GenomeNet

Database: RefSeq
Entry: NC_012923
LinkDB: NC_012923
Original site: NC_012923 
LOCUS       NC_012923              24579 bp    DNA     circular CON 04-APR-2020
DEFINITION  Streptococcus suis BM407 plasmid pBM407, complete sequence.
ACCESSION   NC_012923
VERSION     NC_012923.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMEA2272697
            Assembly: GCF_000026745.1
KEYWORDS    RefSeq.
SOURCE      Streptococcus suis BM407
  ORGANISM  Streptococcus suis BM407
            Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
            Streptococcus.
REFERENCE   1
  AUTHORS   Holden,M.T., Hauser,H., Sanders,M., Ngo,T.H., Cherevach,I.,
            Cronin,A., Goodhead,I., Mungall,K., Quail,M.A., Price,C.,
            Rabbinowitsch,E., Sharp,S., Croucher,N.J., Chieu,T.B., Mai,N.T.,
            Diep,T.S., Chinh,N.T., Kehoe,M., Leigh,J.A., Ward,P.N.,
            Dowson,C.G., Whatmore,A.M., Chanter,N., Iversen,P., Gottschalk,M.,
            Slater,J.D., Smith,H.E., Spratt,B.G., Xu,J., Ye,C., Bentley,S.,
            Barrell,B.G., Schultsz,C., Maskell,D.J. and Parkhill,J.
  TITLE     Rapid evolution of virulence and drug resistance in the emerging
            zoonotic pathogen Streptococcus suis
  JOURNAL   PLoS ONE 4 (7), e6072 (2009)
   PUBMED   19603075
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 24579)
  AUTHORS   Holden,M.T.G.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-OCT-2008) Holden M.T.G., Pathogen Sequencing Unit,
            The Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            FM252033.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 04/04/2020 08:37:00
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 2,131
            CDSs (total)                      :: 2,059
            Genes (coding)                    :: 1,994
            CDSs (with protein)               :: 1,994
            Genes (RNA)                       :: 72
            rRNAs                             :: 4, 4, 4 (5S, 16S, 23S)
            complete rRNAs                    :: 4, 4, 4 (5S, 16S, 23S)
            tRNAs                             :: 56
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 65
            CDSs (without protein)            :: 65
            Pseudo Genes (ambiguous residues) :: 0 of 65
            Pseudo Genes (frameshifted)       :: 33 of 65
            Pseudo Genes (incomplete)         :: 29 of 65
            Pseudo Genes (internal stop)      :: 9 of 65
            Pseudo Genes (multiple problems)  :: 6 of 65
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..24579
                     /organism="Streptococcus suis BM407"
                     /mol_type="genomic DNA"
                     /strain="BM407"
                     /isolation_source="human case of meningitis"
                     /db_xref="taxon:568814"
                     /plasmid="pBM407"
                     /country="Viet Nam:Ho Chi Minh City"
                     /collection_date="2004"
     gene            43..897
                     /locus_tag="SSUBM407_RS10465"
                     /old_locus_tag="SSUBM407_p001"
     CDS             43..897
                     /locus_tag="SSUBM407_RS10465"
                     /old_locus_tag="SSUBM407_p001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015543629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParA family protein"
                     /protein_id="WP_000409925.1"
                     /translation="MEKEELKILEELRRILSNKNEAIVILNNYFKGGVGKSKLSTMFA
                     YLTDKLNLKVLMIDKDLQATLTKDLAKTFKVELPRVNFYEGLKNGNLASSIVHLTDNL
                     DLIPGTFDLMLLPKLTRSWTFENESRLLATLLAPLKSDYDLIIIDTVPTPSVYTNNAI
                     VASDYVMIPLQAEEESTNNIQNYISYLIDLQEQFNPGLDMIGFVPYLVDTDSATIKSN
                     LEELYKQHKEDNLVFQNIIKRSNKVSTWSKNGITEHKGYDKKVLSMYKNVFFEMLERI
                     IQLENEKE"
     gene            989..1204
                     /locus_tag="SSUBM407_RS10470"
                     /old_locus_tag="SSUBM407_p002"
     CDS             989..1204
                     /locus_tag="SSUBM407_RS10470"
                     /old_locus_tag="SSUBM407_p002"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000260238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-binding protein"
                     /protein_id="WP_001835296.1"
                     /translation="MIVGNLGAQKAKRNDTPISAKKDIMGDKTVRVRADLHHIIKIET
                     AKNGGNVKEVMDQALEEYIRKYLPDKL"
     gene            1221..1493
                     /locus_tag="SSUBM407_RS10475"
                     /old_locus_tag="SSUBM407_p003"
     CDS             1221..1493
                     /locus_tag="SSUBM407_RS10475"
                     /old_locus_tag="SSUBM407_p003"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002333002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin"
                     /protein_id="WP_000301765.1"
                     /translation="MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEV
                     NLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKEKVA"
     gene            1495..2358
                     /locus_tag="SSUBM407_RS10480"
                     /old_locus_tag="SSUBM407_p004"
     CDS             1495..2358
                     /locus_tag="SSUBM407_RS10480"
                     /old_locus_tag="SSUBM407_p004"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010782381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin zeta"
                     /protein_id="WP_001284311.1"
                     /translation="MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGS
                     GKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYSNRMTEAI
                     ISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
                     TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETP
                     SISPKETLEKELNRKVSGKEIQPTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTP
                     PIPKTPKLPGI"
     repeat_region   2609..2631
                     /note="inverted repeat"
     repeat_region   complement(2628..3394)
                     /note="IS1216 element"
     gene            complement(2663..3343)
                     /locus_tag="SSUBM407_RS10485"
                     /old_locus_tag="SSUBM407_p005"
     CDS             complement(2663..3343)
                     /locus_tag="SSUBM407_RS10485"
                     /old_locus_tag="SSUBM407_p005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_064305258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS6-like element IS1216 family transposase"
                     /protein_id="WP_001015311.1"
                     /translation="MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSH
                     TTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDI
                     WLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIK
                     YLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEI
                     KVLLGIPA"
     repeat_region   complement(3395..3417)
                     /note="inverted repeat"
     gene            complement(<3409..4065)
                     /locus_tag="SSUBM407_RS10490"
                     /old_locus_tag="SSUBM407_p006"
                     /pseudo
     CDS             complement(<3409..4065)
                     /locus_tag="SSUBM407_RS10490"
                     /old_locus_tag="SSUBM407_p006"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018378534.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
     gene            complement(4069..4401)
                     /locus_tag="SSUBM407_RS10495"
                     /old_locus_tag="SSUBM407_p007"
     CDS             complement(4069..4401)
                     /locus_tag="SSUBM407_RS10495"
                     /old_locus_tag="SSUBM407_p007"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LytTR family transcriptional regulator
                     DNA-binding domain-containing protein"
                     /protein_id="WP_012774870.1"
                     /translation="MNFLIVNKDDISMKLFLEDIFYISSDTTKPHMLKAVTESGVFEF
                     YGTLKDLEDKLKLNFFRCHRKFLVNIDKIQGLNLSERLIVFTNDGVGTISFSRYKQKE
                     LNKLWRRG"
     gene            4591..4959
                     /locus_tag="SSUBM407_RS10500"
                     /old_locus_tag="SSUBM407_p008"
     CDS             4591..4959
                     /locus_tag="SSUBM407_RS10500"
                     /old_locus_tag="SSUBM407_p008"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044981369.1"
                     /translation="MFYIIEQQNKNLQITKIISDYLKNRYPKIAFKILQSFKAPPTHQ
                     SNTYFIINEDICLNEQELEVAKNIRKNDRFGHIILISKNINYLQLFRSHINFLEIIDC
                     NNNLKEDIYNCIDFLNKNIS"
     gene            complement(4988..5578)
                     /locus_tag="SSUBM407_RS10505"
                     /old_locus_tag="SSUBM407_p009"
     CDS             complement(4988..5578)
                     /locus_tag="SSUBM407_RS10505"
                     /old_locus_tag="SSUBM407_p009"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016177603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
                     /protein_id="WP_012774871.1"
                     /translation="MSRIGYIRISSKDQNLDRQVENLSDVFKVFSDKLSGKDKNRPGL
                     EELLSFIREGDIVVVSELDRLGRNNKELTEVISMIHSKGATLEILSFPSLIGIKDDNL
                     RRLLNNLIIEIYKYQAEAERVRLLERQRQGIEIAKRKGKYKGRKPLFTSASPQLQHAF
                     ELFKSGCSDRDIEDLVGINARTFRRYREKFGIKRTT"
     gene            complement(5724..7208)
                     /locus_tag="SSUBM407_RS10510"
                     /old_locus_tag="SSUBM407_p010"
     CDS             complement(5724..7208)
                     /locus_tag="SSUBM407_RS10510"
                     /old_locus_tag="SSUBM407_p010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003078069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primase C-terminal domain-containing protein"
                     /protein_id="WP_044981370.1"
                     /translation="MNIEKIHQMILKDGLRQFKFKNSKHENTPFEEQKGAIFGYRSKK
                     NMTAGRGIVLTSLEAVEDNQTVFTHWTPNVYRYGTYSQKNPRITKGHSENNLRQINAF
                     YIDFDLKNQSDNINFSDILVSSLDLGFMPTLILKTENGYQAYFILKDAAYVTAATEFK
                     VVNVAKMISQNIRNHFIKDLPVDMTCNHFGIARIPREDNIEYFDQNNVYTFAEWFNWS
                     MQQDDLTYSKKPNLLVLSGTEGQKQIDEPWYRLLKNTSKIRGEKAIMGRNNVIFTLAL
                     ANYASGVAYSDCMEELSDYNAELEVPLKKNELKKTIASAYSGRYEAANRDFIKILCQT
                     WISSDLTTKDLFIRQGWYKFKKSRDQRQRSHFSEWREDFWNYIKQKTNSDSPYLRVKK
                     KEITATIGIPERSLDYVLKTLQSEGKILYSFKRGRQGGIILASISNIALSLISMNKKA
                     REAYYIALSRILGVSKGILIKLLKRAIIGLTTPQTSSLFELDTG"
     gene            complement(7586..7783)
                     /locus_tag="SSUBM407_RS10515"
     CDS             complement(7586..7783)
                     /locus_tag="SSUBM407_RS10515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018372616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_044475471.1"
                     /translation="MAELKNNVKRFRVRKAFTQEQLASKVNCSRQLISSIERGKMVPS
                     VLIALKIAKILEVCVDDIFTF"
     gene            complement(7904..8056)
                     /locus_tag="SSUBM407_RS10520"
     CDS             complement(7904..8056)
                     /locus_tag="SSUBM407_RS10520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001180497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class IIb bacteriocin, lactobin A/cerein 7B
                     family"
                     /protein_id="WP_044475472.1"
                     /translation="MENIKKFEEVSTEELTSVEGGVGVLAVIGWSLLAAGGSGLVGYG
                     LARTFG"
     gene            complement(8195..8380)
                     /locus_tag="SSUBM407_RS10525"
     CDS             complement(8195..8380)
                     /locus_tag="SSUBM407_RS10525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000180829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class IIb bacteriocin, lactobin A/cerein 7B
                     family"
                     /protein_id="WP_044475473.1"
                     /translation="MTKFETMDKMNVDFVALSDRELMDMEGGIIPVAVAAGIVASAAF
                     AGLSAGVTIGISRNGRK"
     gene            complement(9053..9214)
                     /locus_tag="SSUBM407_RS10530"
     CDS             complement(9053..9214)
                     /locus_tag="SSUBM407_RS10530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004181943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class IIb bacteriocin, lactobin A/cerein 7B
                     family"
                     /protein_id="WP_079395234.1"
                     /translation="MNKFNTLCDDELVMIEGGLDPFTVTIGLGTLFLAAASGGYAFGK
                     DLANRQRRK"
     gene            complement(9412..9621)
                     /locus_tag="SSUBM407_RS10535"
     CDS             complement(9412..9621)
                     /locus_tag="SSUBM407_RS10535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000180816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class IIb bacteriocin, lactobin A/cerein 7B
                     family"
                     /protein_id="WP_044475475.1"
                     /translation="MTKFETMDKMNVDFVALTEEELMNVDGGLLPVVVGGVVVGWKVA
                     AGVTAGVIAGGVAIGAAAGYFANRP"
     gene            complement(9930..>10256)
                     /locus_tag="SSUBM407_RS10540"
                     /old_locus_tag="SSUBM407_p011"
                     /pseudo
     CDS             complement(9930..>10256)
                     /locus_tag="SSUBM407_RS10540"
                     /old_locus_tag="SSUBM407_p011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002943485.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(10376..10531)
                     /locus_tag="SSUBM407_RS10545"
     CDS             complement(10376..10531)
                     /locus_tag="SSUBM407_RS10545"
                     /inference="COORDINATES: protein motif:HMM:TIGR03949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class IIb bacteriocin, lactobin A/cerein 7B
                     family"
                     /protein_id="WP_153308592.1"
                     /translation="MTNFEVIDKTNFVALSEVEMMETEGGFATGLGIAIGTVAVYCIG
                     YMIGKNK"
     gene            complement(10543..10686)
                     /locus_tag="SSUBM407_RS10550"
     CDS             complement(10543..10686)
                     /locus_tag="SSUBM407_RS10550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003080524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class IIb bacteriocin, lactobin A/cerein 7B
                     family"
                     /protein_id="WP_153585982.1"
                     /translation="MALSEAEMMETEGGFVVTGTMIYTGVKLASASFALGYAIGQAIK
                     NSK"
     gene            complement(10890..11027)
                     /locus_tag="SSUBM407_RS10555"
     CDS             complement(10890..11027)
                     /locus_tag="SSUBM407_RS10555"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_153585979.1"
                     /translation="MKTLTQKELVKTTGGSIIGLIGKGQTLRSPRIYLPGPVKPKLEV
                     M"
     gene            complement(11145..11330)
                     /locus_tag="SSUBM407_RS10560"
     CDS             complement(11145..11330)
                     /locus_tag="SSUBM407_RS10560"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044475477.1"
                     /translation="MTKLIDIDMTKLMDILMFSSLSCSFMYFLGAYLSGKSFDNPLTF
                     VMLSGAVAGVLHLLDRV"
     gene            complement(11342..11497)
                     /locus_tag="SSUBM407_RS10565"
     CDS             complement(11342..11497)
                     /locus_tag="SSUBM407_RS10565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003080524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class IIb bacteriocin, lactobin A/cerein 7B
                     family"
                     /protein_id="WP_079395235.1"
                     /translation="MNNFVDMKQEELENINGGFVVTGTMIYTGVKLASASFALGYAIG
                     QAIKNSK"
     gene            complement(11508..11669)
                     /locus_tag="SSUBM407_RS10570"
     CDS             complement(11508..11669)
                     /locus_tag="SSUBM407_RS10570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000180826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin"
                     /protein_id="WP_153585981.1"
                     /translation="MTKFDTLDNMNFVALSESEMMETDGGLVITGPAIVGGLIVVGFG
                     GLGLYLGSK"
     gene            complement(11869..12765)
                     /locus_tag="SSUBM407_RS10575"
                     /old_locus_tag="SSUBM407_p012"
     CDS             complement(11869..12765)
                     /locus_tag="SSUBM407_RS10575"
                     /old_locus_tag="SSUBM407_p012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002943485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyl transferase AbiEii/AbiGii toxin
                     family protein"
                     /protein_id="WP_012774874.1"
                     /translation="MTPDEIRNTILKAIYSDTELVENLVLKGGNALKLHRIVDRESQD
                     LDFSIKETIRFTKENEGVKLQQLITDAFRQKGFFVNSFEFVPKPKNRHRDLPPFWGGY
                     KISFALLDQEKYQDKINSQDSRQMKELNKYALSIEGGVKKIEIDLSYDEYTEHKEAYD
                     LDGTTIYLYSPLMIVYEKIRASCQQLEEYPLTTNKTRARDLYDIFKTLTNINQVELRS
                     EVLSEDNFYILENIFRVKEVPLELMTKLDTKKDDLAADYERKVLPQISNKDREEFEYI
                     FDYNQRLFNELFEKYQKYNESR"
     gene            12966..13949
                     /locus_tag="SSUBM407_RS10580"
                     /old_locus_tag="SSUBM407_p013"
     CDS             12966..13949
                     /locus_tag="SSUBM407_RS10580"
                     /old_locus_tag="SSUBM407_p013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002943483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012774875.1"
                     /translation="MVLSDEKIQNILLEKKITKDASNLVKYSDEIVIQARKEFGNILN
                     RTSIIKILNDFKQSNKLKKSASVSKFIDIIIDKLGLFEPIKILNEYKGETVTRYIATD
                     VQISPYEIALSLLSKSFLSHYSALFVNDLTINNPKDIYINKEQSKKDFYSNNEQNISQ
                     GRIDYAFSKKMRRTNMIYSFTYDETSYKVHVLNSKNTNNTGVVLKNVVGFSKPVRTTN
                     IERTLIDATVRPGYSGGALEILEAFLRAKNELNSKQLWSYLKKFNYSYPYHKAIAFYL
                     KYSDYSYKNELVDFCNNDNQNSLTFYLDYQMVSPQKDDELGIYFPKMIPLK"
     repeat_region   13968..13990
                     /note="inverted repeat"
     repeat_region   complement(13991..14753)
                     /note="IS1216 element"
     gene            complement(14022..14702)
                     /locus_tag="SSUBM407_RS10585"
                     /old_locus_tag="SSUBM407_p014"
     CDS             complement(14022..14702)
                     /locus_tag="SSUBM407_RS10585"
                     /old_locus_tag="SSUBM407_p014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_064305258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS6-like element IS1216 family transposase"
                     /protein_id="WP_001015311.1"
                     /translation="MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSH
                     TTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDI
                     WLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIK
                     YLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEI
                     KVLLGIPA"
     repeat_region   complement(14754..14776)
                     /note="inverted repeat"
     gene            complement(14890..18540)
                     /gene="addA"
                     /locus_tag="SSUBM407_RS10590"
                     /old_locus_tag="SSUBM407_p015"
     CDS             complement(14890..18540)
                     /gene="addA"
                     /locus_tag="SSUBM407_RS10590"
                     /old_locus_tag="SSUBM407_p015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014638042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase-exonuclease AddAB subunit AddA"
                     /protein_id="WP_012775061.1"
                     /translation="MAFEQFLSAEEIKAVQLAEAHSDKQQKRTAEQIEAIYTHGQNVL
                     VSASAGSGKTFVMVQRILDKLKRGIGIDQLFISTFTVKAAGELKERIEKKLNETIAET
                     TDMELRRHLSAQLADLTKADIGTMDSFTQKLVTTYGYSLGISPQFRILQDETEKASLK
                     KEVFDQLFADYLEEDENGAFRKLVRNFSGNRKDNSGFRQVVYQVHDFSQSTSSPTKWL
                     KEQAVQADLYSQERIEQMLEQGFKEKVLDKLYQAADFFRYHVEWGRNDFGSAKYFANV
                     EEVLDLLTGLDSLDQKDLMERVERILLINNQSRGKGLTNANRPKDEHLIAFKEEYNAG
                     KSQIISELRDLGQEVYELTLLKDYQVQALPLLILLRDFVLDFSQAYLDVKIKEAAFEF
                     GDIGHFAIRILEENADIRQFFQEKYHEVMVDEYQDNNHSQERMLDLLSNGHNRFMVGD
                     IKQSIYRFRQADPMIFQEKFELYQANPQSGKLILLKENFRSQIEVLEATNAIFTRLMD
                     RQVGEIKYDDTHSLVAGSPGQKIAQPKNEMEYLIYDQQDSANSSTDAEEETPLTAGEI
                     EVVAKEIIRLHNEEGADFKDITLLVQKRTHNDLIMSIFEKHGIPIVADGGAASYLQSL
                     EVMIMLDTLRVINNPLNDYALVALLKSPMFRFDEDELTRISLQAGTGFFYQKMEIAQQ
                     ASGQHPELMSEKLKKKITDFLSILENWRAYAKLHSIYDMIWKMFNEKFYYDYVGALPN
                     GSKRQANLYALGLRANQFEKTGYKGLSRFIAMIDRALANDKDLADVQEFLPQNAVQLM
                     TIHKSKGLEFKYVFLMNIDKRFNLEDHYQSVIISRKNGLGIQYLADMKDKVNSPLPQV
                     RVLMNTLPYQNNLQELKIANLSEQMRLLYVALTRAEKKLYLVGKGNADKLAEKYDGKK
                     ENGVLAQSTRESMATFQDWILAIDEAFSGEDLHFKKVFVTDEDLTEEKIGKLTLKSKL
                     EDASLKDIRQSEDIAQALDQLSSVQELNERYKAAIELPSLRTPSQIKKLYEPILEQEG
                     MEVMEKYQPKRTFNLPDFSKKPKITGAQVGSAVHELMQRLDLSWLVTEDTVRAALEAV
                     HAEQAIKDKINVQMILDFFDTDLGREILANTDKLHREAPFASLQTDSVSQENFVLRGI
                     IDGYLLYDDHIVLFDYKTDKYDQPIQLSQRYQAQMQLYAEALKKAYKIDRVDCHLILL
                     GGERIEVVEVNI"
     gene            complement(18540..21806)
                     /gene="rexB"
                     /locus_tag="SSUBM407_RS10595"
                     /old_locus_tag="SSUBM407_p016"
     CDS             complement(18540..21806)
                     /gene="rexB"
                     /locus_tag="SSUBM407_RS10595"
                     /old_locus_tag="SSUBM407_p016"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent nuclease subunit B"
                     /protein_id="WP_012774876.1"
                     /translation="MKLVYTDIRNPLTQYLTEQTATFAEQGKRVFYIAPNSLSFEMER
                     KVLEYLPEQATFDIIVTRFGQLARYLMIDRKEAGQPLDDVGLAMIFFRVLSQFEDGDL
                     KVYGRLQTDFGFINQLVALYKELQRANMSILDLEAMDSPDKQADLVKIFLAVTDILSK
                     EGFEHQSKLAQLTGLVETGQLDEQLKNIVLVVDGFSRFSAEEEALVSALNERVSEILI
                     GVYASKKAVQATYAEGNVYQANVDFLRQLSAQFQTKATYIGQEPVLDSIGKFSKNMEA
                     YYDYSGTMIDLTPADQEKIQLWEVVNQKEEVEQVATAIRQHVHQGARYKDILLLLGDV
                     DSYKLQIGKIFDKYDIPYYFGKAEEMSHHPLVHFVESLERLRRYRFRAEDLLNLLKSG
                     LYASISQKELDLFESYILFADMKGQAAFSRAFSVNGRADYDAEVIKEKRLVYDLTVLE
                     PLRAKIMEPLNQLFKAGPQSGTALLEKFMAFLEAIDLPKNMEKMSRNLSEVEQEKEEQ
                     VWKSFTHLLENFHQIFGKEKLKMDDFLAILQAGMQASHYRTVPATVDVVNVKSYDLIE
                     PHTAKYVYAIGMGQSNFPKVAKNTSLLTEEEMEKVNLVSASSSRFDLVSRENIKKNHA
                     AMMSLLNSATEQLVISTPQIYNEGEDSLSPYIKILQKMGLKSEERGRIKTLSPQDIGH
                     YKSLLSRLIESERPSLETEEWEGQRAFWTVLVRHLKKKLESQSIEIPTITGDIASKQL
                     SDETLAALYPEDKPLNLSASSLTNFYNNQYLYFVRNVLRLREQESIHPTAFQHGLFLH
                     RIFERVVMDQSELDFDQKVDKAILCTRDEAEFAMFYNQDADARYTEEVLDKIARSSAT
                     ILRDNDLVEIDGQEKSFRQDKALVFDLQNGKSVHVNGTIDRLDTLQINQAVGVVDYKS
                     SDQSFSVGDFYNGLKPQLVTYLAALQELDETKDKPVFGAMYLHLQDPIIKLKDTKNLE
                     QLEGAANTSLVYKGLFLKEESLGLNHFYQTRNQLYTEDEFAVLLNHNQELYKQAAMDI
                     LAGRFAINPYTKDGRSVAGEQLKAITGFEADRHMGMARRLVKEAKRQDWMERMKGGQD
                     "
     gene            complement(22097..>23536)
                     /locus_tag="SSUBM407_RS10600"
                     /old_locus_tag="SSUBM407_p017"
                     /pseudo
     CDS             complement(22097..>23536)
                     /locus_tag="SSUBM407_RS10600"
                     /old_locus_tag="SSUBM407_p017"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775059.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="LPXTG cell wall anchor domain-containing
                     protein"
     repeat_region   23539..23561
                     /note="inverted repeat"
     repeat_region   complement(23562..24324)
                     /note="IS1216 element"
     gene            complement(23593..24273)
                     /locus_tag="SSUBM407_RS10605"
                     /old_locus_tag="SSUBM407_p018"
     CDS             complement(23593..24273)
                     /locus_tag="SSUBM407_RS10605"
                     /old_locus_tag="SSUBM407_p018"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_064305258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS6-like element IS1216 family transposase"
                     /protein_id="WP_001015311.1"
                     /translation="MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSH
                     TTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDI
                     WLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIK
                     YLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEI
                     KVLLGIPA"
     repeat_region   complement(24325..24347)
                     /note="inverted repeat"
     gene            <24349..24477
                     /locus_tag="SSUBM407_RS10610"
                     /pseudo
     CDS             <24349..24477
                     /locus_tag="SSUBM407_RS10610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000108743.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="topoisomerase"
CONTIG      join(FM252033.1:1..24579)
//
DBGET integrated database retrieval system