
                     /product="Clathrin adaptor complex small chain, putative"
                     /transcript_id="XM_002421877.1"
                     /db_xref="GeneID:8049557"
     CDS             complement(780795..781397)
                     /locus_tag="CD36_28800"
                     /inference="similar to AA sequence:UniProt:P53600"
                     /inference="similar to AA sequence:UniProt:Q5A006"
                     /note="Similar to S. cerevisiae RET3; subunit of the
                     coatomer complex (COPI), putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Clathrin adaptor complex small chain, putative"
                     /protein_id="XP_002421922.1"
                     /db_xref="GeneID:8049557"
                     /db_xref="GOA:B9WLG1"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:B9WLG1"
                     /translation="MSLNISLYTVSAVLILDNEGNRLFAKYYKSSLGEDSTNLSSKFP
                     HQFDTQQQQLSFEKSLFSKTYKVNQDILLYDNHLIAYKQTNDLLLYLVAPLNENESLI
                     YSTMNNLFEALTILLDNTVDKQTILDKYDMVSLAIDETIDDGIIIEYDPATIVSRVTN
                     PPSAVYENVNLKNIDISEKGLFNALSFASKKLGERLQQGL"
     gene            complement(<781779..>784199)
                     /locus_tag="CD36_28810"
                     /db_xref="GeneID:8049558"
     mRNA            complement(<781779..>784199)
                     /locus_tag="CD36_28810"
                     /product="polyphosphate synthetase, putative"
                     /transcript_id="XM_002421878.1"
                     /db_xref="GeneID:8049558"
     CDS             complement(781779..784199)
                     /locus_tag="CD36_28810"
                     /inference="similar to AA sequence:UniProt:P43585"
                     /inference="similar to AA sequence:UniProt:Q5A007"
                     /note="Similar to S. cerevisiae VTC2; vacuolar transporter
                     chaperone, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="polyphosphate synthetase, putative"
                     /protein_id="XP_002421923.1"
                     /db_xref="GeneID:8049558"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="UniProtKB/TrEMBL:B9WLG2"
                     /translation="MSSSENHGSIPKSKSAAPSSSETKMLFGTKLDHEIYPPWKDFYI
                     SYNHLKKLLKEGVILKNNWTDKDEQNFVSALDENLEKVFGFQHKKFDELNDELNELQQ
                     QTERTDSFNLESFSKELDKILDEAQNLEHFQRLNYTGFIKIVKKHDRIHPEYSVKPLL
                     NVRLKKLPFHSEDYSPLLYKVGTLYQFLRDNYEVDQSLSKLSSFNEGATNGEFQSFKF
                     WIHPDNLMEVKTTILRHLPVLIYNSTNNDDDDDDDDDEDEDDSNKHITGGQTINCLYL
                     DNDHFDLYNHKLTKLNNSSTVRIRWVGKLADKPKISMERKSFDVNSNFFVDDKIELRQ
                     KYINQYVIQKEIPKKLVKLNDANSVKKLLDFIKEYNLQPILRTTYNRTAFQIPGDDRI
                     RIIIDSNLTFIREDSFDPQLPIRDPQQWHRLDLDNSKSPQQFLRKGEFVKFPFSTMEI
                     KIKKSSAKNFKKLQWVNELINSSYLVKEIPNFSKFIHGVASLFLEDDKLDNIPMWFNE
                     LEGDINDDLPKLPSKINNNGITELSNDENLSKFKSMILNNKTSNFQPRSASFSGSLLY
                     TKGNDSEFGTQRIETIEEDVGPSDNGGVKPLSSARVTTDDQSSDFDEDDEEDEDDDRR
                     PNPLVRIMNLPNQFSKLVDVDSEDEEIDLPVGVTKPDQWIKNMGPIKIEPKVWLANER
                     TFNRWLHVTTLLSSLTFIIYSSTSGSNFEGLSTYLAYFYFALTLFSGLWAYYIFMERR
                     KIILERSDKHLDNSFGPLVIALGLTIALIVNFIFGWKNLNLDPNDEFYNNNPTQKKVH
                     EFMVNMVN"
     gene            complement(786341..788944)
                     /locus_tag="CD36_28820"
                     /pseudo
                     /db_xref="GeneID:8049559"
     misc_feature    complement(786341..788944)
                     /locus_tag="CD36_28820"
                     /inference="similar to AA sequence:UniProt:P32843"
                     /inference="similar to AA sequence:UniProt:Q5A061"
                     /note="Similar to S. cerevisiae RNA12;
                     in-frame stop codon"
                     /pseudo
                     /db_xref="GeneID:8049559"
     gene            <790023..>792860
                     /locus_tag="CD36_28830"
                     /db_xref="GeneID:8049560"
     mRNA            <790023..>792860
                     /locus_tag="CD36_28830"
                     /product="hyphally-regulated protein precursor, putative"
                     /transcript_id="XM_002421879.1"
                     /db_xref="GeneID:8049560"
     CDS             790023..792860
                     /locus_tag="CD36_28830"
                     /inference="similar to AA sequence:UniProt:P46591"
                     /inference="similar to AA sequence:UniProt:Q5A6U1"
                     /codon_start=1
                     /transl_table=12
                     /product="hyphally-regulated protein precursor, putative"
                     /protein_id="XP_002421924.1"
                     /db_xref="GeneID:8049560"
                     /db_xref="InterPro:IPR021031"
                     /db_xref="UniProtKB/TrEMBL:B9WLG3"
                     /translation="MQLFSNIIVSLALLTQLVFALEITENKIDRGTVTLNLGEITIYP
                     GASWSIIDNAYTNFVGKLDVRAGAGLYISSTSHLLALQVSLTTLLHSITNNGVVSFDS
                     RVSRTSSSYDLRGVSFTNNGEMYFAASGEFSSSTALTSASWTNTGLLSFYQNQRTSGT
                     VSLGLPLGSITNNGQICLNNQVYEQTTQIKGSGCFTAKGDSTIYISNVLLAVSPKQNF
                     YLTDKGSSMIVQAVSTTQTFNVYGFGEGNKIGLTIPLMGNLWNSAYAYDTVSGILTLR
                     NLLLEQKFNIGTGYDPSKFQVVTDSGSGIPSTILGSVAYYGRIPERALPKSCQTPCKP
                     VPEAPGTTPTQYTTTITKTNTAGNTVTESGVVNVSTDKGGSWFTTTSMFPALPSDTIL
                     STVELSTTQLSSSADIPVETSSAEELLTDTASWETSAAPILPTETPVSSHHSSVQHSS
                     TIGESSADVKATHSSEFGFETASDYIISEPSTSEHSATLSQSSVAGETHSSKLVASDE
                     PSFVTPSESFIFSASASSQPSVSSDSITLTTQSETTSSAGQAFVTLAESDTESISSKV
                     NTLASVTKSSDIQTEFTSTWTTANSDGCIVTESGIISQSGTSLTTLTTFQPATSLSVP
                     PTSVIETEFTTTWTTAKPDSSVATESGVVSQSETLLTTSTTFPAPSSDIVLGSTLTWE
                     SDISNEPSDTLTVSASSYELVNESLAATTTTSFSSSTIVVAPSESDISTSSSVSNNGK
                     TDSVSVSVPNSNTSSIAQHSNGPLSMITTESVNNNPLAPESTNSIVTATITNCNKSKC
                     SESVVTYITSVPHTTVTTGESKKDISTAGNNVSSISGEDVSNTGTITMAASTDGTTPL
                     VGMSGLKPSVVNNDTNSVHATATTAGAGAENDANLPTASDIPVEISVIRPTNSSSSAA
                     VTIPYENGSNKEPIENIKYLALVVFGLMMFM"
     gene            complement(<793680..>794789)
                     /locus_tag="CD36_28840"
                     /db_xref="GeneID:8049561"
     mRNA            complement(<793680..>794789)
                     /locus_tag="CD36_28840"
                     /product="mitochondrial membrane-spanning ATPase,
                     putative"
                     /transcript_id="XM_002421880.1"
                     /db_xref="GeneID:8049561"
     CDS             complement(793680..794789)
                     /locus_tag="CD36_28840"
                     /inference="similar to AA sequence:UniProt:P28737"
                     /inference="similar to AA sequence:UniProt:Q5A026"
                     /note="Similar to S. cerevisiae MSP1"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial membrane-spanning ATPase,
                     putative"
                     /protein_id="XP_002421925.1"
                     /db_xref="GeneID:8049561"
                     /db_xref="GOA:B9WLG4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WLG4"
                     /translation="MINKLKIDFGKFKIDLKLLGDLFVLAGAGLSVYYILNTILNDYL
                     DNTVKNKENEKKGSGILKKIQAANPHLKNLSFNQYEKALLNSLVTPEEITVTFDDIGG
                     LSDIIDELREAVILPLTEPELFAAHSSLIQSPKGVLFYGPPGCGKTMLAKAIAKESGA
                     FFLSIRMSSIMDKWYGESNKITDAIFSLANKLQPCIIFIDEIDSFLRDRSSNDHEVSA
                     MLKAEFMTLWDGLKSNGQIMVLGATNRKNDIDEAFLRRMPKTFAIGKPNASQRTAILN
                     KILKDAQLDENDFDLEYIVANTRGFSGSDLRELCREAAISPVREYIKENYNYKSGKLS
                     RDENDDLPVRPLRTSDFTKTSGSMNGDILPSVAVD"
     gene            <795147..>798194
                     /locus_tag="CD36_28850"
                     /db_xref="GeneID:8049562"
     mRNA            <795147..>798194
                     /locus_tag="CD36_28850"
                     /product="suppressor of glycerol defect protein, putative"
                     /transcript_id="XM_002421881.1"
                     /db_xref="GeneID:8049562"
     CDS             795147..798194
                     /locus_tag="CD36_28850"
                     /inference="similar to AA sequence:UniProt:Q06132"
                     /inference="similar to AA sequence:UniProt:Q5A077"
                     /note="Similar to S. cerevisiae SGD1;
                     essential nuclear protein with a possible role in the
                     osmoregulatory glycerol response"
                     /codon_start=1
                     /transl_table=12
                     /product="suppressor of glycerol defect protein, putative"
                     /protein_id="XP_002421926.1"
                     /db_xref="GeneID:8049562"
                     /db_xref="GOA:B9WLG5"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B9WLG5"
                     /translation="MARFNNEEILNSVGLPSQLLQQIKNKENKGDYDDDDSEDRFTKF
                     EKIRGTKRKSKPISRKDKRKQERELKKQKRVKKDTHPQKIQPKKQNENKQDPLALLAT
                     KKNKSKSRKIEEDNPLEALRKLKETKNNNNKTPKAKSDIKIVKEDELLDDEVSDLGYS
                     EDDFSSENETDFEDVENINMDPMEALRALKQKKNGSNKASSDIRIVKEDDLDDDDISD
                     FEEAEDELQEDNDPMEALRLLKSKKNKSAKTSEIRIVKEDELEQENDDEVSDLVSDEN
                     FDDQEEEEDFGGFEDASEGESDFGFSEDDEEEEDPLAKLKAIKEAKRNGKSEKTKQKQ
                     EKEVYPIDPHLQEQFRKDDEDIEYYAKKLGLKNGKKSKLSKTDDDDIIGGLLDGLDLD
                     FESAMENIDDTTDDHISEEDEEYSSDYLDNSKKVKENPYVAPGSEETKSSEESEITPQ
                     RYIPPALRKKMALEAGEGVSEETLKLRKSIKGPLNKLSEANISSIVSEINALYLSHPR
                     QVLNEEITNIILSSIVQQGRLLDTFVYLHATVVVALYRLQGVEFGAHFIQTIVEKFET
                     YQTDSSKTKEASNIISLLSSVYLFQLVSSKLLYDLIKELINNLDENNADLLLRLIRNS
                     GNQMRSDDPSALKEIVLLINGKVSTLPKDSINTRTQFLIETISSLKNNKLKIVNEANH
                     QLSVKLKKFLGGINENKSGDPIQVSLQDIQNVVTRGKWWLVGSAWKGHETDKPKDDVD
                     IVAMSDILDNAEPNWMELAKAQRMNTDIRRAIFVSIMSANDYIDAVTKLDKLALKRNQ
                     EREIPKVLIHCATMEPSWNPYYGVLGNKLCDSHSFRKTFQFMLWDLIKELDGGSADDE
                     EEEDNFIGFDSFDEENKMKRILNLGRFYAFLLAEGSMPLHNLRTVNFLTASSDTVLFL
                     EVLLVSFFDQVGKKSRKNSVGGGLQSKAQGMYEQKYDDRLLVERVLKAKDQTTMLRGL
                     QYFVQQKVKTSEVVSGKKQLKRVEWGVDALFDIIDEFLKNSED"
     gene            complement(<798262..>799923)
                     /locus_tag="CD36_28860"
                     /db_xref="GeneID:8049563"
     mRNA            complement(<798262..>799923)
                     /locus_tag="CD36_28860"
                     /product="tRNA (uracil-5-)-methyltransferase, putative"
                     /transcript_id="XM_002421882.1"
                     /db_xref="GeneID:8049563"
     CDS             complement(798262..799923)
                     /locus_tag="CD36_28860"
                     /EC_number="2.1.1.35"
                     /inference="similar to AA sequence:UniProt:P33753"
                     /inference="similar to AA sequence:UniProt:Q5A023"
                     /note="Similar to S. cerevisiae TRM2; transfer RNA
                     methyltransferase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="tRNA (uracil-5-)-methyltransferase, putative"
                     /protein_id="XP_002421927.1"
                     /db_xref="GeneID:8049563"
                     /db_xref="GOA:B9WLG6"
                     /db_xref="InterPro:IPR010280"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR025795"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B9WLG6"
                     /translation="MLSLQRNLPRIVSLSNRVIVTQCYNYSKIATPNRKPKGEEKIAN
                     LLRHFKKTKRRNDLTDPTHPSKITYREINDFLQQYSQSHKLEIQTDNIRNSLDIIKNF
                     LPHQRTQDTILDNVKIRAMTSSGEGLAIVPKSMYAHNFVADPEEILNQYTVLIIPKTV
                     IGDNTKVLLKMHHEFYAEGELIEVLNSKSKESRRNDMLIVCEKFNECNGCQLQMLSYE
                     DQLKYKQSVIQRAYKYFYPQIFNSFNDIDNFGVVNESPLQYTYRTKLTPHFAVSKKVN
                     QKLGFQHVNNRERLDVSNCPIATPEINDKLLESREKYIGKSTPLTQLTLRQSLRINHD
                     TGAFKSVALEGQKKVVTEKVEDFLFQYDSNCFFQNNNAILPSVLDYIRYHINQSDKTI
                     DNLIDTYCGVGFFGIALSKSFNENTKIFGIELVEQAIKYANHNAKLNGLDPERVQFVS
                     GDASNIFNNDKFKKSGISGKNSVVIVDPSRKGSNESFLQQLLNFEPEIVVYVSCNVFS
                     QARDLATFENLQQHTNVKYKVKDVMGFDFFPQTKHVESIAILEKV"
     gene            <801878..>803830
                     /locus_tag="CD36_28870"
                     /db_xref="GeneID:8049564"
     mRNA            <801878..>803830
                     /locus_tag="CD36_28870"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421883.1"
                     /db_xref="GeneID:8049564"
     CDS             801878..803830
                     /locus_tag="CD36_28870"
                     /inference="similar to AA sequence:UniProt:Q5A074"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421928.1"
                     /db_xref="GeneID:8049564"
                     /db_xref="InterPro:IPR009836"
                     /db_xref="UniProtKB/TrEMBL:B9WLG7"
                     /translation="MEDSKRNFHYFGYSLDNVDKRSVYEFHNILEQSDFSKYHSFQYI
                     LSEKSLSNNISTSIIPQHLPNEFEIITHLKLIKALSLLKTNVLAGTASYTSISIWRQF
                     VTNAVRRFMVFLTSLKIFIDTDLGYSFGSPDSQNYQKSHFQFTSMMTQLMPPLDVIMV
                     WHSFLLHPKSFYTVLTSCKMKEFANIPLPLHLISQFIDNCTFEFNVPHEYKYNYFQII
                     KCTTTDMFDLQYKVDRVGFDRKYVTVTCPHCKHVISEPIKLSNEMGTGFFDTNFATEN
                     IFFGEQSPCYCSKIENLTHVELRKLQFFTDASKGKSPITFFHKKAPIQTDDLKRTSQS
                     YQELFRQSWETIQAKDLNDIILILEEKCNKESLPQAFLLSSYRKLDLISMTVPGDIQI
                     GENLVEFVLRQESFNNNMNNLNWLHSKTISSIISEATTRYSNFYPIITHPKLSQELKS
                     TLDIDLVWYTHQLCAYGYFQDCLMSPNGCIVDQRDTISNSLIDNSETFTANLYKTLYG
                     QDYFICYCNSCTSMRYGISHPVIDPTTNANSCLSLDNKLLSIDSNMAYPSSESNSIME
                     CTPGLQQYSWVGDNPNDFLTYVVTKDNLDKELIEKDQRIMNNDDFSRENVDCSFDFNI
                     PEVDNAFRDGQHECPNNEFLRLWCMI"
     gene            complement(<803933..>807655)
                     /locus_tag="CD36_28880"
                     /db_xref="GeneID:8049565"
     mRNA            complement(<803933..>807655)
                     /locus_tag="CD36_28880"
                     /product="chromosomal ATPase, putative"
                     /transcript_id="XM_002421884.1"
                     /db_xref="GeneID:8049565"
     CDS             complement(803933..807655)
                     /locus_tag="CD36_28880"
                     /inference="similar to AA sequence:UniProt:P32908"
                     /inference="similar to AA sequence:UniProt:Q5A021"
                     /note="Similar to S. cerevisiae SMC1; structural
                     maintenance of chromosomes protein, putative; subunit of
                     the multiprotein cohesin complex, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="chromosomal ATPase, putative"
                     /protein_id="XP_002421929.1"
                     /db_xref="GeneID:8049565"
                     /db_xref="GOA:B9WLG8"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028468"
                     /db_xref="UniProtKB/TrEMBL:B9WLG8"
                     /translation="MGRLIGLELFNFKSYKGKSIIGFGSSYFTSIIGPNGAGKSNMMD
                     AISFVLGVNSYHLRSQNLKDLIYRGRRNVDTDNTTLDAIEQDPTSAYVMATYEKDNGE
                     ILKLKRTITASGNSDYQINGQSVTMLNYSMVLKQENILIKARNFLVFQGDVETIASQN
                     PKDLTKLIETISGSNEYISEYEKLKEEQEKAHELTTSVFSRKRTLNSESKQYKEQMAE
                     QRQFEEKIITKNDTIKKINLYKLFHNEKKHNQLKDEIKSKNEELKLAKKELSNKEKTY
                     KSIMADYSSSVLNAKKQKQQTETAQQKIDSTKRELIPVEANQRSLSNKINFHKVKVDD
                     LKKDIARQKTLVSSVERQLRDAQRMFDDFQTKIAAAVASSTNISPEGQKEYEELRSKF
                     LADNGSELEEQISLLLNSKDSLNSAKSNLENQKANAQNRIAELESIVATDLKSKLHDV
                     SNEINEVLDKKSSKVEARNALIKQKDEFNHEELKLNTRLRDVLVQLDELASQQRESNK
                     QKKLRENVATLKRLFPQGAIKGLVYELVRPTQQKYESALATLLGANFDSIIVESSAVA
                     YKCIDILKERRAGVATFIPLDSIETDIINLSHLRSIHPSALPGVDIIEYQDKSLEPAV
                     NYIIGNTVVVDSIDTARNLKWQSNTRFENRIVTLQGSVIHKSGLMTGGQQQQKSSASL
                     SWSKQEWTKLNELKEELNQKIFKLQEKRPKDLAINLLAEEIGSLDDKLPVLRNQKTSI
                     ERIIKDRESEIEFQTGLFKGFDKSIQEKMNEITKLNEKIEKINEEMKSSKESIFAEFC
                     EKYGFTNGIEDYENMHGSTLRVRAKERAQFSKTISVLQSKLDFEKERLKETKDRRKNI
                     ESLVVDLENDLANVLTEKKKLEEILDKAEAEYEVLQVEISKFDDSIQSQLRTSKSIES
                     DLDDSRQLVSALVKEITQIEENLLKTDSERANVLRNCKIQNINLPLIDGDLDSISIGE
                     NLESSIKEVYKIDLDYDMLEEKFKEVFTNKLESELEVTLQNTISDLEKLTPNAKAVER
                     LQEVETKLQDYDKEYNVARQKERQVSERFKRVQEKRYDKFMDAFNHISGSIDSIYKEL
                     TKSAMSPLGGSAYLTLEDEDSPFLSGIKYHAMPPMKRFRDMELLSGGEKTMAALALLF
                     AIHSYQPSPFFVLDEIDAALDNANVARIGNYIKKYAGPNFQFIVISLKNSLFEKSDAL
                     VGIYREQRENSSKTVTLDLREYPDEDIALSTVTATT"
     gene            <808714..>810924
                     /locus_tag="CD36_28890"
                     /db_xref="GeneID:8049966"
     mRNA            <808714..>810924
                     /locus_tag="CD36_28890"
                     /product="putative Xaa-Pro aminopeptidase, putative"
                     /transcript_id="XM_002421885.1"
                     /db_xref="GeneID:8049966"
     CDS             808714..810924
                     /locus_tag="CD36_28890"
                     /EC_number="3.4.11.9"
                     /inference="similar to AA sequence:UniProt:Q07825"
                     /inference="similar to AA sequence:UniProt:Q5A020"
                     /codon_start=1
                     /transl_table=12
                     /product="putative Xaa-Pro aminopeptidase, putative"
                     /protein_id="XP_002421930.1"
                     /db_xref="GeneID:8049966"
                     /db_xref="GOA:B9WLG9"
                     /db_xref="InterPro:IPR000587"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:B9WLG9"
                     /translation="MTYSEKQPLLEHGKKIADDHEVSIRSFNFPIFENTLSLFNSINP
                     FQNCLSPLSRKVSNISLDDNSCADGDGDYNLLDDEDTSLPDLPYESDDFPILLPRSKL
                     SQREKLFELKKLMKQYNIGTYIIPSEDEHQSEYTSLSDKRREYITGFTGSAGIAIVTL
                     TNGNALTGEAILSTDGRYFLQAEKQLNPRLWKLFKQGAAGYKPWHEWSVESASKNEFS
                     KVISCDPRVISLSIGEYFDKQAKFRKSFQFKPLLSVNLVDEIWGVEKPSRPLDPIYVL
                     PLVYSGEHTNDKLTRIRQVMKEKNSTYYVVSELDSIAWLFNLRADRDIPFTPVFFAYA
                     LVTFDSVVLYVNGDKLPKDDAQLNDYLSSIENLTIKEYDEFFKDVSKLSGLQDKDIVV
                     LPTRSATSYALYDAITKSVGKSSLYHESIVANLKIFKNKTELFNAKIAQYKDSLAFII
                     FSAWLDYQLVTKRKKISEYDAACKIYSIRQKLPNFKGLSYETISSTGANAAIIHYAPT
                     KTENSIIDPTKPYLIDSGAHYLEGTTDITRTYKFGYHGLTDRDKLYYTLVLKGHLSLA
                     MAKFPPNSTSTGTILDAFARQPLWNKGLDFNHGTGHGVASFGPVHEGPLYISTTSGGP
                     SKGLFQPGAILTDEPGYYVDGEVGFRIESELEVVECDGSLGKTRQGENFLGFNYLTKV
                     PFCRKLIDTTQLSAIEIQWINEYHQSIRDDFGSKLLELKERRVYNWLLDETEPI"
     gene            complement(<810998..>814549)
                     /locus_tag="CD36_28900"
                     /db_xref="GeneID:8049935"
     mRNA            complement(<810998..>814549)
                     /locus_tag="CD36_28900"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421886.1"
                     /db_xref="GeneID:8049935"
     CDS             complement(810998..814549)
                     /locus_tag="CD36_28900"
                     /inference="similar to AA sequence:UniProt:Q5A019"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421931.1"
                     /db_xref="GeneID:8049935"
                     /db_xref="UniProtKB/TrEMBL:B9WLH0"
                     /translation="MNEEDKTSKEDIDLKNAIGDVFGQFDFGSIDTGQDHNHQLQQDQ
                     PEEQSKNQPQQRDSEIPHGHLLAPAQNEEIVAEPKQTSKEKDKIQVQNTQTEATETSK
                     TYEDELNLEDAIGDALDNVFGTSSNNNNDINKRYTDPTNDHESLNSNNQNEINHAIEN
                     ALGDIFAGSKSDTTTDDAVESHEKDKPIPELSSPSRKFQESSDPTDQPSSQQKVEKPK
                     KSLLETKSDEDEDLDDIIGKTISDLVKAPKDNRNETDTQNVSEIPVDAEIKRQHKDQT
                     DKCEDTTIQQNEVNTEKIPTPDKSHDNHLHKRQINSPECSTEDNVITDKPIADIKGKE
                     STDRIDNNKGLTETTTSIGNSKTNSKMNEEVDNLDDVIGKAFEDAISKSQSTPINPCN
                     ITDQDEPSPHPTPSEKTDLPLSQVEQKLAPSETGNDPTNDSTELDQAIGDVFKEIIKE
                     DSNGKTEKLPAPAPAADDDMDLDAVIGDAFKSVLPNELPSKDKSLPLPPDEDEKDLES
                     AIGEAFESISDFKETKRKQDEQVNDDELNAMIAQSFEKAVAITKPDSQTDNEDMENAI
                     TQAFKTAMASTSSSSEISAREAAIRSLAVEISHQVQDHLKNDKFMPPLPFIPGLPQLD
                     DSVLAHFQRVANTDDTKEQTHLRSDSSQTTVSESANFKDNGGVAELENLQMNDILQNA
                     FKMALENPQELISDLDIDSTIQVPTAAFPRQIPPPPPQQHKPAGRQHFVPTSSDQGLQ
                     SYRKYPHQSILEVQRPSTNTPIRKPANKSKSLENESQKKPSLLSNPAVTLQLTSIIST
                     LTSRINSGELSDANILQVIRQMTDVLASGGSLASFLKKPTSVQDVIVTYNDSTKQKML
                     KSLYLTKTFFEKKMSIDEDEVKQKAIRLIDNIAVAFDPVGFRKFIAVEIKDDEFADIS
                     LLLKNVLMTTLKQEPITRFSSNTLKYIELLVDKISQNVSFESTNEETVKRVSQDEELV
                     KPITDLFGLLSGSSLLDNLLPSAVATAVSVAGTGYIYKETSGIDLDIVIRAVCLILNN
                     LLKTAPGITFRGNNTTTIGNQATKRLSDLILVGDLRRTKINPDIGKTTNTDSEKSESW
                     NIDRSSSIKIPQYRRPSALHEKSNVLHKPALTLPRSSPFISNKIESSHSNSQPLQTSN
                     HNNKLKRPGSFQRPNNAKPRATSLGFPKLHSTSFKYQ"
     gene            complement(<815108..>816010)
                     /locus_tag="CD36_28920"
                     /db_xref="GeneID:8049936"
     mRNA            complement(<815108..>816010)
                     /locus_tag="CD36_28920"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421887.1"
                     /db_xref="GeneID:8049936"
     CDS             complement(815108..816010)
                     /locus_tag="CD36_28920"
                     /inference="similar to AA sequence:UniProt:Q5A018"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421932.1"
                     /db_xref="GeneID:8049936"
                     /db_xref="InterPro:IPR013897"
                     /db_xref="UniProtKB/TrEMBL:B9WLH1"
                     /translation="MTTFFKLFSFSISMPIIKRLYITASNNYDSNYQIVPVNTEQPLE
                     IDSKIGLFKLFLNIKNFDGSKPHLSNSLYNLQDDVYLNGEKIEFNKPQKDQDQPNLRM
                     NIEFTPKEDINGSNFVFGNDFTYPIRDYVPVGLLNTGLKLFNWFINDSVKGDPYPDKP
                     YLYGPGISSFTYMAIKNPDDPTVNTHSKNAVENLFQQEENIPKEPNARKKFFGNKKKC
                     EKFTFKKGVTYILQFDTNFVKLADSKYSISIPKFDFDVSHYANDTLNNVNWVFKEGGY
                     EGVDFGKLGLIINFKVLSEDTEDS"
     gene            <817368..>818339
                     /locus_tag="CD36_28930"
                     /db_xref="GeneID:8049937"
     mRNA            <817368..>818339
                     /locus_tag="CD36_28930"
                     /product="transaldolase, putative"
                     /transcript_id="XM_002421888.1"
                     /db_xref="GeneID:8049937"
     CDS             817368..818339
                     /locus_tag="CD36_28930"
                     /EC_number="2.2.1.2"
                     /inference="similar to AA sequence:UniProt:P15019"
                     /inference="similar to AA sequence:UniProt:Q5A017"
                     /note="Similar to S. cerevisiae TAL1"
                     /codon_start=1
                     /transl_table=12
                     /product="transaldolase, putative"
                     /protein_id="XP_002421933.1"
                     /db_xref="GeneID:8049937"
                     /db_xref="GOA:B9WLH2"
                     /db_xref="InterPro:IPR001585"
                     /db_xref="InterPro:IPR004730"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018225"
                     /db_xref="UniProtKB/TrEMBL:B9WLH2"
                     /translation="MSSNSLEQLKASGTTIVTDTGEFEQIAKYKPQDATTNPSLILAA
                     TKNPEYASVIDVAIEYAKDKGSSPKEKAEIALDRLLIEFGKNILDIVPGRVSTEVDAR
                     LSFDKEATVKKALELIDLYKQQGIEKDRILIKIASTWEGIQAARELESKHGIHCNLTL
                     LFSFAQAVACAEAGVTLISPFVGRILDWYKASTGEEYTAETDPGVKSVKAIYNYYKKY
                     GYKTIVMGASFRNTGEIKALAGCDFLTISPKLLEQLYNSTEEVPKQLDAATAKDDDIE
                     KVTYVDDEPAFRFALNEDAMATEKLSQGIRQFGKDAVTLLTELESRF"
     gene            complement(<818713..>820431)
                     /locus_tag="CD36_28940"
                     /db_xref="GeneID:8049938"
     mRNA            complement(<818713..>820431)
                     /locus_tag="CD36_28940"
                     /product="sodium/calcium exchanger protein, putative"
                     /transcript_id="XM_002421889.1"
                     /db_xref="GeneID:8049938"
     CDS             complement(818713..820431)
                     /locus_tag="CD36_28940"
                     /inference="similar to AA sequence:UniProt:Q4WG59"
                     /inference="similar to AA sequence:UniProt:Q5A016"
                     /codon_start=1
                     /transl_table=12
                     /product="sodium/calcium exchanger protein, putative"
                     /protein_id="XP_002421934.1"
                     /db_xref="GeneID:8049938"
                     /db_xref="GOA:B9WLH3"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:B9WLH3"
                     /translation="MNFYIFEESSSQCSIPSSTPNVCSFIQKQCDTTYFKISELYYCC
                     LTPSLPNLLFSSLLILVLLVVILISLSILVSNYLFQNLHNLTNVLGLNNQILSFILIP
                     LSNSLPDILNYYIALDSGSTDLVIGQLMGSLLIMFTIIIGSISILNRGYIIEHPKILM
                     LDLVIVLIVLILFSEILSDGKITNLECWIMITGYFLYILFLIFFDKDKLKEVADEEQV
                     WIEYQNNGSFTHPYNIEDAISILSSNDDEIASYGPVVSRSPSPLPEHTSSANDPLSLS
                     INSLSPRSSSPLYGPSEVATEESPLLLAVPGKFPTSKISPSIPINEDSDDEIIIQIPS
                     RSKSFVQRAFDLVDYLFMTFVPYYRKIKSNYSRAIISWYIIETIAVVNYQFFQFPYKY
                     VIPISYVIAAILVYIQLTSNVQIVAISMAGLTVSLIIVSNLAIVTLQLLKNLGVIWQI
                     SDYLLGLIVFAISNSLNDGITNITISTKINPILGINSCIGTPLLIILLGIGGNGLIVT
                     SRSHKDIWFSLTDNVVISAGGLIFSICCLIIYLPWNDYRVDAKIGNFLLLLYIIMTGV
                     EIYLEY"
     gene            complement(<821549..>822079)
                     /locus_tag="CD36_28950"
                     /db_xref="GeneID:8049939"
     mRNA            complement(<821549..>822079)
                     /locus_tag="CD36_28950"
                     /product="flavin mononucleotide kinase, putative"
                     /transcript_id="XM_002421890.1"
                     /db_xref="GeneID:8049939"
     CDS             complement(821549..822079)
                     /locus_tag="CD36_28950"
                     /EC_number="2.7.1.26"
                     /inference="similar to AA sequence:UniProt:Q03778"
                     /inference="similar to AA sequence:UniProt:Q5A015"
                     /note="Similar to S. cerevisiae FMN1; riboflavin kinase
                     precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="flavin mononucleotide kinase, putative"
                     /protein_id="XP_002421935.1"
                     /db_xref="GeneID:8049939"
                     /db_xref="GOA:B9WLH4"
                     /db_xref="InterPro:IPR015865"
                     /db_xref="InterPro:IPR023465"
                     /db_xref="InterPro:IPR023468"
                     /db_xref="UniProtKB/TrEMBL:B9WLH4"
                     /translation="MTVSNDTSITYPIQQQASIIAGFGRGSSELGIPTANIPINTELN
                     KLEPGIYYGWCKLIPLTAQCDEIKKRVDGKDVLFNHGNELTNEEKDIFPMVMSIGWNP
                     YYHNKDKTAEVHIIHKFHENFYGSKIEYVVLGYIRPELNFNSIDELIDTINSDIEYAK
                     SKLKSDEQSGKEYFTK"
     gene            complement(<822383..>823564)
                     /locus_tag="CD36_28960"
                     /db_xref="GeneID:8049940"
     mRNA            complement(<822383..>823564)
                     /locus_tag="CD36_28960"
                     /product="U1 small nuclear ribonucleoprotein component,
                     putative"
                     /transcript_id="XM_002421891.1"
                     /db_xref="GeneID:8049940"
     CDS             complement(822383..823564)
                     /locus_tag="CD36_28960"
                     /inference="similar to AA sequence:UniProt:Q03776"
                     /inference="similar to AA sequence:UniProt:Q5A014"
                     /note="Similar to S. cerevisiae PRP42; U1 snRNP protein,
                     putative; pre-mRNA-processing factor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="U1 small nuclear ribonucleoprotein component,
                     putative"
                     /protein_id="XP_002421936.1"
                     /db_xref="GeneID:8049940"
                     /db_xref="GOA:B9WLH5"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:B9WLH5"
                     /translation="MSLINKQWSRISTELIQDPQNLELWQSLIEAAEWNEKRGINKST
                     SEEELNILRTTYNSFLEKFPFQFKYWIRYAEWEFKLGNTSTAEQIYLRGLSTQLSHCI
                     ELWISYLNFKINTINDNILEILQKFEIARSLIGFHFFGFEFYELYLSFLDNYKNDSNE
                     FEKKYYILLRIILEIPIYHYGIFYKKWFDLIDKLLKDEKLARQIVRYIAPANEIATLE
                     SKKNTSIFIELKKRFTDAYIATQYHSFELYEFEKKLLPKNNKNTQQDNDLRSRQELDA
                     WMSYIEYLEIKQYPTKFIELVYYRFLYNARNYPQTWSKFADYYIYHGKFNKAKKILTD
                     GIKFVDDYKLLIKLVDLEIFLKNYQRAINLLISYIQYSSNVPIPIRDKVHQVKQLIGQ
                     E"
     gene            <824671..>825459
                     /locus_tag="CD36_28970"
                     /db_xref="GeneID:8049941"
     mRNA            <824671..>825459
                     /locus_tag="CD36_28970"
                     /product="nicotinamide N-methyltransferase, putative"
                     /transcript_id="XM_002421892.1"
                     /db_xref="GeneID:8049941"
     CDS             824671..825459
                     /locus_tag="CD36_28970"
                     /EC_number="2.1.1.1"
                     /inference="similar to AA sequence:UniProt:Q05874"
                     /inference="similar to AA sequence:UniProt:Q5A013"
                     /note="Similar to S. cerevisiae NNT1"
                     /codon_start=1
                     /transl_table=12
                     /product="nicotinamide N-methyltransferase, putative"
                     /protein_id="XP_002421937.1"
                     /db_xref="GeneID:8049941"
                     /db_xref="GOA:B9WLH6"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR025784"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B9WLH6"
                     /translation="MSEDEISIEGDLFEEPEGFLPERPSSHFSTYQRKIPNAEPQEIT
                     LKLVGHNPLYGHLLWNAGIYTADYLDKHSDTLVKDKKILELGAASALPSLVCSLNHAK
                     EVVVTDYPDPDLLSHMEYSFNDLKEKTKYELSPWTVKGYIWGHDLGELLFDEPGRKLT
                     EEEKFDLIILSDLVFNHSEHHKLLNTCRQSLKSDGGRCFVVFSPHRPHLLQDDLDFFE
                     TAKQYQFKTEKIEMVTWKPMFEEDEETADIRARVYAFFLIPEWE"
     gene            complement(<825823..>826353)
                     /locus_tag="CD36_28980"
                     /db_xref="GeneID:8049942"
     mRNA            complement(join(<825823..826011,826351..>826353))
                     /locus_tag="CD36_28980"
                     /product="40S ribosomal protein S30"
                     /transcript_id="XM_002421893.1"
                     /db_xref="GeneID:8049942"
     CDS             complement(join(825823..826011,826351..826353))
                     /locus_tag="CD36_28980"
                     /inference="similar to AA sequence:UniProt:Q12087"
                     /inference="similar to AA sequence:UniProt:Q6CUH5"
                     /note="spliced gene;
                     Similar to S. cerevisiae RPS30B"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S30"
                     /protein_id="XP_002421938.1"
                     /db_xref="GeneID:8049942"
                     /db_xref="GOA:B9WLH7"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="UniProtKB/TrEMBL:B9WLH7"
                     /translation="MGKVHGSLARAGKVKSQTPKVEKQEKPKKPQGRAYMRLLYTRRF
                     VNVTLTNGKRKMNPSPASQ"
     gene            complement(<826788..>827522)
                     /locus_tag="CD36_28990"
                     /db_xref="GeneID:8049943"
     mRNA            complement(<826788..>827522)
                     /locus_tag="CD36_28990"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421894.1"
                     /db_xref="GeneID:8049943"
     CDS             complement(826788..827522)
                     /locus_tag="CD36_28990"
                     /inference="similar to AA sequence:UniProt:Q5A012"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421939.1"
                     /db_xref="GeneID:8049943"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="UniProtKB/TrEMBL:B9WLH8"
                     /translation="MSTSNKRQSNQSLSSSYGSIQAESASPRPIFQTGSKTNASNILS
                     ASTTTPNNDTSGPHSPSSLSSGHPLLNNSNNDNDEIENVTDIKPEDELNDYHLDLLNY
                     KSITLENKGSVARDHMANERTFLAWLRTSLAFITLGIGITQLFRLEKPNSKIHTSSTV
                     IPLSRAPHNGENSQIITRFGKPLGSIFIILGILTLVFGMKRYFQVQYFLTKDFYPATR
                     LSIFVLISIILAIVVVTFGLVLKTSL"
     gene            complement(<829503..>829895)
                     /gene="KRE1"
                     /locus_tag="CD36_29000"
                     /db_xref="GeneID:8049944"
     mRNA            complement(<829503..>829895)
                     /gene="KRE1"
                     /locus_tag="CD36_29000"
                     /product="protein Kre1 precursor homologue, putative"
                     /transcript_id="XM_002421895.1"
                     /db_xref="GeneID:8049944"
     CDS             complement(829503..829895)
                     /gene="KRE1"
                     /locus_tag="CD36_29000"
                     /inference="similar to AA sequence:UniProt:P17260"
                     /inference="similar to AA sequence:UniProt:P28874"
                     /codon_start=1
                     /transl_table=12
                     /product="protein Kre1 precursor homologue, putative"
                     /protein_id="XP_002421940.1"
                     /db_xref="GeneID:8049944"
                     /db_xref="UniProtKB/TrEMBL:B9WLH9"
                     /translation="MNINSVFYYILFLFASTILAADKTSSSVSPTLVWVTGTDANGKL
                     ATTQSTYYQSFMSTYSTAESPSSGSIGLGSISGSVGEIRTYSMVTVSQGNGGLSKFNQ
                     NSLEMKNLSFLKFIGGSFIAFISFIIII"
     gene            complement(<833377..>834394)
                     /locus_tag="CD36_29030"
                     /db_xref="GeneID:8049695"
     mRNA            complement(join(<833377..834280,834378..>834394))
                     /locus_tag="CD36_29030"
                     /product="serine/threonine-protein phosphatase catalytic
                     subunit, putative"
                     /transcript_id="XM_002421896.1"
                     /db_xref="GeneID:8049695"
     CDS             complement(join(833377..834280,834378..834394))
                     /locus_tag="CD36_29030"
                     /EC_number="3.1.3.16"
                     /inference="similar to AA sequence:UniProt:P32345"
                     /inference="similar to AA sequence:UniProt:Q6FM81"
                     /note="spliced gene;
                     Similar to S. cerevisiae PPH3"
                     /codon_start=1
                     /transl_table=12
                     /product="serine/threonine-protein phosphatase catalytic
                     subunit, putative"
                     /protein_id="XP_002421941.1"
                     /db_xref="GeneID:8049695"
                     /db_xref="GOA:B9WLI0"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:B9WLI0"
                     /translation="MLNLDDTIENIKQCKHIPEEDVEELCTKVIELLIEEANIQHVDT
                     PVTICGDIHGQLHDLITLFKTGGELPDTRYLFLGDFVDRGFYSFESFLLLISLKLRYP
                     DRITLIRGNHESRQITTVYGFYDECLRKYGSINVWRYCCEVFDYLSLGAIVGGSQGVF
                     CIHGGLSPEIDTVDQIRVLDRKKEVPHEGGMCDLLWSDPELVNGWSISPRGAGYLFGE
                     NEVNKFLHDNNISLIARAHQLVMEGYKEMFNQGLVTVWSAPNYCYRCGNVASVLTIGD
                     DLSREYKVFEASPHDIGSIPSRKPPVEYFI"
     gene            <835063..>837666
                     /locus_tag="CD36_29040"
                     /db_xref="GeneID:8049945"
     mRNA            <835063..>837666
                     /locus_tag="CD36_29040"
                     /product="integral inner mitochondrial membrane protein
                     with similarity to exonucleases, putative"
                     /transcript_id="XM_002421897.1"
                     /db_xref="GeneID:8049945"
     CDS             835063..837666
                     /locus_tag="CD36_29040"
                     /inference="similar to AA sequence:UniProt:P32843"
                     /inference="similar to AA sequence:UniProt:Q5A061"
                     /note="Similar to S. cerevisiae RNA12;
                     possibly fungus-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="integral inner mitochondrial membrane protein
                     with similarity to exonucleases, putative"
                     /protein_id="XP_002421942.1"
                     /db_xref="GeneID:8049945"
                     /db_xref="GOA:B9WLI1"
                     /db_xref="InterPro:IPR018850"
                     /db_xref="UniProtKB/TrEMBL:B9WLI1"
                     /translation="MIIRTLRSQLRLPKPIFISPSCRYYSTDLEKLKKESDTTESDNS
                     ASATGVIDKTHNEVLLYYDHIYPFTTSKNVVKQYLSRFSLPWSTTYDNEKLKQKVWDL
                     SSPLPTTANITEFVPLKRDCGAFVKFKYPPGVPATQFIEEVRENVERNERERVNSNIL
                     TRLFHEIWRNAPKVYSVKGTPWIEDLRRFPSPKLSVKFEGDPLTEEELYVLFRRYGLI
                     NEIEPGATEAFVYFHSTRAAICAKHCITGMVLNGGKTTLHIQYVAIKRSNFLVSLISN
                     HTKIAIPVLIALLATFAVLIFDPIREWFIEYKILHNRKSFDQFKESRWFKYLYIPYRT
                     IIGWVYSSYDYIDSQIQEVTGSTCSEEGDTSNGSNIADGQSVCDLKNESNMFWIERYE
                     KSKQLQLWIMENANTFIIVKGPQGSGKEEFVLEHSLGSDERLSKKVLVLECDQLGKAR
                     SDNNLIDTTASQLGYFPVFTWTNTVSRFVDLGVQGLTGQKSGLSESKETQIKNMFSLA
                     TQAIRKITINEYNKYVKSVERRNKRLKDDEKIEVLKEDQFLQQHPEAKPIIVLNKYSR
                     RADVSSNDFIPPLIADWASGLVQNNTAHVIFLTADVGSLQLLNDALPNQVFKDISLSD
                     ASISSSRQYVCDVLKVKDTSTLDQCLEPLGGRMLDLQSFIRRIKSGESPQQAINEMIS
                     QAAELINTFFLNSHHKFGAGDSNWDPSQVWLIMKLLSECDTISYSELVKSPLFKVSKE
                     TLEILTTLEKYDLISLKRDKGVLDKISTGRPLFKAAFANIISDLRIWKLYETEYIGRL
                     ISLEVAKIQKLEEELERIYKIGKVDGRIDYVSQKIEASNKKILDLEKQAADVASYTGK
                     TDGKSFLGIKF"
     gene            complement(<837733..>839205)
                     /locus_tag="CD36_29050"
                     /db_xref="GeneID:8049946"
     mRNA            complement(<837733..>839205)
                     /locus_tag="CD36_29050"
                     /product="ubiquitin-like-specific protease, putative"
                     /transcript_id="XM_002421898.1"
                     /db_xref="GeneID:8049946"
     CDS             complement(837733..839205)
                     /locus_tag="CD36_29050"
                     /EC_number="3.4.22.-"
                     /inference="similar to AA sequence:UniProt:Q02724"
                     /inference="similar to AA sequence:UniProt:Q5A035"
                     /note="Similar to S. cerevisiae ULP1"
                     /codon_start=1
                     /transl_table=12
                     /product="ubiquitin-like-specific protease, putative"
                     /protein_id="XP_002421943.1"
                     /db_xref="GeneID:8049946"
                     /db_xref="GOA:B9WLI2"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:B9WLI2"
                     /translation="MNSSTSNPLISDQRVEINDEYELESGSECNHKTTDSYIFRLFYN
                     ILKYLKAYILSTFIRQAKPSIQQPNSEKNKEDEYINLSSESSSDIEIIGVNYKPTNDF
                     HLINNKTTTRIQNNSILIDDTEETPFNIANDNTTSNLLKQLAQDRIRNRNVSATQYGT
                     NLSISKPIKYSSSGYQQWQTQEETTTADFDKQQQQQQTLFDIEPITNKYQESILNYYV
                     PTKPLSINSYSVLDNVISNFYIDKISSIYHKSHETLQQLVTKERIDSQSKIQTLPSEH
                     LNQVLKIWSNNSRQLIVENYSIEIYTHDLHTLKDSKWLNDNIIDYYFNLIMKANPNVF
                     GWTTHFYTTLAQRGYQGVARWAKRKKINVFAMEKILTPINIGNMHWALAVIDNIKKTI
                     TYYDSLGGSRNSGNPQAVQTLARYMKEEAKRLGVTGNEYRLIPHTEAPQQKNGSDCGV
                     FTCTAARYISANKLLSYSQNDMKIIRRRMVYEIIDNCLLD"
     gene            complement(<839678..>842389)
                     /locus_tag="CD36_29060"
                     /db_xref="GeneID:8049947"
     mRNA            complement(<839678..>842389)
                     /locus_tag="CD36_29060"
                     /product="DNA replication licensing factor, putative"
                     /transcript_id="XM_002421899.1"
                     /db_xref="GeneID:8049947"
     CDS             complement(839678..842389)
                     /locus_tag="CD36_29060"
                     /inference="similar to AA sequence:UniProt:P29469"
                     /inference="similar to AA sequence:UniProt:Q5A034"
                     /note="Similar to S. cerevisiae MCM2; minichromosome
                     maintenance protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA replication licensing factor, putative"
                     /protein_id="XP_002421944.1"
                     /db_xref="GeneID:8049947"
                     /db_xref="GOA:B9WLI3"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008045"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:B9WLI3"
                     /translation="MSTPPAGSSYRDNNRRRKRSPYDDDGEDDDNNIDRSSIHQPSSP
                     PLGSSPNPHQQLPSSPAIPFDTALDDDDIEEIVHNDIQDLNPSDQDSEEEGDDLMENL
                     EQDYRANPEQDHYDLGDGNIDDTGDYEEMDAATRRRIDQQLNRRDAILNNANRSRRGA
                     FLDDNEDEDEDDEGEDSMGQFGLPIQRRRRREHHDEDQDDLMDDVEIDPFNEELSLES
                     LSDVKAPSITEWILQPAVSRSIARELKSFFLEYTDANGDSVYGNKMRTLGEVNAESLE
                     VSYKDLADSKAILALFLATSPEEMLKIFDIVAMEAVELHYPNYSQIHQEVHVRITDFP
                     NILNLRDLRESNLNQLVKVSGVVTRRTGVFPQLKYVKFDCLKCGVVLGPYVQDSNTEV
                     KISFCTNCQSKGPFKLNSEKTLYRNYQRITLQEAPGTVPAGRLPRHREVILLSDLVDV
                     AKPGEDVEVTGIYKNNYDGNLNAKNGFPVFATILEANSIRRKESSAFMGGNNLVNMWT
                     DEEVREFRKLSHEKGIIDKIIASMAPSIYGHKDIKTALACSLFGGVPKDVNGKLSIRG
                     DINVLLLGDPGTAKSQILKYAEKTASRAVFATGQGASAVGLTASVRKDPITREWTLEG
                     GALVLADKGTCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLHARCAVIAAAN
                     PNGGRYNSTLPLPENVDLTYPILSRFDIMCIVRDLVNPESDERLASFVIDSHMRSHPA
                     NEEDILNDSSSKSGQNAEEDENMDDGNGDQTTAARTRSERIEQLNKQKEQEISPIPQD
                     LLIKYIQYARVKVQPKLHQMNMDKLARVYADLRKEAITTGSYPITVRHLESILRIAEA
                     FAKMRLSEFVSQNDLNRAIKVSIDSFIGAQKVTVKQKLRSKFMKYTL"
     gene            complement(<843656..>844135)
                     /locus_tag="CD36_29080"
                     /db_xref="GeneID:8049948"
     mRNA            complement(<843656..>844135)
                     /locus_tag="CD36_29080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421900.1"
                     /db_xref="GeneID:8049948"
     CDS             complement(843656..844135)
                     /locus_tag="CD36_29080"
                     /inference="similar to AA sequence:UniProt:Q5A033"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421945.1"
                     /db_xref="GeneID:8049948"
                     /db_xref="UniProtKB/TrEMBL:B9WLI4"
                     /translation="MISTLSSSITTSTHKLENPIDSQRKRHKHTMQSMSSSTHHPHFQ
                     LSKNNENVNDEQQQHHQAEYISTGTSLHNTNNGTFTPITQTHSHEYLMMMGEESNSNK
                     LDIEMITEDKFFQPQQNIEKPKYEECPCGHLHGPGQGNHHDIHAVGLSDFPLLRGPD"
     gene            <846092..>848029
                     /locus_tag="CD36_29090"
                     /db_xref="GeneID:8049949"
     mRNA            <846092..>848029
                     /locus_tag="CD36_29090"
                     /product="glucose transporter of the major facilitator
                     superfamily, putative"
                     /transcript_id="XM_002421901.1"
                     /db_xref="GeneID:8049949"
     CDS             846092..848029
                     /locus_tag="CD36_29090"
                     /inference="similar to AA sequence:UniProt:Q12407"
                     /inference="similar to AA sequence:UniProt:Q5A032"
                     /note="metabolite transport protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="glucose transporter of the major facilitator
                     superfamily, putative"
                     /protein_id="XP_002421946.1"
                     /db_xref="GeneID:8049949"
                     /db_xref="GOA:B9WLI5"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WLI5"
                     /translation="MSELTEPHLHHHVQIKESILVGKALLNFTTFFVTLGILVMGFEQ
                     SVYAPIITNKYFKEYYHNPTPTEIGFMIAILEIGALFSSIIAGKVGDLVGRKRATRYG
                     AVFFYIGGFIQCISPNMFILCIGRLLGGFGIGFLTTVVPMFQSEISPAEARGFYACVE
                     FTGNIIGYAIGIWLDYAFSYLESDYSWKAPLIIQFLLGVVLWLGTFIVVETPRWLLNH
                     DHDLEGMIVIADLYADGDVEDDHAMSEYRNIKESVLIDRIEGGERSYEYLFKRYAKRL
                     SVACFGLMFAQLNGINLISYYAPMIFEEAGWVGRQAVFMTGINGIIYVISTIPPWYLV
                     DSWGRKPLLMSGALIMGIPFCIAGYSLSLNNEYTSTIVVTSIIISNFGFGFSWGGIGW
                     LLPAEVLPLSVRSKGAALATATNWFSNFVVGLASPILLDQIKWKTYFIPAVSCFISFF
                     AVWYLFPETKGLSLEEMGSVFDDKSSIFSHHASGSVGGSSSSSIFNYGATAESNRRTS
                     ITNDSTPAIAGSVSGAIDSIHQSAASMARNPTSNSNQQLDGIITGAAPPPMPTSIAAT
                     TTNNIKPVKSDTADALSLDSGFGGSQSDIVQEIEPPSLEEILKYKVQKQAEPNAFIAT
                     FHWLFSKKGHTNDEESRLLQQ"
     gene            complement(<848146..>849825)
                     /locus_tag="CD36_29110"
                     /db_xref="GeneID:8049950"
     mRNA            complement(<848146..>849825)
                     /locus_tag="CD36_29110"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421902.1"
                     /db_xref="GeneID:8049950"
     CDS             complement(848146..849825)
                     /locus_tag="CD36_29110"
                     /inference="similar to AA sequence:UniProt:Q5A083"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421947.1"
                     /db_xref="GeneID:8049950"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:B9WLI6"
                     /translation="MSSRYLLRTRSRVLFKPRNTTITTTTHANFVLRRQFSQYNYNRT
                     YAAYNQPKTPFWKKLVYATLGLGIISGYVYYMWWPKHTFPSSIAKFLRKGLWAESDRG
                     EFDYQLALKYYLQALEHANEIGLDPLSDEYTGIQLKIGEMFERLNMLTDAAYIYNEIA
                     TLYLTVLTAPRDSPEGQRIKDRKHRRHLIQKDLRIAIKLVSLNPTNPSLAKAILITHL
                     IIAQDEVNKRMGSSISSANKLNLVNKIDPNNKSVSNNSNGAYTAILDNDTIVITNNKT
                     GEESRIKKTPEVWEPFTDEFFNAMDLLSAVCITAGDLSMATKVKIAMNESMLLADIEP
                     SKMLLSQCNLGSLLYMQAEELEAQEISMTRRFSELSGIEYDQLLETQQQQQQIQLQQL
                     EKNSEDKSNLNSKSNSKLIMEKLRKTVPLSDQEALATVTKSRSVCLQLAIKSYESVLQ
                     FAKSFPQDFIKQHNEISETVALATYGLGVINLHLSHYDKAERLLRESRVRAKACDYGT
                     LLPMIEKELEKLFNEKKLLSQNADGDDGNHSKLMKKKHSLHDIEMDITLNK"
     mobile_element  complement(849906..855203)
                     /note="5' truncated near start of ORF1"
                     /mobile_element_type="LINE:RE, Zorro3"
     gene            complement(<850171..>853626)
                     /locus_tag="CD36_29120"
                     /db_xref="GeneID:8049951"
     mRNA            complement(<850171..>853626)
                     /locus_tag="CD36_29120"
                     /product="polyprotein of l1-like non-ltr retrotransposon
                     zorro 3, putative"
                     /transcript_id="XM_002421903.1"
                     /db_xref="GeneID:8049951"
     CDS             complement(850171..853626)
                     /locus_tag="CD36_29120"
                     /inference="similar to AA sequence:UniProt:Q59KQ0"
                     /note="Similar to C. albicans POL92;
                     transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="polyprotein of l1-like non-ltr retrotransposon
                     zorro 3, putative"
                     /protein_id="XP_002421948.1"
                     /db_xref="GeneID:8049951"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:B9WLI7"
                     /translation="MRRNESYINSLTIGSKSIGSHQSADFKKLLDIFLKLIGEHSMID
                     IWFIQEVRFVSQEQFNYINKILKQHNAQLRMHHFEDLTGFLIHSPHAKLKFKINDNDN
                     HQTTHFEGCISILDIKLITNEDITLINNYLHSGDMDAQMTLLNAFTKYIANLKKHNNH
                     NIIYGSDFNHIMSLDDVQLPSNQNSYTFTKKESEIIQLMSRFHNKWKLQDAFQIFNNM
                     RPTNFHSNKSVKKRLDRIYIDSRIRRKLKKYRLLTEFKQISTYKIIATSFQIQKESVL
                     NVGNSRYRIPQWMSQDENIIKDPNNNEKGNLTPFSNWNGIINQIQEKVIFYEIYSKYI
                     RPYTSNTEKVPDEQMLKFRFRPSINFSVITEMQTESGNIVQDTETMINLATKFYQDLF
                     SSDDRQLESFNFVDQFDKKIDETVKVLLEKAFTEDNVYDHLLMINKKTAVGTDGISYQ
                     NLIELWPSLGESLIRAGNHILKYGTLPQQMSEVIITLIPKKSKTPIIENFRPISVLSC
                     AVRLLSSVIEKQLNPVLAKVIEKTQTGFLKERSISNSIYLLDMVLTRYQTSKTADAES
                     AGFINLDFRKAFDSVHHDFILKVLQQVGFGPKATNFLMAITAKQKAKVSINNIDGPCF
                     PLKRGVRQGNPISPLIFILILETFLARLSKEIEGIGVVNEVSSVAYTAYADDVIIFFK
                     NKNDQERIQQLLEDFGRESGLYLNNNKTEVCYFNDIPEISFLPYVSKKLQLEKLTYLG
                     VPMKKADEEFDPWTSFVLNLNAQIRMTPISDLSYQLIMKLMNIFIFSKLYYRDLHSPI
                     STTAVSSIITTVQQRLPLYFKLQRLQTPNHLGGFGLMNPNHQVKGRRGKQIYLLYTQE
                     DDLIIKFMRTKIQDILDNITKDYHTMSTEPDKLMVYPWYYFGMGVSCHPSLQFRYLKE
                     RVYENLTKSEISWFEAWFQLVHYTGPPVETPIRIMSIEDYANLIIQPKTEIINLMSPN
                     FEKQPLSEQTFHHTSRKLCPQAPIIPEGWGKHFDTIKSLTISDWTEFWKNMNKVQKQS
                     VGSLQDYHLFILGYYSHYPFYPNYKKSEIHFCQLCNTGTDSIVHHIFECGETMELWSK
                     HFNSQRTPQFIIGNKHLHKKDLHALNEYIKEVVQKVKRRRGSPILNHGEKENVDAGTN
                     VLVQT"
     gene            complement(<853783..>854838)
                     /locus_tag="CD36_29130"
                     /db_xref="GeneID:8049952"
     mRNA            complement(<853783..>854838)
                     /locus_tag="CD36_29130"
                     /product="non-ltr retrotransposon zorro 3 orf1-related
                     protein, putative"
                     /transcript_id="XM_002421904.1"
                     /db_xref="GeneID:8049952"
     CDS             complement(853783..854838)
                     /locus_tag="CD36_29130"
                     /inference="similar to AA sequence:UniProt:Q59KP9"
                     /note="transposable element"
                     /codon_start=1
                     /transl_table=12
                     /product="non-ltr retrotransposon zorro 3 orf1-related
                     protein, putative"
                     /protein_id="XP_002421949.1"
                     /db_xref="GeneID:8049952"
                     /db_xref="GOA:B9WLI8"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:B9WLI8"
                     /translation="MREELMHIQRILDFNIMDKVMCLMPFTLEQSEGKLSSEMAKVRT
                     IVENLEFVIDGTVEHIKIDSAKRNRQLVVFKVPINCRSLAKSLFQQLFLHKEGVIVQQ
                     YAPSIEKAQLGRTSLTEENNHQLLTEYVCYFIVDLFSGQVPKRRIKTNNTKNEPSAYE
                     QCTSRVLSNYKYCEYCRCMTHTKYHCPMIKPCTNCGVKGHKTTSCKKAQLTTKVVIGK
                     PDNKQYFPALPPKMVNKTMKDASPRKGSITKTTFSTKGDNTEKVITPTAQNDSPTLQE
                     SPPVTITGRREVTTKPPTATTAPRKTMTTGVSEMDTSKHNISSNHEASSRKKVNLSEQ
                     PSSPAKDPGSNLSPQLQ"
     gene            <855474..>855776
                     /locus_tag="CD36_29140"
                     /db_xref="GeneID:8049953"
     mRNA            <855474..>855776
                     /locus_tag="CD36_29140"
                     /product="conserved hypothetical mitochondrial protein"
                     /transcript_id="XM_002421905.1"
                     /db_xref="GeneID:8049953"
     CDS             855474..855776
                     /locus_tag="CD36_29140"
                     /inference="similar to AA sequence:UniProt:Q12082"
                     /inference="similar to AA sequence:UniProt:Q5A030"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical mitochondrial protein"
                     /protein_id="XP_002421950.1"
                     /db_xref="GeneID:8049953"
                     /db_xref="UniProtKB/TrEMBL:B9WLI9"
                     /translation="MSNILSVFNPPPSRPYPPSPDELESQCLPCTAIQSIVAIGGGLY
                     LSSPNQFKDKTTGKIDLRKNPIWWQRSVRGAGIILFGLGAYRAGEVVQILYRKRFG"
     gene            <857196..>860027
                     /locus_tag="CD36_29150"
                     /db_xref="GeneID:8049954"
     mRNA            <857196..>860027
                     /locus_tag="CD36_29150"
                     /product="Hyr1-like cell wall protein, putative"
                     /transcript_id="XM_002421906.1"
                     /db_xref="GeneID:8049954"
     CDS             857196..860027
                     /locus_tag="CD36_29150"
                     /inference="similar to AA sequence:UniProt:Q5A6U1"
                     /codon_start=1
                     /transl_table=12
                     /product="Hyr1-like cell wall protein, putative"
                     /protein_id="XP_002421951.1"
                     /db_xref="GeneID:8049954"
                     /db_xref="InterPro:IPR021031"
                     /db_xref="UniProtKB/TrEMBL:B9WLJ0"
                     /translation="MQLFSNIIVSLALLTQLVFALEITENKVDRGTVTLNLGDITIYP
                     GASWSIIDNAYTNFVGKLDVRAGAGLYISSTSHLLALQVSLTTLLHSITNNGVVSFDS
                     RVSRTSSSYDLRGVSFTNNGEMYFAASGEFSSSTALTSASWTNTGLLSFYQNQRTSGT
                     VSLGLPLGSITNNGQICLNNQVYEQTTQIKGSGCFTAKGDSTIYISNVLLAVSPKQNF
                     YLTDKGSSMIVQAVSTTQTFNVYGFGEGNKIGLTIPLMGNLWNSAYAYDTVSGILTLR
                     NLLLEQKFNIGTGYDPSKFQVVTDSGSGIPSTIMGSVAYYGRIPERALPKSCQTPCKP
                     VPEAPGTTPTQYTTTISKTNTAGNTVTESGVVNVLTDKGGSWFTTTSMFPALPSDTIL
                     STVELSTTQLSSSADIPVETSSAEELLTDTASWETSAAPILPTETPVSSHHSSVQHSS
                     TIGESSADVKATHSSEFGFETASDYIVIEPSTSEHSATLSQSSVAGETHSSKLVASGE
                     PSFVTPSESFIFSASASSQPSVSSDSITLTTQSETTSSAGQAFVTLAESDTESISSKV
                     NTLASVTKSSDIQTEFTSTWTTANSDGCIVTESGIISQSGTSLTTLTTFQPATSLSVP
                     PTSVTETEFTTTWTTSKPDSSVATESGVVSQSETLLTTLITFPAPSSNIVLGSTLTWE
                     SDISNEPSDTLTVSASSYELVNESLAATTTTSFSSATIVVAPSESDISTSSSVSNNGK
                     TDSVSDSVPNSNTSSIAEHSNGSLSMITTESVNNNPLAPESTNSIVTATITNCNKSKC
                     SESVVTYITSVSHTTVTTGESKKDISTAGNNVSSISGEDVSNTGTITMAASTDGTTTL
                     VGMSGLKPSVVNNDTNSVHATATNAGAENDANLPTASDIPVEISVIRPTNSSSSAAVT
                     IPYENGSNKEPIENIKYLALVVFGLMMFM"
     gene            <869238..>871112
                     /locus_tag="CD36_29160"
                     /db_xref="GeneID:8049955"
     mRNA            <869238..>871112
                     /locus_tag="CD36_29160"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421907.1"
                     /db_xref="GeneID:8049955"
     CDS             869238..871112
                     /locus_tag="CD36_29160"
                     /inference="similar to AA sequence:UniProt:Q5A6T8"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421952.1"
                     /db_xref="GeneID:8049955"
                     /db_xref="UniProtKB/TrEMBL:B9WLJ1"
                     /translation="MDQTYLDQQQLDPNVSNQQLSQEASSVPQQQQQQQPLQQLQQYQ
                     QQSLNNVSYSGDNRFQQYQPRVTPSVSSSQQSMASAATPGFSAMHAGNYTPNQQYGVP
                     NQYTVVQQQPPRQQSYEEHINPFNYNSADRTLIAPIPPLHIQHQLATRQNQPQNRQES
                     SSIASMHTHENTSTINDSPNTMMIKQEHHTFQPQHNEGAGVYHPIDQQQQQQQQQQQP
                     QQPQHRFPLTSSNCTRCKKPFEQPGGIPKSSNSTSDGQNLSASNSQPPAKTYKLCEHC
                     RALQRQRSRRWQKKTKDRPGICRRCASEIPLAERRFVLCPNCRENLRMRKANRAAQGK
                     CVHCSGPLDATVSGKDGEDSSNGDEHGNKSNEVQNSESGRGNENQKVVRGTSFKVCRR
                     CRENDKIRRANLEKMGNCNRCAKALDPNEYGRNKVCLNCRTKKKRSSTGSMTNTDEVR
                     TSPIQNHFGMNMSHQYIQPPPPPPPPPPHLMASHHQFQPQPHMMSHEQMNTFTGMTSS
                     GISGIQQANNGMIGGDQSQQHQQQHNGSLQIQQTYYQSHIQMPPPLPLQQQQQQLQQY
                     YSTDANSQPPHSALPGSLPPPPPPQLQSNQQYGHFQQQQQQQQQQQQQQYHQEYPNNQ
                     "
     gene            <873898..>875649
                     /gene="STE7"
                     /locus_tag="CD36_29180"
                     /db_xref="GeneID:8049956"
     mRNA            <873898..>875649
                     /gene="STE7"
                     /locus_tag="CD36_29180"
                     /product="serine/threonine-protein kinase, putative"
                     /transcript_id="XM_002421908.1"
                     /db_xref="GeneID:8049956"
     CDS             873898..875649
                     /gene="STE7"
                     /locus_tag="CD36_29180"
                     /EC_number="2.7.12.2"
                     /inference="similar to AA sequence:UniProt:P46599"
                     /codon_start=1
                     /transl_table=12
                     /product="serine/threonine-protein kinase, putative"
                     /protein_id="XP_002421953.1"
                     /db_xref="GeneID:8049956"
                     /db_xref="GOA:B9WLJ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:B9WLJ2"
                     /translation="MTRTTRIDTQEATKHKDLPPVPSTSLSSNSEYLMESKSLGRKNF
                     KKLSLDASPVKSTSNNLRSSDMMSIKEPTSLRQKRQRPPPMLHLPTSSSSTTSTPTSN
                     ITGTSSASSVHFSQKSPGSGVIVSQTLSRPSSAGGMGSSGYSALNINQSNRNVDPDNV
                     VSTDMILNQISNLDLTSMNHHRQNSHHHLPSTNRKRQTVISSISPTKSSASSSPLEPQ
                     NQSLPASSQSPIATTSALKLNNKDLLTLKQLGSGNSGSVSKILHIPTQKTMAKKIIHI
                     DSKSVIQTQIIRELRILHECHSPYIIEFYGACLNNNNTIVICMEYCNCGSLDKILPLC
                     ENRQFPTFVLKKLSFAILSGLTYLYTTHKIIHRDIKPNNVLMTHKGEFKLCDFGVSRE
                     LTNSLAMADTFVGTSMYMSPERIQGLDYGVKSDVWSTGLMLIELASGVPVWSEDNSNN
                     DDDDEDGDDGCSGQGILATERNGQNSPSKSRKKNQKGNGYNSYNGPEGILDLLQRIVN
                     EDAPTLTNKINPVTKLPYDKYLCQFIDLCLIKDDSVRKTPWQLLEDKEHFFKGVEEGA
                     YDKEHKSWAKKIRKCKV"
     gene            complement(<875875..>878094)
                     /locus_tag="CD36_29190"
                     /db_xref="GeneID:8049709"
     mRNA            complement(<875875..>878094)
                     /locus_tag="CD36_29190"
                     /product="TBP-associated factor, putative"
                     /transcript_id="XM_002421909.1"
                     /db_xref="GeneID:8049709"
     CDS             complement(875875..878094)
                     /locus_tag="CD36_29190"
                     /inference="similar to AA sequence:UniProt:Q03761"
                     /inference="similar to AA sequence:UniProt:Q5A731"
                     /note="SCTAF12; transcription initiation factor TFIID
                     subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="TBP-associated factor, putative"
                     /protein_id="XP_002421954.1"
                     /db_xref="GeneID:8049709"
                     /db_xref="GOA:B9WLJ3"
                     /db_xref="InterPro:IPR003228"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:B9WLJ3"
                     /translation="MNNSMSNGSQNQNANNGQQPQQQINLQNIPPQQLAQLVTAMRTA
                     YDQAKNSTNDAERQQHFNRAENIRRLLARYQAQKNRLQQQQQQRTQQQTQQQTQQQTQ
                     QQTQQQRNLTEHQRQIQAVQAQAQALAQMNNNENFNAMNNSQVGTPMMQQQSPSMMLQ
                     SPMMQQKPINAGTPMRQQSPLMTQQSPPEQFQSQKPHPTPQPQVQQNVQQMNQNNVMR
                     NNNTPGPNGALPGQINGIPIANSNITMERFNQIRQKLSEVQRRVQLLEQTKKSGNVTP
                     EQIQQIDKEIIECKAKFQQYQKVGIYIRNQLVLQAKAQQQRQLQQQQQQQSLQNNNLK
                     SVQNQNQNQNQVQGAQSIGQTPQQQSFSPQLQAAQQQQFMGNQQQQQQVRNTNKSALQ
                     GQVLSQAPTPLPVRQTPQSQPTVQGGMASQAPTPVARGSQPTPSQPSRTGSIVQQRAP
                     SRQASATPQAHFQPPLPQESRHPSATASEKPLPQQQQQQGVGTAKSPSVAATPAQNNG
                     TVTARSASPAATTTDGATTGRTGTPQQQQSRSRSGSSLNLAGITRQSVPSLPISSSIN
                     VKQPTITTFNSINDTRPSLTGGAANPLSILLDTPAITRLPTFDIEGDTGILDSNSSGR
                     VLNKRKLGDLINTIGVDEGDGKTTIDGNVEEFLLDLADEFIHSVTSFACRLAKHRKVD
                     SIEARDVQLHLDKNWNIKIPGYAMDEIRSTRKIQPSTSYSQKVQGVEVSKAVNDDNV"
     gene            complement(<878645..>880768)
                     /locus_tag="CD36_29200"
                     /db_xref="GeneID:8049957"
     mRNA            complement(<878645..>880768)
                     /locus_tag="CD36_29200"
                     /product="polyamine transporter, putative"
                     /transcript_id="XM_002421910.1"
                     /db_xref="GeneID:8049957"
     CDS             complement(878645..880768)
                     /locus_tag="CD36_29200"
                     /inference="similar to AA sequence:UniProt:Q12256"
                     /inference="similar to AA sequence:UniProt:Q5A6T2"
                     /note="Similar to S. cerevisiae TPO4; transporter of Major
                     Facilitator Superfamily (MFS), putative"
                     /codon_start=1
                     /transl_table=12
                     /product="polyamine transporter, putative"
                     /protein_id="XP_002421955.1"
                     /db_xref="GeneID:8049957"
                     /db_xref="GOA:B9WLJ4"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WLJ4"
                     /translation="MGFFGTSKEEESKLRQAVLTTSDTRQSFSSNTESSVYETADEMD
                     SQVSPNIDDVDQEKDIEAVNANEINHNENSGATNAISQGDDDSTVQDHEYSVNQISDS
                     NEDSDGSIPMNFSGVDGDKEEEEEEEEEEEENRLNREYTIERIKSHKSLEAAAEEQIK
                     EEESLIHPHSSTSTTFDKEKIYTVDELSYDGPDDKDNPHNWPKWKKWMITYTAAILCL
                     VCSLGSSMYTGSVPEIMVRFGASQELCLAGLTFYLLGLAFGPALSGPLSEVFGRKPLY
                     MFSLPIAMLFTMGVGLAKNVRTILVLRFFCGFFSSPALAVASGTISDCWAINPAEQSF
                     AVALFCLCPFLGPVLGPIIGGFASEHKGWQWASAWVLLMFFGAVWPFTIILPETYKPI
                     ILARKAQKKGMKVEVPKLNIAFVKKVIKFNLFMPLKLLIEEPIVLVLSVYISFIFAVL
                     FGFFEAFPVIFRGVYHMDLGISGLPFISVGIGLFLGVMTYVILDKTIFFPKNPDGSRG
                     KRDADGNFIWGVPEEKLLNGKIGAPFLPIALFWLGWSGRNDSVHWMAPTASGVFFGYG
                     LILVFFSVVSYFSMSFPPIYVASAIAANNLLRYTLASVFPLFTVQCFENLGIGWAGSL
                     FAFIALVMVPVPYVFGYFGPYLRARSKFGYAAYFKKLEEQKELQAAADAERKKASNKQ
                     EQSVNSSADEVEMTLESEKAVAEKV"
     gene            complement(<882827..>884134)
                     /locus_tag="CD36_29210"
                     /db_xref="GeneID:8049958"
     mRNA            complement(<882827..>884134)
                     /locus_tag="CD36_29210"
                     /product="nucleus export protein, putative"
                     /transcript_id="XM_002421911.1"
                     /db_xref="GeneID:8049958"
     CDS             complement(882827..884134)
                     /locus_tag="CD36_29210"
                     /inference="similar to AA sequence:UniProt:P38770"
                     /inference="similar to AA sequence:UniProt:Q5A6T0"
                     /note="Similar to S. cerevisiae BRL1"
                     /codon_start=1
                     /transl_table=12
                     /product="nucleus export protein, putative"
                     /protein_id="XP_002421956.1"
                     /db_xref="GeneID:8049958"
                     /db_xref="GOA:B9WLJ5"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="UniProtKB/TrEMBL:B9WLJ5"
                     /translation="MPSHATNVYNDIDAGMLLSSLSLNERSNNDRDLKIEEVYDNIYD
                     DPMDIDDTDDLSNHMEIDDTTFEIDNVKGDDFGTGTESDDKDISEEAQQEDGLFSLLS
                     PTLMGAKLAIKKPLLLMPPPTVLEPSNAKAESTLPDVDYEYDTSSFTPMKNDAMITRK
                     ANTSTFQPSNINLFLSHSNEMPSGQSLGEYQNLHSNYQQPVTIHNHHHHYYYNNKDDS
                     VSSAPPRNSNLQSLEQEKRNLQMQQYKQQLEERQLYLQEYQRNNQILLPSPWQHNISP
                     IERIPYLLMSYLQMLINFIASLYGIYLVYCLFQTINTDIKSKVEQQQTNLMISIESCR
                     RSYYQNGCDDKDNLVPLLVSKCQKFEKCMKQDPYKLSNISIMSAEIIGMIINSLIEPL
                     SLKFYLFMLGFILIIFACNFTFGYIRAKAYYGGSTKYGHEKLD"
     gene            <884479..>885729
                     /locus_tag="CD36_29220"
                     /db_xref="GeneID:8049959"
     mRNA            <884479..>885729
                     /locus_tag="CD36_29220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421912.1"
                     /db_xref="GeneID:8049959"
     CDS             884479..885729
                     /locus_tag="CD36_29220"
                     /inference="similar to AA sequence:UniProt:Q59JU3"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421957.1"
                     /db_xref="GeneID:8049959"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024679"
                     /db_xref="UniProtKB/TrEMBL:B9WLJ6"
                     /translation="MRATNRVIFWRKKKIQLSSLFQTEKTPMPNNNSSHRYSVQLTNI
                     IVQQLSLNMASKRKRKEKQKDFTKAKLKVGKTAQKPDNYTDTSFKSKTISLPNQSIAS
                     SSNSSVGSRASGPSVGPSLAVLAHQLSLTKHHSSNTRKEVLNYLQTHLPENPSYYKNI
                     MTSILPLILDEDKEVRKALMGLLSAIFEKQPGLIDLHLRSTILFILSAMSHIIPNIRT
                     TSTHFLRIIVENSHGNLINSYFVKIMRNWFVLMGWSLNEQDSKQLSMAVTTLSITAMN
                     ANSKQARIGHLQNLNKFLSKTLQHDQDLDKIKDIKLNITIHPQSYKYLLTDTVQPYQP
                     LKLFVKEFKSEGSGSNGSGISMLDLNSISTEDLDTRKKIMNDVFKPLMIKNLNTFVKE
                     GGDIGREANNCISIITQACTSSSE"
     gene            <885912..>886835
                     /locus_tag="CD36_29230"
                     /db_xref="GeneID:8049960"
     mRNA            <885912..>886835
                     /locus_tag="CD36_29230"
                     /product="ribosomal recycling factor, mitochondrial
                     precursor, putative"
                     /transcript_id="XM_002421913.1"
                     /db_xref="GeneID:8049960"
     CDS             885912..886835
                     /locus_tag="CD36_29230"
                     /inference="similar to AA sequence:UniProt:P38771"
                     /inference="similar to AA sequence:UniProt:Q5A6S7"
                     /note="Similar to S. cerevisiae RRF1"
                     /codon_start=1
                     /transl_table=12
                     /product="ribosomal recycling factor, mitochondrial
                     precursor, putative"
                     /protein_id="XP_002421958.1"
                     /db_xref="GeneID:8049960"
                     /db_xref="GOA:B9WLJ7"
                     /db_xref="InterPro:IPR002661"
                     /db_xref="InterPro:IPR023584"
                     /db_xref="UniProtKB/TrEMBL:B9WLJ7"
                     /translation="MKKKKKKKKSSFKCEMQNSYDTHIQIFFSNFIFEKSLFIQRGFN
                     LQMFRSVIAQQRSVLPRLAIPRILSPVLFCSSKSFHSSSPCLAKRKNKKSSNNKNNEE
                     LDFSEKVDEIPEVTIDFQKVTSNFDNVLAKFNKAATDIKLGKLNPKIFDNLEVNIGNH
                     GQEELVPFTSVAQTSVKGRNFIINLFDASYGKHVINSIIGSGLNMSGTIDPTNKFQIK
                     VPIPNITAETKQENIKQLKEIFENLKNNHKSSSLNYVRSEARNKFQSGLKHNKISDNQ
                     HQLLKKLETLHKTYVDKLTDAFKQAEKSILK"
     gene            complement(<886896..>888596)
                     /locus_tag="CD36_29240"
                     /db_xref="GeneID:8049961"
     mRNA            complement(<886896..>888596)
                     /locus_tag="CD36_29240"
                     /product="monensin sensitivity protein Mon1 homologue,
                     putative"
                     /transcript_id="XM_002421914.1"
                     /db_xref="GeneID:8049961"
     CDS             complement(886896..888596)
                     /locus_tag="CD36_29240"
                     /inference="similar to AA sequence:UniProt:P53129"
                     /inference="similar to AA sequence:UniProt:Q5A723"
                     /note="Similar to S. cerevisiae MON1; vacuolar fusion
                     protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="monensin sensitivity protein Mon1 homologue,
                     putative"
                     /protein_id="XP_002421959.1"
                     /db_xref="GeneID:8049961"
                     /db_xref="InterPro:IPR004353"
                     /db_xref="UniProtKB/TrEMBL:B9WLJ8"
                     /translation="MLFPKTLNVADKSSLLVPQTTKASATGPTTAVSYETASSEIRSI
                     RGSPYLPSSPVDSQQFDGRSIISASGMSEYIADLNDLPGIRHGINPTSIKTGSTGSRS
                     FKFSNCFQTVDDNELSNKDFFTKYISISKNDDKVQFNHKLKHFFIFSSAGKPIYSMNG
                     ADDIVIGYMGILTTIVSSFQENFDQELQLLELDQGVKIVAVNKSPIILISISKLMLET
                     VESVHLQLDTLYCYLIGILSKSVIDKHFHNRLNYDLRRILSPLDFENLDELCLSLAYG
                     IPNTGDGNKNSTFGLYICQVLLTSSRESVKIRHTLRSKLNSIVNTNNADVLFTLLLSG
                     NGKILNYLHPKQHSLPNKDLNMLLFIIHSLLKSQSQQDEDLWLPLCMPNFNDHGFLYV
                     FVRQCQDLVLMLISGSKNSFDTLKLSANEICAKLNSKQELTIQLINELSIPLNVEVPF
                     VFKHFIYKDIRLNQFVMSELPTHEFSSFQFLKCYNELKVNQAKIIKYDNNLNYKKLTY
                     LQDRDITGFMLMDKYYEFYCIIERTSEQEPITSKKLIQISSQIIRWCKKNHARLFVTI
                     "
     gene            complement(<888823..>889571)
                     /locus_tag="CD36_29250"
                     /db_xref="GeneID:8049962"
     mRNA            complement(join(<888823..889439,889538..>889571))
                     /locus_tag="CD36_29250"
                     /product="R-SNARE protein, putative"
                     /transcript_id="XM_002421915.1"
                     /db_xref="GeneID:8049962"
     CDS             complement(join(888823..889439,889538..889571))
                     /locus_tag="CD36_29250"
                     /inference="similar to AA sequence:UniProt:P22214"
                     /inference="similar to AA sequence:UniProt:Q6BLC2"
                     /note="spliced gene;
                     Similar to S. cerevisiae SEC22; protein transport protein,
                     putative; synaptobrevin homologue, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="R-SNARE protein, putative"
                     /protein_id="XP_002421960.1"
                     /db_xref="GeneID:8049962"
                     /db_xref="GOA:B9WLJ9"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:B9WLJ9"
                     /translation="MVESTLIYRYDALPLCGSVDDENNPNLTDQKKKCKILISRITPN
                     SETKASIESGELYTIHYLIDNSIIYICICNKSYPKKLAFSYLSEISHEFFNSHGNDAL
                     SNKARPYGFNSFDNFLQKTKKIYQDQRAQSNLDKLNNDLIDVKKVMTKNIEDLLYRGD
                     SLDKMSDLSSSLKQDSLKYKRRAQRINFEAMLRQYIPIVGAGLIFVFMVYYLLFRR"
     gene            <889929..>890663
                     /locus_tag="CD36_29260"
                     /db_xref="GeneID:8049963"
     mRNA            <889929..>890663
                     /locus_tag="CD36_29260"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421916.1"
                     /db_xref="GeneID:8049963"
     CDS             889929..890663
                     /locus_tag="CD36_29260"
                     /inference="similar to AA sequence:UniProt:Q5A6S4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421961.1"
                     /db_xref="GeneID:8049963"
                     /db_xref="InterPro:IPR029196"
                     /db_xref="UniProtKB/TrEMBL:B9WLK0"
                     /translation="MDLSNLSNTLPLDNTRAGNTTAVHSSTTTTPIPNINQDLTNHFK
                     DAAKSVASLYNISLNNTVDNSVSNRNIKTEFANAAKAVASLYKLGQSSQSTSYTKGYL
                     QCLEDLLAVLTNNEDIEDWVLTRRIELMNHAGNPSSKPPSSGDSSQHSEPDPFTIPHD
                     YEFTFNSDIKPPVHFRPGIPPISVQHNSKQRASIGNHHSRHNKKILSSEDSIMIDDSD
                     NEEKEVKSQLFPKYLKESPLKKKKKI"
     gene            complement(<891054..>892490)
                     /locus_tag="CD36_29270"
                     /db_xref="GeneID:8049964"
     mRNA            complement(<891054..>892490)
                     /locus_tag="CD36_29270"
                     /product="eIF-2b GDP-GTP exchange factor subunit gamma,
                     putative"
                     /transcript_id="XM_002421917.1"
                     /db_xref="GeneID:8049964"
     CDS             complement(891054..892490)
                     /locus_tag="CD36_29270"
                     /inference="similar to AA sequence:UniProt:P09032"
                     /inference="similar to AA sequence:UniProt:Q5A6S3"
                     /note="Similar to S. cerevisiae GCD1; guanine nucleotide
                     exchange factor subunit, putative; translation initiation
                     factor eIF-2b subunit gamma, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="eIF-2b GDP-GTP exchange factor subunit gamma,
                     putative"
                     /protein_id="XP_002421962.1"
                     /db_xref="GeneID:8049964"
                     /db_xref="GOA:B9WLK1"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:B9WLK1"
                     /translation="MEFTAVIICGKGKALSPFSQVRSTGIPKPLLPIANKPMVQYVLD
                     WCLQANFSKIIVLFEKEDESSGVLEQSIKKYQEEKELTNTNKNESHVNIDTIPYNCEN
                     NGLILYKLYQLYRENKVANNNFIILPCDLITNLPPQVIIEAYRNRNDSDLGLLIAYKN
                     QLDIEDKKAKIFPHNYTIYSDTDENGNESPVFLDAYTQADIEFHQALSIRTQMCWRYP
                     AATISNKLLNSGIFLGSCSQIFNVFDEQKDKFNESYFEKRSLMKIVRDLARRSWKHAS
                     HQASVGFFIVPKQATFFRCNNLPVLMEANRYFMKKQAIAKSASQQTPNKQDKQPGAHV
                     GNDSLVGENTELGEKTNVKRSVIGSNCKIGKKNKITGCLILDNVEIQDDVTLENCIIG
                     HDVVIQGKCKLTNCNVESTNEVAHNTQAKNSNLLCLTLEGLVDEDDQYGDDSGDEEDT
                     DEYDSTDEEDESEFEDEYTGNEDGLFAY"
     gene            <892803..>894092
                     /locus_tag="CD36_29280"
                     /db_xref="GeneID:8049965"
     mRNA            <892803..>894092
                     /locus_tag="CD36_29280"
                     /product="26S protease subunit, putative"
                     /transcript_id="XM_002421918.1"
                     /db_xref="GeneID:8049965"
     CDS             892803..894092
                     /locus_tag="CD36_29280"
                     /inference="similar to AA sequence:UniProt:P53549"
                     /inference="similar to AA sequence:UniProt:Q5A6S2"
                     /note="Similar to S. cerevisiae RPT4"
                     /codon_start=1
                     /transl_table=12
                     /product="26S protease subunit, putative"
                     /protein_id="XP_002421963.1"
                     /db_xref="GeneID:8049965"
                     /db_xref="GOA:B9WLK2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WLK2"
                     /translation="MSADENDPLLQALNADSNNNIPDAANANAESTTTNAPAEPIDPE
                     RERALSKFKDKLLEHRKWDARLKDLRLSIRDLDKDYEKTENDIKALQSVGQIIGEVLK
                     QLDDERFIVKASSGPRYIVGCRNTIKKENLKNGVRVSLDMTTLTIMRILPREVDPLVY
                     NMTTFEPGEISFNGIGGLTEQIRELREVIELPLKNPELFTRVGIKPPKGVLLYGPPGT
                     GKTLLAKAVAATIGANFIFSPASAIVDKYIGESARLIREMFAYAKEHEPCIIFMDEVD
                     AIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLGQTKIIMATNRPDTLDPALLRAGR
                     LDRKIEIGLPNEAGRLEIFKIHTAKVAKHGEFDFEAAVKMSDGFNGADIRNVVTEAGF
                     FAIRDDRDYILQNDLMKAVRKVADVKKLEGKLDYEKL"
     gene            complement(<894172..>895188)
                     /locus_tag="CD36_29300"
                     /db_xref="GeneID:8050296"
     mRNA            complement(<894172..>895188)
                     /locus_tag="CD36_29300"
                     /product="mitochondrial 54S ribosomal protein YmL40"
                     /transcript_id="XM_002421919.1"
                     /db_xref="GeneID:8050296"
     CDS             complement(894172..895188)
                     /locus_tag="CD36_29300"
                     /inference="similar to AA sequence:UniProt:P36534"
                     /inference="similar to AA sequence:UniProt:Q5A6S0"
                     /note="Similar to S. cerevisiae MRPL40"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 54S ribosomal protein YmL40"
                     /protein_id="XP_002421964.1"
                     /db_xref="GeneID:8050296"
                     /db_xref="GOA:B9WLK3"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="UniProtKB/TrEMBL:B9WLK3"
                     /translation="MSWVTRTFRFERNVNKYPENLRKHFQKNKEITNLPSFKNFFPTT
                     LPRSQQKTNVEAGIMEGDLAYVTTGPHKGKIAEVLSYSSEYDAVSLSNISSKKLIPKI
                     FWPEGQTSHVFDFPDFIPRNQVRVVGKDKDEHGNVSYVVAEDIELRDRYYDDRFKKFM
                     PRRFVKYHENIEFPWPEPQAVEDGPLSTPENVAMERTFEFNSIAKSGIPKAALAQLRN
                     PYSKYKKKTLSGLQVAKLNGPEMPLTIEQKIWIAKNQENQAENKPEYEPLSEEIQEFI
                     GKKMADHLNKIESPELRYHLDVLSNSVSREFQKTLDIIEKSKSQGDSELTNSAGESSN
                     KGSL"
     gene            complement(<895531..>896220)
                     /locus_tag="CD36_29310"
                     /db_xref="GeneID:8050297"
     mRNA            complement(join(<895531..895568,895662..>896220))
                     /locus_tag="CD36_29310"
                     /product="cell division control protein, putative"
                     /transcript_id="XM_002421920.1"
                     /db_xref="GeneID:8050297"
     CDS             complement(join(895531..895568,895662..896220))
                     /locus_tag="CD36_29310"
                     /inference="similar to AA sequence:UniProt:P06704"
                     /inference="similar to AA sequence:UniProt:Q5A6R9"
                     /note="Similar to S. cerevisiae CDC31;
                     spliced gene; nuclear pore complex subunit, putative;
                     spindle pole body calcium-binding protein component,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cell division control protein, putative"
                     /protein_id="XP_002421965.1"
                     /db_xref="GeneID:8050297"
                     /db_xref="GOA:B9WLK4"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR029530"
                     /db_xref="UniProtKB/TrEMBL:B9WLK4"
                     /translation="MSGFSRLNNNSNINSTNNGVSPNKRNLFGSATAANTSTNNNNSS
                     NMNSSIVKQELLEEQKLEIREAFQLFDMNGDGCLDYHELKVAFRALGFDLTKRQVLDI
                     IHEYDTDDTNLITYDNFYKTVGEMIIKRDPLEEIRRAFRLFDIDGTGKISVRNLRKIS
                     RDLGENLSDEELQAMIDEFDLDEDGEINEEEFIRICTE"
     gene            <896437..>899124
                     /locus_tag="CD36_29320"
                     /db_xref="GeneID:8050298"
     mRNA            <896437..>899124
                     /locus_tag="CD36_29320"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421921.1"
                     /db_xref="GeneID:8050298"
     CDS             896437..899124
                     /locus_tag="CD36_29320"
                     /inference="similar to AA sequence:UniProt:P33420"
                     /inference="similar to AA sequence:UniProt:Q5A6R8"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421966.1"
                     /db_xref="GeneID:8050298"
                     /db_xref="GOA:B9WLK5"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR027663"
                     /db_xref="UniProtKB/TrEMBL:B9WLK5"
                     /translation="MSFKIGQSVIVKNDIGSIKYIGLTKFAPGVWYGIELLQPKGKNN
                     GSVQGVKYFDCKEDDNGFYGIFVKESMLNALEDNKNNDLEDVAQYNKTIENLKLKLKA
                     LTDESIRHREKVAAIQLELQTKIEIMKSMESKLEMQTVENEYLKSIKLDLEEKLHKLS
                     FEHQELKNEFELIQEELEINREIEREMESLDSDHYSPGDVRMIFEKNRRLEDTLALLT
                     RNSKETENKLKQELEHLQCEQLNMNELQKKLDQAESVVRMLQERIETTEDMDKMMERL
                     TVENEDLTNKIHTLMMTIDELNEIHELDKKLEEDQKQVEFDLRQEIDNLQQIIHQDKL
                     KIRELERNKLAQLSQANESLDSLSRSDQESELQVLRQTIADLRLRSRSDSVQLKLVKS
                     RYEILQQRIAYSQASMVFPELIDLIFMIKLACSDIVVVMESISSKSLHQIFAITFLSL
                     IANFLKSLTKLLEFNYSTDSTTKLLPEMTSKVKECNLCLDDVIDVFLSDDLRINIPNK
                     LYQSVQKLQDIILDVAVTLNLSFSSPKLVYECKECLKFVAYCSELETSFFFDVWKHLR
                     FHTSNADPALTALIKVGDDNLARIKGIVEALKETSDVEEKHDVTFSSGILDFEAIVSQ
                     IGILLKLYDIVKSDGLEINVDLLNKIIELMQTVESQYKVDIKVHSFQVTVASIYEYKF
                     ESTYQQSSTSDSGLHNKLALREREVTDLKLNIALLEQNMSSLASQNTQYITELTQELQ
                     SLKQEEEGSLKTISQLEQDKKDLVSELNAVNRNIMSTTQFANLKSQLDYNNSLTTMEK
                     IVHLKRLTRTIDMEIVDEFAWLQTQSKRQFWTEASSVHNLSKSLQALALNAKPVSINN
                     DNSNKWTKKKDSSKFAALVLEENYNKYKTTRTNLLCLEK"
     gene            complement(<899099..>900466)
                     /locus_tag="CD36_29330"
                     /db_xref="GeneID:8050299"
     mRNA            complement(<899099..>900466)
                     /locus_tag="CD36_29330"
                     /product="phosphatidylinositol
                     N-acetylglucosaminyltransferase subunit, putative"
                     /transcript_id="XM_002421922.1"
                     /db_xref="GeneID:8050299"
     CDS             complement(899099..900466)
                     /locus_tag="CD36_29330"
                     /EC_number="2.4.1.198"
                     /inference="similar to AA sequence:UniProt:P32363"
                     /inference="similar to AA sequence:UniProt:Q5A6R7"
                     /note="Similar to S. cerevisiae SPT14"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphatidylinositol
                     N-acetylglucosaminyltransferase subunit, putative"
                     /protein_id="XP_002421967.1"
                     /db_xref="GeneID:8050299"
                     /db_xref="GOA:B9WLK6"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR013234"
                     /db_xref="UniProtKB/TrEMBL:B9WLK6"
                     /translation="MGYNIAMVTDFFYPQPGGVEFHVYHLSQKLIELGHSVVIITHNY
                     SSRNGVRVLTNGLKVYYVPLWVIYRSSVFPTVFSCFPILRNIFIRESIEIIHGHGSLS
                     TLCHEAILHGRTMGMKTVFTDHSLFGFAEIGSIMGNKALKFTLSDVGHVICVSHTCKE
                     NTVLRGSIDPLKVSVIPNAVISKDFKPKSNRLKKDYTKEITIVVITRLFPNKGADLLT
                     AVIPRICQLKPKVKFLIAGDGPKFLDLEQMREKYFLQERVTLVGAIKHEEVRDVMVQG
                     DIYLHPSLTEAFGTVIVEAASCGLYVVTTKVGGIPEVLPNEMTSFAEPEENSLIDAAI
                     DAITKIESNEIDTSKFHDAVAKMYSWHDIAKRTENVYNSLDLNKLNEPLLHRLQKYYC
                     CGIIAGKLYALCVIVDIFIFVILEWLYPADHIDKATKWPSPIKEKEKEEEEEEGTFIF
                     PNKVN"
     gene            complement(<900836..>902704)
                     /locus_tag="CD36_29340"
                     /db_xref="GeneID:8050300"
     mRNA            complement(<900836..>902704)
                     /locus_tag="CD36_29340"
                     /product="mRNA export factor, putative"
                     /transcript_id="XM_002421923.1"
                     /db_xref="GeneID:8050300"
     CDS             complement(900836..902704)
                     /locus_tag="CD36_29340"
                     /inference="similar to AA sequence:UniProt:P84149"
                     /inference="similar to AA sequence:UniProt:Q99257"
                     /note="Similar to S. cerevisiae MEX67"
                     /codon_start=1
                     /transl_table=12
                     /product="mRNA export factor, putative"
                     /protein_id="XP_002421968.1"
                     /db_xref="GeneID:8050300"
                     /db_xref="GOA:B9WLK7"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR005637"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:B9WLK7"
                     /translation="MSYRGRGGGYNNNYTRGQFSSGPHQHQQNVDSFVAANQYPIEIM
                     GWNGASSGECISFISRKCKVIVSNYSVDSNSGVLKGYVKNESQANTLLNWSGVKFAGQ
                     SLRFSKGVSNISNQMGGGASSGSQSTIETISQFLKARYQPEIKMLNLNNVKQDPTLTA
                     QGFFGSLSVSSKFFPALMKVASDLKLDVDSIDLSNNELQDLQTLTSMAQTFPKLQNLS
                     LQNNNFTKIKVFETWRHKLNFLRELILFNNPIVQTNDPAEIQNIKLELMKSFPRLVVL
                     NGEILRNEQVLITNLSFPFEPQDTMFFQDEDSRNLATNFIANYLKLWDSNRSELMILY
                     QNESQFSMQVDSSHPHLIESGNSGYSGSTDFGYYLNNSRNLTRVSSVKARMAKLSVGQ
                     EQIYKSFQQLPKTRHDIIATPELFSMEVYKFPTLNGIMITLHGSFDEVAQPEIDGSSN
                     STAPSGPRGGSRYHSGPKHKRIPLSKKSFDRTFVVIPGPNGSMIVASDTLLIRPYTSD
                     FPWKVQKLLSNPTVASATPGVSATSTPSPLPPTTIATPQIAPPGTGPTTADLPADIKA
                     RLNQIQQELLVKILLETKLNINYGIMLCEQSNWDYQQASVNFKNSAASLPSDAFIQ"
     gene            complement(<903133..>903600)
                     /locus_tag="CD36_29350"
                     /db_xref="GeneID:8050301"
     mRNA            complement(<903133..>903600)
                     /locus_tag="CD36_29350"
                     /product="DNA damage response protein, putative"
                     /transcript_id="XM_002421924.1"
                     /db_xref="GeneID:8050301"
     CDS             complement(903133..903600)
                     /locus_tag="CD36_29350"
                     /inference="similar to AA sequence:UniProt:Q12091"
                     /inference="similar to AA sequence:UniProt:Q5A6R5"
                     /note="Similar to S. cerevisiae DAP1"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA damage response protein, putative"
                     /protein_id="XP_002421969.1"
                     /db_xref="GeneID:8050301"
                     /db_xref="GOA:B9WLK8"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:B9WLK8"
                     /translation="MLTTILIILVILYFARNIYNEFINNPSNPLDASTEKESTVVEGK
                     FTPKSLTKYNGKDSPKIFIAVKNRVFDVTQGGAFYGPGGPYENFAGRDASRGLAKNSF
                     DPDVLTDINEPIDKLTDLTAVEKESLDGWEEHFENRYKVVGTFHENGTVEEKS"
     gene            <904408..>904935
                     /locus_tag="CD36_29360"
                     /db_xref="GeneID:8050302"
     mRNA            <904408..>904935
                     /locus_tag="CD36_29360"
                     /product="N-terminal acetyltransferase complex subunit,
                     putative"
                     /transcript_id="XM_002421925.1"
                     /db_xref="GeneID:8050302"
     CDS             904408..904935
                     /locus_tag="CD36_29360"
                     /EC_number="2.3.1.-"
                     /inference="similar to AA sequence:UniProt:Q08689"
                     /inference="similar to AA sequence:UniProt:Q5A6R4"
                     /note="Similar to S. cerevisiae NAT5"
                     /codon_start=1
                     /transl_table=12
                     /product="N-terminal acetyltransferase complex subunit,
                     putative"
                     /protein_id="XP_002421970.1"
                     /db_xref="GeneID:8050302"
                     /db_xref="GOA:B9WLK9"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:B9WLK9"
                     /translation="MARDIIALDDLTPNNLGVLKKINEVTLPIKYPELWYKQILESSN
                     SIVQLAYYSELPVGAIKARTFHNNHNLKFNDFVNNKSSQVLSKTPNTVYIESFAVLEA
                     YRRLGIGKKLLNYLIEETKKRFIHEIIIHVSVANDEAIAWYKKQGFSQGELVADYYKD
                     QGLQSPDAYIFTMTV"
     gene            complement(<905110..>907131)
                     /locus_tag="CD36_29370"
                     /db_xref="GeneID:8050303"
     mRNA            complement(<905110..>907131)
                     /locus_tag="CD36_29370"
                     /product="protein translocation protein, putative"
                     /transcript_id="XM_002421926.1"
                     /db_xref="GeneID:8050303"
     CDS             complement(905110..907131)
                     /locus_tag="CD36_29370"
                     /inference="similar to AA sequence:UniProt:P14906"
                     /inference="similar to AA sequence:UniProt:Q5A6R3"
                     /note="Similar to S. cerevisiae SEC63; sec62/63 complex
                     subunit homologue, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="protein translocation protein, putative"
                     /protein_id="XP_002421971.1"
                     /db_xref="GeneID:8050303"
                     /db_xref="GOA:B9WLL0"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR027137"
                     /db_xref="UniProtKB/TrEMBL:B9WLL0"
                     /translation="MASSEYNYDESGETWPFFVLALLSFILLPLTIRYISRVFSNTNP
                     TKENQSIVGAIQENSETLKVPNLSEIKSFQSKQKSSKIFNKTLVFLIIGWCIVIYVAK
                     YVTKEADLTVLFDPYTILDVSFTASEKEIKSHYRKLSLKYHPDKLPKDLTEEQRSQAE
                     QAYIRLTSAYKALTDEVTRENFLKYGHPDGEQPATHGIALPQFLVDGRYSSLVVVLYF
                     MVIGILLPYIVGKWWSNVKSHTRKGLHVDTAANFVRKFTDRDPAKVITPDVILDYVLE
                     SEEIRQEFPDFLHAELKKLVYRYLNRQFDSDSKIEKKKINLVARLPFLINGLIDIAIV
                     FKLHETIFAAEDLKKSIIQAVKPTGRHQELLQLPYVDPEIVSKQPIRKLGKLFAISKE
                     EAKKALGIQSDEHLECALNVAQHIPTLRIIDAEIKVPGEEDGVVHPNSQGHISIKFLV
                     KSPKLKSCPDIEDERLKDEETLEYMKNPLIVNEQQSQLPYSYAPYFPQPTRNCWSCYV
                     IGQKENRLLEDSTNCVLENIDLNNLDLSQEEWIKGTNVRIGTYKIQLPGAIGNVGNYY
                     YRLVMKNNAYFGCDVDIPIDLEVTPVSIGKSLAGLKKKFDEEDESEDSESDSDISDPE
                     EDSLAGAIAALRGSDLKKKKSSQDELEEESEDEEVFTDINTDTEDEGDN"
     gene            complement(<907548..>909326)
                     /locus_tag="CD36_29380"
                     /db_xref="GeneID:8050304"
     mRNA            complement(<907548..>909326)
                     /locus_tag="CD36_29380"
                     /product="5-aminoimidazole-4-carboxamide ribonucleotide
                     formyltransferase, putative"
                     /transcript_id="XM_002421927.1"
                     /db_xref="GeneID:8050304"
     CDS             complement(907548..909326)
                     /locus_tag="CD36_29380"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /inference="similar to AA sequence:UniProt:P38009"
                     /inference="similar to AA sequence:UniProt:Q5A6R2"
                     /note="Similar to S. cerevisiae ADE17; AICAR
                     transformylase, putative; IMP cyclohydrolase, putative;
                     IMP synthetase, putative; bifunctional purine biosynthesis
                     protein, [includes phosphoribosylaminoimidazolecarboxamide
                     formyltransferase (ec 2.1.2.3); IMP cyclohydrolase (ec
                     3.5.4.10)], putative; inosinicase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="5-aminoimidazole-4-carboxamide ribonucleotide
                     formyltransferase, putative"
                     /protein_id="XP_002421972.1"
                     /db_xref="GeneID:8050304"
                     /db_xref="GOA:B9WLL1"
                     /db_xref="InterPro:IPR002695"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR024050"
                     /db_xref="InterPro:IPR024051"
                     /db_xref="UniProtKB/TrEMBL:B9WLL1"
                     /translation="MSEKQHTKTAILSVYDKTGLLDLAKGLVAANVRILASGGTAKLI
                     REAGFPVEDVSSITHAPEMLGGRVKTLHPAVHGGILARNLESDEHDLTAQGIEKVDFV
                     VCNLYPFKETISKVAVTVPEAVEEIDIGGVTLLRAAAKNHERVSILSDPQDYAHFLEE
                     LKSGEITAETRNRLALKAFEHTADYDVAISDFFRKQYAENISQLPLRYGANPHQKPAQ
                     AFVSEGELPFKVLNGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVG
                     LPLTDIEKKIYFVEDIENLSPLANAYARARGADRMSSFGDFIALSNIVDKPTAQIISK
                     EVSDGVIAPGYSEEALELLKKKKNGKYCILQIDPNYNPETLETRQVYGITLQQKRNDA
                     IFKGSSFKEIVSKNKDLTEQGAIDLTIATIALKYTQSNSVCYAKNGMVIGLGAGQQSR
                     IHCTRLAGDKADNWWLRQHPKVLGFKWAKGTKRPEKSNAIDLYVTNQIPTEEPEKSEY
                     ESKFAEIPEPLTAEERKEWLSKLSNVALSSDAFFPFPDNVYRAARSGVKFIAAPSGSV
                     MDKAVFAAADANDIVYVENPIRLFHH"
     gene            complement(<910121..>910735)
                     /locus_tag="CD36_29390"
                     /db_xref="GeneID:8050305"
     mRNA            complement(<910121..>910735)
                     /locus_tag="CD36_29390"
                     /product="60S ribosomal protein L15"
                     /transcript_id="XM_002421928.1"
                     /db_xref="GeneID:8050305"
     CDS             complement(910121..910735)
                     /locus_tag="CD36_29390"
                     /inference="similar to AA sequence:UniProt:P54780"
                     /inference="similar to AA sequence:UniProt:Q5A6R1"
                     /note="Similar to S. cerevisiae RPL15B"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L15"
                     /protein_id="XP_002421973.1"
                     /db_xref="GeneID:8050305"
                     /db_xref="GOA:B9WLL2"
                     /db_xref="InterPro:IPR000439"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR020925"
                     /db_xref="InterPro:IPR024794"
                     /db_xref="UniProtKB/TrEMBL:B9WLL2"
                     /translation="MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSR
                     PDKARRLGYKAKQGFVIYRIRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQKSLRSTA
                     EERVGRRASNLRVLNSYWVNQDSTYKYFEVILVDPSHKAIRRDARYNWIVNPVHKHRE
                     ARGLTSAGKKSRGINKGHLFNKTKAGRRHTWKKHNTLSLWRYRS"
     gene            <911527..>913254
                     /locus_tag="CD36_29400"
                     /db_xref="GeneID:8050306"
     mRNA            <911527..>913254
                     /locus_tag="CD36_29400"
                     /product="nuclear assembly factor, putative"
                     /transcript_id="XM_002421929.1"
                     /db_xref="GeneID:8050306"
     CDS             911527..913254
                     /locus_tag="CD36_29400"
                     /inference="similar to AA sequence:UniProt:P53919"
                     /inference="similar to AA sequence:UniProt:Q5A6R0"
                     /note="Similar to S. cerevisiae NAF1; protein required for
                     the assembly of box H/ACA snoRNPs and for pre-rRNA
                     processing, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="nuclear assembly factor, putative"
                     /protein_id="XP_002421974.1"
                     /db_xref="GeneID:8050306"
                     /db_xref="GOA:B9WLL3"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="UniProtKB/TrEMBL:B9WLL3"
                     /translation="MSETTNSPETVSREITEDSGSKQSTDADRSTLPSEDSNEKVTTT
                     TEKNSSEIVNIQSPIPTHNSESDKNISIGINNASDVTQVQQIASNNENTVQIREEHEQ
                     PKVYEPVVEPHDELEQSKEIIPEKEIQQVDNLQEDELDQINDESAKSTKKPKSSETEK
                     VKADTNQVEQLSDEEINVDDISSDDSSEGSSTEESSSDSSSNESSDEHEISNIDYNDG
                     EDEDEDSNEGPVKSVHEITDEKAPSLPDNYEISPNAPIEEIGEVTGLVENTMIIKART
                     SGEFRILQEKSVFCFEDRTVIGPLFEIFGRVQQPVYSVKFNSEEQFLKFKDSKGKTVY
                     YVVPDSQFLYTDSIKHIKGTDASNCHDEELPEEEQEYSDDEKESAAKSAKKKKKNKKN
                     KDKPTVTSGPSLPNKRQKVSAYSPIATHSQNTFQNRGRQISPQNNTIYNNYGQQPPAP
                     APAPQQQQQQQSPPAAQYGQPYYPQTDSYNSIMGQTPQYPQPSFGQSQHFYQNAYNQQ
                     AQPQYQPSYPIPQQYNQYQQQPQQQFNTNMSNAQIQQQVNPAQLEHLQRLLLQHLQNN
                     QTQYQHPPQ"
     gene            complement(<913290..>916061)
                     /locus_tag="CD36_29420"
                     /db_xref="GeneID:8050307"
     mRNA            complement(<913290..>916061)
                     /locus_tag="CD36_29420"
                     /product="DNA-binding protein of the mitochondria involved
                     in repair of mitochondrial DNA, putative"
                     /transcript_id="XM_002421930.1"
                     /db_xref="GeneID:8050307"
     CDS             complement(913290..916061)
                     /locus_tag="CD36_29420"
                     /inference="similar to AA sequence:UniProt:P25846"
                     /inference="similar to AA sequence:UniProt:Q5A6Q9"
                     /note="Similar to S. cerevisiae MSH1; MutS protein
                     homolog, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-binding protein of the mitochondria involved
                     in repair of mitochondrial DNA, putative"
                     /protein_id="XP_002421975.1"
                     /db_xref="GeneID:8050307"
                     /db_xref="GOA:B9WLL4"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WLL4"
                     /translation="MILRKNSIIPFRRLSSSCRFLARKAATKKIVSPVLEEWDRGARN
                     QDTGLSPLLASMKRLMDSNPGCVSLIQVGSFYELYFEQAEEYGPKLGLKIAKKKTSNH
                     VVPFAGFPTTQLRKFTEMLIHEQQVNVAIIDQCDQGSKTNQNLVHRKISRIITPGTLI
                     DESFLNFNENNYLVAISFAPNLLNLPPDPQMKVGLSWTDISVGESFVQLTTLGELSSD
                     IGRINPSEILLPKEFQDHNLHLGQWYSPLSELKRYIIRYHSTTNYNDLKLQYHDNIQK
                     VRKHLETFSPREQAALNMIMSYMSINLPDVDILMTLPTRYFNETCLQMDSRTRDALEL
                     TERTIAGRTSSVGSFVSVIKRTCTSSGTRLLTEWVKSPSLDIKDIEKRQSFVKMFLKN
                     RHLKIVTRQHLQQLGDFIRNLQKLVIGRGDPVNQLVYAANTLDGLQKLRDFLVEEYEK
                     SPQKMSCLTNLLEKFDIPKNLAEKIYNTIDIEERSVSGESTEEIEEPTEEYANTNSSY
                     SNSFLEKYRLKEEENGDAENFYSVKRDFNDELKVLHNELSDLETEENKLWSKLRNALD
                     DIDGKLNIVKRGIFGRYNNVILISGKTSSINKASAKLDGDILYAKKMSLVYRSKEWNE
                     IQHLILDKKEAILLVERKIIEELKSEVTQRFPEFRELAGLADFLDVTSSLAIVADQNN
                     WTCPKLIKSPRLSIEGGRHVVVESSLKDSGNMFIPNDSKMGTDGTLWVISGPNMGGKS
                     TYLRQNALIVILAQIGSFVPAERATIGLVDKIFTRIGATDDLFNDLSTFMVEMVEVSN
                     ILTNATSSSLAIVDEIGRGTSGKEGLAIAYATLLSLLQVNRCRTLFATHFGKELEQLL
                     VANNIDQKNIRYFRTRVLESSNNGKGFVIDHTLEPGISERSHALDVARMAGFPENALT
                     VAEEVLDNL"
     gene            complement(<916349..>917623)
                     /locus_tag="CD36_29440"
                     /db_xref="GeneID:8050308"
     mRNA            complement(<916349..>917623)
                     /locus_tag="CD36_29440"
                     /product="chromatin modification-related protein,
                     putative"
                     /transcript_id="XM_002421931.1"
                     /db_xref="GeneID:8050308"
     CDS             complement(916349..917623)
                     /locus_tag="CD36_29440"
                     /inference="similar to AA sequence:UniProt:P53911"
                     /inference="similar to AA sequence:UniProt:Q5A6Q7"
                     /note="Similar to S. cerevisiae EAF7"
                     /codon_start=1
                     /transl_table=12
                     /product="chromatin modification-related protein,
                     putative"
                     /protein_id="XP_002421976.1"
                     /db_xref="GeneID:8050308"
                     /db_xref="GOA:B9WLL5"
                     /db_xref="InterPro:IPR012423"
                     /db_xref="UniProtKB/TrEMBL:B9WLL5"
                     /translation="MTTLDKKNPTEKIHRQWSIENEIKLFSLLCDYKPAGKKKQQNIE
                     VIIKNINESLDSNEEPFSEYDVWNKLRSLYDLEKIGQIEELSNENTSTDENTNQTSER
                     PASITKDTKNTKNTSNAKDVIQDKKEMGQERSGSTSSLSTPEPPQRRTRSARETTKSK
                     LNSRDTPKEKPQHNDEKTTLDGTEKSKVEVSSTSDHTDDQSPTSGRIKKSSDESLGGN
                     MSDNDNVNKAKGNEKTAKIKEENISEQEEENVGGDEKANKNKDTNEDEDEEDVEVIEE
                     SDTDKENESSSEESSPEPMTKRTRQRTRSAHEKPASSNIKTRTRQSVKFDDKSSEPSP
                     TVTDAGSRKRRAQPGSVSPPHPPKTRRRTRSVAHEEEEDDATTHSTDEAEPEIIKMET
                     RQTTRRSSRISTESSTSTSTPNIKVRRSSRKR"
     gene            <917921..>919306
                     /locus_tag="CD36_29450"
                     /db_xref="GeneID:8050309"
     mRNA            <917921..>919306
                     /locus_tag="CD36_29450"
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /transcript_id="XM_002421932.1"
                     /db_xref="GeneID:8050309"
     CDS             917921..919306
                     /locus_tag="CD36_29450"
                     /inference="similar to AA sequence:UniProt:P27929"
                     /inference="similar to AA sequence:UniProt:Q5A6Q6"
                     /note="Similar to S. cerevisiae NAM9"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /protein_id="XP_002421977.1"
                     /db_xref="GeneID:8050309"
                     /db_xref="GOA:B9WLL6"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:B9WLL6"
                     /translation="MPRRIDKVSSMTKGHITMSMNKLNLFNIYRKDPLQYFGKTLYQQ
                     KWAAKTETRNYHGQQIKEKRFKNVLFDSNLKTYSQLDASLKGHDVAPTPITLQTYGTL
                     EKRLEIALFRSMFASSVRQARQFILGGYVKVNGVVIKHPSFPLQSGDVFSVDPEKVLF
                     ALGKTKPSLEKALSVDKKQIKKWNNYVFEAKQNPEKIWDLKQNKPDSLDTLKQIEDFE
                     KQKKSVQNAKKLMKIQQNQVTRQSILQDIIQLGNSASESASLETFSKYGDVARTKCLQ
                     IYQTLAKKNHPITKDPSTKNIEGFLAKDETKSPDEKHEIRLINSTLRELQNSEWERIR
                     IQFENFEEGTDTKFFQTSFAKALRSVPKLNKEEILEDESKAKVQLPWQKHLFGRKDPS
                     RSYFTPWTPRPFLGAFAILPSHIEISFDTCHAIYLRDPVARPGHSEVISPFPDHVHER
                     AYMYYVRKGKS"
     gene            <919535..>920455
                     /locus_tag="CD36_29460"
                     /db_xref="GeneID:8050310"
     mRNA            <919535..>920455
                     /locus_tag="CD36_29460"
                     /product="mitochondrial N5-glutamine methyltransferase,
                     putative"
                     /transcript_id="XM_002421933.1"
                     /db_xref="GeneID:8050310"
     CDS             919535..920455
                     /locus_tag="CD36_29460"
                     /EC_number="2.1.1.-"
                     /inference="similar to AA sequence:UniProt:P53944"
                     /inference="similar to AA sequence:UniProt:Q5A6Q5"
                     /note="Similar to S. cerevisiae MTQ1"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial N5-glutamine methyltransferase,
                     putative"
                     /protein_id="XP_002421978.1"
                     /db_xref="GeneID:8050310"
                     /db_xref="GOA:B9WLL7"
                     /db_xref="InterPro:IPR004556"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B9WLL7"
                     /translation="MSRLSAKVIREARRISPFLPRLLPANRTIEQASLELKWIKEELP
                     KEDWNDAVNQRYQLVPLQYILGSQPFGGLNIKCKQGVLIPRWETEEWCNKLVDTIKQI
                     HMKQLVVLDACTGTGCIPLLIGHKLSNIASKIYGFDVSGKAFDLANENLSLYRQKHPN
                     KSMDLKFYLGDVFDAEIMDRLDLPKINLLTSNPPYIPYHDYIKSSDRDGVAKSVKLYE
                     PSLALLGDGEFYRSLVQNILRPSQAEGFVFEVGYKNQADYVNFLLEDESAWSIGVMRD
                     SSDHVRCVVGWLNGSDFDGFKSLCDDVYVR"
     gene            complement(<920545..>921906)
                     /locus_tag="CD36_29470"
                     /db_xref="GeneID:8050311"
     mRNA            complement(<920545..>921906)
                     /locus_tag="CD36_29470"
                     /product="tRNA (adenine-n(1)-)-methyltransferase
                     non-catalytic subunit, putative"
                     /transcript_id="XM_002421934.1"
                     /db_xref="GeneID:8050311"
     CDS             complement(920545..921906)
                     /locus_tag="CD36_29470"
                     /inference="similar to AA sequence:UniProt:P41814"
                     /inference="similar to AA sequence:UniProt:Q5A6Q4"
                     /note="Similar to S. cerevisiae GCD10"
                     /codon_start=1
                     /transl_table=12
                     /product="tRNA (adenine-n(1)-)-methyltransferase
                     non-catalytic subunit, putative"
                     /protein_id="XP_002421979.1"
                     /db_xref="GeneID:8050311"
                     /db_xref="GOA:B9WLL8"
                     /db_xref="InterPro:IPR007316"
                     /db_xref="InterPro:IPR017423"
                     /db_xref="UniProtKB/TrEMBL:B9WLL8"
                     /translation="MTVFKKSETTIQSGQHVLIRLPSEGLKIVHLQDTGIIGLGKFGS
                     FEVSNILGYPLGTSFEIIEDHKVKPIKSISTLDLTDSDETVQRQELTKMFSDSAENNQ
                     NIINIGSKIQKLSKDDIDELKKSGASSSVGQMIIEKMIAGHEGFDKKTIFSQQKYLKR
                     KQQKFLRRFTVDYLGGSELLQYYIEKDLNRVLDLSVETLGLMLTYSNVRPGGKYLIID
                     ETGGVLTYAMMERMNCEGTIVSIHENEHANLIALRYSDYGNELETKTVKNINWLQFID
                     PQNEKIDWTDLSDEEVKKIKNKSQYKKRRDRALQINEVIQLVEDGNFDAFISVSTLNM
                     SEVLEYVLPKVGGSRPIVVYNQYKESLLEVQQALAGDKRVLAPSIYETRVRPYQTIPG
                     RMHPVMTNRGGGGYILWGTRVIPHDAITAVGKGYAKRKRVEAPSETDTETIEVPIDQE
                     SSV"
     gene            <922195..>924057
                     /locus_tag="CD36_29480"
                     /db_xref="GeneID:8050312"
     mRNA            <922195..>924057
                     /locus_tag="CD36_29480"
                     /product="RNA m(5)C methyltransferase, putative"
                     /transcript_id="XM_002421935.1"
                     /db_xref="GeneID:8050312"
     CDS             922195..924057
                     /locus_tag="CD36_29480"
                     /inference="similar to AA sequence:UniProt:Q5A6Q3"
                     /inference="similar to AA sequence:UniProt:Q6B1M0"
                     /note="Similar to S. cerevisiae NOP2"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA m(5)C methyltransferase, putative"
                     /protein_id="XP_002421980.1"
                     /db_xref="GeneID:8050312"
                     /db_xref="GOA:B9WLL9"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR011023"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023273"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B9WLL9"
                     /translation="MGRRAKNKQGVPPTFDEFQASKLKNDTKRKRSGAKEQKNDLPVS
                     KKPKSSTTSSKQTDHTENSKAKQKSKSKSKVTKDDEAEDEVDDLPEVDFEELASAKKS
                     LFDDSDEEELDDEFDVEGEDDFDSDEGERARPMFSDDEDEDLENLNAENMELYSKKLD
                     EEERLEAEEAEKELLEGETKQPRAKVLPTAEEEAEMSKGPQDVTMVRTRMLEVVKVLE
                     NFKELAEEGTSRTDYTNRLLKDICEYFGYSEFLADKLFNLFSPAEAMEFFEANEIARP
                     ITIRTNTLKTRRRDLAQALVNKGVNLQPIGSWTKVGLQIFDSQVPIGATPEYLAGQYI
                     LQAASSFLPVMALEPQENERILDMAAAPGGKTTYISALMKNTGCVFANDANKARTKSL
                     IANIHRLGCKNTIVCNYDAREFPKVIGGFDRVLLDAPCSGTGVIAKDESVKVSRTEKD
                     FMQIPHLQKQLLLSAIDSVDAHSSTGGVIVYSTCSIAVDENEAVVDYALRKRPNVKLV
                     DTGLTIGKEGFTSYRGKHFNPKISLTRRYYPHTYNVDGFYVAKFKKIAPSPHDVSKAG
                     AKEKENAARAEAEEEGIIHGDFAEFDNEEDKEIMERSKKHSLRKKGINPNATKK"
     gene            complement(<924137..>926473)
                     /locus_tag="CD36_29490"
                     /db_xref="GeneID:8050313"
     mRNA            complement(<924137..>926473)
                     /locus_tag="CD36_29490"
                     /product="actin-like protein, putative"
                     /transcript_id="XM_002421936.1"
                     /db_xref="GeneID:8050313"
     CDS             complement(924137..926473)
                     /locus_tag="CD36_29490"
                     /inference="similar to AA sequence:UniProt:P53946"
                     /inference="similar to AA sequence:UniProt:Q5A6Q0"
                     /note="Similar to S. cerevisiae ARP5"
                     /codon_start=1
                     /transl_table=12
                     /product="actin-like protein, putative"
                     /protein_id="XP_002421981.1"
                     /db_xref="GeneID:8050313"
                     /db_xref="GOA:B9WLM0"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027664"
                     /db_xref="UniProtKB/TrEMBL:B9WLM0"
                     /translation="MAPSKVKSEEETFPPQEIHLLKDAVFGFHKQEPFYQNYQQDVPI
                     AIDLGTSSLRVGLTNSPEPNNVFPGIISRYRDRKAMKTLTIIGNDVYSDSALRSTIKT
                     PFDGQLITNWDYMEYILDYSFEHIGATSDNGKLNNPIVMTEPITCTYNQRKSMYELLF
                     EAYQVPKVSFGIDSLFSFYANSSGKSSGLVIGAGNQSTSIIPVINGRGILSQAKRIDW
                     GGEQSQQYLSKLLALKYPYFPSKLNNYHTANLFKDYCYISEDYQQEIKHILDIDVLES
                     KDVVVQAPVEINVSNEKKKTDEELAEQAAKRKEQGKRLQKQAQEKRLEKLAQKQEEWE
                     YFSKFKEDNASLSPQEFETKLIENGFDGLEDFKKYMSSLERSLKRASQGGEDDHEEEE
                     IDPSSAWPLVDIPDDQLTAEQIKEKRKQKLHKANFEARERNKEIKRQQEEARLQFEKE
                     QQEWRDRDLDDWCTTKRLKLAEAISKYKERQKLLESFKDRKSAAAQQRMKYIADLAND
                     ENGSTSTQSRKRRRNANATIDNDPNDTFGANDEDWNMYREITNSSVEEEMEQINSEIL
                     KLEEELLLYDPNFHHEDTFAAASTFDWKNSVLHKFIHGPRPNITIEMQAEGLSPEEIA
                     THPEMIRKNHQMHLNVERIRVPEILFQPSIGGIDQAGISEIADDLLNSRLDGNFTPGG
                     QSYEVLGDIFLTGGLSLLPGFKNRIMSDFRSFLPVGAPLHVRTAKDPILDPWHGMYKW
                     ANSEDSTDGYVTKEEYEEYGPEYIKEHGLGNACLKDWS"
     gene            <926771..>928414
                     /locus_tag="CD36_29500"
                     /db_xref="GeneID:8050314"
     mRNA            <926771..>928414
                     /locus_tag="CD36_29500"
                     /product="adenylyl cyclase-associated protein (cap),
                     putative"
                     /transcript_id="XM_002421937.1"
                     /db_xref="GeneID:8050314"
     CDS             926771..928414
                     /locus_tag="CD36_29500"
                     /inference="similar to AA sequence:UniProt:P17555"
                     /inference="similar to AA sequence:UniProt:Q5A6P9"
                     /note="Similar to S. cerevisiae SRV2"
                     /codon_start=1
                     /transl_table=12
                     /product="adenylyl cyclase-associated protein (cap),
                     putative"
                     /protein_id="XP_002421982.1"
                     /db_xref="GeneID:8050314"
                     /db_xref="GOA:B9WLM1"
                     /db_xref="InterPro:IPR001837"
                     /db_xref="InterPro:IPR006599"
                     /db_xref="InterPro:IPR013912"
                     /db_xref="InterPro:IPR013992"
                     /db_xref="InterPro:IPR016098"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="InterPro:IPR018106"
                     /db_xref="InterPro:IPR028419"
                     /db_xref="UniProtKB/TrEMBL:B9WLM1"
                     /translation="MSTEESQFNVQGYNIITILKRLEAATSRLEDITIFQEEANKKHY
                     GVDSLTEKGTPKSRTVESSEAISGGKSLESGSFPTYSEAPVEKSKLLVEFENFVESYV
                     HPLVETSKKIDSLVGESAQYFYEAFVEQGKFLELVLKSQKPDMADPALAKALEPMNAK
                     CTKINELKDSNRKSPFFNHLNTFSESTTVFYWIGIPTPVSYIVDTKDTVKFWSDRVLK
                     EYKSKDQVHVEWVKQTLSVFDELKNYVKEYHTAGVSWNPKGKPFAEIVSQQAESADKN
                     SSSVSGAAGAAPPPPPPPPPPPPSTFFDDTDKGSEDASSASGGINAVFAELNQGASIT
                     SGLKKVDKSEMTHKNPELRKQPPVAPKKPTPPKKPTSLSGGVGSAPVKKPAKKELIDG
                     TKWIIQNFTKADVSDLSPITIEVEMHQSVFIGNCSDVTIQLKGKANAVSVSETKNVGL
                     VIDSLISGVDVIKSYKFGIQVLGLVPMLSIDKSDEGTIYLSQESIDNDSQVFTSSTTA
                     LNINAPKGNDDYEELAVPEQFVSKVVNGKLVTQIVEHAG"
     gene            <928800..>929981
                     /locus_tag="CD36_29510"
                     /db_xref="GeneID:8050315"
     mRNA            <928800..>929981
                     /locus_tag="CD36_29510"
                     /product="mitochondrial protein import protein, putative"
                     /transcript_id="XM_002421938.1"
                     /db_xref="GeneID:8050315"
     CDS             928800..929981
                     /locus_tag="CD36_29510"
                     /inference="similar to AA sequence:UniProt:P25491"
                     /inference="similar to AA sequence:UniProt:Q5A6Z6"
                     /note="Similar to S. cerevisiae YDJ1; yeast dnaJ protein,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial protein import protein, putative"
                     /protein_id="XP_002421983.1"
                     /db_xref="GeneID:8050315"
                     /db_xref="GOA:B9WLM2"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:B9WLM2"
                     /translation="MVKDTKFYDALGVSPNASDAELKKAYRKAALKYHPDKNPSPEAA
                     EKFKELSHAYEILSDDQKREIYDQYGEEGLSGQGAGGFGMNADDIFAQFFGGGFHGGP
                     QRPSRGKDIKHSIACSLEELYKGKSVKLALNKTVLCSECNGRGGAEGKVAQCPDCHGN
                     GMKFVTKQMGPMIQRFQTVCDKCQGTGDLIDPKDRCKKCNGKKTESERKILEVHVKPG
                     MKDGDHITFAGEGDQTPGVTPGDVVFIISQKPHPVFQRKGNDLLIEQEIELATALAGG
                     EIAFKHISGDWVRIEIPAGEVIAPGSVKMVEGFGMPVRTHKGNLIIHFNVKFPENNFA
                     DEESLKKLATLLPKPKEIKIPADADVDDCTMVPAKLEQSNPYESDEEAHGGPGVQCAS
                     Q"
     gene            complement(<930614..>932140)
                     /locus_tag="CD36_29520"
                     /db_xref="GeneID:8050316"
     mRNA            complement(<930614..>932140)
                     /locus_tag="CD36_29520"
                     /product="multidrug resistance transporter, putative"
                     /transcript_id="XM_002421939.1"
                     /db_xref="GeneID:8050316"
     CDS             complement(930614..932140)
                     /locus_tag="CD36_29520"
                     /inference="similar to AA sequence:UniProt:P53943"
                     /inference="similar to AA sequence:UniProt:Q5A6P6"
                     /note="Similar to S. cerevisiae AQR; plasma membrane
                     transporter of the major facilitator superfamily,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="multidrug resistance transporter, putative"
                     /protein_id="XP_002421984.1"
                     /db_xref="GeneID:8050316"
                     /db_xref="GOA:B9WLM3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WLM3"
                     /translation="MPEDREELDIEKVLSKKLEAIETSTEKKAPYTVFESTDKLLLII
                     VLSLVGFWSAISSPIYFPALPTLTKYFNTTPSVMNISVVAYLIFQGIAPTISSNLADT
                     FGRRPVILGSIIVFCAVCIAISQTKVYWLLALLRCFQAAGIAPVFAISSGVAGDICTP
                     ANRGGMVGAVSGLQLAGNGMGGLVGAALISGFHTWRAIFIFLAIGGGVTFIFAFLVLA
                     ETSRRIVGNGSIMPKNVLNKAVLIYLPHFKSKITNDYSTLQPKGAFDILGPFKIFFQK
                     EVFCTLLPSGMHFAAWTVSLTSLSTELESNKYNYSVMKVGLVYLPQGIACFIGSLIAG
                     RCLNWYYRYRKNLYDKQMNDVPLNDRPPFNLVASRLTLTIVPLAMMVIGLASFGWCLQ
                     YKQPIISIIISTILISFSASVMMSVCTTMLVDLYPKQSGASASCVNLMRCWLAALFTG
                     VLDHMISSLGLGGTYTLLTGICLLTDLGLVYVLYNANQRFVNYVSPNQTAVNSDAEDY
                     "
     gene            complement(<933406..>934947)
                     /locus_tag="CD36_29540"
                     /db_xref="GeneID:8050101"
     mRNA            complement(<933406..>934947)
                     /locus_tag="CD36_29540"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421940.1"
                     /db_xref="GeneID:8050101"
     CDS             complement(933406..934947)
                     /locus_tag="CD36_29540"
                     /inference="similar to AA sequence:UniProt:Q5A6P5"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421985.1"
                     /db_xref="GeneID:8050101"
                     /db_xref="UniProtKB/TrEMBL:B9WLM4"
                     /translation="MSATPTRELDQHTSSSPTKPSQPKSFHAITTPSPTDSESVTKEK
                     KPSPSNPEFVSNWKNFNVGDTKYIHHGHSSSIASSALKSETKTKPNKPSSPITKASSN
                     KIVINKSISKLLGLSEEAIDEKSIWPYKMETLNGIINLKIEEEKTKQESIKKDLANTA
                     IELLTLAKSLNVPGELISYLFISDSVTSDSLNATISKIRNETQQSFLKDSSEKSKMDS
                     IIGIKRKHSSTSLKSSGSALVSPLRSPKKLPLEIAHRRVVSDGSDEISNKSMSKMSSP
                     PQPPSLPLPLPPTSVHNHQPPPPLLPSSQFATHPSSQNQNQNQNQSHSHVHSPSLPQQ
                     LVPPMYPIFYTPQQVVPQQYNQQQSQQTQQSQQPHSSPSATQDGSGKVQDSPFAQQYQ
                     VIYPGHYSGAPNFVRQQYPYYVSSSPTQAAQQYIIQGPPVVSQSHLPQTSSSAAQPQT
                     QQKQQQQPVPSHHFESPDKTTGKSEDDTTPNKRHKNTKGGSINFMITTPKNPPKKRYN
                     NSSSK"
     gene            <936997..>937740
                     /locus_tag="CD36_29560"
                     /db_xref="GeneID:8050102"
     mRNA            <936997..>937740
                     /locus_tag="CD36_29560"
                     /product="nicotinamide riboside kinase, putative"
                     /transcript_id="XM_002421941.1"
                     /db_xref="GeneID:8050102"
     CDS             936997..937740
                     /locus_tag="CD36_29560"
                     /EC_number="2.7.1.-"
                     /inference="similar to AA sequence:UniProt:P53915"
                     /inference="similar to AA sequence:UniProt:Q5A6P3"
                     /note="Similar to S. cerevisiae NRK1"
                     /codon_start=1
                     /transl_table=12
                     /product="nicotinamide riboside kinase, putative"
                     /protein_id="XP_002421986.1"
                     /db_xref="GeneID:8050102"
                     /db_xref="GOA:B9WLM5"
                     /db_xref="InterPro:IPR000764"
                     /db_xref="InterPro:IPR026681"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WLM5"
                     /translation="MTISGIENNNIGNQVLLVALGGASSSGKTTVAKALKLLIPSSVL
                     IHLDDFYFTDSDIPVDPETGYQNWDCPQAIDFDRFTECLQNLKKGVFTSVKSIEPSES
                     DLKLSKEEEIHFAKEITNNSQKFVKKKIVLVDGFMLFHDPNIIKLFDIKLFFHAPFDT
                     LKSRREARKGYTTAEGFWVDPPNYFSKIVWPAYVKSHAYLYQEEKVDSNELNQQIVQR
                     YDLVDVDNNDTTRLYALVETSLSSIINHL"
     gene            complement(<937918..>941046)
                     /locus_tag="CD36_29570"
                     /db_xref="GeneID:8050103"
     mRNA            complement(<937918..>941046)
                     /locus_tag="CD36_29570"
                     /product="ATPase, putative"
                     /transcript_id="XM_002421942.1"
                     /db_xref="GeneID:8050103"
     CDS             complement(937918..941046)
                     /locus_tag="CD36_29570"
                     /inference="similar to AA sequence:UniProt:P53914"
                     /inference="similar to AA sequence:UniProt:Q5A6P2"
                     /note="Similar to S. cerevisiae KRE33;
                     In S. cerevisiae: essential protein of unknown function;
                     required for resistance to K1 killer toxin"
                     /codon_start=1
                     /transl_table=12
                     /product="ATPase, putative"
                     /protein_id="XP_002421987.1"
                     /db_xref="GeneID:8050103"
                     /db_xref="GOA:B9WLM6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR007807"
                     /db_xref="InterPro:IPR013562"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027992"
                     /db_xref="UniProtKB/TrEMBL:B9WLM6"
                     /translation="MGKKAIDARIPALIRNGVQEKQRSFFIIVGDKARNQLPNLHYLM
                     MSADLKMNKSVLWAYKKKLLGFTSHRQKREAKIKKDIKRGIREVNEQDPFEAFISNQH
                     IRYVYYKETEKILGNTYGMCILQDFEAITPNLLARTIETVEGGGLVVILLKNMTSLKQ
                     LYTMSMDIHSRYRTEAHDDVVARFNERFLLSLGSCENCLVVDDELNVLPISGGKHVKP
                     LPPKDDDELTPNAKELKELKESLADVQPAGSLVALSKTINQAQAILTFIDVISEKTLR
                     NTVTLTAGRGRGKSAALGIAIAAAISHGYSNIFVTSPSPENLKTLFEFIFKGFDVLGY
                     TEHMDYDIIQSTNPSFNKAIVRVDVKREHRQTIQYISPNDNHVLGQAELLIIDEAAAI
                     PLPIVKKLMGPYLIFMASTINGYEGTGRSLSLKLIQQLRTQSNNATPSETTVVSRDKK
                     SSEITGALTRTLKEVVLDEPIRYAPGDPVEKWLNKLLCLDVSLSKNSKFATKGTPHPS
                     QCQLFYVNRDTLFSYHPVSEAFLQKMMALYVASHYKNSPNDLQLMSDAPAHQLFVLLP
                     PIEAGDNRVPDPLCVIQLALEGEISKESVRKSLSRGQRAGGDLIPWLISQQFQDEEFA
                     SLSGARVVRIATNPEYSGMGYGSRAIELLKDYYSGKFTDISESTELNDHTITRVTDSE
                     LANASLKDEIKLRDVKTLPPLLLKLSEKAPYYLHYLGVSYGFTSQLHKFWKKSGFTPV
                     YLRQTPNELTGEHTSVVLSVLPGREDKWLHEFSKDFHKRFLSLLSYEFKKFQASQALS
                     IIEAAELGEGDKTTSQTLTKGQLDSLLSPFDLKRLDSYANNLLDYHVIVDMLPLISQL
                     FFSKKTGKDISLSSVQSAILLAIGLQHKDMDQIAKELNLPTNQAMAMFAKIIRKFSTY
                     FRKVLTKAIEESMPNLEDENVDAMNGKETEQIDYKAIEQKLQDDLEEAGDEAIKEMRE
                     KQRELINALNLDKYAIAEDAEWDEKSMDKATKGKANVVSVKSGKRKSKENANDIYEKE
                     MKAVKKSRKSKK"
     gene            <941573..>943042
                     /locus_tag="CD36_29580"
                     /db_xref="GeneID:8050104"
     mRNA            <941573..>943042
                     /locus_tag="CD36_29580"
                     /product="meiosis-specific transcription factor, putative"
                     /transcript_id="XM_002421943.1"
                     /db_xref="GeneID:8050104"
     CDS             941573..943042
                     /locus_tag="CD36_29580"
                     /inference="similar to AA sequence:UniProt:P38830"
                     /inference="similar to AA sequence:UniProt:Q5A6P1"
                     /note="Similar to S. cerevisiae NDT80"
                     /codon_start=1
                     /transl_table=12
                     /product="meiosis-specific transcription factor, putative"
                     /protein_id="XP_002421988.1"
                     /db_xref="GeneID:8050104"
                     /db_xref="GOA:B9WLM7"
                     /db_xref="InterPro:IPR008967"
                     /db_xref="InterPro:IPR024061"
                     /db_xref="UniProtKB/TrEMBL:B9WLM7"
                     /translation="MTKLSFHKKQKSKNRACNLDFKSDSALELLSSKSKVAPRSGLQF
                     KIGPPFQQTIQVSHLFIKELNQPVVPILNARIDRGFDLTNNEWVGYKRNYFSVVASFS
                     FEDYGTNKSILQTNGFFIVSDEKEYQVKQFSIRLVSKSVQDNTEISLMQHTAKRDRGP
                     IAEPPIVPVITGSIPSHIVVKEGSNIRKVSKIRQFDSLFFQDYSTLPILQAGSILNNY
                     DKNKDYVKVVKYERIQFSSAINCKKQSITEKKRFILQIQLLAALSGENTYAIIAISNT
                     PSLIIRGRSPSSYNSQGEGGEQAQGIEFDEDVQSCLTTVNDKYNAYPESRDLGEFSII
                     DNLQKNKENFEILKGYDSMDSYTINTMMSSEVTGSNWLGCSKLTFEEQPELSSQQGFP
                     DMKLYSSLSPVPGLLEQDSEPESLEPSYFLMKCRALVLESSETMMASRQNTFSKEFLN
                     HKQQAANLAYKIFDDGVEDEESDGDIVSKYVTPSDVMTA"
     gene            <943384..>943746
                     /locus_tag="CD36_29590"
                     /db_xref="GeneID:8050105"
     mRNA            join(<943384..943648,943721..>943746)
                     /locus_tag="CD36_29590"
                     /product="RNA processing complex subunit, putative"
                     /transcript_id="XM_002421944.1"
                     /db_xref="GeneID:8050105"
     CDS             join(943384..943648,943721..943746)
                     /locus_tag="CD36_29590"
                     /inference="similar to AA sequence:UniProt:P38203"
                     /inference="similar to AA sequence:UniProt:Q5A6P0"
                     /note="Similar to S. cerevisiae LSM2;
                     spliced gene; U6 snRNA-associated protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA processing complex subunit, putative"
                     /protein_id="XP_002421989.1"
                     /db_xref="GeneID:8050105"
                     /db_xref="GOA:B9WLM8"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016654"
                     /db_xref="UniProtKB/TrEMBL:B9WLM8"
                     /translation="MLFFSFFKTLVDQEVTVELKNDIEIKGTLKSVDQFLNLKLDNIT
                     CTNGQRYPYLGAVKNLFIRGSNVRYVHMNPNSVDCTLLQDASRREAMVQASK"
     gene            complement(<943875..>944324)
                     /locus_tag="CD36_29600"
                     /db_xref="GeneID:8050106"
     mRNA            complement(<943875..>944324)
                     /locus_tag="CD36_29600"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421945.1"
                     /db_xref="GeneID:8050106"
     CDS             complement(943875..944324)
                     /locus_tag="CD36_29600"
                     /inference="similar to AA sequence:UniProt:Q5A6N9"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421990.1"
                     /db_xref="GeneID:8050106"
                     /db_xref="GOA:B9WLM9"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:B9WLM9"
                     /translation="MTMSILELSKEIDKLAKIINEKNKELETLQRNYDSKLHMINKYI
                     ETISPSSTGTIPEEQLINAISKPIECPHCHEKLWDNQEKSTFLLIPKQKIDTKFDTIA
                     TQDEQPQPPTITTSSNKQKKKTNIVCSYCKMTGHTRAKCRKRLNTPM"
     gene            complement(<945165..>946850)
                     /locus_tag="CD36_29610"
                     /db_xref="GeneID:8050107"
     mRNA            complement(<945165..>946850)
                     /locus_tag="CD36_29610"
                     /product="oligosaccharide translocation protein, putative"
                     /transcript_id="XM_002421946.1"
                     /db_xref="GeneID:8050107"
     CDS             complement(945165..946850)
                     /locus_tag="CD36_29610"
                     /inference="similar to AA sequence:UniProt:P38206"
                     /inference="similar to AA sequence:UniProt:Q5A6N8"
                     /note="Similar to S. cerevisiae RFT1"
                     /codon_start=1
                     /transl_table=12
                     /product="oligosaccharide translocation protein, putative"
                     /protein_id="XP_002421991.1"
                     /db_xref="GeneID:8050107"
                     /db_xref="GOA:B9WLN0"
                     /db_xref="InterPro:IPR007594"
                     /db_xref="UniProtKB/TrEMBL:B9WLN0"
                     /translation="MSVSSSKHPSNDANVANQSVQGVSHLIVVQIMAKLLTFVLNQLI
                     IRYLSPSIIGATTYLEFICSTILFFSRESIRLSVQRVRNNSNNKDYVAQKVINFGVLA
                     IALAFPIFCAIGYWQLNYSSVMDKLFLSPFYKPVIVLFVASVILELLVEPIYCLYQFQ
                     LDFGKRSKFEGSAIFVKCIVSVLSILLARQYFFGQNFEAAAICAFALAQFGYSMTLFA
                     CYFTSFKFEFQNHEIKYSLVKLKDENAREFYFERDTLIIVKGFFVQMIFKQFLTEGDK
                     LLTSHLCTIEEQGMYAVMANYGSIIARLLFQPLEESTRLMFTKLLNDNSGSETEEKTK
                     KSESSKYTQTFNYLKLISIFYFNLSLIILFAGVTSGPYLLKLLMGGRASNWENTDIFK
                     LFPQYIVYLPFLAFNGILEALFSSMATNSDLKNFSKFMTLITILVLLISFLLIDALNL
                     RISGLILANIFNMSSRIGYCYFKISKFYSNEHVKISFVDIIRYSYPSIMITSIIWIIQ
                     FFIIGQNTTNFSQLILNACFSFVLLILLMIVESENLKKPFERVTGKLLKTKLD"
     gene            <947200..>947517
                     /locus_tag="CD36_29630"
                     /db_xref="GeneID:8050108"
     mRNA            <947200..>947517
                     /locus_tag="CD36_29630"
                     /product="transcriptional activator, putative"
                     /transcript_id="XM_002421947.1"
                     /db_xref="GeneID:8050108"
     CDS             947200..947517
                     /locus_tag="CD36_29630"
                     /inference="similar to AA sequence:UniProt:P13434"
                     /inference="similar to AA sequence:UniProt:Q5A6N7"
                     /note="Similar to S. cerevisiae HAP3"
                     /codon_start=1
                     /transl_table=12
                     /product="transcriptional activator, putative"
                     /protein_id="XP_002421992.1"
                     /db_xref="GeneID:8050108"
                     /db_xref="GOA:B9WLN1"
                     /db_xref="InterPro:IPR003956"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:B9WLN1"
                     /translation="MNQQNERDIELREQDRWLPIANVARIMKNTLPPTAKVSKDAKEC
                     MQECVSEFISFITSEASDKCLKEKRKTINGEDILYSMYDLGFENYAEVLKIYLAKYRE
                     ARK"
     gene            <947909..>950152
                     /locus_tag="CD36_29640"
                     /db_xref="GeneID:8050109"
     mRNA            <947909..>950152
                     /locus_tag="CD36_29640"
                     /product="multisite-specific tRNA:m5c-methyltransferase,
                     putative"
                     /transcript_id="XM_002421948.1"
                     /db_xref="GeneID:8050109"
     CDS             947909..950152
                     /locus_tag="CD36_29640"
                     /EC_number="2.1.1.29"
                     /inference="similar to AA sequence:UniProt:P38205"
                     /inference="similar to AA sequence:UniProt:Q5A6Y3"
                     /note="Similar to S. cerevisiae NCL1; tRNA
                     (cytosine-5-)-methyltransferase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="multisite-specific tRNA:m5c-methyltransferase,
                     putative"
                     /protein_id="XP_002421993.1"
                     /db_xref="GeneID:8050109"
                     /db_xref="GOA:B9WLN2"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023270"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B9WLN2"
                     /translation="MRQANFFFLCKLIKNNHIYLCVLFFLFFFFSFHCMLTRNYSKMA
                     KKHFKKRNNRDSSKGFGKRPANDASWSDIVRENANWETYYKSLNLIPESEWDDFKKAC
                     QTNLPMTFRITGSRKHAEEIRNIFLDRHVSQLKGKTFDGVDITPKNIEFYPDNLGWQI
                     DVSKNVIKKQKEYAKTQRFLVVETEVGNISRQEAVSMIPPLLLDVKPHHYVLDMCAAP
                     GSKTAQLIEALHAEDEKKLPTGFVLANDSDYKRSHMLVHQVKRLNSPNFLVVNHDATL
                     FPRIRLNNSSQDLKFDRILCDVPCSGDATMRKNLNVWKDFRVGNALGLHNVQELILNR
                     GLQLLKKGGRLVYSTCSLSPIENEAIVASALRKWGDQIRLVNVDNELPGLKRRKGVSE
                     WKVYGKDMELREPGAEDVPQTAFPPTKEEAEKFHLENCVRVYPHLQNTGGFFITVFEK
                     VNPVTDVDTEADGNKRKADDSDSEENEPKKQKGGNTSSTEPDSSSKTGRLPRDANEEP
                     FIFLDSSNSELQKCYSFYGFSDSFAKDCALVRNSTGEPLRTIYYSSPIIKDILTIEKQ
                     KLKLVHGGIKLFVAQRNDAGACGWRIQTESLHTIEHFVDEKRHVKCNLKLLERLMKEG
                     FPKIQEIKESGVDPEFSEKIDNVTEGCLFLTVDRSNEGLENLLLPLWRGKSNVNLMVN
                     KKDTHELLNRVFDIETSAKDHGKEKAHQDKVEAAKQQINNATEASSTPENTEQETPEV
                     EQKINDE"
     gene            complement(<950239..>950826)
                     /locus_tag="CD36_29650"
                     /db_xref="GeneID:8050110"
     mRNA            complement(<950239..>950826)
                     /locus_tag="CD36_29650"
                     /product="RNA polymerase I-specific transcription
                     initiation factor, putative"
                     /transcript_id="XM_002421949.1"
                     /db_xref="GeneID:8050110"
     CDS             complement(950239..950826)
                     /locus_tag="CD36_29650"
                     /inference="similar to AA sequence:UniProt:P38204"
                     /inference="similar to AA sequence:UniProt:Q5A6N5"
                     /note="Similar to S. cerevisiae RRN10; subunit of UAF
                     (upstream activation factor) for RNA polymerase I,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA polymerase I-specific transcription
                     initiation factor, putative"
                     /protein_id="XP_002421994.1"
                     /db_xref="GeneID:8050110"
                     /db_xref="GOA:B9WLN3"
                     /db_xref="InterPro:IPR007898"
                     /db_xref="InterPro:IPR022793"
                     /db_xref="UniProtKB/TrEMBL:B9WLN3"
                     /translation="MNISEVDRTLLNSTNVYNASNGEYHVNQTLNRTYIHNSKHHKLI
                     ETPQGLKVIIDKKVNDLDKVFYSRGKVVPPDELLDMMKLDSLKIPMKLREDFKDDAKL
                     PDSDLLKVIHYFVSKKLGEEKNKGDISKMVQSMDETALIAMGLLIESWCEELITDDTA
                     KHFLTTHNDDPTILLSDEESDTKVNNEDAEYEDEE"
     gene            <951072..>952283
                     /locus_tag="CD36_29660"
                     /db_xref="GeneID:8050111"
     mRNA            <951072..>952283
                     /locus_tag="CD36_29660"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421950.1"
                     /db_xref="GeneID:8050111"
     CDS             951072..952283
                     /locus_tag="CD36_29660"
                     /inference="similar to AA sequence:UniProt:Q5A6Y1"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421995.1"
                     /db_xref="GeneID:8050111"
                     /db_xref="UniProtKB/TrEMBL:B9WLN4"
                     /translation="MVEHESIARHYRTRNELLQLLHEDKNRTSLIRLAVLQIVTNNHF
                     KYGTDINTPRRTRSGKSRPDTVTEKDNKGKTVNTKSDSEQAREYEVTLNKLKLEHTTT
                     SKLQEAKIQSLKEENAKLKMQLKNNSSKNNASINTSFSSIFTSSKTRSSIFTTRNVKS
                     SSSSVSKIGVRSKSNTENSPVSFTLNKPIFEPASTPVKKSKLTFPKSLKSINQLSPSQ
                     TYTEATTTSTSGVPSSSAVPSSPTRPSSLTASTPSKYISAFDKSDNSSSPEFSPNRSQ
                     NNTKNSENDADNSESVETGGFVSANTSVGSSDNESSGDPKKKVKTTRKLQLAKSAKME
                     RARNVSNDKKNNGKLAHGLDDDELNPLKYYEDSNFKDIGLSPPTKRKHNELDNTKKLK
                     VRKKKNIFSID"
     gene            <952692..>955913
                     /locus_tag="CD36_29680"
                     /db_xref="GeneID:8050112"
     mRNA            <952692..>955913
                     /locus_tag="CD36_29680"
                     /product="ATP-dependent protease, mitochondrial precursor,
                     putative"
                     /transcript_id="XM_002421951.1"
                     /db_xref="GeneID:8050112"
     CDS             952692..955913
                     /locus_tag="CD36_29680"
                     /EC_number="3.4.21.-"
                     /inference="similar to AA sequence:UniProt:P36775"
                     /inference="similar to AA sequence:UniProt:Q5A6N1"
                     /note="Similar to S. cerevisiae PIM1"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP-dependent protease, mitochondrial precursor,
                     putative"
                     /protein_id="XP_002421996.1"
                     /db_xref="GeneID:8050112"
                     /db_xref="GOA:B9WLN5"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027065"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027503"
                     /translation="MIKASKCNKARALFLVRTSIPRTFIRNATSAIPTTVKLKDLSSL
                     PPLTKSLPTNLPFLMPDTLHNLLRFDSKKEKQPSTDKSNDKDKPSRKEKGKDKEKENE
                     ERKDINEDEKYDIKEETDSKPTIDPNNPVSSKSSISSSSGGANNNNNNDDSDGRDDDG
                     SPKDKEFLSPSDAGLHPPFLAIAMKDRPFLPGATRHLHVTDPEVIKCVNHMINSNIKS
                     PYFVLFHVRDTNSEDAALDVIKDRDFVHEVGTLCQIIKTTGSEILVYPHYRVKLVDIS
                     TPNSRSERIEMEQDNSQTSYLKKFEVSYAVTQQLKDEPYDEQSITINAWTRRIKELYE
                     KLAPKYEQPENKEEIMNNPSMLADFIASKVHAKPEQIQQILESSNVETKLELSLQLLQ
                     VEADADEMRQTALKNIRERTEKAYAQSLIKEYTKELLKAAGIGENSKVHKFDERIKHL
                     KMPEEAMKAYKTEKERLGTQSDMEQNVVERYLDWLTQIPFGVYTKDSFNVKKAREILD
                     RDHYGLKDVKDRILEFISVGKISGNVDGRILCLAGPPGTGKTSIAKSIAEALNRKYTR
                     IAVGGVQDVHDVKGHRRTYVASIPGRIVTALTQAKTSNPLMLIDEIDKLDTTSHGGAA
                     RAFLEILDPEQNNSFVDNFIEVKVDLSKVLFVCTANYLGSIPAPLRDRMEIIEVNGYT
                     KNDKIEITKRHLIPAAAKKVGLEEGRVVIPDETILRLIDKYCRESGLRHIKSLINRIF
                     SKASRKIVEELEDTDADPHSREIVEESLVAKENESVISDKAKKDAGSSSIESNDSNTE
                     AKVSTTTENEKKQEQKQKQDEEIKKLDLPADLKIEVKPETLKDFVGPEIYIKDRLYET
                     LNPGVATGLAYNTSGDGDALYIESILTDSISSDLGNAGLHVTGSLKEVMKESASIAYS
                     FAKQFMVRQFPDNRFFEAAHIHVHCPGGAIPKDGPSAGIAFTSSLVSLALNKSLPNDT
                     AMTGEITLTGKVLAIGGLREKSLGAKRAGYTKIIFPKDCEYQLDEIPDEVKEGLTYIP
                     VEWYSEVFEHLFKGISKEEGNSVWKEEFAKLEEKKKSKKTHTV"
     gene            complement(<956073..>957563)
                     /locus_tag="CD36_29690"
                     /db_xref="GeneID:8050113"
     mRNA            complement(<956073..>957563)
                     /locus_tag="CD36_29690"
                     /product="zinc finger protein, putative"
                     /transcript_id="XM_002421952.1"
                     /db_xref="GeneID:8050113"
     CDS             complement(956073..957563)
                     /locus_tag="CD36_29690"
                     /inference="similar to AA sequence:UniProt:Q09329"
                     /inference="similar to AA sequence:UniProt:Q5A6N0"
                     /note="Similar to S. pombe MLO2;
                     no apparent S. cerevisiae orthologue"
                     /codon_start=1
                     /transl_table=12
                     /product="zinc finger protein, putative"
                     /protein_id="XP_002421997.1"
                     /db_xref="GeneID:8050113"
                     /db_xref="GOA:B9WLN6"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="UniProtKB/TrEMBL:B9WLN6"
                     /translation="MYTYVQGLCNQSNSKQNRTPNDKPTHQTTLQSISSGLFLFFKQI
                     PHSTMSKENAQSANDETATLTAVDYIQNQEELEKEARELMPYDPNECTYEMGELRQPL
                     FACLTCSTENENQPIGVCYSCSIQCHSQHELVELFTKRSFVCDCGTTRMKNTKDGACK
                     LRRHGKREHSGRKLSNSSATHSTYVELAAEDIPSSSNTYNQNFHGRFCGCKQVYNPLE
                     ETGHMIQCYFGFTCGEDWYHDRCIMGITFTDERATQKPQNSQEESVPDGTNIKTDIST
                     TQSDTANVDSIEKLQYFPKLEAFDEFICWRCVSSFKDVFEDLDKHFPGVVLSKLPRFS
                     NVNTVEDWYSQREKLLEPCPKKIKTEASSVTMGEFHNQEYSLFLSNDFRYKLMDNYES
                     LDHESKLYKFLINNSFLFKDDPIFKPPEDDSEDDCFSSTNVGTGRVLESLPRDKAIES
                     IQAYDKIKSKLKDFFKPFAEQGKIVTEEEVRNFFGHIDDKNNDSEQ"
     gene            complement(<957870..>958349)
                     /locus_tag="CD36_29700"
                     /db_xref="GeneID:8050114"
     mRNA            complement(<957870..>958349)
                     /locus_tag="CD36_29700"
                     /product="H/ACA ribonucleoprotein complex subunit,
                     putative"
                     /transcript_id="XM_002421953.1"
                     /db_xref="GeneID:8050114"
     CDS             complement(957870..958349)
                     /locus_tag="CD36_29700"
                     /inference="similar to AA sequence:UniProt:P32495"
                     /inference="similar to AA sequence:UniProt:Q5A6M9"
                     /note="Similar to S. cerevisiae NHP2; H/ACA snoRNP
                     protein, putative; high mobility group (HMG)-like nuclear
                     protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="H/ACA ribonucleoprotein complex subunit,
                     putative"
                     /protein_id="XP_002421998.1"
                     /db_xref="GeneID:8050114"
                     /db_xref="GOA:B9WLN7"
                     /db_xref="InterPro:IPR002415"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:B9WLN7"
                     /translation="MGSKKESKSKSSSDDVSTEDNYEKRMSAVLPFAKPLASKKLNKK
                     ILKTVKKASKAKHVKRGVKEVVKSLRKGEKGLVIIAGDISPADVISHIPVLCEDNSVA
                     YIFIPSKEDLGSAGATKRPTSCVMIVPGGGKSKKNADKTDEYRDGFDDIVKEINASE"
     gene            <958612..>959394
                     /locus_tag="CD36_29720"
                     /db_xref="GeneID:8050115"
     mRNA            <958612..>959394
                     /locus_tag="CD36_29720"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421954.1"
                     /db_xref="GeneID:8050115"
     CDS             958612..959394
                     /locus_tag="CD36_29720"
                     /inference="similar to AA sequence:UniProt:Q5A6M7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002421999.1"
                     /db_xref="GeneID:8050115"
                     /db_xref="UniProtKB/TrEMBL:B9WLN8"
                     /translation="MSSPTNRLNIKKRKKVYSNEFKSLRQQSQEFLALELTNTPLDQK
                     PTQPLEDHKLINYINKMHPRVNVSQQDKVTYITILLTLSEPPKILDQKQKLIDNFKIG
                     DILVTDPVPGSIDQYLTIYGKPIYITKCLMYVIYYLNVIMHINYDLFTFKTANYKFTI
                     LLNSQNLKHKHNLKYLDIAQYSEHIYSGFIQGDLHSIFNFVLQTIEQGNNVDNRDINN
                     SPIFGLHIDSALCHRTSKTKESINKANNRLLEYLYSSTGKLM"
     gene            complement(<959485..>962346)
                     /locus_tag="CD36_29730"
                     /db_xref="GeneID:8050116"
     mRNA            complement(<959485..>962346)
                     /locus_tag="CD36_29730"
                     /product="beta-coat protein of the COPI coatomer,
                     putative"
                     /transcript_id="XM_002421955.1"
                     /db_xref="GeneID:8050116"
     CDS             complement(959485..962346)
                     /locus_tag="CD36_29730"
                     /inference="similar to AA sequence:UniProt:P41810"
                     /inference="similar to AA sequence:UniProt:Q5A6M6"
                     /note="Similar to S. cerevisiae SEC26; coatomer subunit,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="beta-coat protein of the COPI coatomer,
                     putative"
                     /protein_id="XP_002422000.1"
                     /db_xref="GeneID:8050116"
                     /db_xref="GOA:B9WLN9"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011710"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016460"
                     /db_xref="InterPro:IPR029446"
                     /db_xref="UniProtKB/TrEMBL:B9WLN9"
                     /translation="MSDSGYTLIYEPNTATKVSVNEFKNLLEKGKDDVKVDTMKKILI
                     TILNGDPLPDLLMHIIRFVMPSRNKELKKLLYHYWEVCPKMDESGKMRHEMILVCNAI
                     QRDLQHPNEYIRGNTLRYLTKLKEPELLETLVPNVRQCLEHRHAYVRKNAVFALWSIH
                     KVSDHLAPDADELIYRFLYEENDSVCKRNAFVCLGDLNREAALQYIQDNISVIETLDP
                     LIQLAFIEFIKKDSVQNPSLKQQYAQLMTEIIESSSNVVMYEAANTLTVLTSNPQSIL
                     LAGNKFVELATRESDNNVKIITLERINQLHKQHPGVLQDLSLEILRVLSSQDLDVKKK
                     ALDVTLQFITTRNVEDVVKLLKKELQSTALSNDDKNADYRQLLINAIHQLAIKFVEVA
                     ANVIDLLLDSIADLNTTAAYEVITFVKEVVEKFPDLRDAILRRLILALPHVKSGKVFR
                     GALWVIGEYALEESLIQESWKYIRGSIGEVPIIASELKSKKHEEDTEELQEEEAEYDG
                     KPRRKGPVVLPDGTYATESALTSETTDSLESDSKTPIRKQILGGDFYLGAVLASTLVK
                     LILRLQSLKQTQEKILNGLKAEALLIMVSILRVGESSLVSKKIDEDSADRILSYIKIL
                     NDEEDLQEIKTSFLEDTKDAFKAQINNAELKKAEALAKDLHDNAEQIDDAIVFRQLDK
                     DNKKSKTSVDDLAAASGSNELKKEDLSSRLNKIIQLTGFSDPIYAEAFVKVHQYDVVL
                     DVLLVNQTTTTLRNLSVEFATLGDLKVVDKPTTANIGPHGFYKVQTTIKVTSADTGVI
                     FGNIVYDGQHSDDSRIVILNDVHVDIMDYIKPATCSESQFRKMWNEFEWENKITIKSP
                     IETLKEYLDELMKGTNMQCLTPGAVIGEECQFLSANLYSRSSFGEDALANLCIEKQSD
                     GPIIGHVRIRSKGQGLALSLGDRVASISRKGKTATITRV"
     gene            complement(<962759..>965170)
                     /locus_tag="CD36_29750"
                     /db_xref="GeneID:8050117"
     mRNA            complement(<962759..>965170)
                     /locus_tag="CD36_29750"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421956.1"
                     /db_xref="GeneID:8050117"
     CDS             complement(962759..965170)
                     /locus_tag="CD36_29750"
                     /inference="similar to AA sequence:UniProt:Q5A6M5"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422001.1"
                     /db_xref="GeneID:8050117"
                     /db_xref="UniProtKB/TrEMBL:B9WLP0"
                     /translation="MSERKKFSSRISSIFNYNSSNSIPTQSSIQKSGSHSRSTGTPKS
                     APSSSKTLGSLSPSPRPLSKPLLNTNNLRSNSSLVTSTSHNNNNSISVSSRTDTNRKK
                     VSSKPSISTLESYPHSNSNNNNNNSNYDNSINKNPHLNDNIISPLQHHNEGSLNPNQY
                     YQQSPQYLNPLLKSPDSLESGPSKPTSPNPSINNRLRRKPPSDLDSFDFGMYGENNDG
                     SDNETKGGTFDSPKSGTGITNDIIADLESDIDNFLKASSESGKEISMVTRTNSSKHSS
                     PFPSSSSDVADNSYINDLSISRSKPVMGLADIVNEDNQHNNKDFAEPSLSAPYPLDSP
                     LITPVISPVESPQIIQNEFMPITSNDNDSPNLKSEFSSMGQTSLANPFSSPVASGTPS
                     IVSPRRLRNFDSSTPVSPVASLISSTERNGGEISQYPVSSISRNASQNYTSSRTPSAV
                     SRMHSARSPGYPQSQPSAQTQTPLSRTLTENSTAAPIALSKSYTQKTYTSNRSNPSQH
                     RMSSSVGSIYSSNSYRNVNLAALKKTLKLKPGEGERSNYVLAIRRAAGTSYNESTRMK
                     WKLPVGILPVDKSATKENSNGKYMRLAGNSLASSRKKTSGVELKHGHLKPRLLAAEID
                     EGDDSTAISLAKTPLTQSSVNLKATETNTNKTVSNENSLIRTTTDVSIVTGDTNSIVT
                     TTTDTNTSGRGEGNGIKRNESIVSSNSSGSLSDKNFTNFGYYQHRSYKDDDEDIFADG
                     VNRQATNEDGNETDDENNHINGYPKNSYMDINSIDHPEEEEEEDNERPRLVLANPDYD
                     SDDSS"
     gene            <966363..>968093
                     /locus_tag="CD36_29760"
                     /db_xref="GeneID:8050118"
     mRNA            <966363..>968093
                     /locus_tag="CD36_29760"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421957.1"
                     /db_xref="GeneID:8050118"
     CDS             966363..968093
                     /locus_tag="CD36_29760"
                     /inference="similar to AA sequence:UniProt:Q5A6M4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422002.1"
                     /db_xref="GeneID:8050118"
                     /db_xref="UniProtKB/TrEMBL:B9WLP1"
                     /translation="MNGIKPSKTNHKHNHYYGKLANLRSVRFHNLHLSVRDSMENNQN
                     IMQTYTGQSEQQQHIQPPTRILNRRRSTINSIGMVNPLQEIEDSISSQKLLQLNQSSL
                     LTTFISIHSNIHNKLLYISEIISNDMNPQFEINLPYVPPNIHKCVIKLWCRNHGDGDW
                     KLLCLYKLNLRKVTTVESSSLENLDLYKSNTLSLQLNDGWFTFQDMLNRIIIDDDKKS
                     NVNSLSQPIPSYTFDSIRCLNNLYNSLQELFISKHNLMQQIKLYIGNLQDYKNINNIN
                     VVLNKLQFQVHKLIHDVNRLNSQNEQLNNKIYNIKQKINDLHNIIETFNINTKEIIEN
                     KLELYETEIQNIQVSQLSLQQQKLNKLLKTKMKLIEVVFPIDNIDSTKFSILGFQFPQ
                     DQQEILAICYYNNPSIELKNQYYQPEFDNETQLHNFKIQQINATLSIVVQLMILIADI
                     TNTDYKYKMVLHGSQSYIIDEISKNYPLSKKTPSHNIKPFKFPLYYDSTTNEKVIVSS
                     GNQSSLMIMNQEFEYGLKLLNKNLIILIDKVQNLMFGDGSGNYDSHVPIECLDNVLWN
                     LKYLELFMTV"
     gene            complement(<968450..>968956)
                     /locus_tag="CD36_29770"
                     /db_xref="GeneID:8050119"
     mRNA            complement(<968450..>968956)
                     /locus_tag="CD36_29770"
                     /product="major cell wall mannoprotein with possible
                     lipase activity, putative"
                     /transcript_id="XM_002421958.1"
                     /db_xref="GeneID:8050119"
     CDS             complement(968450..968956)
                     /locus_tag="CD36_29770"
                     /EC_number="3.1.1.-"
                     /inference="similar to AA sequence:UniProt:P27654"
                     /inference="similar to AA sequence:UniProt:Q5A6M2"
                     /note="Similar to S. cerevisiae TIP1; temperature
                     shock-inducible protein precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="major cell wall mannoprotein with possible
                     lipase activity, putative"
                     /protein_id="XP_002422003.1"
                     /db_xref="GeneID:8050119"
                     /db_xref="GOA:B9WLP2"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:B9WLP2"
                     /translation="MRFAFTTVSLSLLLSSLVASEAASSDVQFLTALVGDYQDHKSDY
                     IKFFATAKDVPGDLSTLATKVLTYTDDSYTTLLNDDSLNVSNLEGFATSLPWYTRIQA
                     EAGGKGSASGSGSGSGSAKSTASAEKSSGSSASASKTAGSSSATGGVSELIAPVGAVV
                     GALAVALM"
     gene            complement(<971361..>971711)
                     /locus_tag="CD36_29780"
                     /db_xref="GeneID:8050120"
     mRNA            complement(<971361..>971711)
                     /locus_tag="CD36_29780"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421959.1"
                     /db_xref="GeneID:8050120"
     CDS             complement(971361..971711)
                     /locus_tag="CD36_29780"
                     /inference="similar to AA sequence:UniProt:Q5A6M0"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422004.1"
                     /db_xref="GeneID:8050120"
                     /db_xref="UniProtKB/TrEMBL:B9WLP3"
                     /translation="MKFSTTLLALTASIATVMSADSSAAASGAGSAAKSGASSVASAA
                     KSGASSAASDAKSGASSAASGAGSAAKSGASSAASGASSAAKSGGSSSASGFAPIVGV
                     GAGSLAAVAGLLLL"
     gene            complement(<973527..>975989)
                     /locus_tag="CD36_29790"
                     /db_xref="GeneID:8050121"
     mRNA            complement(<973527..>975989)
                     /locus_tag="CD36_29790"
                     /product="transcription initiation factor TFIID subunit,
                     putative"
                     /transcript_id="XM_002421960.1"
                     /db_xref="GeneID:8050121"
     CDS             complement(973527..975989)
                     /locus_tag="CD36_29790"
                     /inference="similar to AA sequence:UniProt:O13282"
                     /inference="similar to AA sequence:UniProt:Q5A6L8"
                     /note="Similar to S. cerevisiae TAF5"
                     /codon_start=1
                     /transl_table=12
                     /product="transcription initiation factor TFIID subunit,
                     putative"
                     /protein_id="XP_002422005.1"
                     /db_xref="GeneID:8050121"
                     /db_xref="GOA:B9WLP4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR007582"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:B9WLP4"
                     /translation="MAEENKQLQDSKDGEKHQTSEQTNTSGNTQVSAPAPAPAPIPPA
                     QQQQQQQQQQQQQQQQKSSTQNQSSAAASARSSQGGRSNPPQYSQADLNRIVLEYLNK
                     KGYHRTEAQLRLESSNIPTPAVPLATPATTELASVNEIGDNKDLKEKLTKAEQELKEL
                     RDKKSKIEKELREAKDREVKISKEKELKQLKELEKKTKRESDPEIYFTAYSMLRRWVG
                     SSLDLYKPELSRVLYPLYIHCFLELISKGFSSEAKSFFDKFRSDHLILHGVEVEKFAG
                     LSLPEHLEENDLAVAYRKYKYRILVSKTSLNLLIYFLHENEAVGGGILIRIINQYLNP
                     VISTNRPDKIDQEGEANPEEGISEYVTDTDEVKKFNEQNVKLGKLPIDPEVAKEVEAD
                     LKIKDEKIEPVNDKTLTEEFQDMIKPDQDSPARESLPLPLKDANDIKKMIIQVEDSRS
                     KIKLGAIQASLPSVCMYTFHNTNNDMTCIEFNDDSTLVAAGFQDSYIKLWSLDGKPLK
                     SVLKRDRHKPQENTRKLIGHSGPVYGVSFSPDNKYLLSCSEDKTVRLWSLDTYTALVS
                     YKGHTQPVWDVKFSPLGHYFVTASHDQTARLWATDHIYPLRIFAGHINDVDCVEFHPN
                     SNYVFTGSSDKTCRMWDVHTGNCVRVFLGHTNSVNCLAVSPDGRWLASGGEDGIICVW
                     DIGSGRRLKSMRGHARASLYSLAFSRDGTVLVSGCADNSVRVWDVKKNTNDAGPEPEA
                     FNNNVNGNETNSDGALSTQRPQQQQQQQQQQQSQQQSQQSKKESIATSDHMNAFFTKK
                     TPVYKVHFTRRNLCLAAGAFQG"
     gene            complement(<976244..>977041)
                     /locus_tag="CD36_29810"
                     /db_xref="GeneID:8050122"
     mRNA            complement(<976244..>977041)
                     /locus_tag="CD36_29810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421961.1"
                     /db_xref="GeneID:8050122"
     CDS             complement(976244..977041)
                     /locus_tag="CD36_29810"
                     /inference="similar to AA sequence:UniProt:Q5A6L7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422006.1"
                     /db_xref="GeneID:8050122"
                     /db_xref="UniProtKB/TrEMBL:B9WLP5"
                     /translation="MNQRNTIQPVRSNNSTKLAVPARHSHTTSVSSFNNASFTTQFLP
                     NQPKPTRTGSSSGHYRLSRTTTNTTGDNYSTQDTQSIATIDKVPPSKPSATYSDKLWT
                     QIDVLDDVKKMAEEVRGKGSFFNDNFNLQLKKLKESQDKLLNTMSTQQFNDFNSKEHQ
                     KQHFYQLNTISPTVHPSDNLFKEHKILHEDEEKQNQEQKKQAKQEKINSFFKSDDKQE
                     DLEFKNQTIYRKENFEEINQYVSQIKKDLKGLGESMKQFDESTREIW"
     gene            <977213..>978127
                     /locus_tag="CD36_29820"
                     /db_xref="GeneID:8050123"
     mRNA            <977213..>978127
                     /locus_tag="CD36_29820"
                     /product="phosphatidylinositol
                     N-acetylglucosaminyltransferase subunit, putative"
                     /transcript_id="XM_002421962.1"
                     /db_xref="GeneID:8050123"
     CDS             977213..978127
                     /locus_tag="CD36_29820"
                     /EC_number="2.4.1.198"
                     /inference="similar to AA sequence:UniProt:P46961"
                     /inference="similar to AA sequence:UniProt:Q5A6L6"
                     /note="Similar to S. cerevisiae GPI2"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphatidylinositol
                     N-acetylglucosaminyltransferase subunit, putative"
                     /protein_id="XP_002422007.1"
                     /db_xref="GeneID:8050123"
                     /db_xref="GOA:B9WLP6"
                     /db_xref="InterPro:IPR009450"
                     /db_xref="UniProtKB/TrEMBL:B9WLP6"
                     /translation="MKEIHLSSSILHDSDPSTENYHEHALSQEQPSWKKLLYLQQPFP
                     DNYTDQSFLSQLKRNTTVAKYSYKNLVQAFSFIVFYISCILLVILMFIGIYEKQWDPI
                     IPTLISTGISLIGFFTLNNLSMNMRSLMVITFILLIVSPILKSLTKSTSSDSIWAISC
                     VLCLANSIFHDYSMKVSYRPIVSTNISLSNAIVLASRLSTTLEVFLFVLFAIEVNILL
                     PLFDAKIRLSGLEAIHWTIAFLTFNLASYLVYVLLNYKFLVYWVLSVFVMVVIMPMYF
                     LSLQRYKNEIQGPWDVAKPKFMKSGIQN"
     gene            complement(<978291..>979823)
                     /locus_tag="CD36_29830"
                     /db_xref="GeneID:8050124"
     mRNA            complement(<978291..>979823)
                     /locus_tag="CD36_29830"
                     /product="bleomycin hydrolase, putative"
                     /transcript_id="XM_002421963.1"
                     /db_xref="GeneID:8050124"
     CDS             complement(978291..979823)
                     /locus_tag="CD36_29830"
                     /EC_number="3.4.22.40"
                     /inference="similar to AA sequence:UniProt:Q01532"
                     /inference="similar to AA sequence:UniProt:Q5A6L5"
                     /note="Similar to S. cerevisiae BLH1; cysteine proteinase,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="bleomycin hydrolase, putative"
                     /protein_id="XP_002422008.1"
                     /db_xref="GeneID:8050124"
                     /db_xref="GOA:B9WLP7"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR004134"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="UniProtKB/TrEMBL:B9WLP7"
                     /translation="MGSNTSKTINSVSTKASLPETEEEEILNEKSYSLTSDFDDFREQ
                     FEGLELENAENEINPISENILSKWEDDFKSQTKNLLAQNALAKNAIVDVIAKNSVGRQ
                     SLKDRYLFNITVDTIGSPAHLNNQKSSGRCWIFASSNVLRTHVIKSYNLKEDDFQLSQ
                     SYLYFYDKLEKANFFLENIEDTASEDLDSRLISYLFSNPVNDGGQWDMIVNLVNKYGV
                     VPNEVFPDNAQSTNSSKLNYVVTEKLREYGLKLRSLIAKNAPQNVISSFKASAIKSIY
                     KTIALALGTPPKPTDEFLWEFVDKDGKYKSFKTNPLDFYKNHVRYNASEHFSLIHDPR
                     NGYNKLYTVERLNNIFGGKPIEYINLEIDEIKQVAIKMLKDNEPVFFGSDVGKFSDSK
                     SGILDTTAYDYSTAFDFSLDITKSQRLKVGSSQMTHAMVITGVHLDPQTNKPVRWKIE
                     NSWGEDSGQKGWFMMTDEWFDEYVFQIVTNKKYSGKKAYDIWKGKEFNTLPYYDPMGA
                     LA"
     gene            complement(<980225..>981232)
                     /locus_tag="CD36_29840"
                     /db_xref="GeneID:8050125"
     mRNA            complement(<980225..>981232)
                     /locus_tag="CD36_29840"
                     /product="palmitoyl-protein hydrolase, putative"
                     /transcript_id="XM_002421964.1"
                     /db_xref="GeneID:8050125"
     CDS             complement(980225..981232)
                     /locus_tag="CD36_29840"
                     /EC_number="3.1.2.22"
                     /inference="similar to AA sequence:UniProt:Q20390"
                     /inference="similar to AA sequence:UniProt:Q4WYS3"
                     /inference="similar to AA sequence:UniProt:Q5A6L4"
                     /note="Similar to C. elegans PPT-1; palmitoyl-protein
                     thioesterase precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="palmitoyl-protein hydrolase, putative"
                     /protein_id="XP_002422009.1"
                     /db_xref="GeneID:8050125"
                     /db_xref="GOA:B9WLP8"
                     /db_xref="InterPro:IPR002472"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B9WLP8"
                     /translation="MAHARSTINLCSVDKRTTRMLLSNLLNVQQTILSLIPETNIDVS
                     KNLAKPVLPNADDYRPVVIWHGLGDNYNSSGIHKVHEILDSMYPGIYVHSIRLDENPS
                     SDEQKSFFGDANRQIDEVCKQLRNITELSKGFDSIGFSQGGVFLRGLIERCPLEVNNF
                     ITFGSPHLGVSELPLCKDRFDWLCKQRNALLKKQVWRDSVQKRVVPAQYFRDPAHLDQ
                     YLEHSNYLADINNEWAERNATYKKNFSKLNKLVLVSFTEDTTLVPKESSQFYDFDPEQ
                     KRSIPFLYTELYKNDYIGLKALYKKNSVDFLSIKAEHMHIDEGFIKSIAQEYFGGKLG
                     T"
     gene            complement(<981531..>982652)
                     /locus_tag="CD36_29850"
                     /db_xref="GeneID:8050126"
     mRNA            complement(<981531..>982652)
                     /locus_tag="CD36_29850"
                     /product="oxidoreductase, 20G-Fe(II) oxygenase family,
                     putative"
                     /transcript_id="XM_002421965.1"
                     /db_xref="GeneID:8050126"
     CDS             complement(981531..982652)
                     /locus_tag="CD36_29850"
                     /inference="similar to AA sequence:UniProt:Q4WZ04"
                     /inference="similar to AA sequence:UniProt:Q5A6L3"
                     /note="oxidoreductase, 2og-fe(ii) oxygenase family,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="oxidoreductase, 20G-Fe(II) oxygenase family,
                     putative"
                     /protein_id="XP_002422010.1"
                     /db_xref="GeneID:8050126"
                     /db_xref="GOA:B9WLP9"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:B9WLP9"
                     /translation="MSFQEIPVIDLQEAFDPTTKSKFLEEVRDAIINVGFLLLKNYES
                     LGPTEEDLNAIKQQALEFFALPEKEKLHCEMLNSPHFLGYTRLANEITASHTDWREQI
                     DLATELPAPKEGEPLYKNIEGPNLWPNPEVIPKFRPTIENFIEKMTALSNAFKDLVAE
                     SIGVDPKALSRYFKENQQCKMKLIAYPDVSELDGTKSAALDDTPETNQGVGPHRDSDL
                     ITYIYQATEHQNSLQVQNFQGHWITVPNIPGHLVVNNGQTLQAITGGVAKATIHRVLV
                     PEKGTGTRISIPFFQTIDLDSSKGVVDNLPQEVIDLKNERDKKIKDWGVDTGFQFEPD
                     VSKEPIGHAVFRNRIKSHQDVAKKWYPEVLKSVLQEYTY"
     gene            <984790..>986244
                     /locus_tag="CD36_29870"
                     /db_xref="GeneID:8050127"
     mRNA            <984790..>986244
                     /locus_tag="CD36_29870"
                     /product="hexokinase-2, putative"
                     /transcript_id="XM_002421966.1"
                     /db_xref="GeneID:8050127"
     CDS             984790..986244
                     /locus_tag="CD36_29870"
                     /EC_number="2.7.1.1"
                     /inference="similar to AA sequence:UniProt:P04807"
                     /inference="similar to AA sequence:UniProt:Q5A6L2"
                     /note="Similar to S. cerevisiae HXK2"
                     /codon_start=1
                     /transl_table=12
                     /product="hexokinase-2, putative"
                     /protein_id="XP_002422011.1"
                     /db_xref="GeneID:8050127"
                     /db_xref="GOA:B9WLQ0"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="UniProtKB/TrEMBL:B9WLQ0"
                     /translation="MVHLGPKPAQKRKGTFTDVSPQLLDALKPIQEQFTISADTLRAI
                     VKHFISELDRGLSKAGGNIPMIPGWVMDFPTGKETGSYIAIDLGGTNLRVVLVKLGGN
                     RDFDTTQSKFALPPHMRTATSDELWDFIAKCLKDFVDEIYPDGCTEPLPLGFTFSYPA
                     SQSRINEGILQRWTKGWAIDGIEGKDVVPMLQKAIKKVGVPINVVALINDTTGTLVAS
                     MYTDPEAKMGLIFGTGVNGAYFDVVKDIPKLEGKCPADIPPESPMAINCEYGSFDNEK
                     YILPRTKYDVQIDEESPRPGQQTFEKMISGYYLGEVLRLILLEFAEEKKLIFKGQNID
                     KLKIPYVMDASYPSRIEEDPFENLSDVADLFREKLGIETTEPERKIIRRLAELIGERS
                     ARFSVCGIAAICQKRGYETAHCAADGSVYNKYPGFKERTAQALRDIYEWPADIKDPII
                     IVPAEDGSGVGAAIIAALTEKRLREGKSVGLLEA"
     gene            <986556..>986945
                     /locus_tag="CD36_29880"
                     /db_xref="GeneID:8050128"
     mRNA            <986556..>986945
                     /locus_tag="CD36_29880"
                     /product="mitochondrial import protein, putative"
                     /transcript_id="XM_002421967.1"
                     /db_xref="GeneID:8050128"
     CDS             986556..986945
                     /locus_tag="CD36_29880"
                     /inference="similar to AA sequence:UniProt:Q08176"
                     /inference="similar to AA sequence:UniProt:Q5A6V5"
                     /note="Similar to S. cerevisiae MIM1; mitochondrial outer
                     membrane protein, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial import protein, putative"
                     /protein_id="XP_002422012.1"
                     /db_xref="GeneID:8050128"
                     /db_xref="GOA:B9WLQ1"
                     /db_xref="InterPro:IPR013262"
                     /db_xref="UniProtKB/TrEMBL:B9WLQ1"
                     /translation="MSQEYINPGTLNSSNSLLVDELTESNDLVVLEEQLSPDEVILNA
                     DIINTERLIEESRSLEEQPSYAIDIFGILKKAAINLVLPFINGMMLGFGEILAHEIGF
                     RYNWIGARVEPPRRMVQKKSESSSKYL"
     gene            <987195..>988583
                     /locus_tag="CD36_29890"
                     /db_xref="GeneID:8050129"
     mRNA            <987195..>988583
                     /locus_tag="CD36_29890"
                     /product="fumarase, putative"
                     /transcript_id="XM_002421968.1"
                     /db_xref="GeneID:8050129"
     CDS             987195..988583
                     /locus_tag="CD36_29890"
                     /EC_number="4.2.1.2"
                     /inference="similar to AA sequence:UniProt:P08417"
                     /inference="similar to AA sequence:UniProt:Q5A6L1"
                     /note="Similar to S. cerevisiae FUM1; fumarate hydratase,
                     mitochondrial precursor, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="fumarase, putative"
                     /protein_id="XP_002422013.1"
                     /db_xref="GeneID:8050129"
                     /db_xref="GOA:B9WLQ2"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR005677"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR018951"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="UniProtKB/TrEMBL:B9WLQ2"
                     /translation="MSRIESDAFGEISVPADKYWGAQTQRSLGNFEIGDTKMPIPIIK
                     AFGTLKKAAAIVNEKMGSLDPKLSAAIQEAASEVIEGKFNDNFPLVVYQTGSGTQSNM
                     NANEVISNRAIEILGGEKGSKKPVHPNDHCNMSQSSNDTFPTVMHIAAVSEVEQQLLP
                     KLIALRDAFEAKSKEFSDIIKIGRTHLQDATPLTLGQEFSGYVQQLTFGIERIKSTLP
                     RLSNLAQGGTAVGTGLNTKKGFDVKIAEEISNLTGSQYHTAPNKFEALAAHDAIVETS
                     GALNTLAVSLYKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQCEAMTMV
                     CAQVMGNNTTITFSGASGQFELNVFKPVMAYNLLNSIRLLGDACQSFRLHCVESIKAN
                     KEKIDKVLNESLMLVTALNPKIGYDNASKAAKNAHKKGITLKESCLELGLLTSEEFDE
                     WVRPEKMIGPKD"
     gene            complement(<988580..>988993)
                     /locus_tag="CD36_29900"
                     /db_xref="GeneID:8050130"
     mRNA            complement(<988580..>988993)
                     /locus_tag="CD36_29900"
                     /product="RNA-processing protein, putative"
                     /transcript_id="XM_002421969.1"
                     /db_xref="GeneID:8050130"
     CDS             complement(988580..988993)
                     /locus_tag="CD36_29900"
                     /EC_number="3.1.26.5"
                     /inference="similar to AA sequence:UniProt:P40571"
                     /inference="similar to AA sequence:UniProt:Q5A6L0"
                     /note="Similar to S. cerevisiae RPR2; RNase P
                     ribonucleoprotein, putative; nuclear RNase P subunit,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA-processing protein, putative"
                     /protein_id="XP_002422014.1"
                     /db_xref="GeneID:8050130"
                     /db_xref="GOA:B9WLQ3"
                     /db_xref="InterPro:IPR007175"
                     /db_xref="UniProtKB/TrEMBL:B9WLQ3"
                     /translation="MAKGKGKGKDKGKSIPNRDNYARISHLYQISNQFYLAHPEYQAL
                     SRGYNRNLDLIAKKTVIKLSPHIKRTLCKKCNTMLIPGLTMSMYIENFSKEKSQQNDV
                     FINKCLNCGKCKRFPVGKDRNYILFTDKQDESIET"
     gene            <989196..>990108
                     /locus_tag="CD36_29910"
                     /db_xref="GeneID:8050131"
     mRNA            join(<989196..989230,989323..989342,989411..>990108)
                     /locus_tag="CD36_29910"
                     /product="proteasome component, putative"
                     /transcript_id="XM_002421970.1"
                     /db_xref="GeneID:8050131"
     CDS             join(989196..989230,989323..989342,989411..990108)
                     /locus_tag="CD36_29910"
                     /EC_number="3.4.25.1"
                     /inference="similar to AA sequence:UniProt:P40303"
                     /inference="similar to AA sequence:UniProt:Q6CEN6"
                     /note="Similar to S. cerevisiae PRE6;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="proteasome component, putative"
                     /protein_id="XP_002422015.1"
                     /db_xref="GeneID:8050131"
                     /db_xref="GOA:B9WLQ4"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:B9WLQ4"
                     /translation="MSGYDSALSIFSPDGHVFQVEYASEAVKRGTCAVGVKGKNTVVL
                     GCEKRTALKLQDPRITPSKICKVDHHILLAFAGLNADARILVDKARVEAQSHKLTLED
                     PVSVEYLTKYVAGVQQKYTQSGGVRPFGIATLIAGFDVRDDVPKLFQTEPSGVFNAWK
                     AHAIGRSSKTVKEFLEKHYEEDLSEEDTIKLTVKSLLEVVQTGAKNIEVSVLKPGAVI
                     KKLDVDEIKKYVDAIEAEKAAEAEKKKQKSKD"
     gene            complement(<990159..>991277)
                     /locus_tag="CD36_29920"
                     /db_xref="GeneID:8050132"
     mRNA            complement(<990159..>991277)
                     /locus_tag="CD36_29920"
                     /product="structure-specific endonuclease, putative"
                     /transcript_id="XM_002421971.1"
                     /db_xref="GeneID:8050132"
     CDS             complement(990159..991277)
                     /locus_tag="CD36_29920"
                     /inference="similar to AA sequence:UniProt:P26793"
                     /inference="similar to AA sequence:UniProt:Q5A6K8"
                     /note="Similar to S. cerevisiae RAD27"
                     /codon_start=1
                     /transl_table=12
                     /product="structure-specific endonuclease, putative"
                     /protein_id="XP_002422016.1"
                     /db_xref="GeneID:8050132"
                     /db_xref="GOA:B9WLQ5"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR023426"
                     /db_xref="InterPro:IPR029060"
                     /translation="MGVKGLNQLIKEHSPSAYKEFQLKNLFGRKVAIDASMCLYQFLI
                     AVRQSDGQQLTNEDGETTSHLSGMFYRTIKMVENNIKPVYVFDGKPPVLKGGELEKRL
                     LRREEAQKQKTALGDEGTVEEVLKFEKRLVRVTREQNEEAKKLLELMGIPCVDAPCEA
                     EAQCAELARGGKVYAAASEDMDTLCYEPPFLLRHLTFSEARKMPIDQIEYKDAIAGLD
                     MTKEQFIDLCILLGCDYCESIKGIGQATAFKLIKEHGSLDNIVEWIKNNKTKYTLPEN
                     WPYDEARQLFMNPEVTNANEISLKWKEPDVDGLIEFMVRQKGFSEDRIRSGAEKLKKG
                     LKGGVQGRLDGFFKVVKNDDKKRKADPKETKSSKKKRR"
     gene            complement(<991551..>992615)
                     /gene="CDC10"
                     /locus_tag="CD36_29930"
                     /db_xref="GeneID:8050133"
     mRNA            complement(<991551..>992615)
                     /gene="CDC10"
                     /locus_tag="CD36_29930"
                     /product="cell division control protein 10 homologue"
                     /transcript_id="XM_002421972.1"
                     /db_xref="GeneID:8050133"
     CDS             complement(991551..992615)
                     /gene="CDC10"
                     /locus_tag="CD36_29930"
                     /inference="similar to AA sequence:UniProt:P25342"
                     /inference="similar to AA sequence:UniProt:P39827"
                     /note="septin, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cell division control protein 10 homologue"
                     /protein_id="XP_002422017.1"
                     /db_xref="GeneID:8050133"
                     /db_xref="GOA:B9WLQ6"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WLQ6"
                     /translation="MSIEEPSTQHIAQPQKYVGFDTITTQIENRLLKRGFQFNIMVVG
                     RSGLGKSTLVNTLFSSKLTTSQGRKSPSEPIEKTTEIKVASHSLLENNVRLNINVIDT
                     PGFGDQINNEKCWEPLVKYVKEQHSQYLRKELTAQRDKFLADTRVHCILYFIPPNGQK
                     LKQLDVQALKKLSEIANVVPIIAKSDSLTLDERSEFKKLLQSEFMKYNFNIYPYDSED
                     LYEEERQLNEDIKSLIPFAIAGSESEIEINGEMVRGRKTKWGAINIEDVSQCEFVFLR
                     DFLTRTHLQDLIETTALTHYETFRSKQLIALKENASNPNRQSQVQKDQGQTSQQDPKN
                     ATGVPNAPMFQSTTGTAAAR"
     gene            <993410..>994036
                     /locus_tag="CD36_29940"
                     /db_xref="GeneID:8049675"
     mRNA            <993410..>994036
                     /locus_tag="CD36_29940"
                     /product="mitochondrial ribosomal protein, large subunit,
                     precursor, putative"
                     /transcript_id="XM_002421973.1"
                     /db_xref="GeneID:8049675"
     CDS             993410..994036
                     /locus_tag="CD36_29940"
                     /inference="similar to AA sequence:UniProt:P25348"
                     /inference="similar to AA sequence:UniProt:Q5A6K5"
                     /note="Similar to S. cerevisiae MRPL32"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial ribosomal protein, large subunit,
                     precursor, putative"
                     /protein_id="XP_002422018.1"
                     /db_xref="GeneID:8049675"
                     /db_xref="GOA:B9WLQ7"
                     /db_xref="InterPro:IPR002677"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:B9WLQ7"
                     /translation="MMSLALRFGTVTSIQEALWGVFPRLPSITIRLGLQNRLGNQTTT
                     DERLQELKEKIEESGGEAPFMIDNGTILKAVPKKKLSRARRRKKLYAPGNKQVHPINN
                     IVRCSACGSVKRSHFMCMNCFAEIKTFLKSLKRKNGIIKDTVNPQSDLNPLDERVIYP
                     GKFETEHERQLKAKEWVPKREKPMPYNSTQVRHHKVHPKKGKVMVELE"
     gene            complement(<994187..>994996)
                     /locus_tag="CD36_29950"
                     /db_xref="GeneID:8050134"
     mRNA            complement(<994187..>994996)
                     /locus_tag="CD36_29950"
                     /product="pyridoxamine 5'-phosphate oxidase, putative"
                     /transcript_id="XM_002421974.1"
                     /db_xref="GeneID:8050134"
     CDS             complement(994187..994996)
                     /locus_tag="CD36_29950"
                     /EC_number="1.4.3.5"
                     /inference="similar to AA sequence:UniProt:P38075"
                     /inference="similar to AA sequence:UniProt:Q5A6K4"
                     /note="Similar to S. cerevisiae PDX3"
                     /codon_start=1
                     /transl_table=12
                     /product="pyridoxamine 5'-phosphate oxidase, putative"
                     /protein_id="XP_002422019.1"
                     /db_xref="GeneID:8050134"
                     /db_xref="GOA:B9WLQ8"
                     /db_xref="InterPro:IPR000659"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR019576"
                     /db_xref="InterPro:IPR019740"
                     /db_xref="UniProtKB/TrEMBL:B9WLQ8"
                     /translation="MFKQVASKSRIPIENSISSIRRMTLNSTNAVPDTRREDPETTTQ
                     EPIIFAPATYQYTKGHLGDTEVDSDPLVQFNKWFKEAQDSLPANSDIIVEATNFSTAR
                     LPSGRVSSRIVLLKELDKYGFLVYSNWNTSKKAKDYESNKYASLTFFWPHVQRQVRVE
                     GVMEHVTRETSERYFNTRPRGSKIGAWASPQSSVVQSRDDLDQIKDKYNDKFKDLQDH
                     EIPCPDYWGGIRIEPLEVEFWQGGLSRLHDRITYRREKKEDPNWEIFRLAP"
     gene            <995822..>997480
                     /locus_tag="CD36_29980"
                     /db_xref="GeneID:8050135"
     mRNA            <995822..>997480
                     /locus_tag="CD36_29980"
                     /product="phosphatidylserine receptor, putative"
                     /transcript_id="XM_002421975.1"
                     /db_xref="GeneID:8050135"
     CDS             995822..997480
                     /locus_tag="CD36_29980"
                     /inference="similar to AA sequence:UniProt:Q5A6U6"
                     /inference="similar to AA sequence:UniProt:Q75LR4"
                     /inference="similar to AA sequence:UniProt:Q9ERI5"
                     /note="Similar to Mus musculus Ptdsr"
                     /codon_start=1
                     /transl_table=12
                     /product="phosphatidylserine receptor, putative"
                     /protein_id="XP_002422020.1"
                     /db_xref="GeneID:8050135"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:B9WLQ9"
                     /translation="MMDQKRRKYNKSRRTISTNSFLVKHPLNVKPSGNSLLASTPILQ
                     QQRKDSLGDLRILPDEILMNIISYITDPPSLLNLSHTSRILYAFLYDEEIWKRVYLQN
                     IAHYDTKSWLGSWRNTVLNIRENTEWLQLPDNLLCSDLLYRPIQCSQIDYTKLFCEII
                     REEEVYHRDAILGQLDDLPRGRIQRIQESNLNLDEFNAAYHSSPFILVNSDSNRWPNW
                     NFELLFHQFPNVKFRQEAVSWDLKKYSQYLHNNKDENPLYLFDCKSDAMKVLKQEYKV
                     PEIFQDDLFTVFNNKKFNCRPDHAWIIMGSARSGSTFHKDPNSTSAWNAAIQGRKLWV
                     MLPPHITPPGVGTDEEQSEVTSPVSVTEWVISGFFNDSTKIDECLIGITFPGECMYVP
                     SGWWHTVINIDDSIAITQNFVPKSKLAQVLNFLKNKPKQISGFRLKEIKQCLACIAKD
                     SGDEVLIECLKAFNSLTVDLNEDCGELQDLPDMPIFEIFKQLLSNNGKEDILNDALEK
                     LKKIELKNYERETGKSRAWEKLTEPANSETATFSFNFDEVSDSE"
     gene            complement(<997536..>999050)
                     /locus_tag="CD36_29990"
                     /db_xref="GeneID:8050136"
     mRNA            complement(<997536..>999050)
                     /locus_tag="CD36_29990"
                     /product="autophagy-related protein, putative"
                     /transcript_id="XM_002421976.1"
                     /db_xref="GeneID:8050136"
     CDS             complement(997536..999050)
                     /locus_tag="CD36_29990"
                     /inference="similar to AA sequence:UniProt:P25568"
                     /inference="similar to AA sequence:UniProt:Q5A6K2"
                     /note="Similar to S. cerevisiae ATG22"
                     /codon_start=1
                     /transl_table=12
                     /product="autophagy-related protein, putative"
                     /protein_id="XP_002422021.1"
                     /db_xref="GeneID:8050136"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR024671"
                     /db_xref="UniProtKB/TrEMBL:B9WLR0"
                     /translation="MKVNHKQISSVSINEAVESSSEIQEGIPNNNNKNDKNQESIWNK
                     KSSFHTWLVLCYSTGPVASMSRTYVPASIQSIARNVGKTRMNQPCGTQGNDCYVKFGF
                     ITVHHTSYVLYLRAVSTAIEGIVAIFLMGIADYSNYRKLFLIFSILIYGFLALPFIGL
                     TNNDYQTLVLASILYSLLIIDDSIYQILEGSYIPLFMRADKENPMQRGSVVAVLGLFL
                     GNLGGITALVIGIIISYSSGTPEIKGYHNFLIAITVAGCMTIVLSLFSALYIPNVQGK
                     PRVDSFLVLPFKRFFNLLKDIQKYPMAFLYCISWVIWNVSFNNFMSMFLLLFRSTLGL
                     GNSDAEYTVYTFMSYICSSGGSLLWMLLYQKWNNNIKYWGYAFLSVSLLANFWGCLGI
                     NKLTPIGFQNRWEFWVFEVFYSATSSAMRSLNRCIYSSLLPVGNEAQYFGLEVTLGIA
                     SGWIGSLVNAVIQDRTNDDRFPFLPNMFLVIVSLILYYYVDLQKGMNDVDNEES"
     gene            complement(<999330..>1000910)
                     /locus_tag="CD36_30010"
                     /db_xref="GeneID:8050137"
     mRNA            complement(<999330..>1000910)
                     /locus_tag="CD36_30010"
                     /product="Major Facilitator Superfamily (MFS) transporter,
                     putative"
                     /transcript_id="XM_002421977.1"
                     /db_xref="GeneID:8050137"
     CDS             complement(999330..1000910)
                     /locus_tag="CD36_30010"
                     /inference="similar to AA sequence:UniProt:P38125"
                     /inference="similar to AA sequence:UniProt:Q5A6K1"
                     /note="Similar to S. cerevisiae DTR1; dityrosine
                     transporter, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="Major Facilitator Superfamily (MFS) transporter,
                     putative"
                     /protein_id="XP_002422022.1"
                     /db_xref="GeneID:8050137"
                     /db_xref="GOA:B9WLR1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WLR1"
                     /translation="MLNIVTLGLKFYFFRFVDCFPFLTNSVTKQEIMSKKEQPKQNEI
                     ETDNKQSSTDLNNGKSVSDSEKQNDLENQTSQEKPYCALSLKRKTIIIGIVTIAGCLG
                     PISGNIYIPILPQLENEFHVSAQVINGTVSAFMLVFAIAPLLWASWADYGGRKTLYLI
                     PLVFFVLANILLAATPANIVGLYILRVLQAFGASSVISVGAGTVADIIEPKHRAKAIS
                     VFMWGPQLGPVLGPVLSIIASKGQWRWIFGFLAFFGFAVYLMILFFLPETLRYLVGNC
                     SCYKDTSIYVKPHLRQKKIVDGYPVPPKPSFKSYWILIKFKPVLLCSINSGLLFATFY
                     GLMVTFAHILKSKYSFTDAQISASYLCPGISLIVGSTIGGWASDKMRAEIIKHNPDKY
                     VPEYRFSLQILGLVISITGVIGYGWTVHKQTNVVAVFIFTFLGGFGMTWVFVANTTYL
                     TECTTGQPATNVAIGNFARNISATICTAIIDPLISAMGFGWCLTGLGLTNILGIFFVV
                     ILLKWGPGWRRQFLNTST"
     gene            complement(<1001340..>1002773)
                     /gene="DIT2"
                     /locus_tag="CD36_30030"
                     /db_xref="GeneID:8050138"
     mRNA            complement(<1001340..>1002773)
                     /gene="DIT2"
                     /locus_tag="CD36_30030"
                     /product="cytochrome p450-Dit2 homologue, putative"
                     /transcript_id="XM_002421978.1"
                     /db_xref="GeneID:8050138"
     CDS             complement(1001340..1002773)
                     /gene="DIT2"
                     /locus_tag="CD36_30030"
                     /EC_number="1.14.14.-"
                     /inference="similar to AA sequence:UniProt:P21595"
                     /inference="similar to AA sequence:UniProt:Q0P7I4"
                     /inference="similar to AA sequence:UniProt:Q5A6K0"
                     /note="DIT1 and DIT2 contribute to virulence of C.
                     albicans; dityrosine synthesis cytochrome P450, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="cytochrome p450-Dit2 homologue, putative"
                     /protein_id="XP_002422023.1"
                     /db_xref="GeneID:8050138"
                     /db_xref="GOA:B9WLR2"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="UniProtKB/TrEMBL:B9WLR2"
                     /translation="MLQLLKYIFIGGFTYLLYLILEIVFPPFNFPRNIPTIPFYVSFL
                     GACTSLDQEDIYKLYLREKLEKYGAVKMYFASRWNILITKPDFLLEMFKNEDVFAKSG
                     NHVKIPNSVLATYTGDNIISAHGELWKLYRDVVAQSIQFPDLKPIFKNTHKLLRFINN
                     EMGSANQTTISVTDILQKYSLANVCESVLGVNFNVLDDKQSLMHEKIKYVKSQIFNPI
                     FLNFPYFDNFPIPSRLKARREVIGFRKWYGQSLVEKYNLQLPNSAATKLVDSLIKEKL
                     TEKQFLDNAIILMIAGHENPLLLMLSLLYVVSKYPQVQELIRNETEPTKPYFHSVIYE
                     TLRMYPPLGLIINRCTTRITKLGNIVIPKNVYCGYNNFGTGRDRNVWGSDADTFKPER
                     WGVEIDEINKKFTLAKRSAELPAFHGRKRACLGEKYALFEVKQFLLAILGDYKVSLDP
                     TWKEQLTAAGPISPLQLKIKFEKLTVS"
     gene            <1003518..>1005041
                     /locus_tag="CD36_30040"
                     /db_xref="GeneID:8049684"
     mRNA            <1003518..>1005041
                     /locus_tag="CD36_30040"
                     /product="spore wall maturation protein, putative"
                     /transcript_id="XM_002421979.1"
                     /db_xref="GeneID:8049684"
     CDS             1003518..1005041
                     /locus_tag="CD36_30040"
                     /inference="similar to AA sequence:UniProt:P21623"
                     /inference="similar to AA sequence:UniProt:Q59KH8"
                     /note="Similar to S. cerevisiae DIT1;
                     DIT1 and DIT2 contribute to virulence of C. albicans"
                     /codon_start=1
                     /transl_table=12
                     /product="spore wall maturation protein, putative"
                     /protein_id="XP_002422024.1"
                     /db_xref="GeneID:8049684"
                     /db_xref="InterPro:IPR007817"
                     /db_xref="UniProtKB/TrEMBL:B9WLR3"
                     /translation="MKSSSTLSLNSNTSSNTTVDTDSFEQKQQQILKQDPDTIYECIR
                     LIYTRNSSGFLSYRCYNSFEVENIFNVIPKNEINRIYFQNGLTQLKIDDECYFWEKQV
                     EPEIWQGLITIQFNVTDFDYWFINLLATSARVYFQKGKSINDYDVYTKMVANTFANEL
                     KHTVENDQWESVGEAFFSESINFFTSRWQPLEAVLPAFPCKSSNIEKVAGDMPDKGEE
                     LALSRLIQFANSIAKIYPPGIIIWIVSDGHVFSDCIGVDDFKVNRYFQGLQSLYQGLK
                     PKDSNPIRFCSLPEIFKLGSSGFNVSWVDNVTLGHHLHTEIDEQSEFCRKILVSSCDT
                     DCGKLRQDITTTGHPRLSLFRGFSKFMTEDLALHPTTSHMTRKKFKKIVAKIAFEMIK
                     RNDAYSNLVELMFPFHLRFSIHAHCNSGPKFGISLLSKIGENQCRPINTIQDHKEPRN
                     TDLLHIPTPWHNSVVKIDNCDIYFIIKSNKVEEEIRKGNGSGGWDANNLHYIFFSNE"
     gene            <1005196..>1005597
                     /locus_tag="CD36_30060"
                     /db_xref="GeneID:8050139"
     mRNA            <1005196..>1005597
                     /locus_tag="CD36_30060"
                     /product="tubulin-folding cofactor A, putative"
                     /transcript_id="XM_002421980.1"
                     /db_xref="GeneID:8050139"
     CDS             1005196..1005597
                     /locus_tag="CD36_30060"
                     /inference="similar to AA sequence:UniProt:P48606"
                     /inference="similar to AA sequence:UniProt:Q6FWU3"
                     /note="Similar to S. cerevisiae RBL2; tubulin-specific
                     chaperone A, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="tubulin-folding cofactor A, putative"
                     /protein_id="XP_002422025.1"
                     /db_xref="GeneID:8050139"
                     /db_xref="GOA:B9WLR4"
                     /db_xref="InterPro:IPR004226"
                     /db_xref="UniProtKB/TrEMBL:B9WLR4"
                     /translation="MEKKRRKIKTTNKKKKFRDLGNLFTPDQVYNNYLPVIIMGPSPL
                     QIKVNALKRLIKEEKLCKQEVAEQEQHVNQMKANNADEYELKKQIQVLEESQRMVPEV
                     TKKITQYRQALREFLDSYKGDEDVTEAKELL"
     gene            complement(<1005756..>1007377)
                     /locus_tag="CD36_30070"
                     /db_xref="GeneID:8050140"
     mRNA            complement(join(<1005756..1007213,1007333..>1007377))
                     /locus_tag="CD36_30070"
                     /product="UDP-glucose pyrophosphorylase, putative"
                     /transcript_id="XM_002421981.1"
                     /db_xref="GeneID:8050140"
     CDS             complement(join(1005756..1007213,1007333..1007377))
                     /locus_tag="CD36_30070"
                     /EC_number="2.7.7.9"
                     /inference="similar to AA sequence:UniProt:P32861"
                     /inference="similar to AA sequence:UniProt:Q59KI0"
                     /note="Similar to S. cerevisiae UGP1;
                     spliced gene; UTP-glucose-1-phosphate uridylyltransferase,
                     putative"
                     /codon_start=1
                     /transl_table=12
                     /product="UDP-glucose pyrophosphorylase, putative"
                     /protein_id="XP_002422026.1"
                     /db_xref="GeneID:8050140"
                     /db_xref="GOA:B9WLR5"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR006141"
                     /db_xref="InterPro:IPR016267"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:B9WLR5"
                     /translation="MATTGKRHAKSQSTYAFDNTATNVTASQMRNALNNLADTVENPE
                     QKNRFENEMDNFFSLFRRYLTEKASGSTLDWDKIRSPSSDEVVEYGDLNSSNTSANLS
                     KLAVLKLNGGLGTSMGCVGPKSVIEVRDGNNFLDLAVRQIEHLNRKYDADVPLLLMNS
                     FNTDADTAKIIKKYQSHRIRVKTFNQSRFPRIYKDSLLPVPESFDDSLEAWYPPGHGD
                     LFEALVQSGELDALLAQGREILFVSNGDNLGATVDSKILDHMIETGAEYIMELTPKTR
                     ADVKGGTLINYQGEVRLLEIAQVPKEHVEEFKSIKKFKYFNTNNLWINLRAIKKLVEA
                     NAIEVEIIPNQKTISHGKSDINVLQLETAVGAAIRHFKGAHGVVVPRSRFLPVKTCSD
                     LLLVKSDLFYLEHGALVLDPTRDGFSNPLIKLGSHFKKVSGFQSRIPYIPKILELDHL
                     TITGNVTIGKGVQLKGTVIIVCNDGDKIDIPNGAILENVVVTGNLTILEH"
     gene            <1009771..>1010268
                     /locus_tag="CD36_30080"
                     /db_xref="GeneID:8050141"
     mRNA            <1009771..>1010268
                     /locus_tag="CD36_30080"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421982.1"
                     /db_xref="GeneID:8050141"
     CDS             1009771..1010268
                     /locus_tag="CD36_30080"
                     /inference="similar to AA sequence:UniProt:Q59KI3"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422027.1"
                     /db_xref="GeneID:8050141"
                     /db_xref="UniProtKB/TrEMBL:B9WLR6"
                     /translation="MIEREKKKKEITGLFNSHKNQSTLSSSYSNLSNLNNISMESNNN
                     KLKKKLINIAYNEEDEGEEEEEEFKIKSVYDLKKQERNKLDNTTNDTERSDNTNLEHK
                     DEIGHQQEQEEEEEEEEEDDKEESPPKIINRDPSIDSDYDSDLDLNNSESISINQLKT
                     HKYLG"
     gene            complement(<1010422..>1014522)
                     /locus_tag="CD36_30090"
                     /db_xref="GeneID:8050142"
     mRNA            complement(<1010422..>1014522)
                     /locus_tag="CD36_30090"
                     /product="DNA helicase, putative"
                     /transcript_id="XM_002421983.1"
                     /db_xref="GeneID:8050142"
     CDS             complement(1010422..1014522)
                     /locus_tag="CD36_30090"
                     /EC_number="3.6.1.-"
                     /inference="similar to AA sequence:UniProt:P53115"
                     /inference="similar to AA sequence:UniProt:Q59KI4"
                     /note="Similar to S. cerevisiae INO80"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA helicase, putative"
                     /protein_id="XP_002422028.1"
                     /db_xref="GeneID:8050142"
                     /db_xref="GOA:B9WLR7"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR020838"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B9WLR7"
                     /translation="MNISSMLSTDNNASLKELTTTDQQQHQQQLQMEQSSINGNGQTS
                     SPSVNNVQENHISELHSSNQRPPSILPVGATLDHATTSTANHQPVNSSPLKHSVDENS
                     NSTTVSSLQKDSNSIIASILPESYQFDNSYTPTIDQKYKSLFESNINVINQLDQYQQI
                     GHHLKLLKFDEVKLNNYLINTGQFASNYIDRVVAEDISSRNNKISETNKNKELIAIDY
                     SKPLHHNSTRGKEFKWGSTRKIHKVEHKSRRRKPAAAAAAATTDDSNKATTTNGTKDH
                     SASVSAVTATNGSDTPDRRHHRQTSKPATPVLIKPKTESGHGSSEVQPRRSSRPKVKR
                     KAFEDEIDTPEKHSSSTSQVKKSHESTGGDHKRAKIEDKQGEQKQEQEEEEEKSKSTA
                     LSEAAAAGMTAKEFKAFMRQYDNTYIAIWKDLSRKDGPKGSRSMQQATQGRLINLRKT
                     AMLAAREAKRWQLKNTKNQKDLVTKARRAMREMFNFWKRNERLERDLKKKHEKELLDK
                     AKKEEEEREAKRQSRKLNFLITQTELYSHFIGKKIKTDELEGTNTDGNLKSQNKDHLD
                     KYADVDGSATHDINAVDFDNDDEEALHRMAAQNAQNALIEVQNKAKQFDNSEESFKNP
                     DTNGEEMNFQNPTLLGDITIPQPNMLKCTLKEYQLKGLNWLANLYEQGINGILADEMG
                     LGKTVQSISVLAYLAETYNMWGPFLVVTPASTLHNWQQEITKFVPEFKVLPYWGNAKD
                     RKILRKFWDRKSLRYDKDSPFHVLVTSYQLIVADIAYFQKMKWQYMILDEAQAIKSSS
                     SSRWKSLLNLTCRNRLLLTGTPIQNSMQELWALLHFIMPSIFDSHDEFSDWFAKDIES
                     HAQSNTSLDEQQLRRLHMILKPFMLRRIKKNVQSELGDKVEIDVYCDLTTRQKKLYQQ
                     LRSQISMSDTDLLELESNSTSSDSSLANLVMQFRKVCNHPDLFERADVNSPFSFGKFA
                     ETGSFLRETNELDVNYSTENIVEYDLPRLIYDELLTPNYGKSTRDAIYSKFSIYNPEN
                     TNDLGWLKGINVSPNELKRCAQKDIFVRAIDMQNKSTETMKLERINYLYGSDYIPENK
                     KLLITERTSDSFISNSSVFPDLVSVQEKVGQDMYLNKLEPAVTPIAAAPPITVNCSSM
                     NFTNRMNNTLFDPIIRSSLIPLSLSTELKLMKDQVPLEQYPKSNMLPTPIFDYSNIRM
                     PSMDRFIAESGKLAKLDELLVDLKQGGHRILIYFQMTRMMQIFEEYLAYKSYKYIRLD
                     GSTTIESRREMVQAWQTNPEIFIFMLSTRAGGLGLNLTSADTVIFYDSDWNPTIDSQA
                     MDRAHRIGQTKQVKVFRLVTRNTIEQKILERAKEKEEIQKLVVGNM"
     gene            <1015775..>1016107
                     /locus_tag="CD36_30100"
                     /db_xref="GeneID:8050143"
     mRNA            <1015775..>1016107
                     /locus_tag="CD36_30100"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421984.1"
                     /db_xref="GeneID:8050143"
     CDS             1015775..1016107
                     /locus_tag="CD36_30100"
                     /inference="similar to AA sequence:UniProt:P47131"
                     /inference="similar to AA sequence:UniProt:Q59MZ4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422029.1"
                     /db_xref="GeneID:8050143"
                     /db_xref="GOA:B9WLR8"
                     /db_xref="InterPro:IPR005349"
                     /db_xref="UniProtKB/TrEMBL:B9WLR8"
                     /translation="MGLDHPAFTLSGLCAIGGIMGYVRKGSFPSLVAGITFSALYGGA
                     GYLLKQNADYGLELALGTSSILLIAGLARSIPTSFSKPIPLVLLVLGGASTAYYAKKY
                     NEFYPLFS"
     gene            complement(<1016292..>1020359)
                     /locus_tag="CD36_30110"
                     /db_xref="GeneID:8050144"
     mRNA            complement(<1016292..>1020359)
                     /locus_tag="CD36_30110"
                     /product="formylglycinamide ribotide amidotransferase,
                     putative"
                     /transcript_id="XM_002421985.1"
                     /db_xref="GeneID:8050144"
     CDS             complement(1016292..1020359)
                     /locus_tag="CD36_30110"
                     /EC_number="6.3.5.3"
                     /inference="similar to AA sequence:UniProt:P38972"
                     /inference="similar to AA sequence:UniProt:Q59MZ5"
                     /note="Similar to S. cerevisiae ADE6; formylglycinamide
                     ribotide synthetase, putative;
                     phosphoribosylformylglycinamidine synthase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="formylglycinamide ribotide amidotransferase,
                     putative"
                     /protein_id="XP_002422030.1"
                     /db_xref="GeneID:8050144"
                     /db_xref="GOA:B9WLR9"
                     /db_xref="InterPro:IPR000728"
                     /db_xref="InterPro:IPR010073"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="InterPro:IPR016188"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:B9WLR9"
                     /translation="MSKFLILSGPKALSDFRINNLIQDIEKKIGQSDIIDKVIGSFTH
                     YISLQQQQNDLTDKQLELLKILLTYDNPLEQQGPNSSLNEILIKNSTTIDGKSIELPN
                     DTYLIQILPRSGTISPWSSKATDIAQICGLKNQIERIERGLSLLIKTKNGFKLDKNIN
                     DSYPIENLLTSVFDRMTQIIYFGNNVPQYNDLFAHHSPKPLITIDIISDSENLIKANK
                     QLGLALDQGEIDYLINAFKEIIGRNPTDVELFMFAQVNSEHCRHKIFNADWTIDGIPQ
                     KLSLFKMIKNTHEKTPQYTISAYSDNAAVFEGHEGYIWTPDFKTKQWKSIKEKVQTLV
                     KVETHNHPTAVSPFAGAATGSGGEIRDEGAVGRGSKSKAGLSGFSVADLNIPTLLQPW
                     ERNVGKPNHIASSLDIMLEAPIGSAAFNNEFGRPAINGYFRTLTTEVENCHGKKEIRG
                     FHKPIMLAGGMGAIRPDLALKDTKITPGAKLIVLGGQSMLIGLGGGAASSISSGEGSA
                     DLDFASVQRGNPEIQRRAQEVINTCVSLGKLGNPIQSIHDVGAGGLSNALPELVHDND
                     LGAKFELRSILSLEPGMSPMEIWCNESQERYVLGVAPENLDLFAEICQRERAPFAVVG
                     VATEEQRLILTDSLLNSTPIDLEMSVLFGKPPKMSRTAFTQDLKLTPFETSSDSTITL
                     DIGESIDRVLQLPAVGSKNFLITIGDRFITGLVDRDQMVGPWQVPVADVGVTATSLGD
                     TILTTGEAMAMGEKPTLALISASASAKMCVAESLLNIFAADIPSLDHVKLSANWMSAA
                     SHDGEGAKLYEAVQAIGMDLCPDLGISIPVGKDSMSMKMKWDDKEVIAPLALTITSFA
                     PVDNTSNTWTPQLQNVANEETMLVLIDLAGSDEIKKSLGGSALAQVYQQVGNSAPTVH
                     SHKILKSFLETLVVLHKQFDVLAYHDRSEGGLITTVLEMAFAGRCGLDLNVNGKQDVF
                     TELFNEELGAVFQIKSKDYTKFQQIFLDNGINENFIQIIGKPKFDSKQIIDISFNGTP
                     IYSSTRSHLQQLWSNTSYHIQKLRDNPITSTQEYDAIKDDNDPGISYQLTYSPNDFKK
                     YSKQPKVAILREQGVNSQQEMAWCFQQAGFDVYDVTMSDILEGRTTLDEFVGIAACGG
                     FSYGDVLGAGAGWAKSVLFHDKARAEFKKFFQDRTDTFAFGACNGCQFLSRIAELIPG
                     TENWPTFEKNLSEQYEARFVMVEIDSQSKNNSIFLQNMKGSKLPIAVAHGEGRAQFKT
                     SQQQQDFQLDVIHYVDNYGKITENYPFNPNGSPNGIAGITNSNGRVLAMMPHPERVCR
                     KESNSWYPIEQGKQWGQYGPWIELFKSAREWVGDN"
     gene            <1020849..>1021139
                     /locus_tag="CD36_30120"
                     /db_xref="GeneID:8050145"
     mRNA            <1020849..>1021139
                     /locus_tag="CD36_30120"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421986.1"
                     /db_xref="GeneID:8050145"
     CDS             1020849..1021139
                     /locus_tag="CD36_30120"
                     /inference="similar to AA sequence:UniProt:Q3E747"
                     /inference="similar to AA sequence:UniProt:Q6BGY2"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422031.1"
                     /db_xref="GeneID:8050145"
                     /db_xref="InterPro:IPR019034"
                     /db_xref="UniProtKB/TrEMBL:B9WLS0"
                     /translation="MVQGNLKLKSKQSNRITKKQQNPKKAAPKIIKPKKTIAKESLKL
                     TKIHSGQLMKSTEKLIASRVGHLELIKGSRRQVEKENKQASNNNNNNNNKKK"
     gene            complement(<1021532..>1023253)
                     /locus_tag="CD36_30130"
                     /db_xref="GeneID:8050146"
     mRNA            complement(<1021532..>1023253)
                     /locus_tag="CD36_30130"
                     /product="uncharacterized mitochondrial protein, putative"
                     /transcript_id="XM_002421987.1"
                     /db_xref="GeneID:8050146"
     CDS             complement(1021532..1023253)
                     /locus_tag="CD36_30130"
                     /inference="similar to AA sequence:UniProt:Q04991"
                     /inference="similar to AA sequence:UniProt:Q59MZ6"
                     /note="Similar to S. cerevisiae FMP42"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized mitochondrial protein, putative"
                     /protein_id="XP_002422032.1"
                     /db_xref="GeneID:8050146"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:B9WLS1"
                     /translation="MKSQLPPLTTRIIEITCAIVWCLLAAGPVFGFAAIKPIFISQHI
                     YENKCDLSTTTTTTTSTTTSSNEAKCVEQDLSLNFLFTIACMVTNISALPVGSILDSY
                     GPKITGIIGSILLMLGSLSLKFASNFDNNNYYHNYQLINFFDGYLIGYTLLALAGPFV
                     FISCFQLANCFPQNSGLILALLTGAFDSSSALFLFYRLYYNNISSISINKFFSLYLIV
                     PIFIFLCQIFIMPKDSYKTVGTLAKIAETGIDETGKPLNNNLLTLEDRERRNLDSAII
                     DVTEYYQPTISETTSLLIMRRASTSASTPTPTPTSAPTTSRRESTASRISYNSIKSHY
                     EQEADSKLIYSSGGVFGILHGYSIIEQLNSGWFILMTLFTTIQMLRINYFVATIKSQE
                     LYLYNGNEELATIINHFFDLALPLGGLFSIPFIGLILDNLTTLTILYILTGLSLFIGI
                     AGLISSWLPATYSGIIVLVIYRPFYYTAVSDFCAKVFGYDNFGTIYGTIIAFSGICNI
                     LQQVMDKATHKYFNMNPSPINTLLVILTAIFGFALIIYVKSKEAHIKRKNLEMEAQDA
                     SNRPVPV"
     gene            complement(<1023833..>1024420)
                     /locus_tag="CD36_30140"
                     /db_xref="GeneID:8050147"
     mRNA            complement(<1023833..>1024420)
                     /locus_tag="CD36_30140"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421988.1"
                     /db_xref="GeneID:8050147"
     CDS             complement(1023833..1024420)
                     /locus_tag="CD36_30140"
                     /inference="similar to AA sequence:UniProt:Q59MZ7"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422033.1"
                     /db_xref="GeneID:8050147"
                     /db_xref="UniProtKB/TrEMBL:B9WLS2"
                     /translation="MFGNQITERKGLDLTIPYSSTTTTTTYNNNNKKSIFKLLFIGLI
                     IISSGIFLYSSTTTLSSYYPYKQQQQQSTNSISNIPAKIDFDAPLSEPTNIVEQQINK
                     RYVESIDLEYIIKRDDSNNNNKDDDNNNNNNNNKDDSKKKSKPIYDQPGMRFVFALFA
                     FVILNMIAICIHHIYMKITNSVNAYKTVNDDISPF"
     gene            <1025007..>1025453
                     /locus_tag="CD36_30150"
                     /db_xref="GeneID:8050148"
     mRNA            <1025007..>1025453
                     /locus_tag="CD36_30150"
                     /product="DNA-directed RNA polymerase subunit common to I,
                     II, and III, putative"
                     /transcript_id="XM_002421989.1"
                     /db_xref="GeneID:8050148"
     CDS             1025007..1025453
                     /locus_tag="CD36_30150"
                     /EC_number="2.7.7.6"
                     /inference="similar to AA sequence:UniProt:P20436"
                     /inference="similar to AA sequence:UniProt:Q59MZ8"
                     /note="Similar to S. cerevisiae RPB8"
                     /codon_start=1
                     /transl_table=12
                     /product="DNA-directed RNA polymerase subunit common to I,
                     II, and III, putative"
                     /protein_id="XP_002422034.1"
                     /db_xref="GeneID:8050148"
                     /db_xref="GOA:B9WLS3"
                     /db_xref="InterPro:IPR005570"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:B9WLS3"
                     /translation="MSGILFEDMFIVDSTDPGRYNKVSRITGHSSTSKDITITLDINK
                     ELFPVQNHDSLTITLASSLGNESSMITSNGSWRPPKFDDKSLADDYDYVMYGTIYKFE
                     ENTDNDKMAVYISFGGLLMRLEGGYRSLSNLKQENAYILIRHYKDN"
     gene            <1026010..>1026654
                     /locus_tag="CD36_30160"
                     /db_xref="GeneID:8050149"
     mRNA            join(<1026010..1026028,1026161..>1026654)
                     /locus_tag="CD36_30160"
                     /product="hypothetical protein"
                     /transcript_id="XM_002421990.1"
                     /db_xref="GeneID:8050149"
     CDS             join(1026010..1026028,1026161..1026654)
                     /locus_tag="CD36_30160"
                     /note="orthologue present in CGD, but no Fasta/Blast hit
                     to any C. albicans gene;
                     spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="hypothetical protein"
                     /protein_id="XP_002422035.1"
                     /db_xref="GeneID:8050149"
                     /db_xref="UniProtKB/TrEMBL:B9WLS4"
                     /translation="MIDTDKSDPILKQIPLIKNPTFQPPRPITLSNNYNKLIPTLSTT
                     VIPPKLNISDTEIDSWLNEIRSLRQQIINKQINSNSHSHSNHNNGQSDKYEKWIREQS
                     NKIAPGFNYTVMQPQKPIRIQDRKLISKEEVEAEEAAEEVESDNDNDNEFGYDEMNEL
                     DRIFGKTKLN"
     gene            <1027429..>1029681
                     /locus_tag="CD36_30170"
                     /db_xref="GeneID:8050150"
     mRNA            <1027429..>1029681
                     /locus_tag="CD36_30170"
                     /product="alpha-1,3-mannosyltransferase, putative"
                     /transcript_id="XM_002421991.1"
                     /db_xref="GeneID:8050150"
     CDS             1027429..1029681
                     /locus_tag="CD36_30170"
                     /EC_number="2.4.1.-"
                     /inference="similar to AA sequence:UniProt:P40549"
                     /inference="similar to AA sequence:UniProt:Q59MZ9"
                     /note="Similar to S. cerevisiae MNT3"
                     /codon_start=1
                     /transl_table=12
                     /product="alpha-1,3-mannosyltransferase, putative"
                     /protein_id="XP_002422036.1"
                     /db_xref="GeneID:8050150"
                     /db_xref="GOA:B9WLS5"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="UniProtKB/TrEMBL:B9WLS5"
                     /translation="MKFHIKKYVIVTSILLSVLLLFKRQFLPFQSNPKPIDNNNVPIS
                     FDLIKQRNKFENPIYTKWKSSTNSLSLDPDLTIRCNDYFQQLNKENFQIDYNNNNDNN
                     DNNNDDKKIDPFIYKRKKWLKERIRNLRKQYKFDKNKDKYDFELMAQMEFINVSKKQS
                     NYEWNIYQHFSHSRIFGKCFATATTTATAITNDNDNSNSKLNSNSKLKQELCKSFVKK
                     LYPWMSGNLPIFEKNGKKLEKLSIELDESNCIINQINKNSKGKGIIIPLIQNDNNNNN
                     NSNDDNKSINDDQQIENIGRLIKVLRALNNTLPIEIIYMELTLNHKQKLNDIATKFDS
                     QSNFIKQDITFVDISPTITITTTTTTTNTTISHSLMIALSSIFTSFQEFIILNQHIIP
                     LIDLNEFFNNERYKLNGNYFFKSPSKLKNRIIKFNIGFHEITSFMKNQLTPNKYDHQY
                     FNLNIGFDSSNNGNNNNDGNVVIDRFFNYQFNNLIDSSLIIFNKWKTLSGLLLSCNFE
                     FLYYKDLFNIRFLPTTINNNNNENSLDYLWLGQYISGINDQIIFNYNYAIIAGILTPS
                     QNLPKDLIESLEICSSSFGQLSDNNDISLLYITSHQLQNWLINQKKFLTLLKNKYEFK
                     FKELINNIFDPSNQLIKTSMERINSTIFEKLKSQPLIIENIIRPPTLIEPINVLGYNE
                     PNQAWVHQEEFDKIQNNNGHGHSYGHPYYCVYSSIGDPLKEGIRGLSINVEKKLQEKY
                     KKLFEIWLQN"
     mobile_element  complement(1029999..1030268)
                     /mobile_element_type="retrotransposon:solo LTR, nu J"
     gene            <1030598..>1031362
                     /locus_tag="CD36_30190"
                     /db_xref="GeneID:8050151"
     mRNA            <1030598..>1031362
                     /locus_tag="CD36_30190"
                     /product="40S ribosomal protein S3"
                     /transcript_id="XM_002421992.1"
                     /db_xref="GeneID:8050151"
     CDS             1030598..1031362
                     /locus_tag="CD36_30190"
                     /inference="similar to AA sequence:UniProt:P05750"
                     /inference="similar to AA sequence:UniProt:Q59N00"
                     /note="Similar to S. cerevisiae RPS3"
                     /codon_start=1
                     /transl_table=12
                     /product="40S ribosomal protein S3"
                     /protein_id="XP_002422037.1"
                     /db_xref="GeneID:8050151"
                     /db_xref="GOA:B9WLS6"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR005703"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="UniProtKB/TrEMBL:B9WLS6"
                     /translation="MVNAILSKKKKLVADGVFYAELNEFFTRELAEQGYAGVEVRKTP
                     SKLEVIVKASNTQGVLGEQGRRIHELTSLIVKRFKLSPEGIAIYAERVEERGLSAAVQ
                     AEALKAKLLSGLPIRRAAYGVLRFAMGAGAKGVEVVISGKLRAARAKSQKYADGFMIH
                     SGQPTRDFIDIAIRHVLMRQGVLGIKVKIMKDPAANRFGPKALPDAVKIAEAKDEDEV
                     IPAPTVKSYKQTTETTVEETEAPIETETEAEVEVTA"
     gene            <1032995..>1033300
                     /locus_tag="CD36_30200"
                     /db_xref="GeneID:8050152"
     mRNA            <1032995..>1033300
                     /locus_tag="CD36_30200"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421993.1"
                     /db_xref="GeneID:8050152"
     CDS             1032995..1033300
                     /locus_tag="CD36_30200"
                     /inference="similar to AA sequence:UniProt:Q3E752"
                     /inference="similar to AA sequence:UniProt:Q59N01"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422038.1"
                     /db_xref="GeneID:8050152"
                     /db_xref="UniProtKB/TrEMBL:B9WLS7"
                     /translation="MEQQQQPLQLQFLQLSTEISQPFIIPNISPISSPKLLAKSSIEE
                     NKIGKLPKMGSNVLSPLVVIAEEVEEQNQNQNQGQEELIIDDGELISTRKLSILDLN"
     gene            complement(<1034314..>1036908)
                     /locus_tag="CD36_30210"
                     /db_xref="GeneID:8050153"
     mRNA            complement(<1034314..>1036908)
                     /locus_tag="CD36_30210"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421994.1"
                     /db_xref="GeneID:8050153"
     CDS             complement(1034314..1036908)
                     /locus_tag="CD36_30210"
                     /inference="similar to AA sequence:UniProt:Q59N02"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422039.1"
                     /db_xref="GeneID:8050153"
                     /db_xref="GOA:B9WLS8"
                     /db_xref="InterPro:IPR026859"
                     /db_xref="UniProtKB/TrEMBL:B9WLS8"
                     /translation="MNFDRFNPLSNYLYHPNNNSPLRSTTRQGSEVPIQSIHTEVVDD
                     DHDVGGEMSDWGIEESTQTKVNNNNNNSNSNNNLSGGNGLLSSPSIKSNSTTTTSNQT
                     NYNKNAIHNQLIDDFFPLPPAPPQPSYIHQQHQQHQQHHQQPQQQQQNHYINHPLRKL
                     STTSSQPITPKETIEFDFKYYYDSLINNQISFNTENFSKFIKRYLSLENKLNEFWEKF
                     QYNLVLSNNLLKDSMILSIKNDINNGKDSKDNNNNSKDNNSNNNLSENNDHSINNNKF
                     KNDDDNYDDNYDYDYDSFIYSINNDGTILKILNRQYELNYNYNYNNMKIIILIILMII
                     YLLKQQQLLKYNSNNNSNGYGYGYSHGYGHGHGLSMKIQFKLFKIIIYISMKLIKVKK
                     FKLIIESNQILLNLQKFLIMNYKINQKLINLKEYGEQFQGNNNIDHIDHVDHNEEFEK
                     LKQYLYHILSLLNLNLQNSIIKLLPFMNGELLEQYCLMNNIKLDILNQENESFTTSHN
                     GYGKNLDFKSKSKSLSSSSLSLENINYYFNKFDNLRKLFICQLLIINHHQPCKFNFFL
                     YKLMDQFNINDKNFNLINFNSSKLKIIHNLLIDHNLILSNINGLFEKFEFVNQLKLNN
                     KNKNKNKNKTTTTTTTTVVTDTTTNVLNNSFMSKPTSSLLLPPPPSSSSSSSSSIHLD
                     DLINKLSNLTINLKYFQKYNNSIKNFHNIDEHQDKLLIFNQFKQDLNNIKSLYKLCLN
                     DLYQESSNNSQQYSIPPQLQVQPQSPTTTSTTTTSTTTISSPTNSNGNRFSLKEFSII
                     KKRSSITTPTTNTNTNTSTSNGSGNGNGNGNINHINSKRFSGAFTVIQPNRFSSITNI
                     SEIEDFNI"
     gene            complement(<1038546..>1040531)
                     /locus_tag="CD36_30220"
                     /db_xref="GeneID:8050154"
     mRNA            complement(join(<1038546..1039991,1040070..>1040531))
                     /locus_tag="CD36_30220"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421995.1"
                     /db_xref="GeneID:8050154"
     CDS             complement(join(1038546..1039991,1040070..1040531))
                     /locus_tag="CD36_30220"
                     /inference="similar to AA sequence:UniProt:Q59N20"
                     /note="spliced gene"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422040.1"
                     /db_xref="GeneID:8050154"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="UniProtKB/TrEMBL:B9WLS9"
                     /translation="MSKQPSQQQQHYQHQQQRQQKNITNSSSPVSDKQSHDSQQLLLA
                     HLYNYFKTNGLEETAQTLLTECNNTIPKSTTTSYGYSLENSGLDYKNTFLDEWWGLLW
                     SIQSSINPNLNQLTNPSGILTPQQQMILQQRMFQQQQQIQQQQQQQQQQQQQMMQQQQ
                     QQQQQPINNFGPRQQQSGVPNNLSAISANQMRPPGSNNFQSNMSPSNEQLQSQARLQQ
                     LKFQFQQQQQQQQQQQQQQRQKKFQRQLSTSSQRSPIINNGQPQSQPLQQQQQQVQQQ
                     VQQRQDQRPASAPQTQPTSGNNNTSGGGGGVSPKLHRQSVDDYQMNLLQMENQNNLQR
                     QKYLNNQSQQQSQQQQQSQQQSSSQKSSPFQPPAQQPKNVTTTNTTTTTTNRGQKSTR
                     KQQQKNSRRQSTQQQHQHQQQSQQQLSSSQSFTTSNNSFDVSPQIQNQGMLSTKDQQH
                     HQHHQQQQPQQQQSLPLNNNNHNNNKQDVVNGVFDDAFFSGNLLLDDFNEFANSNMDD
                     NNNNSINNSTTITTTNNNNNNLQFNTISSERMLFTMPPNQNQFSQQPGGGGGMSQPNF
                     FEGIELSDGNSGNGNNGNNDNNGNNGNNVNNGDHNDHNDHNDNDDDDDDDAPIITTDW
                     LSSMGSGPGYE"
     gene            complement(<1041653..>1043737)
                     /locus_tag="CD36_30250"
                     /db_xref="GeneID:8050155"
     mRNA            complement(<1041653..>1043737)
                     /locus_tag="CD36_30250"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002421996.1"
                     /db_xref="GeneID:8050155"
     CDS             complement(1041653..1043737)
                     /locus_tag="CD36_30250"
                     /inference="similar to AA sequence:UniProt:Q59N05"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422041.1"
                     /db_xref="GeneID:8050155"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:B9WLT0"
                     /translation="MAMTSIIDNNYNQFNIRYDKNTIHPYQSLITKLPPYIIQQILQY
                     VNQFDLINLSLTCSRLYLLSIEKLYQRITIILEAELPIKYQGNTYNYIIDNGMKFMDS
                     SLIFKLKNLQKFIKTIINNQSILQLIKYFIFDKSYDISNNNDNNDNDQQLMLNSIQCQ
                     IMKIFENSYNLNFLHISFIDFTNDGINKLTNFLSIKNIRQKMFKLLITNLNQLNQPFI
                     PANLTNLFLLLNDDEIPKIMDLSIYPFDCFNSLFTLTCSTTNQLGLSILKNLKLSSRN
                     MKLKLKGLTIFHRHKNDSIVTTIGEKEEEEEEDDITKLDFEIINQTIDLTYLSHLYLK
                     IDCNEHRDNLCNCYEIFFQKFSKFSNNNNGLPNLINFEIESYPNIEWLRPHQQMENIL
                     IPLSGFIKTLKNLLRLTIDFSTPGFKMFDNNLSLSNYMLNKLNEHLIQAFFFSFVIPK
                     TDQDNNIEKQTNQIPLLTNLKTLQLPDFFTSFIYYKPDFMESLLHTCKCWGCQLVLNK
                     LEQEFYNKLIDENLETNFYMTIGYILGKLQVDREVCIPIKEKTFNYNKYPINKGQPHT
                     LHNNFHIQNNNNNNNQNNTNNNEIINCNCQCNIINDPLGIDELNIDNLVTTYIIHQID
                     PIINYLNLIFINLNNLMIHGIYYEKKLSINNKMIPIYDNLNYPKSFLNQMKDNIDRGL
                     NPSGPFGKFRND"
     gene            complement(<1044690..>1046195)
                     /locus_tag="CD36_30260"
                     /db_xref="GeneID:8050156"
     mRNA            complement(<1044690..>1046195)
                     /locus_tag="CD36_30260"
                     /product="potassium-activated aldehyde dehydrogenase,
                     mitochondrial precursor, putative"
                     /transcript_id="XM_002421997.1"
                     /db_xref="GeneID:8050156"
     CDS             complement(1044690..1046195)
                     /locus_tag="CD36_30260"
                     /EC_number="1.2.1.3"
                     /inference="similar to AA sequence:UniProt:P46367"
                     /inference="similar to AA sequence:UniProt:Q59N06"
                     /note="Similar to S. cerevisiae ALD4"
                     /codon_start=1
                     /transl_table=12
                     /product="potassium-activated aldehyde dehydrogenase,
                     mitochondrial precursor, putative"
                     /protein_id="XP_002422042.1"
                     /db_xref="GeneID:8050156"
                     /db_xref="GOA:B9WLT1"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:B9WLT1"
                     /translation="MSIPLSIDVTLPDGKKFIQPTGLFINNEFIKSKSGKTLQSINPS
                     TSEINGEVYAADIEDIDYAVECAFKAFKSWKKFTGVERGQYLYKLADLVEQQRDLLGS
                     IEAWDSGKTKSTNANFDIDECIAVIRYAASWADKITGKVIQNDPKKFAYTIHEPWGVC
                     AQIVPWNYPLLMSMWKIPIAIAAGNTVILKTSEITPLSMLYFASLIKQVGFPPGVINI
                     VSGFGSTAGAALACHKKISKIAFTGSTATGKIIQKLAAENLKAVTLECGGKSPLIIRS
                     DADIDQAIKWSAIGIMSNQGQICTSTSRIYVHESIYNKFIENFINHVKLNYKQGDVFN
                     DEAIVGPQVSKLQYDKILNYIDIGKKEGAKCVLGGEKNIEGELSKGYFIKPTIFVDVK
                     PEMRIVNEEIFGPVVVVGKFSTDEEVINYANQTDYGLGAAIFTKDITAAHNMASDIEA
                     GMVWINSSNDSDYHIPFGGVKMSGVGRELGEYGLNMYTQAKAVHVNLGTRL"
     gene            <1047050..>1048174
                     /locus_tag="CD36_30270"
                     /db_xref="GeneID:8050157"
     mRNA            <1047050..>1048174
                     /locus_tag="CD36_30270"
                     /product="low specificity L-threonine aldolase, putative"
                     /transcript_id="XM_002421998.1"
                     /db_xref="GeneID:8050157"
     CDS             1047050..1048174
                     /locus_tag="CD36_30270"
                     /EC_number="4.1.2.5"
                     /inference="similar to AA sequence:UniProt:P37303"
                     /inference="similar to AA sequence:UniProt:Q59N07"
                     /note="Similar to S. cerevisiae GLY1"
                     /codon_start=1
                     /transl_table=12
                     /product="low specificity L-threonine aldolase, putative"
                     /protein_id="XP_002422043.1"
                     /db_xref="GeneID:8050157"
                     /db_xref="GOA:B9WLT2"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR023603"
                     /db_xref="UniProtKB/TrEMBL:B9WLT2"
                     /translation="MDLSIFDNQSPAHNDFRSDTFTTPTISMIQSLSQTTLGDAVYNE
                     DLKTIELENKVAQLTGKESGLFCVSGTLSNQIAIRTNLYQPPFSIMCDYRAHIYIHEA
                     GGLSTLSQAMIQPIIPKNGIYLTLKDDILPNFIIDDGEIHGAPTKLICLENTLHGMIF
                     PLNEIKKISKFCHKNQIKLHLDGARIWNASIETGISLKEYCSYFDSISLCLSKTLGAP
                     IGTILVSDKKFILKANHFKKQNGGGIRQSGLLASMAIIAINENFSKLKKTHDMAKELG
                     QLCHTKNIILEHPVQTNFVFIDLKANKINPKKLIEISNKYNIKIYSGRIAFHYQISQQ
                     SFENAKKVILEIIQYAKENPYEEEEEEEQTNFKFYTSENK"
     mobile_element  1048376..1049794
                     /note="missing most of ORF1 except extreme 5' end, and
                     front half of ORF2"
                     /mobile_element_type="LINE:RF, Zorro3"
     gene            <1049890..>1050897
                     /locus_tag="CD36_30280"
                     /db_xref="GeneID:8050158"
     mRNA            <1049890..>1050897
                     /locus_tag="CD36_30280"
                     /product="l-aminoadipate-semialdehyde
                     dehydrogenase-phosphopantetheiny transferase, putative"
                     /transcript_id="XM_002421999.1"
                     /db_xref="GeneID:8050158"
     CDS             1049890..1050897
                     /locus_tag="CD36_30280"
                     /EC_number="2.7.8.-"
                     /inference="similar to AA sequence:UniProt:P50113"
                     /inference="similar to AA sequence:UniProt:Q59N08"
                     /note="Similar to S. cerevisiae LYS5; phosphopantetheinyl
                     transferase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="l-aminoadipate-semialdehyde
                     dehydrogenase-phosphopantetheiny transferase, putative"
                     /protein_id="XP_002422044.1"
                     /db_xref="GeneID:8050158"
                     /db_xref="GOA:B9WLT3"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="UniProtKB/TrEMBL:B9WLT3"
                     /translation="MTLQDHLNDKSNIILFTTRLTKELIEFWNDDYNFECCLRLLNDL
                     SLQSKISSSTKITNKQRFKQLLSNLFIRYIFNSILFESESTDLNLFNKIEFDYNEYGK
                     PILSSSSLLSSSSLLNNFQFNISNSNDIIALVIEFSSIDPIGIDLSHSIQKNISNTKY
                     LEQFKPIFDDIYELPQINNYFKFNHFWTLKESFTKFIGSGLNIELSDFYFIVDYNNNN
                     NNDEFSNNNRNFQIKKRNITIDNQEEEEEEGKDHNFINYSLNWFDKIFINIDKLGQKN
                     PFINNLNKKKKIYCRSSILDNGNEFKLPVIITIINQNKNKSIKPIELRFDKILSEYLN
                     Q"
     gene            complement(<1051561..>1052403)
                     /locus_tag="CD36_30290"
                     /db_xref="GeneID:8050159"
     mRNA            complement(<1051561..>1052403)
                     /locus_tag="CD36_30290"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422000.1"
                     /db_xref="GeneID:8050159"
     CDS             complement(1051561..1052403)
                     /locus_tag="CD36_30290"
                     /inference="similar to AA sequence:UniProt:Q59N10"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422045.1"
                     /db_xref="GeneID:8050159"
                     /db_xref="UniProtKB/TrEMBL:B9WLT4"
                     /translation="MKTTTFTLLLSIATAINAAAFEDSRLKLLFARDGEISFGATISA
                     EISHGFGFDHHGHTDHHGHTADLSTDITGVVSSSTVESTIEELSSTVTSDSESSVITS
                     DSSAATTASSSSSSTTTTDDDEISTEATESIETTDSIDTTESVETTDSVETTDSIDTN
                     TTEETTDVTDSVETIFESGSNTEELSFTIGNSDLSESSIEETPLTTDTNIISTEDFSS
                     ITTSTTEWIQTTTLHNSSNSNHTNSNSSNVSNTTTSANFAIQHGTDYGVAVVAAAIVG
                     ALLI"
     gene            <1054808..>1056076
                     /gene="CDC43"
                     /locus_tag="CD36_30310"
                     /db_xref="GeneID:8050160"
     mRNA            <1054808..>1056076
                     /gene="CDC43"
                     /locus_tag="CD36_30310"
                     /product="geranylgeranyltransferase type I beta subunit,
                     putative"
                     /transcript_id="XM_002422001.1"
                     /db_xref="GeneID:8050160"
     CDS             1054808..1056076
                     /gene="CDC43"
                     /locus_tag="CD36_30310"
                     /inference="similar to AA sequence:UniProt:P18898"
                     /inference="similar to AA sequence:UniProt:Q9Y764"
                     /codon_start=1
                     /transl_table=12
                     /product="geranylgeranyltransferase type I beta subunit,
                     putative"
                     /protein_id="XP_002422046.1"
                     /db_xref="GeneID:8050160"
                     /db_xref="GOA:B9WLT5"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="UniProtKB/TrEMBL:B9WLT5"
                     /translation="MNQLLITKHEKFFNRCLIGLPSSAQSEDSNKLAIIYFCLHGLQL
                     LQKFQFHEQELIYYRNFIYKQFMIENNEIISFRSTHYFSNINKKFKFDCPNLSSTLFA
                     LYNLLILKSPYHNYINRNKIMKFLCKCQINNGINKGGFVPTLYYENGIYKQFGEPDLR
                     VCYMALLIRHLMKYDNNNNNNNNNNNNNNTNEDKDKDNDKDNDKDNDNDKDNDNDKDN
                     DKDNDIDVISLQKFILDRININGGFSSTIMDESHLGFTFCAVASLKLLNYPLENLQST
                     KEWLIHRQVDYPKNLYNNDNDNDNNNDYDYEYYRNIDIGGFNGRENKLSDTCYSWWCT
                     GSLYNINCNFIKLVDLNKAKNYLLNQTQNQLFGGFSKDPQSIPDPMHSYLALASLSLW
                     DHEKFALQEINPILTITKESYQFFKDEIKY"
     gene            <1056432..>1057463
                     /locus_tag="CD36_30320"
                     /db_xref="GeneID:8049676"
     mRNA            <1056432..>1057463
                     /locus_tag="CD36_30320"
                     /product="mitochondrial transport protein, putative"
                     /transcript_id="XM_002422002.1"
                     /db_xref="GeneID:8049676"
     CDS             1056432..1057463
                     /locus_tag="CD36_30320"
                     /inference="similar to AA sequence:UniProt:Q07534"
                     /inference="similar to AA sequence:UniProt:Q59KC4"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial transport protein, putative"
                     /protein_id="XP_002422047.1"
                     /db_xref="GeneID:8049676"
                     /db_xref="GOA:B9WLT6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:B9WLT6"
                     /translation="MSSSSSKTNQNGKSPDATVHLIAGAIAGLISAITLQPFDLLKTR
                     LQQQQLTTKHEVRTTLTKELKKLTRIKDLWRGTLPSTLRTSIGAGLYFTTLSKMRSSW
                     GDYKQFKDSSINLKSNSSILPKLTPLENLTIGFIARGIVGYITMPITIIKTRFESNLY
                     NYNSMYEGISGIYLDDKQQQQHHQQHQQQTRSKSKGSWKNFFKGSVATLARDCPYAGL
                     YVLTYESFKNDLIPMIIPYSYNLGDNKSSIINSTAAVLAASTCTTITAPFDAIKTRLQ
                     LTNEGSMTTVLKTMLQEDGGIKNLFRGLSLRLGRKGISAGISWCIYEELIKSNYFQSK
                     FIKKDVPLK"
     gene            <1057879..>1059246
                     /locus_tag="CD36_30330"
                     /db_xref="GeneID:8050161"
     mRNA            <1057879..>1059246
                     /locus_tag="CD36_30330"
                     /product="peroxisomal membrane protein, putative"
                     /transcript_id="XM_002422003.1"
                     /db_xref="GeneID:8050161"
     CDS             1057879..1059246
                     /locus_tag="CD36_30330"
                     /inference="similar to AA sequence:UniProt:P53112"
                     /inference="similar to AA sequence:UniProt:Q59KC3"
                     /note="Similar to S. cerevisiae PEX14"
                     /codon_start=1
                     /transl_table=12
                     /product="peroxisomal membrane protein, putative"
                     /protein_id="XP_002422048.1"
                     /db_xref="GeneID:8050161"
                     /db_xref="GOA:B9WLT7"
                     /db_xref="InterPro:IPR006785"
                     /db_xref="InterPro:IPR025655"
                     /db_xref="UniProtKB/TrEMBL:B9WLT7"
                     /translation="MNEELINSAVSFLKDPQVGTSPLTKKVEFLESKGLNQEEIEEAL
                     KRANDNSSSSSVTSSNSSNTTSTSPSYQPTSQQQQQQQQQQQQQQQQQVYPQPPLDYY
                     NVAPPVPERSWKDYFIMATATAGVTYGLYQVITRYLIPSIIPPSQSSIDQDKEIINEE
                     FIKIDKILDQLTIEQEEIKISNQNKLTEIDTVIENINDFLNKYNKDKLKFDDDLRLMK
                     LEIDNLNNNIEKNMQLTKENINDELNEINQELQSLKNLIKARNGSSINQINGGNETRK
                     IAPVSSIPSASEILKNARARARNVENITPEPKQEIKQESEPEPEPKQESETKPVKKSE
                     QSILSKSDELKRSKDVTKNGVVASGIPAWQLQHKEQEIEEKSNQEDSQKQSTNNNNNN
                     GIPAWQQAASSVDTPKSEEEIKEKIKNVGVPTWQLNASTNNSTTRNDDSDSNTVTPQQ
                     STSAE"
     gene            <1060486..>1061586
                     /locus_tag="CD36_30340"
                     /db_xref="GeneID:8050162"
     mRNA            <1060486..>1061586
                     /locus_tag="CD36_30340"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422004.1"
                     /db_xref="GeneID:8050162"
     CDS             1060486..1061586
                     /locus_tag="CD36_30340"
                     /inference="similar to AA sequence:UniProt:Q59KC2"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422049.1"
                     /db_xref="GeneID:8050162"
                     /db_xref="UniProtKB/TrEMBL:B9WLT8"
                     /translation="MSAQTTYPKRSLEVVPFSYQLEFIDKVVSNPIKSQHQSFNRYHN
                     NNNHHHQHPHPHSHSHQNQNHNQHQQYQQYLQQQQQNKYTLAAVAAAAALQQQQQQTF
                     LLQQQAQQAALAQKKQQQQQQQQQQQQQQQQQQQTQNQHQHSQSFVNYTSQSPQVFAS
                     PTPPQVFGDVPTDKSMANSSMFSTSSQPLNGGNIDLKTSFMMFNNSTNSIPSPTNSHY
                     GGGGGSGSGKQTSTSSQSSAATGFTTKLFDNSVGSNSNSPILLPPNANRNPSPPNLFL
                     STNNNKINNNGSPLMGASMTPTSTSFLNNSPSLVTTGPISSNTWNIGVSTPTSGSIWG
                     NKSSGTSTTLTATPIAKTSSNIMSSFNGSNLW"
     gene            <1062381..>1065365
                     /locus_tag="CD36_30350"
                     /db_xref="GeneID:8050163"
     mRNA            <1062381..>1065365
                     /locus_tag="CD36_30350"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422005.1"
                     /db_xref="GeneID:8050163"
     CDS             1062381..1065365
                     /locus_tag="CD36_30350"
                     /inference="similar to AA sequence:UniProt:Q59QR5"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422050.1"
                     /db_xref="GeneID:8050163"
                     /db_xref="GOA:B9WLT9"
                     /db_xref="InterPro:IPR014801"
                     /db_xref="UniProtKB/TrEMBL:B9WLT9"
                     /translation="MSMDTISLSKLIKKSINQKLPPKSFISLFNKLSKKQSISNEEFI
                     NELLVGDDDNDDDNDDYDENSLKKHKRIEYKQTLIIELSFSNVENNHLFWTNLNQIPN
                     KLQSKYLLKITKILSHQSQHYDKEVLKNFIKHEIIEYIMKYTSITINEEISQYILENI
                     VLLLSVLIDKFEKYLQQDTTNSFQNFMVKLLSILPSLTNDDGYLTSYLLNKSKNLLTK
                     NQYDQVINLNNMVRTGERQASIVSLNNNDNNNDISNNSSMQVNVASLKMVNSIDDYYI
                     KMRRLWIRKIFHHFDYDNILTVFIGNFITPTNQRNSYLIANEFIKTIFGCLDMKGYCL
                     FNVKNYILTRIPILFNNFRFTDEDNLEKAVNDALKTIEIDNEFKQFFLKGFTTSSTSS
                     TTTINEESVTINLREKFRNKLLDINSEFISLEESGLIEFINSLPSSIMNRSAKLQQDF
                     TDLILTIIDELKYNKDYEKLNRLILVIMNNIEIINIILFNSNLSLLYKLIDIIDSSNF
                     ISDYNDYDDDNNNNNNNNNNNNNNNDDDDDDIENFQDYYSYCGNLIISVIMIMEIFQI
                     NLSNLELKSNGSFIIDYLNNFYYRLCDNLVNNEPTNCDNDDRIIIENYNNLMNDWVNA
                     LFDDRNEGLSDDLIKSLNIKQIYKIIPIIYQQGIIDTNNKKINWEILNNGLEYLSQPF
                     LTPIIPMIIKSLLRDFNIDNDLKFKIIKELIKDNNNSSSSTTTTTTTTTTTNMIIKMV
                     INICGNEILQFNPPSDIMEIIMKNTVYLDKSDPIPRDINFKEFFKRQILGEIKFSGNF
                     LFFYQKYILNNRSQLIFNLIEEIYNFQKFNHEESKLYINLMIFIMLLDSIENKSDKDY
                     WKKQFQMPYKPNLQTISDTRFELSMDNHYSSIFNDDSRTSSSSSSEVDNFLKNGDGDG
                     DRDGGEDELMKDVDVVDNNTNERINTSQQLQKLNRKIHRYECFLNEFRKIRSNTTETN
                     LFVKSIRLLNDKLFEELTNWIV"
     gene            complement(<1065418..>1066287)
                     /locus_tag="CD36_30360"
                     /db_xref="GeneID:8050164"
     mRNA            complement(<1065418..>1066287)
                     /locus_tag="CD36_30360"
                     /product="methyltransferase, putative"
                     /transcript_id="XM_002422006.1"
                     /db_xref="GeneID:8050164"
     CDS             complement(1065418..1066287)
                     /locus_tag="CD36_30360"
                     /inference="similar to AA sequence:UniProt:Q4W9Y3"
                     /inference="similar to AA sequence:UniProt:Q59QP1"
                     /codon_start=1
                     /transl_table=12
                     /product="methyltransferase, putative"
                     /protein_id="XP_002422051.1"
                     /db_xref="GeneID:8050164"
                     /db_xref="GOA:B9WLU0"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B9WLU0"
                     /translation="MTSITNNNNQHQVYYNKGFEKSISDTHSWRTVKNSANYVIPLIK
                     PNFKILDVGCGPGSITIDFAQNYLSNGNNGGEGGSIIGIEPTQELIDIANENKLKLVP
                     NLTNISFQIGSIYELPFDDNTFDLVHAHQVIIHLQDPIKALKELKRVTKPEGFVCIRD
                     ADLESSIVYPNKFSLLNDFYVIKAKNAISTDTQAGRKLRIKALQAGYESKNLKTSFSS
                     WLLTDDLNLKQSWVNSTINRIKSDVEKLDPNDIEKNKQLNEKFIKLWQDWLKDETSMF
                     NMNHFEIIYQKPT"
     gene            complement(<1067006..>1067941)
                     /locus_tag="CD36_30370"
                     /db_xref="GeneID:8050165"
     mRNA            complement(<1067006..>1067941)
                     /locus_tag="CD36_30370"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422007.1"
                     /db_xref="GeneID:8050165"
     CDS             complement(1067006..1067941)
                     /locus_tag="CD36_30370"
                     /inference="similar to AA sequence:UniProt:Q59QR4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422052.1"
                     /db_xref="GeneID:8050165"
                     /db_xref="UniProtKB/TrEMBL:B9WLU1"
                     /translation="MKRQHNDTIPTNNSEFTKTKLRKTTNMTSYPSPTYSFEESSDYY
                     RFPIGRPTTPVDKIVNSLEHMPISPIKNNNNNKTEVGFTPSTLTTSEDFFIVEAKTRP
                     TPSPSPSPSPSPTPSPAGTPPPARSPSPSPSPRPRPYPHPHPRPRPRPYRRSTIHQRL
                     LSHNLRSISNFPEIEIYLGNEPKSKSKVLETSTTTTTNNLQITDYFNPFGCLNFNPFA
                     PFTNSPYPFSYSQPTILPTTTTTTKATTNLIHPILLPPPIFMSEENNTNKNSDENFPF
                     IFITGGSRTDNVVCTNPKCPCDAKPSYFVEKFFNY"
     gene            complement(<1069463..>1070053)
                     /locus_tag="CD36_30390"
                     /db_xref="GeneID:8050166"
     mRNA            complement(<1069463..>1070053)
                     /locus_tag="CD36_30390"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422008.1"
                     /db_xref="GeneID:8050166"
     CDS             complement(1069463..1070053)
                     /locus_tag="CD36_30390"
                     /inference="similar to AA sequence:UniProt:Q59QN9"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422053.1"
                     /db_xref="GeneID:8050166"
                     /db_xref="GOA:B9WLU2"
                     /db_xref="InterPro:IPR000327"
                     /db_xref="UniProtKB/TrEMBL:B9WLU2"
                     /translation="MSLNSFTFDEFIQIQVEEYILNEKRRIENEWKLKLFKLEKKIDR
                     MQQILETLLMSQRSEESESDKDSIDKHSRSPTTLTPLINKLENKTKFTTPPPPPPPPP
                     HSKLQIEHNHIEEYLKTNEIHLYDPPKVSVQEFANNFYPELYETPVFHTMSQNSPPHS
                     QCSITNLRKYEKMKIPKYEDDSDIIELNEYNKQFKQ"
     gene            complement(<1071729..>1072706)
                     /locus_tag="CD36_30400"
                     /db_xref="GeneID:8050167"
     mRNA            complement(<1071729..>1072706)
                     /locus_tag="CD36_30400"
                     /product="covalently-linked cell wall protein precursor,
                     putative"
                     /transcript_id="XM_002422009.1"
                     /db_xref="GeneID:8050167"
     CDS             complement(1071729..1072706)
                     /locus_tag="CD36_30400"
                     /inference="similar to AA sequence:UniProt:P47001"
                     /inference="similar to AA sequence:UniProt:Q59QP3"
                     /note="Similar to S. cerevisiae CIS3"
                     /codon_start=1
                     /transl_table=12
                     /product="covalently-linked cell wall protein precursor,
                     putative"
                     /protein_id="XP_002422054.1"
                     /db_xref="GeneID:8050167"
                     /db_xref="UniProtKB/TrEMBL:B9WLU3"
                     /translation="MFLLLEPNNNIYNTYCNENYKYSPKVLPNIHFFFLLFITTYSSI
                     KPINQSIIMKFSIAALSLATLAVVSAGYVSRGEGVSRGEKFECDFDTFEWKFALAVKE
                     LKHKGKNWGRDVDLDIVYELDDGQLFHGCRETYDASKCKNCYEAFEFNEEDNDKDCDD
                     DCKRKKKGHRNYKRGGYSDGDCDDDCERVERCNYPFCELYDDNCDLLITLRDGVLRDE
                     KHAIGEIVANHQFQFDKPPQKDALHKEGFSIVYTEGNYYLALDHKIKFWHCKVDDKGL
                     YKLYDESIGEQCSEIELIILKSNERAEFNEREEECDDDCKRKKEHGKKY"
     gene            <1074596..>1075387
                     /locus_tag="CD36_30410"
                     /db_xref="GeneID:8050168"
     mRNA            <1074596..>1075387
                     /locus_tag="CD36_30410"
                     /product="succinate dehydrogenase, iron-sulfur protein
                     subunit, mitochondrial precursor, putative"
                     /transcript_id="XM_002422010.1"
                     /db_xref="GeneID:8050168"
     CDS             1074596..1075387
                     /locus_tag="CD36_30410"
                     /EC_number="1.3.5.1"
                     /inference="similar to AA sequence:UniProt:P21801"
                     /inference="similar to AA sequence:UniProt:Q59QN7"
                     /note="Similar to S. cerevisiae SDH2"
                     /codon_start=1
                     /transl_table=12
                     /product="succinate dehydrogenase, iron-sulfur protein
                     subunit, mitochondrial precursor, putative"
                     /protein_id="XP_002422055.1"
                     /db_xref="GeneID:8050168"
                     /db_xref="GOA:B9WLU4"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR004489"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR025192"
                     /db_xref="UniProtKB/TrEMBL:B9WLU4"
                     /translation="MFRSILHQQKAVQFSVRSLATAAAEKAPRLKKFQIYRWNPDTPE
                     VQPKMQTYEVDLNKCGPMVLDALLKIKNEQDATLTLRRSCREGICGSCAMNIGGRNTL
                     ACLCRIDQDESKDLKVYPLPHMFVVRDLVPDLTHFYKQYKSIEPYLQRDSNPADGREN
                     LQSIEDRAKLDGLYECILCACCSTSCPSYWWNQQQYLGPAVLMQAYRWLIDSRDQATA
                     NRKAMLQNSMSLYRCHTIMNCARTCPKGLNPGKAIAEIKKQLAFD"
     gene            <1076782..>1077921
                     /locus_tag="CD36_30420"
                     /db_xref="GeneID:8050169"
     mRNA            <1076782..>1077921
                     /locus_tag="CD36_30420"
                     /product="NAD(+)-dependent formate dehydrogenase,
                     putative"
                     /transcript_id="XM_002422011.1"
                     /db_xref="GeneID:8050169"
     CDS             1076782..1077921
                     /locus_tag="CD36_30420"
                     /EC_number="1.2.1.2"
                     /inference="similar to AA sequence:UniProt:Q08911"
                     /inference="similar to AA sequence:UniProt:Q59QN6"
                     /note="Similar to S. cerevisiae FDH1; formate
                     dehydrogenase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="NAD(+)-dependent formate dehydrogenase,
                     putative"
                     /protein_id="XP_002422056.1"
                     /db_xref="GeneID:8050169"
                     /db_xref="GOA:B9WLU5"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:B9WLU5"
                     /translation="MGKPKVLMVLYAGGNHAKEEAKLLGTVENELGIRKLVEEHGYEL
                     VTTTDKEPAPTSAFDENLEDAEIIITTPFFPAYVNRERIAKAPKLKLCITAGVGSDHY
                     DLDALNERGIAAIEVTGSNVVSVAEHAVMTMLILIRNYGEGHAQAINGTWDVAAVAKD
                     EFDLEDKVIATVGAGRIGYRILERLVAFNPKKLLYYDYQPLPEEAINKLNAASKLFNG
                     IDNIIERVEKLEDLVSQADVVTINCPLYEQSRGLFNKDLISKMKKGSYLVNTARGAIV
                     DPEAVADAVNSGHIAYGGDVWPVQPAPKDMPWRTMHNPYGKAYGNAMTLHVSGTSLDA
                     QARYANGVKQILTEYFNKTYKYRPQDVICIDGDYATKAYGQREKK"
     gene            <1078102..>1079313
                     /locus_tag="CD36_30430"
                     /db_xref="GeneID:8050170"
     mRNA            <1078102..>1079313
                     /locus_tag="CD36_30430"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422012.1"
                     /db_xref="GeneID:8050170"
     CDS             1078102..1079313
                     /locus_tag="CD36_30430"
                     /inference="similar to AA sequence:UniProt:Q59QN5"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422057.1"
                     /db_xref="GeneID:8050170"
                     /db_xref="InterPro:IPR013961"
                     /db_xref="UniProtKB/TrEMBL:B9WLU6"
                     /translation="MDRIPLSVFEKLNNQDLCSDVPEDRFVSKCLRSQETFSTPCKEW
                     TYFTKGNNILEFHDTTGLNKVLISFTQPAKKRKQKKPNGSRNQPKIIGSDLTEGFSEF
                     KPESLKDVYSFDDILRSIQYLIHNKKFNLDDLKIVTIRRHLQKLMTIPIYKQEVQFNV
                     IYWKGMIFFAYDWKSESTNNNDDNSSSKYHKLMQYTGFKFEKVLSEGIKDSNFYTVVQ
                     HCVDNIPVIYTAEIDCSIDKEKGLENYVELKTHSKLPDDKISTINKLNKKLLSTFIQT
                     KFIDCQHSIVGFRSTDLKIASIKKYTQRELASVINSFPVFLTDKCSINTKSIFQWYNL
                     VINWIVSKEITDPNTPQIFRLSFKRAQELINSYLIMEKIQDDTIFNDLIPKWFQSFII
                     NTSNNPLYVHD"
     gene            complement(<1079310..>1079585)
                     /locus_tag="CD36_30440"
                     /db_xref="GeneID:8050171"
     mRNA            complement(<1079310..>1079585)
                     /locus_tag="CD36_30440"
                     /product="mitochondrial 54S ribosomal protein YmL44"
                     /transcript_id="XM_002422013.1"
                     /db_xref="GeneID:8050171"
     CDS             complement(1079310..1079585)
                     /locus_tag="CD36_30440"
                     /inference="similar to AA sequence:UniProt:P19956"
                     /note="Similar to S. cerevisiae MRPL44"
                     /codon_start=1
                     /transl_table=12
                     /product="mitochondrial 54S ribosomal protein YmL44"
                     /protein_id="XP_002422058.1"
                     /db_xref="GeneID:8050171"
                     /db_xref="GOA:B9WLU7"
                     /db_xref="InterPro:IPR019716"
                     /db_xref="UniProtKB/TrEMBL:B9WLU7"
                     /translation="MITKYFANVSVKFNPFSNAGKSARLFLSRVPSGTKIDCKVLTKP
                     SDIQEIKVVFKDKHVMTANPATMRLADLSDYFDIHSRKLAIKDSIQD"
     gene            complement(<1079870..>1080577)
                     /locus_tag="CD36_30450"
                     /db_xref="GeneID:8050172"
     mRNA            complement(<1079870..>1080577)
                     /locus_tag="CD36_30450"
                     /product="endoplasmic reticulum membrane protein,
                     putative"
                     /transcript_id="XM_002422014.1"
                     /db_xref="GeneID:8050172"
     CDS             complement(1079870..1080577)
                     /locus_tag="CD36_30450"
                     /inference="similar to AA sequence:UniProt:P43614"
                     /inference="similar to AA sequence:UniProt:Q59QN4"
                     /note="Similar to S. cerevisiae KEG1"
                     /codon_start=1
                     /transl_table=12
                     /product="endoplasmic reticulum membrane protein,
                     putative"
                     /protein_id="XP_002422059.1"
                     /db_xref="GeneID:8050172"
                     /db_xref="InterPro:IPR007482"
                     /db_xref="UniProtKB/TrEMBL:B9WLU8"
                     /translation="MASLYPLKFNEKLAFFYNTVAATLWFCCLGRFLILLPLVGRKFL
                     PGGMADFFHVVSVLPIIETLFVKSALRKRFTLTSLWGVSNGLKMVWLCYGVIFPHPKI
                     AKHTSYSLLITSWCLQYFIHYFYYAFKVKTKSSFHFLFWLEYNSFYLTYPLGLIAEMI
                     LLFLSLAFVKQDSIYEYFLRAAFLSYIPIAYFAWGHLKSRKKRRYTEIMNKRNVRQVA
                     TLESISTNTTSIELKEM"
     gene            <1080781..>1081689
                     /locus_tag="CD36_30460"
                     /db_xref="GeneID:8050173"
     mRNA            <1080781..>1081689
                     /locus_tag="CD36_30460"
                     /product="endoplasmic reticulum-located J-protein
                     precursor, putative"
                     /transcript_id="XM_002422015.1"
                     /db_xref="GeneID:8050173"
     CDS             1080781..1081689
                     /locus_tag="CD36_30460"
                     /inference="similar to AA sequence:UniProt:P43613"
                     /inference="similar to AA sequence:UniProt:Q59QN3"
                     /codon_start=1
                     /transl_table=12
                     /product="endoplasmic reticulum-located J-protein
                     precursor, putative"
                     /protein_id="XP_002422060.1"
                     /db_xref="GeneID:8050173"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:B9WLU9"
                     /translation="MKFIKVFLLFVTLVVAAQWSKEDYEIFSFNDKLQHDLGGDITFY
                     KWLGLEKGPKSSLQEINKAYRKLSRKLHPDKFASASRSDKKKANERFQRLSLVGNILR
                     DQSLKRRYDYFYTKGFPKWKGTGYYYSKFRPGIIFTLIILYVLVGFLHFFSLKINRKQ
                     AFKRIVDLKNEVKNQAWGGLQFPPGDGSDRKLSNEATGKTFLVKADGTVWLVEDDEQH
                     LIDEYDVNVNPGFKESLFFKIPVKIWNLVLGKWVPIDTSVEYKKQETSPQEDADNNNK
                     KKIQKKKTKGKKIELPNGKVVYSRKK"
     gene            complement(<1081742..>1084525)
                     /locus_tag="CD36_30470"
                     /db_xref="GeneID:8050174"
     mRNA            complement(<1081742..>1084525)
                     /locus_tag="CD36_30470"
                     /product="Sit4 phosphatase-associated protein, putative"
                     /transcript_id="XM_002422016.1"
                     /db_xref="GeneID:8050174"
     CDS             complement(1081742..1084525)
                     /locus_tag="CD36_30470"
                     /inference="similar to AA sequence:UniProt:P40856"
                     /inference="similar to AA sequence:UniProt:Q59QN2"
                     /note="Similar to S. cerevisiae SAP185"
                     /codon_start=1
                     /transl_table=12
                     /product="Sit4 phosphatase-associated protein, putative"
                     /protein_id="XP_002422061.1"
                     /db_xref="GeneID:8050174"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="UniProtKB/TrEMBL:B9WLV0"
                     /translation="MSFWPFTNSMNSNNALSKFLDSVQDLSSITAEDLIGDPTLSEEL
                     LNELHNIKGNYNSRNGAANFSFSQPQTINDATVSNSDSASFTSSTNDINTANTKDSRG
                     RKLLEVLIQPHILSGLIDYVEKSVEFFYEQSIKENEKVLDLLNENPPETDIQEEEELK
                     KIRQKNGIKSNDDNDDDDDDVDDNEEEETEDSKFRRCVQVAADILSVDLWIISNRITE
                     TESLINKLWRIIDLNNLSESSPSVSYLVHILDQLMDANSIELLNFFRRQKNLVDTFLL
                     KIEVPILMDFFFRLIQTDKPDSPTGIIDTIASQNIISKLIEILKPESSQFASQKCIPN
                     HQLFFKQTAATDFLKALVNISSNAALASVMETNIGPNQLTRELVSPAVINTMIDDIML
                     VKINDENGKTQTNKHGINNVVSIIIELIRKNNSDYDLNCGTYSSMLQNGDGGPIEVNS
                     YVMYQWLKDFEQNPPGPRDPIYLGEMLDLFSSNLDRIAALIQMEPIPPPHVTSNILGF
                     TRFKLSELIAELLHCSNMILLNSRKIKKIIQVRDQIRSQQEKRLQKALQEQISFSDSP
                     NIHQVTTGLDDVSLDDIHFTSHSNDEVHNYGKLLDSLDQEEDSEDDEPSISPENPFVC
                     SERDESMRQDPCVGDYFKIKLLDSGILYDIISMFTKFPWNNFFHNVVFDLIQQIFNGK
                     LNSYNSFLIVELFKENQCNLTDIVVNSYKEDLNPRPGYMGHLILISEEIVKFTSLYKP
                     DLISPVIVSAVQSEKWTWFISEVLLKTREIYNVVLGAEDSDGNNDYGFDTSSVGYLDM
                     DQPKKIILGDASNHDEFINDNSGQNNGSVQESEQEHTSNDLNDLGDDYDMNQYFVPDI
                     NVSKMSPSGDLTKHSIEDDCDDDLDEHHDDSSDKYLENLSDSSSDGDEDEDEDEDIGE
                     TNKLKRVPTHNDD"
     gene            complement(<1085164..>1088955)
                     /locus_tag="CD36_30480"
                     /db_xref="GeneID:8050175"
     mRNA            complement(<1085164..>1088955)
                     /locus_tag="CD36_30480"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422017.1"
                     /db_xref="GeneID:8050175"
     CDS             complement(1085164..1088955)
                     /locus_tag="CD36_30480"
                     /inference="similar to AA sequence:UniProt:Q59QQ4"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422062.1"
                     /db_xref="GeneID:8050175"
                     /db_xref="InterPro:IPR001370"
                     /db_xref="UniProtKB/TrEMBL:B9WLV1"
                     /translation="MANINHEMIYRDHRLKTFEDPIKVGNKSLAWDEFSNVESFDRLI
                     ESGFYYNPTSRSKTRITCAYCGNSEIIKSNKDVDNINTKHLRRNSSCPMSLIANIDDI
                     ISNFNSNRDELKNFWKNHNLFNDPFHSKTIEFRKQFYVNYPLDKIDSIPNSNSLSHAG
                     FIYSPRSIEDDRVRCMYCQCALDYWEEDDDPIEEHIRNESTYCYFLDLYNNEHDDNKS
                     SLEFENPKIINNINDVESMEESISNNSDQEVIELASFHASKNVNDNYNRPNDDVIDIS
                     ENLTTHPLSKSSSPPQEITNNDAHNASVNKIDNSFSTPVKDISQDLSIIEQDDRPTYR
                     RSKRIKRLYGERDRNVDYWDKLPDEDLLQEFIEVSQKSSKNDNSKRKSSTIEKEQMDN
                     SLIYNESTDENGTDGIGDIKIHNDSEVEEVVYDNDEIPMDEIEMEDVDVEEHNSKELS
                     LQDQVKNAMTNDKEEEEDRLQSEILSENNEPTEPISTKQSSFSNRDNNEDKYSNTEEG
                     KHSTLNLQKEKEGSVSVIQEDYNSNLNETDNKNTDNVNSNIEEEEFNSEDSDDESEYQ
                     SNDNSESYADTSDASFKISGNFDDTTQELENNKTKPKRTKSRAPTRGTDTSNQSKTIP
                     KSETKKPKRVVISKKEKSTIPIETLFDNTEDNLEYDEKHIEKIENEPLAHLLEPQKFK
                     KKDTRTKKTKTKPRDTEPQRQIETKNFESTKRKFEEPNTSPFRFLDSLKNSQRKRKKL
                     SKPNILDMSFETAEVLSSPNKFISPKNEAMVNRKDGSSSAKNHKQNNVSKEDVIEEEI
                     KTERNDNHTITNNNSLSKTKNGVQKIPKNDKDVFIDPDEELVFGITKSSGLPNSNIPT
                     KDVDNSPKKESLILKDLDSFVSLEKSPKPKIAEIQATSTSNNSRISFAVEPESSDNDS
                     YSNYIQDIKQIDAEISKVMLEDTEQYSLTRTNTNEKEELISNKGNHEDSEKKSIVEQD
                     SNTIETDDSDFSIEEEEEEEKEEESIESEDEEEELNIDSTEELQTNQKASPVRRSSDI
                     TTSNDQSLEESTDPNDSPSKTKNVDTYHSPDSINELPSKSPTKVTNNQEIVKELKEIK
                     KSKDSLDIDEKHYPDVLGIGGLDTSPLGMNSSLTEIHKLNNYNGNGNINDKDNSVEEK
                     KKLQPPSPPKSSSSLKWQLRPMSQFIEQTKFLESSANELKDLACSEYDLHNDVTGDLT
                     KFIAEMPEEEEEMTIKQWIEHCAANCKDIVTQSCTEINDFILEEYDRAIRMIEEMPTD
                     D"
     gene            <1090777..>1092757
                     /locus_tag="CD36_30490"
                     /db_xref="GeneID:8050176"
     mRNA            join(<1090777..1091774,1091867,1091968..1092276,
                     1092344..>1092757)
                     /locus_tag="CD36_30490"
                     /product="glucose transporter of the major facilitator
                     superfamily, putative"
                     /transcript_id="XM_002422018.1"
                     /db_xref="GeneID:8050176"
     CDS             join(1090777..1091774,1091867,1091968..1092276,
                     1092344..1092757)
                     /locus_tag="CD36_30490"
                     /inference="similar to AA sequence:UniProt:Q12300"
                     /inference="similar to AA sequence:UniProt:Q59QN0"
                     /note="Similar to S. cerevisiae RGT2;
                     spliced gene; high-affinity glucose transporter, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="glucose transporter of the major facilitator
                     superfamily, putative"
                     /protein_id="XP_002422063.1"
                     /db_xref="GeneID:8050176"
                     /db_xref="GOA:B9WLV2"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:B9WLV2"
                     /translation="MSTGDLEDLDIQKLIVEKRLEQSGGSGLATMKRNKRALGTCLFV
                     SLGGILYGYNQGMFGQVSSMHSFGETVGIGKIQDNPTLQGLLTSILELGAWVGVLMNG
                     YLADAFGRRASVVIGCILFNIGVIVQAVARDANYGYILGGRFVIGLGVGVLSMIVPLY
                     NSEISRAEIRGANTAIYQLSITFGIMISYWITYGTNFIGGTGENQSQASWLVPMCIQA
                     VPAIILAVFIYSFPESPRWLINVGQEDKALEVLAWLRETEQEDFSLQIEFLEMKAQKI
                     FEQTLETEAYPHLQDGTKISKLKINLNQYKSMVTHLPTFRRVSVACLTMVFQQWTGAN
                     FILYYAPFIFASLGLSGNTTSLLASGVVGIVMFVCTIPAVLWVDKVGRKPLLISGALV
                     MGLCHFIVAGILGGYSDNIGSHKAAGWVAVVFIWVFAGAFGYSWGPCSWVIVAEVFPL
                     GMRAKGVSLGSSFNWLMNFSVAISTPKFVANAKYGAYIFLGLMCVIGSLYVYFMVPET
                     KNKTLDELDEVFGDFTGTSKKESELREKILKQVGLVELLVGSDKELDSFGSKPEVEYK
                     EKETHSE"
     gene            complement(<1093026..>1094523)
                     /locus_tag="CD36_30500"
                     /db_xref="GeneID:8050177"
     mRNA            complement(join(<1093026..1094420,1094509..>1094523))
                     /locus_tag="CD36_30500"
                     /product="V-ATPase subunit, putative"
                     /transcript_id="XM_002422019.1"
                     /db_xref="GeneID:8050177"
     CDS             complement(join(1093026..1094420,1094509..1094523))
                     /locus_tag="CD36_30500"
                     /EC_number="3.6.3.14"
                     /inference="similar to AA sequence:UniProt:P41807"
                     /note="Similar to S. cerevisiae VMA13;
                     spliced gene; vacuolar ATP synthase subunit, putative;
                     vacuolar proton pump subunit, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="V-ATPase subunit, putative"
                     /protein_id="XP_002422064.1"
                     /db_xref="GeneID:8050177"
                     /db_xref="GOA:B9WLV3"
                     /db_xref="InterPro:IPR004908"
                     /db_xref="InterPro:IPR011987"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:B9WLV3"
                     /translation="MSEGYTPLVIDSTFLFDSKKIIKERIIPWEGLARSGVVSEDDAN
                     HIKLLEKQSIENRNNTVKGQLDLYSKCLLNVLNRVDSKDDVLKNILALINDLLLDVPE
                     FLDAVLKLSEVDKSLPYIPFINHLDNKDNLIKSLALYNLEILLGKVKTINDDEVLIKI
                     FSVLSYLIGDSADSNYQFIGVQLLQDLLIVKPFKLVYQNNNLLTNFKPINNLIEKSAK
                     NPNSIGLQLSYNILLVVWVLSYTAPINRSLIHNFPQLVGNLLSIAKDSIKLKIVRVAV
                     AILKNFVDITISSQEQFKVIKVLLFSDALNTVNTLRERKFASNGSDEELSNDLNYLYD
                     NLQEIVTQKLTSFDEYLTELENPKLISWASPTHKSTEFWLENSGKFKDSNYKLVKRIF
                     EILISNTNDSTTINVILLNDLQFLIKNLGKDLITFINTEKGGQYKLLIMTFLDNSQGD
                     NELKYQALKTIQLLVGHNF"
     mobile_element  complement(1095445..1095858)
                     /mobile_element_type="retrotransposon:solo LTR, lambda F"
     gene            complement(<1098541..>1099662)
                     /locus_tag="CD36_30510"
                     /db_xref="GeneID:8050178"
     mRNA            complement(<1098541..>1099662)
                     /locus_tag="CD36_30510"
                     /product="glutamine synthetase, putative"
                     /transcript_id="XM_002422020.1"
                     /db_xref="GeneID:8050178"
     CDS             complement(1098541..1099662)
                     /locus_tag="CD36_30510"
                     /EC_number="6.3.1.2"
                     /inference="similar to AA sequence:UniProt:P32288"
                     /inference="similar to AA sequence:UniProt:Q59QM8"
                     /note="Similar to S. cerevisiae GLN1"
                     /codon_start=1
                     /transl_table=12
                     /product="glutamine synthetase, putative"
                     /protein_id="XP_002422065.1"
                     /db_xref="GeneID:8050178"
                     /db_xref="GOA:B9WLV4"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR027302"
                     /db_xref="InterPro:IPR027303"
                     /db_xref="UniProtKB/TrEMBL:B9WLV4"
                     /translation="MTASLTEQTAILAKYLELPQNGKVLAEYVWIDAEGNTRSKCRTL
                     SKKPTSVDDLPEWNYDGSSTGQAPGHDSDVYLRPVAFYPDPFRKGDNIIVLNECWNND
                     GTPNKFNHRHECAKLMKAHSSEEVWFGLEQEYTLFDQYDYPYGWPKGGFPAPQGPFYC
                     GVGTGKVVARDVIEAHYRACLYAGINISGINAEVMPSQWEFQVGPCEGIEMGDQLWIA
                     RYLLQRVAEEFAVKISFHPKPLKGDWNGAGCHTNVSTKSMRVPGGMKVIESALSKLAK
                     RHKEHMLLYGADNDQRLTGRHETGHMDTFSSGVANRGASIRIPRQVAKEGYGYFEDRR
                     PASNIDPYLVTGIMVETICGSIPDADMAKEFLRESSDDN"
     gene            complement(<1103574..>1106402)
                     /locus_tag="CD36_30530"
                     /db_xref="GeneID:8050179"
     mRNA            complement(<1103574..>1106402)
                     /locus_tag="CD36_30530"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422021.1"
                     /db_xref="GeneID:8050179"
     CDS             complement(1103574..1106402)
                     /locus_tag="CD36_30530"
                     /inference="similar to AA sequence:UniProt:Q59QM6"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422066.1"
                     /db_xref="GeneID:8050179"
                     /db_xref="UniProtKB/TrEMBL:B9WLV5"
                     /translation="MAYGIKLIGGIITLYLFYVWTFVCPLTTIDTDSTNSLTPINHHF
                     CSLSNKYIKPQFYPIYQSHINPVLINLDETLHVGENIDKSIEIIHNFNHQYKISEYYH
                     RICDLLIDSTQQGINYFQDNIAPQLSRWIRLFILRIRMYYEISKINLEYYLYPTINKF
                     YKQFVSKLKSIEYINDFINWINEIYLKLATSKHALKLQQKSNFLQTEFKNLVTFDDFN
                     PKQIKNNVLQIVKDMLGEKSIEQSLTDEPTRDKIPMELTPTGETTSNETPVYQTSNDY
                     VSVNEVHVEQVPAEETPDEETLVEETSIEETPVEEIPTEEEPIEKTLKEETSIEEIPT
                     KETSIEETFSEEIPIEQYSVEEEVVVEEEIPSSNDDDEDDSEFELEPETIHITSTIVV
                     TNSEAEATSIDGAVSTDDPVWGPILHEINYWENKVNKTMVLALNNLKIEMKPKIDEII
                     NNIKPEISDTLQDLQKTNYEQYQLIHRKISQINKDYEEIKLTNNSLIETITRQEIRDD
                     ISNCTKISEDASAKIQEILNNNHEKILTIFYDILQDTIDILETSSESIINEFKNQLNY
                     FIYQSELKDYDDEINWTIWKKYHKIKESLFEFRDNLIKDADDYQLDNKKNIDKLTTDS
                     LNEWDNYLKNIEFHLNFLIRDNIEFLQLIRAKANIAFQMREGLADELNRIKREKEQEK
                     AKDIKIETPELVDIPVAGAVDAKQVYFEYSDDSEELRDFGNDSIIVDSKEDLDKSSKK
                     SSSASQDTESEIYYYEHTVGPNEDVADVNDFIVETTIVDSEQSTASGEATILNHDNVK
                     NETEAIEEVEVEIEIETEVEVEYETEIETEIVTNTQLDIQYETELEIEFETEYETQIE
                     TAFETQIGVPSVDTSSSLQDVTAQSIETSSYRSNNGQPESMIDKDNDDEDDYDVVVEE
                     EQILILEEDDDDEEDEEEEEEGETTKKI"
     gene            complement(<1107508..>1109103)
                     /locus_tag="CD36_30550"
                     /db_xref="GeneID:8050180"
     mRNA            complement(<1107508..>1109103)
                     /locus_tag="CD36_30550"
                     /product="arginine permease, putative"
                     /transcript_id="XM_002422022.1"
                     /db_xref="GeneID:8050180"
     CDS             complement(1107508..1109103)
                     /locus_tag="CD36_30550"
                     /inference="similar to AA sequence:UniProt:P04817"
                     /inference="similar to AA sequence:UniProt:Q59QM3"
                     /note="Similar to S. cerevisiae CAN1"
                     /codon_start=1
                     /transl_table=12
                     /product="arginine permease, putative"
                     /protein_id="XP_002422067.1"
                     /db_xref="GeneID:8050180"
                     /db_xref="GOA:B9WLV6"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:B9WLV6"
                     /translation="MNEETHLLTSSFNQQEVGNEHPTHPHPHPHANTKRLLTSLHTSM
                     ISLGGIIGTGLFIGVRITLLNGPIISLMSYLYISLICFYIIQAVGEMSCYMPLNGSLC
                     QFQFIYISNPIGIINNFIYWISWSITLALELSLIYNMLKYWQWQWLDIIGETWMIFII
                     WTILTICNLFPVNNYGNIEFIITIFKIFFMMGWIVISISLIMNNGSGSGFKYWNKDLI
                     WGIDYIKVIENPVGSKLINILSSLISSCFTFQSIESVAICSGEIIDVHKNLPRAIKYV
                     VSRIVIFYILTLFLLTLMIPSNDPRLVSSGEGDNDMFSSPFLIGLINMGMSSSSFLLG
                     FFNFIILISMVSAANSNIYFGSRCLLSMVEEGYFPVMFGETTKSGVPLNAILLTSSIG
                     LISLLSKFKSIDIFYKLLINLSSTSGLIMWLFISISYLQFRKALAFNSIVYENLAYTA
                     IHRFPMIKFSYITIVSIVTIIIGNGIVNIWEFSWDSFISCYLTSIILIVGSVWLSMIW
                     KQPILKKVEDIDIFTDQSVHAFK"
     gene            complement(<1109367..>1111427)
                     /locus_tag="CD36_30560"
                     /db_xref="GeneID:8050181"
     mRNA            complement(<1109367..>1111427)
                     /locus_tag="CD36_30560"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422023.1"
                     /db_xref="GeneID:8050181"
     CDS             complement(1109367..1111427)
                     /locus_tag="CD36_30560"
                     /inference="similar to AA sequence:UniProt:Q59QM2"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422068.1"
                     /db_xref="GeneID:8050181"
                     /db_xref="GOA:B9WLV7"
                     /db_xref="InterPro:IPR001044"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:B9WLV7"
                     /translation="MGIPELWDLLKPSFGKRISLDELVDQSLKERQRPPRVAIDAYSF
                     IFQADHSSIMIDEKEGVLMQNVMAKILALVGLNISVVIVFDGILKPFKLKSKENEGLV
                     YEDELQRLSLVSNYSENNPFVEQLKIELFNNKIEYVQAPGEGEAQCAYLQKLGIVDYV
                     ISQDVDALVFGARQVLRNFSRFAEDIGKSPPKTSDITARSSYYVTPVDMDKVEQETGL
                     TTSRLIFLASLRGGDYSVGAKKMGIVNAKNLALSGTSKSMYYTENKSKIQLRELQKSP
                     QKLKGPPPDFANELIDCVQSTDKSIKLHPWDSRLDPKTRRYRFDSLLKKMNFYLQEQN
                     RDIFGRKVTFQEEFKFDEYYTMLYLFPLVSDQIPIFTPNTLGTGEFESDLHINLPPKI
                     RVSRLSNANRRKYVQIVGEPINELPEKQKKLFVPESYNWSIKHIICKLMTHDSNWIKV
                     TNYKEDNGLPKVMLKYDASNIFKEYPELLEARRALDNNGQPQSPGKNYVWVSQSLVEH
                     YNPKLVDEYVESKKEKEYIKKYKFSPQKTTLDSLEVSPIKKSILKGPVPFKLKPKSPR
                     KLSPNKSTTLSPRKRSKPVLLPGQKQLDFFLVKKNNKENAMKSIPELKPNDKEIIEDN
                     PFLDSFNSAIKDNEEVKRNYQQEEEEESRPIEKPITEERESYDVTFSTTISLDRIFIK
                     DSGL"
     gene            <1112715..>1113536
                     /locus_tag="CD36_30570"
                     /db_xref="GeneID:8050182"
     mRNA            <1112715..>1113536
                     /locus_tag="CD36_30570"
                     /product="covalently-linked cell wall protein precursor,
                     putative"
                     /transcript_id="XM_002422024.1"
                     /db_xref="GeneID:8050182"
     CDS             1112715..1113536
                     /locus_tag="CD36_30570"
                     /inference="similar to AA sequence:UniProt:P47001"
                     /inference="similar to AA sequence:UniProt:Q59QP3"
                     /note="Similar to S. cerevisiae CIS3"
                     /codon_start=1
                     /transl_table=12
                     /product="covalently-linked cell wall protein precursor,
                     putative"
                     /protein_id="XP_002422069.1"
                     /db_xref="GeneID:8050182"
                     /db_xref="UniProtKB/TrEMBL:B9WLV8"
                     /translation="MKFSIATLSLATLAVVSAGYVSRGEGVSRGEKFECDFDTFEWKF
                     ALAVKELKHKGKNWGRDVDLDIVYELDDGQLFHGCRETYDASKCKNCYEAFEFNEEDN
                     DKDCDDDCKRKKKGHRNYKRGGYSDGDCDDDCERVERCNYPFCELYDDNCDLLITLRD
                     GVLRDEKHAIGEIVANHQFQFDKPPQKDALHKKGFSIVYTEGNYYLALDHKIKFWHCK
                     VDDKGLYKLYNESIGEQCSEIELIILKSNERAEFNEREEECDDDCKRKKEHGKKY"
     gene            complement(<1114788..>1115207)
                     /locus_tag="CD36_30580"
                     /db_xref="GeneID:8050005"
     mRNA            complement(<1114788..>1115207)
                     /locus_tag="CD36_30580"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422025.1"
                     /db_xref="GeneID:8050005"
     CDS             complement(1114788..1115207)
                     /locus_tag="CD36_30580"
                     /inference="similar to AA sequence:UniProt:Q59KQ3"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422070.1"
                     /db_xref="GeneID:8050005"
                     /db_xref="UniProtKB/TrEMBL:B9WLV9"
                     /translation="MSCFAKVKCFLACIVLYYISYLYNYKCPTLTPLQEGVETILHPL
                     HSHHSVLCDYLHTGINTVEPYTAKVHGFLDDHVHSHPLFIEYKVEDKLTCAKNQFSTY
                     VYPYIHQLYQFTDAAEVHAHEHLSQVYDKVQKTLKKD"
     gene            <1116292..>1117278
                     /locus_tag="CD36_30590"
                     /db_xref="GeneID:8050006"
     mRNA            <1116292..>1117278
                     /locus_tag="CD36_30590"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422026.1"
                     /db_xref="GeneID:8050006"
     CDS             1116292..1117278
                     /locus_tag="CD36_30590"
                     /inference="similar to AA sequence:UniProt:Q59KQ2"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422071.1"
                     /db_xref="GeneID:8050006"
                     /db_xref="UniProtKB/TrEMBL:B9WLW0"
                     /translation="MQQRQQQQQFASSFAPRTPTRTRSSILTPISPNKLSSLSPTKER
                     KISESTGLVKFSLSPKKSTTESPNTKRKSTTLTKPGLSIEVPISSPPPKQQNPPTSLK
                     HLQIEQQKLLEKYSSCQVQLHEHERQAEMKKMELLEISKKIEESKRQEAILNGSQDIY
                     TQAYLQTEKELNQLNIRLSPPRKTINQSPLKKQASFLMNQAIDECTNVKKKASIIFNN
                     NRETVSPLKKQASFIVNQALDECNNVKQRASIIFNNQNEELQTFIKSSNEKFDVLAKQ
                     TNKFFNNNFKIFEKNDPEPNIGDSSFNIENLQEVIYERSFEVDIDDYDSSFE"
     gene            complement(<1117493..>1119388)
                     /locus_tag="CD36_30600"
                     /db_xref="GeneID:8050007"
     mRNA            complement(<1117493..>1119388)
                     /locus_tag="CD36_30600"
                     /product="ATP:glycerol 3-phosphotransferase, putative"
                     /transcript_id="XM_002422027.1"
                     /db_xref="GeneID:8050007"
     CDS             complement(1117493..1119388)
                     /locus_tag="CD36_30600"
                     /EC_number="2.7.1.30"
                     /inference="similar to AA sequence:UniProt:P32190"
                     /inference="similar to AA sequence:UniProt:Q59KQ1"
                     /note="Similar to S. cerevisiae GUT1; glycerokinase,
                     putative; glycerol kinase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="ATP:glycerol 3-phosphotransferase, putative"
                     /protein_id="XP_002422072.1"
                     /db_xref="GeneID:8050007"
                     /db_xref="GOA:B9WLW1"
                     /db_xref="InterPro:IPR005999"
                     /db_xref="InterPro:IPR018483"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:B9WLW1"
                     /translation="MPRRVSNAPCIPVVATIDIGTTSARAIIFSAEGEEIAKHQIEYS
                     TTASEAPENSSNTDQFRRRSSLLRHDEPIFSAEGIAITLNDNIMIENNKSSVGPTIRF
                     PQPGWVECMPVHILANAVQCLVACLISLRKVNQDPNLKLKYKVKAIGIANMRETTIVW
                     SRKTGKPLSGGITWTDTRTSEIIQHLEKMIDEDRKAELKEKTGLPLSTYFSAAKLRWL
                     LDNDDVIREEYEKGDGNLMFGTVDTWLIYHLTKEKAFVSDITNASRTYFMDLETLDYD
                     DDLLDFWGIDPTKIRLPKIVSSSEFYGEFAAPKLSNLGFHNKITQEAYDILKTITGVP
                     ICGCLGDQSASLVGQLAFSSGSAKCTYGTGAFLLYNTGPHKLISKRGALTTFGFWFPT
                     LKGNDGKPHYAMEGSIAVAGSIIQWLRDNLKMIDNAKDIGPLASQVENSGGVVFIPAF
                     SGLYAPYWDGGSRGTIFGMTQYTSAAHIAHAALEGVCYQVRAILKAMASDAGAVDDFL
                     EDALSCQNTDKLLSTLATDGGMSKADEVLQIQADILGPCVTVKRAQTAECTALGAAIA
                     AGLSFKNEEDRIWKDLDDVVAKISGSSEEMAANSFTAKLSDENRRKDWKRWEKAVERA
                     KGWLEDE"
     gene            complement(<1120060..>1121118)
                     /locus_tag="CD36_30620"
                     /db_xref="GeneID:8050008"
     mRNA            complement(<1120060..>1121118)
                     /locus_tag="CD36_30620"
                     /product="inositol hexakisphosphate kinase, putative"
                     /transcript_id="XM_002422028.1"
                     /db_xref="GeneID:8050008"
     CDS             complement(1120060..1121118)
                     /locus_tag="CD36_30620"
                     /EC_number="2.7.4.21"
                     /inference="similar to AA sequence:UniProt:Q12494"
                     /inference="similar to AA sequence:UniProt:Q59KK0"
                     /note="Similar to S. cerevisiae KCS1; inositol
                     polyphosphate kinase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="inositol hexakisphosphate kinase, putative"
                     /protein_id="XP_002422073.1"
                     /db_xref="GeneID:8050008"
                     /db_xref="GOA:B9WLW2"
                     /db_xref="InterPro:IPR005522"
                     /db_xref="UniProtKB/TrEMBL:B9WLW2"
                     /translation="MVLIVVDVLRKKNFDTGVVMNNITTSQMKPFKNKVGGHTPIFSI
                     SKQEICKELNKTERNFYRKISKNHPLFYYMARYKGSNDSQLILEDLTSQLRSPCVLDL
                     KMGTRQYGCNATITKQQSHQAKAKSTTTRKLGVRICGLQVFNYQNKPFCQDKYFGRRI
                     TVGKQFCKILAKFLYNGHDIYSLLNRIPHLINQLKELYTIFTGLPGYRMYGSSILLMY
                     EGGENNSENQVKVKIIDFANAVMAGEENIDTVTVPPQHPDSPDLGYLRGLNSLIVYFT
                     LIFSILSRIKISNTEEMVDWIQENKQTLKEQSCPWLDDYAELDGLKDGGIHQDMSGDP
                     FDIEYPEYTLEEDEGLSE"
     gene            <1122715..>1123851
                     /locus_tag="CD36_30630"
                     /db_xref="GeneID:8050009"
     mRNA            <1122715..>1123851
                     /locus_tag="CD36_30630"
                     /product="alpha-1,2 mannosyltransferase, putative"
                     /transcript_id="XM_002422029.1"
                     /db_xref="GeneID:8050009"
     CDS             1122715..1123851
                     /locus_tag="CD36_30630"
                     /EC_number="2.4.1.131"
                     /inference="similar to AA sequence:UniProt:P27810"
                     /inference="similar to AA sequence:UniProt:P87207"
                     /note="Similar to S. cerevisiae KTR1"
                     /codon_start=1
                     /transl_table=12
                     /product="alpha-1,2 mannosyltransferase, putative"
                     /protein_id="XP_002422074.1"
                     /db_xref="GeneID:8050009"
                     /db_xref="GOA:B9WLW3"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:B9WLW3"
                     /translation="MLRHLVVILIAILLFTFPPQISPLFESLSITRSSTTCYQYTTRE
                     QLKSILESDTHTANFCIEKPTLSSPKKANATMLMLCRNSDVFSVLETIQNIQDRFNNK
                     YNYDYTFLNDIPFDYEFIYLVSSIIPYGKINFGLIPTEHWSYPSHINISLANEIRQNY
                     VNVPYGDSESYRHMCRFYSGFFYKHELVRQYRYYWRIEPGIKLYCDINYDVFEYMMIN
                     DKKYGFVISLFEYSETIPTLWNHVSKYINDNMIISELLPLLTNEYNWYNLCHFWSNFE
                     IANLDIFNNDDYENFFQYLDNIGGFYYERWGDAPIHSIAVALFLQKKDIHWFEDIGYY
                     HVPYLQCPQDIDLYIKNKCTCNPNEDFTWSELSCTNHFLNILQG"
     gene            complement(<1123939..>1125894)
                     /locus_tag="CD36_30640"
                     /db_xref="GeneID:8050010"
     mRNA            complement(<1123939..>1125894)
                     /locus_tag="CD36_30640"
                     /product="alpha-1,2-mannosyltransferase, putative"
                     /transcript_id="XM_002422030.1"
                     /db_xref="GeneID:8050010"
     CDS             complement(1123939..1125894)
                     /locus_tag="CD36_30640"
                     /inference="similar to AA sequence:UniProt:P38069"
                     /inference="similar to AA sequence:UniProt:Q59KJ7"
                     /note="Similar to S. cerevisiae TTP1"
                     /codon_start=1
                     /transl_table=12
                     /product="alpha-1,2-mannosyltransferase, putative"
                     /protein_id="XP_002422075.1"
                     /db_xref="GeneID:8050010"
                     /db_xref="GOA:B9WLW4"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:B9WLW4"
                     /translation="MFQQLGYRLRLFRRRHKYIFINSIFLSVIIIFLLYSYWSNLPAE
                     DNSAIINEKGTYHHSLWDSINMALFSPKTKPFEEKKPQVNPNNIQEMDVESDHVSGKP
                     TNTQHKQQQQSKVQVSDETYQLNLKLINEQQEKYNRLHPSEQKRLQQGYEFFDDIFKI
                     FYQAKPSVSQLNTYPSKNRIYHARFDSLANDDTIFSEKYLSQFLQLSKEELAAMKKSH
                     KYVVENLPENAPDGLYKKNGIVYVAGGSFNWLTLLSIKSLRAVGCHLPIEVFIPKIEE
                     YESDLCNRILPELDARCVYMKNQLVNPNKGNSESFANKFEFKGYQYKALAILLSSFEN
                     VLLLDSDNIPAHSPEELFETDPFKSYGLVVWPDYWKRATSPYYYSIADIDISEKYLGS
                     KYNEVEGQYTDLSAEKGSVDLDKVPLHQRLGSIPDPTSESGQLLISKKTHLKPLLLAL
                     YYNLYGPSHYYPLFSQGSDGEGDKETFLAATVTLNKKYYQVAKFLVSLGHFKVPGGDF
                     EGCGMGQFDPQQDLEYIKLREQYEKIPEKNKEKQHQFKLQHQMLEKGPEILFVHANFP
                     KLNPWKLKQEKKIFDAQGNRVRLYGPGMIKRIGYDFERFQWEGMKYLLCIYDVKLQIF
                     EDVKKSDLCDEILEHLKFLEKTQNITD"
     gene            <1127181..>1127642
                     /locus_tag="CD36_30650"
                     /db_xref="GeneID:8050011"
     mRNA            <1127181..>1127642
                     /locus_tag="CD36_30650"
                     /product="small subunit of the clathrin-associated adaptor
                     complex AP-1, putative"
                     /transcript_id="XM_002422031.1"
                     /db_xref="GeneID:8050011"
     CDS             1127181..1127642
                     /locus_tag="CD36_30650"
                     /inference="similar to AA sequence:UniProt:P35181"
                     /inference="similar to AA sequence:UniProt:Q59KJ6"
                     /note="Similar to S. cerevisiae APS1"
                     /codon_start=1
                     /transl_table=12
                     /product="small subunit of the clathrin-associated adaptor
                     complex AP-1, putative"
                     /protein_id="XP_002422076.1"
                     /db_xref="GeneID:8050011"
                     /db_xref="GOA:B9WLW5"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:B9WLW5"
                     /translation="MAIQFLFLISRQGKTRLSKWYQTISQKEKSKIIRELSTIILSRR
                     AKMCNVLEYKDLKIIYRRYASLFFVIGVNSDDNELIGLEIIHRFVEQMDKLYGNVCEL
                     DIIFGFDKAYHILDELLIDGYLQESSKREVLKRVNQQDELENMDEFENILA"
     gene            complement(<1133179..>1134483)
                     /locus_tag="CD36_30670"
                     /db_xref="GeneID:8050012"
     mRNA            complement(<1133179..>1134483)
                     /locus_tag="CD36_30670"
                     /product="NAD-dependent (2R,3R)-2,3-butanediol
                     dehydrogenase, putative"
                     /transcript_id="XM_002422032.1"
                     /db_xref="GeneID:8050012"
     CDS             complement(1133179..1134483)
                     /locus_tag="CD36_30670"
                     /EC_number="1.1.1.4"
                     /inference="similar to AA sequence:UniProt:P39714"
                     /inference="similar to AA sequence:UniProt:Q59KU9"
                     /note="Similar to S. cerevisiae BDH1; butanediol
                     dehydrogenase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="NAD-dependent (2R,3R)-2,3-butanediol
                     dehydrogenase, putative"
                     /protein_id="XP_002422077.1"
                     /db_xref="GeneID:8050012"
                     /db_xref="GOA:B9WLW6"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:B9WLW6"
                     /translation="MNSLLSRRIVSQPKLYKRIISTRTICNSFFLSYSHSNCQHQHHQ
                     QQQQQQIVKTMQAIEYHGNRNLKYVTDRPIPEITHPHDVKIKVSHCGICGSDLHEYLD
                     GPIFFDGEINAVSKKKKLGQCLGHELCGVITELGSEVSHHLQLGQHVVLEANGSCLDK
                     KYLQQSQEEQDDICSACAHGRYNACKRLGFYGLGYDNGGFAEYIVVSENKVIPYDANI
                     IPDEVAALVEPLAVSWHGVRQSKIEECKSPQALILGGGPIGLCTIFALKGHKVTDIVV
                     SEPAEGRRELAQSFGVKTFNPFDYKDSETQIKELLKMTESNAGFTHVYDCSGNKATFN
                     TMLKVLATGGVGTNVAIWPKVPIDFYPMDLTYNELYLTASMDYTKIDFELVVKAFETG
                     LIDPKDAAKLVSKKVSLKDGIEHGILDLINNKEKYIKILLHP"
     gene            complement(<1136384..>1137943)
                     /locus_tag="CD36_30690"
                     /db_xref="GeneID:8050013"
     mRNA            complement(<1136384..>1137943)
                     /locus_tag="CD36_30690"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422033.1"
                     /db_xref="GeneID:8050013"
     CDS             complement(1136384..1137943)
                     /locus_tag="CD36_30690"
                     /inference="similar to AA sequence:UniProt:Q59KV0"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422078.1"
                     /db_xref="GeneID:8050013"
                     /db_xref="UniProtKB/TrEMBL:B9WLW7"
                     /translation="MANQRQEPRYFMQDDDQAIHRKPPRHLQLRARSFTEPTPHCTPD
                     NTERLVQSAQEISFIEDSEDEIPVILSSISTSLPRFSSIYNSFHSSLETSLLLMNHRC
                     NEESQYSNENFNQQDFAVMSQSSYYHECHISEPATVSNDDSDVILINSTIHQDKYEHE
                     EYDYDNERNISIDSNVTEEFDKRNILLGLESAKILAPKVEVDFSQEPNDNEILECSTQ
                     CGEEDNVIEVETDNMNVTSEVVGQQFENLVEEKRAKVEPKNMENSRQNTLSSNCIHEN
                     KNKEILIETFPGEIKILKRSPKKEDEKANLKTEMNDDNRVNKPQRKELKPGDSYENNS
                     DLKNEKEVGIGNDVQGQTNKCHASNEENGSKNHDSKRILENSERENYTPLVSNNSSVS
                     SQNLKNSTAKITIANAEQKIQGKSTKENNKELLKCDNEHVTKDIPKLSNNSKSKTTKT
                     STTKPATINQSLANTASNKENIDRGNRKIVRKRIASKPLSEICNSHPRSRVGLSKRVK
                     IDSLHHKLKNK"
     gene            complement(<1140157..>1140990)
                     /locus_tag="CD36_30710"
                     /db_xref="GeneID:8050014"
     mRNA            complement(<1140157..>1140990)
                     /locus_tag="CD36_30710"
                     /product="flavodoxin, putative"
                     /transcript_id="XM_002422034.1"
                     /db_xref="GeneID:8050014"
     CDS             complement(1140157..1140990)
                     /locus_tag="CD36_30710"
                     /inference="similar to AA sequence:UniProt:P25349"
                     /inference="similar to AA sequence:UniProt:Q59KV1"
                     /note="Similar to S. cerevisiae YCP4;
                     possibly fungus-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="flavodoxin, putative"
                     /protein_id="XP_002422079.1"
                     /db_xref="GeneID:8050014"
                     /db_xref="GOA:B9WLW8"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:B9WLW8"
                     /translation="MKIAIIQYSTYGHITQLAKAVQKGVADAGYKADIFQVPETLPQE
                     VLDKMHAPAKPTDIPIATNDTLTEYDAFLFGVPTRYGTAPAQFFEFWGATGGLWAKGA
                     LAGKPAGVFVSTSGQGGGQETTVRNFLNFLAHHGMPYIPLGYATAFALQSNMEEIHGG
                     SPYGAGTFANVDGSRQPTKLELEIAEKQGEAFVKSAAKLVGSKKEGTTAASKSAATND
                     TAAATSGAAAGTTAPKESTKEDSTGAKKEAANGTATRTQQSTKAPETADKSSCSKCII
                     M"
     gene            <1142455..>1143054
                     /locus_tag="CD36_30720"
                     /db_xref="GeneID:8050015"
     mRNA            <1142455..>1143054
                     /locus_tag="CD36_30720"
                     /product="flavodoxin, putative"
                     /transcript_id="XM_002422035.1"
                     /db_xref="GeneID:8050015"
     CDS             1142455..1143054
                     /locus_tag="CD36_30720"
                     /inference="similar to AA sequence:UniProt:Q12335"
                     /inference="similar to AA sequence:UniProt:Q59KV2"
                     /note="Similar to S. cerevisiae PST2;
                     possibly fungus-specific"
                     /codon_start=1
                     /transl_table=12
                     /product="flavodoxin, putative"
                     /protein_id="XP_002422080.1"
                     /db_xref="GeneID:8050015"
                     /db_xref="GOA:B9WLW9"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:B9WLW9"
                     /translation="MAPKVAIIIYSLYHHIAQLAEEEKKGIEAAGGVADIYQVPETLS
                     DEVLKLLHAPAKPNYPIATNDTLTGYDAYLFGIPTRFGNYPAQFKAFWDATGGLWAQG
                     SLAGKQAGIFVSTSGQGGGQETTAVNALSVLVHHGIIFVPLGYAKAFPLQTNLEEIHG
                     GSPYGAGTFAGVDGSRQPTKLEKEIAFIQGKSFYETISK"
     gene            complement(1143343..1143438)
                     /gene="tRNA-Arg (ACG)"
                     /locus_tag="CD36_tRNA_0092"
                     /db_xref="GeneID:8050016"
     tRNA            complement(1143343..1143438)
                     /gene="tRNA-Arg (ACG)"
                     /locus_tag="CD36_tRNA_0092"
                     /product="tRNA-Arg"
                     /anticodon=(pos:complement(1143404..1143406),aa:Arg,
                     seq:acg)
                     /db_xref="GeneID:8050016"
     gene            complement(1143468..1143561)
                     /gene="tRNA-Arg (ACG)"
                     /locus_tag="CD36_tRNA_0093"
                     /db_xref="GeneID:8049712"
     tRNA            complement(1143468..1143561)
                     /gene="tRNA-Arg (ACG)"
                     /locus_tag="CD36_tRNA_0093"
                     /product="tRNA-Arg"
                     /anticodon=(pos:complement(1143527..1143529),aa:Arg,
                     seq:acg)
                     /db_xref="GeneID:8049712"
     gene            <1144945..>1146024
                     /locus_tag="CD36_30750"
                     /db_xref="GeneID:8049713"
     mRNA            <1144945..>1146024
                     /locus_tag="CD36_30750"
                     /product="covalently-linked cell wall protein, putative"
                     /transcript_id="XM_002422036.1"
                     /db_xref="GeneID:8049713"
     CDS             1144945..1146024
                     /locus_tag="CD36_30750"
                     /inference="similar to AA sequence:UniProt:Q03180"
                     /inference="similar to AA sequence:UniProt:Q59K90"
                     /note="Similar to S. cerevisiae PIR3"
                     /codon_start=1
                     /transl_table=12
                     /product="covalently-linked cell wall protein, putative"
                     /protein_id="XP_002422081.1"
                     /db_xref="GeneID:8049713"
                     /db_xref="GOA:B9WLX0"
                     /db_xref="UniProtKB/TrEMBL:B9WLX0"
                     /translation="MKFSTAALTFSFFAIVNSSVVTYSTEFGGNEEHKHDKYDCEIDT
                     FDWKFALVVKEWKHHKDEKFCKDTDLDLVYEGDDGQLYHGCDGTYPYSKCKHCTNVFG
                     GGDDDNKWDNKWKDDKGDDKWKDKKCDDKWDDKHKDDHCKDDNGKDGKCKDDDKCKDK
                     KCDDKWDGNCKDDHGKDDKCKDDGKWDDKCKDKCDDKHKDDNCKDEKCDDKCKDDEKC
                     HDHWKGDDKCDKHHCKYPYCEIHNTDCDLLITLCNGVLKDKRDATGEIAVNHQFQFDK
                     PPQNDALHKKGFSIVHTEGTYYLALNHQIEFWHCKVDDKGLYKIYDKSIGDQCSKIEL
                     IVLKSDEKATNDDCDDDCKKKEKYD"
     gene            <1146551..>1147066
                     /locus_tag="CD36_30790"
                     /db_xref="GeneID:8050017"
     mRNA            <1146551..>1147066
                     /locus_tag="CD36_30790"
                     /product="3-hydroxyanthranilate 3,4-dioxygenase, putative"
                     /transcript_id="XM_002422037.1"
                     /db_xref="GeneID:8050017"
     CDS             1146551..1147066
                     /locus_tag="CD36_30790"
                     /EC_number="1.13.11.6"
                     /inference="similar to AA sequence:UniProt:P47096"
                     /inference="similar to AA sequence:UniProt:Q59K86"
                     /note="Similar to S. cerevisiae BNA1; 3-hydroxyanthranilic
                     acid dioxygenase, putative"
                     /codon_start=1
                     /transl_table=12
                     /product="3-hydroxyanthranilate 3,4-dioxygenase, putative"
                     /protein_id="XP_002422082.1"
                     /db_xref="GeneID:8050017"
                     /db_xref="GOA:B9WLX1"
                     /db_xref="InterPro:IPR010329"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:B9WLX1"
                     /translation="MVLAQPINIHKWIEENGDLLKPPVNNFCLHRGGFTIMIVGGPNE
                     RSDYHINQTPEYFYQFKGTMCLKVVDDGEFKDIFIHEGDSFLLPANVPHNPCRYENTI
                     GIVVEQDRPAGVNDKVRWYCQKCQTVIHEVEFYLTDLGTQIKEAIVKFDADLDAKTCK
                     NCGTVNSSKRD"
     gene            complement(<1147143..>1147790)
                     /locus_tag="CD36_30800"
                     /db_xref="GeneID:8050018"
     mRNA            complement(<1147143..>1147790)
                     /locus_tag="CD36_30800"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422038.1"
                     /db_xref="GeneID:8050018"
     CDS             complement(1147143..1147790)
                     /locus_tag="CD36_30800"
                     /inference="similar to AA sequence:UniProt:Q59K85"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422083.1"
                     /db_xref="GeneID:8050018"
                     /db_xref="InterPro:IPR019560"
                     /db_xref="UniProtKB/TrEMBL:B9WLX2"
                     /translation="MSTEVNQTVSKVKGAIEDESITEQESGFRYAAYANRLRTILLAS
                     HRYVAYTSDIGESFRPVAHPYLVKSGYAVSWLYILGDVSYASWITKMKAEGRYEPGLK
                     PWDKAPAPNEVAAKTFTSTHGLVDSDWRLSALKRGIFQSIASMGLPAFTIHSAVRYSS
                     YLFKNSKVPVLKTYGPVAIGLGIVPVLPYIFDEPVEHAVDWVFEQGEDIYHQKFK"
     gene            <1148088..>1148924
                     /locus_tag="CD36_30810"
                     /db_xref="GeneID:8050019"
     mRNA            <1148088..>1148924
                     /locus_tag="CD36_30810"
                     /product="conserved hypothetical protein"
                     /transcript_id="XM_002422039.1"
                     /db_xref="GeneID:8050019"
     CDS             1148088..1148924
                     /locus_tag="CD36_30810"
                     /inference="similar to AA sequence:UniProt:Q59K84"
                     /codon_start=1
                     /transl_table=12
                     /product="conserved hypothetical protein"
                     /protein_id="XP_002422084.1"
                     /db_xref="GeneID:8050019"
                     /db_xref="InterPro:IPR019413"
                     /db_xref="InterPro:IPR025390"
                     /db_xref="UniProtKB/TrEMBL:B9WLX3"
                     /translation="MKLNIIIRFTNSLSASDQVTDLSIPLSINYDVDDVNKLVNVVWL
                     KTTIRNKV