GenomeNet

Database: RefSeq
Entry: NC_012926
LinkDB: NC_012926
Original site: NC_012926 
LOCUS       NC_012926            2146229 bp    DNA     circular CON 04-APR-2020
DEFINITION  Streptococcus suis BM407, complete genome.
ACCESSION   NC_012926
VERSION     NC_012926.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMEA2272697
            Assembly: GCF_000026745.1
KEYWORDS    RefSeq; complete genome.
SOURCE      Streptococcus suis BM407
  ORGANISM  Streptococcus suis BM407
            Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
            Streptococcus.
REFERENCE   1
  AUTHORS   Holden,M.T., Hauser,H., Sanders,M., Ngo,T.H., Cherevach,I.,
            Cronin,A., Goodhead,I., Mungall,K., Quail,M.A., Price,C.,
            Rabbinowitsch,E., Sharp,S., Croucher,N.J., Chieu,T.B., Mai,N.T.,
            Diep,T.S., Chinh,N.T., Kehoe,M., Leigh,J.A., Ward,P.N.,
            Dowson,C.G., Whatmore,A.M., Chanter,N., Iversen,P., Gottschalk,M.,
            Slater,J.D., Smith,H.E., Spratt,B.G., Xu,J., Ye,C., Bentley,S.,
            Barrell,B.G., Schultsz,C., Maskell,D.J. and Parkhill,J.
  TITLE     Rapid evolution of virulence and drug resistance in the emerging
            zoonotic pathogen Streptococcus suis
  JOURNAL   PLoS ONE 4 (7), e6072 (2009)
   PUBMED   19603075
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2146229)
  AUTHORS   Holden,M.T.G.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-OCT-2008) Holden M.T.G., Pathogen Sequencing Unit,
            The Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            FM252032.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 04/04/2020 08:37:00
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 2,131
            CDSs (total)                      :: 2,059
            Genes (coding)                    :: 1,994
            CDSs (with protein)               :: 1,994
            Genes (RNA)                       :: 72
            rRNAs                             :: 4, 4, 4 (5S, 16S, 23S)
            complete rRNAs                    :: 4, 4, 4 (5S, 16S, 23S)
            tRNAs                             :: 56
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 65
            CDSs (without protein)            :: 65
            Pseudo Genes (ambiguous residues) :: 0 of 65
            Pseudo Genes (frameshifted)       :: 33 of 65
            Pseudo Genes (incomplete)         :: 29 of 65
            Pseudo Genes (internal stop)      :: 9 of 65
            Pseudo Genes (multiple problems)  :: 6 of 65
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2146229
                     /organism="Streptococcus suis BM407"
                     /mol_type="genomic DNA"
                     /strain="BM407"
                     /isolation_source="human case of meningitis"
                     /db_xref="taxon:568814"
                     /country="Viet Nam:Ho Chi Minh City"
                     /collection_date="2004"
     gene            join(2146228..2146229,1..1372)
                     /gene="dnaA"
                     /locus_tag="SSUBM407_RS00005"
                     /old_locus_tag="SSUBM407_0001"
     CDS             join(2146228..2146229,1..1372)
                     /gene="dnaA"
                     /locus_tag="SSUBM407_RS00005"
                     /old_locus_tag="SSUBM407_0001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002922822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_011921628.1"
                     /translation="MNQEQLFWQRFIELAKVNFKPSIYDFYVADAKLLGINQQVANIF
                     LNRPFKKDFWEKNFEELMIAASFESYGEPLTIQYQFTEDEQEIRNTTNTRSSIVHQVQ
                     TLEPATPQETFKPVHSDIKSQYTFANFVQGDNNHWAKAAALAVSDNLGELYNPLFIFG
                     GPGLGKTHILNAIGNKVLADNPQARIKYVSSETFINEFLEHLRLNDMESFKKTYRNLD
                     LLLIDDIQSLRNKATTQEEFFHTFNALHEKNKQIVLTSDRNPDHLDNLEERLVTRFKW
                     GLTSEITPPDFETRIAILRNKCENLPYNFTNETLSYLAGQFDSNVRDLEGALKDIHLI
                     ATMRQLSEISVEVAAEAIRSRKQTNPQNMVIPIEKIQTEVGNFYGVSLKELKGSKRVQ
                     HIVHARQVAMFLAREMTDNSLPKIGKEFGNRDHTTVMHAYNKIKTLLLDDENLEIEIT
                     SIKNKLR"
     gene            1526..2662
                     /gene="dnaN"
                     /locus_tag="SSUBM407_RS00010"
                     /old_locus_tag="SSUBM407_0002"
     CDS             1526..2662
                     /gene="dnaN"
                     /locus_tag="SSUBM407_RS00010"
                     /old_locus_tag="SSUBM407_0002"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002894295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_004194538.1"
                     /translation="MIQFSINKNIFLQALSITKRAISTKNAIPILSTVKITVTSEGIT
                     LTGSNGQISIEHFISIQDENAGLLISSPGSILLEAGFFINVVSSMPDLVLDFNEIEQK
                     QIVLTSGKSEITLKGKEAEQYPRLQEVPTSKPLVLETKVLKQTINETAFAASTQESRP
                     ILTGVHFVLTENKNLKTVATDSHRMSQRKLVLDTSGDDFNVVIPSRSLREFTAVFTDD
                     IETVEVFFSNNQILFRSEHISFYTRLLEGTYPDTDRLIPTEFKTTAIFDTANLRHSME
                     RARLLSNATQNGTVKLEIANNVVSAHVNSPEVGRVNEELDTVEVSGEDLVISFNPTYL
                     IEALKATTSEQVKISFISSVRPFTLIPNNEGEDFIQLVTPVRTN"
     gene            2754..3635
                     /locus_tag="SSUBM407_RS00015"
                     /old_locus_tag="SSUBM407_0003"
     CDS             2754..3635
                     /locus_tag="SSUBM407_RS00015"
                     /old_locus_tag="SSUBM407_0003"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011921629.1"
                     /translation="MTLYILANPNAGSHTAEHIIFKIKESYPQLAVNIFMTVGPEDEK
                     SQIEAILKEFVSSEDQLMILGGDGTLSKALRFWPASLPFAYYPTGSGNDFAKAMNITS
                     LYRSVDAILERKTSRIYVLNSSYGTVVNSMDFGFAAQVINGSTNSILKKILNKVKLGK
                     LTYLFFGIKTLFSKQAINLELTLDEKSYQLDNLFFISVANSLYFGGGIMIWPTASAKK
                     KEVDIVYFKNGNFYQRLQSLLALLTKRHESSHTIQHLTGVDVVLKSKEKLLLQIDGET
                     CTANEVTLTYQERSMYL"
     gene            3645..3848
                     /locus_tag="SSUBM407_RS00020"
                     /old_locus_tag="SSUBM407_0004"
     CDS             3645..3848
                     /locus_tag="SSUBM407_RS00020"
                     /old_locus_tag="SSUBM407_0004"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF951 domain-containing protein"
                     /protein_id="WP_011922523.1"
                     /translation="MYQLGTFVEMKKPHACVIKSTGKKANKWEVIRLGADIKIRCTNC
                     DHVVMMSRHDFERKMKQVLPSEA"
     gene            3952..4311
                     /locus_tag="SSUBM407_RS00025"
                     /old_locus_tag="SSUBM407_0005"
     CDS             3952..4311
                     /locus_tag="SSUBM407_RS00025"
                     /old_locus_tag="SSUBM407_0005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_012775462.1"
                     /translation="MKQLAQQIRVLRTAKNLSQDELAEKLYISRQAVSEWENGEATPD
                     IDKLVQLAEIFGVSLDYLVLGKEPEKEIVVEQRGKMNGWEFLNEESKRPLTRGDVVLL
                     IFLAVMLLGGLFIKHYF"
     gene            4397..5512
                     /gene="ychF"
                     /locus_tag="SSUBM407_RS00030"
                     /old_locus_tag="SSUBM407_0006"
     CDS             4397..5512
                     /gene="ychF"
                     /locus_tag="SSUBM407_RS00030"
                     /old_locus_tag="SSUBM407_0006"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002269933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="redox-regulated ATPase YchF"
                     /protein_id="WP_012774879.1"
                     /translation="MSLTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMV
                     EVPDERLQKLTELIIPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVH
                     VVRAFDDENVMREQGREDAFVDPIADIDTINLELILADLESINKRYARVEKMARTQKD
                     KDSVAEFAVLEKIKPVLEDGKSARTVEFTDEEQKIVKQLFLLTTKPVLYVANVDEDKV
                     ADPEAISYVQQIRDFAATENAEVVVISARAEEEISELDDEDKGEFLEALGLTESGVDK
                     LTRAAYHLLGLGTYFTAGEKEVRAWTFKRGMKAPQCAGIIHSDFEKGFIRAVTMSYDD
                     LMTYGSEKAVKEAGRLREEGKEYVVQDGDIMEFRFNV"
     gene            5670..6239
                     /locus_tag="SSUBM407_RS00035"
                     /old_locus_tag="SSUBM407_0007"
     CDS             5670..6239
                     /locus_tag="SSUBM407_RS00035"
                     /old_locus_tag="SSUBM407_0007"
                     /EC_number="3.1.1.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015604161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoacyl-tRNA hydrolase"
                     /protein_id="WP_011921633.1"
                     /translation="MTRLIIGLGNPGDRYFETKHNVGFMLLDKIAKRENVTFNHDKIF
                     QADIATTFIDGEKIYLVKPTTFMNESGKAVHALMTYYGLDATDILVAYDDLDMAVGKI
                     RFRQKGSAGGHNGIKSIVKHIGTQEFDRIKIGIGRPKGKMSVVNHVLSGFDIEDRIEI
                     DLALDKLDKAVNVYLEEDDFDTVMRKFNG"
     gene            6239..9733
                     /gene="mfd"
                     /locus_tag="SSUBM407_RS00040"
                     /old_locus_tag="SSUBM407_0008"
     CDS             6239..9733
                     /gene="mfd"
                     /locus_tag="SSUBM407_RS00040"
                     /old_locus_tag="SSUBM407_0008"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015604162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription-repair coupling factor"
                     /protein_id="WP_011921634.1"
                     /translation="MNILDLLHKNKQINQWQSGLNQSTRQLLLGLSGTSKSLIMATAY
                     DCLAEKIMIVTATQNDAEKLVADLTAIIGSENVYNFFTDDSPIAEFVFASKERTQSRI
                     DSLNFLTDSTSSGILVASIVACRVLLPSPETYKGSKIQLEVGQEIEVDKLVKNLVNIG
                     YKKVSRVLTQGEFSQRGDILDIFDMQSETPYRIEFFGDEIDGIRIFDVDSQKSLENLD
                     EISISPASDIILSSEDYSRASQYIQTAIEQSTLEEQQSYLREVLADMQTEYRHPDLRK
                     FLSCIYEQSWTLLDYLPKSSPLFLDDFHKIADKQAQFEKEIADLLTDDLQKGKTVSSL
                     KYFASTYAELRKYKPATFFSSFQKGLGNVKFDALYQFTQHPMQEFFHQIPLLKDELTR
                     YAKSNNTVVIQASSDVSLQTLQKNLQEYDIHLPVHAADKLVEGQQQVTIGQLASGFHL
                     MDEKLVFITEKEIFNKKMKRKTRRTNISNAERIKDYSELAVGDYVVHHVHGIGQYLGI
                     ETIEISGIHRDYLTVQYQNSDRISIPVEQIDLLSKYLASDGKAPKVNKLNDGRFQRTK
                     QKVQKQVEDIADDLIKLYAERSQLKGFAFSPDDENQVEFDNYFTHVETDDQLRSIDEI
                     KKDMEKDSPMDRLLVGDVGFGKTEVAMRAAFKAVNDGKQVAILVPTTVLAQQHYANFQ
                     ERFAEFPVNVDVMSRFKTKAEQEKTLEKLKKGQVDILIGTHRLLSKDVVFADLGLLVI
                     DEEQRFGVKHKERLKELKKKIDVLTLTATPIPRTLQMSMLGIRDLSVIETPPTNRYPV
                     QTYVMETNPSVIRDAMLREIDRGGQVYYLYNKVDTIEQKVSELKELVPEATIGYVHGQ
                     MSEIQLENTLYAFVEGEYDILVTTTIIETGVDIPNANTLFIENADHMGLSTLYQLRGR
                     VGRSSRIAYAYLMYRPDKSLTEVAEKRLEAIKGFTELGSGFKIAMQDLSIRGAGNILG
                     AAQSGFIDSVGYEMYSQLLEQAILEKQGKATQRQKSNSEVNLQIDAYLPSDYIGDQRQ
                     KIEIYKRIKNIDSRVNYQELQEELIDRFGEYPDVVAYLLEIGLLKSFLDQVFCHTVLR
                     RQHQVTVTFEPMAGQIFLTQDYFEALSVTNLKAQITENKGKLAVVFNIQQKKEYEILE
                     ELISFAEKLKEIKARKAE"
     gene            9783..10055
                     /locus_tag="SSUBM407_RS00045"
                     /old_locus_tag="SSUBM407_0009"
     CDS             9783..10055
                     /locus_tag="SSUBM407_RS00045"
                     /old_locus_tag="SSUBM407_0009"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding S4 domain-containing protein"
                     /protein_id="WP_004194330.1"
                     /translation="MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVN
                     DQVEIQFGNKLLTVKVLEMKDSTKKEDALKMYEIISEKRIEKDEEI"
     gene            10042..10410
                     /locus_tag="SSUBM407_RS00050"
                     /old_locus_tag="SSUBM407_0010"
     CDS             10042..10410
                     /locus_tag="SSUBM407_RS00050"
                     /old_locus_tag="SSUBM407_0010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation initiator family protein"
                     /protein_id="WP_004194327.1"
                     /translation="MKKSKILQLNNAFIQSERKKTQHQLAERQQKNRFMGAILILVIF
                     LFMLPAYNLVGTYTNIQQQEKKLAELEKNYEELTKEQKQEAEMVAKLKNEEYAAKYVR
                     AKYQYSKEGEFVYNIPGLPK"
     gene            10533..11813
                     /locus_tag="SSUBM407_RS00055"
                     /old_locus_tag="SSUBM407_0012"
     CDS             10533..11813
                     /locus_tag="SSUBM407_RS00055"
                     /old_locus_tag="SSUBM407_0012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydrolase"
                     /protein_id="WP_011921635.1"
                     /translation="MQKKLLVWLLPVLFGWQVVDSTEIPFELTAQEEYELTHTIYDQY
                     FQTIPQNPNVFQTENLYSDEELTIAGGQLQPNQHFSITDVLVNSKKELVFQIDDKGYI
                     LASRHLLFDDVIVTETTVEQTYWTKKGFTLLTSPIANEATEIKNDLQPYQAVMVSKIV
                     TTSLGDFAYVTDKGWIAVNNLSKTDNRVEAVQELLTNKYSKDTIGIYVKQLSTGQTAG
                     VNQEKLFYSASIAKLPILYYVQEQLNAGYIDLTTKVKYTAESISFPGAYVAGGSGSLS
                     KTPDNKDYSVEELINKTAKESDNVASNLLSYYVANKFDSNFYQVITAKTGSEWSMVTR
                     ETSAEIAGKMMEALYIQNGYVLESLLSTQFDNQRISKDISVPVAHKIGDADDVKHDVA
                     IVYAGSPFVLSIFTDKSNYDEITQIANDIYRILK"
     gene            11814..13082
                     /gene="tilS"
                     /locus_tag="SSUBM407_RS00060"
                     /old_locus_tag="SSUBM407_0013"
     CDS             11814..13082
                     /gene="tilS"
                     /locus_tag="SSUBM407_RS00060"
                     /old_locus_tag="SSUBM407_0013"
                     /EC_number="6.3.4.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA lysidine(34) synthetase TilS"
                     /protein_id="WP_011921636.1"
                     /translation="MKDRFLKVTLDGHFFDKHKKVLVAVSGGLDSMNLFHLLYECKQV
                     LGIELGIAHINHGQREESVIEEKYLRQLAEESNVPFYLSYFEGVFSEEAARKWRYGFF
                     ATIMEKEGYTALVTAHHADDQAETVFMRLIRGGRLRHLSAIQPTQPFATGELIRPLLS
                     FKKADFEKLFHFEDCSNADFKYFRNRVRNDYLPKLKQENPKIELTLNNLAVDTNNLFQ
                     ALRDLTQDLSVTDVMSFQQQTPAVQSYLLEEYLEKFPDLQLSRPQFNEVLHILRSKAN
                     YYHLLKNDYMLEKDYHRFQIYKIGPETDSQPEKIMIESEGIFSYGSYIFSLNHPLEEA
                     DSILYFPTENPIVVRRRQAGDTILINGVNKKLRRWFIDNKISQKVRQNALIIEQNGEI
                     YGITNLVSSDLSKSVKNDIIKATLYIKMKE"
     gene            13090..13632
                     /gene="hpt"
                     /locus_tag="SSUBM407_RS00065"
                     /old_locus_tag="SSUBM407_0014"
     CDS             13090..13632
                     /gene="hpt"
                     /locus_tag="SSUBM407_RS00065"
                     /old_locus_tag="SSUBM407_0014"
                     /EC_number="2.4.2.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012657584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="WP_012775463.1"
                     /translation="MLDKDIKKILVSEEEIVAKCKELGQILATDYADKNPILVGILKG
                     SIPFMAELMKHIDAHVETDYMVVSSYHGGTESCGTVKIIKDLDNSVAGRHIIFVEDII
                     DTGRTLKELKELFALRQAASIKIATLLDKPEGRVVEIEPDYTCFTIPNEFVVGFGLDY
                     DENYRNLPYVGVLKEEVYTK"
     gene            13654..15627
                     /locus_tag="SSUBM407_RS00070"
                     /old_locus_tag="SSUBM407_0015"
     CDS             13654..15627
                     /locus_tag="SSUBM407_RS00070"
                     /old_locus_tag="SSUBM407_0015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006595315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent zinc metalloprotease FtsH"
                     /protein_id="WP_011921638.1"
                     /translation="MNNQPNKGFIKNPFLIILVIATIVTAFQFFNAGQQVATQEISYS
                     QVVTELKNNNVSEITYQPNSSVIEITGKYKTEQEAKDELASSIKLFQVSSKVKYKNFK
                     SLILPSETNLSELQALANENGVKVAIKPESSNGLWLNIIFNLLPLVIAGVFFMMMMNQ
                     GGGGARGAMNFGRNKAKALEQSNIKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLG
                     ARIPAGVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFED
                     AKKAAPAIIFIDEIDAVGRQRGVGMGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAAT
                     NRSDVLDPALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAADVDLKLVAQQTPG
                     FVGADLENVLNEAALVAARRNKTVIDASDIDEAEDRVIAGPSKKDRQVSAKEREIVAY
                     HEAGHTIVGLVLSNAREVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMG
                     GRVAEEIIFNTQTTGASNDFEQATQMARAMVAEYGMSDKMGPMQYEGSHAMFGGQTTQ
                     KHISEQTAYELDNEVRDLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDSVQIKSL
                     YETGKMPENIERDDEDVHPLSYEEVKEKINTKE"
     gene            15965..16435
                     /locus_tag="SSUBM407_RS00075"
                     /old_locus_tag="SSUBM407_0016"
     CDS             15965..16435
                     /locus_tag="SSUBM407_RS00075"
                     /old_locus_tag="SSUBM407_0016"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="WP_011921639.1"
                     /translation="MEFEKVYASVKGIVNKARKEFYIKLWDRDDWEQEGMMTLFELLE
                     AQPWLVDEQVQLYCYFKVKFRNRIKDRIRKQESQKRKFDRMPHEDIYELSHAIQSPGL
                     INDELLMLRGALRDYRKNLSNDQLDKYEKLISGQCFNGRREMIRDLQIHLKDFR"
     gene            16969..18524
                     /locus_tag="SSUBM407_RS00080"
                     /old_locus_tag="SSUBM407_r0001"
     rRNA            16969..18524
                     /locus_tag="SSUBM407_RS00080"
                     /old_locus_tag="SSUBM407_r0001"
                     /product="16S ribosomal RNA"
     gene            18570..18642
                     /locus_tag="SSUBM407_RS00085"
                     /old_locus_tag="SSUBM407_t0001"
     tRNA            18570..18642
                     /locus_tag="SSUBM407_RS00085"
                     /old_locus_tag="SSUBM407_t0001"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:18603..18605,aa:Ala,seq:tgc)
     gene            18916..21826
                     /locus_tag="SSUBM407_RS00090"
                     /old_locus_tag="SSUBM407_r0002"
     rRNA            18916..21826
                     /locus_tag="SSUBM407_RS00090"
                     /old_locus_tag="SSUBM407_r0002"
                     /product="23S ribosomal RNA"
     gene            21912..22027
                     /gene="rrf"
                     /locus_tag="SSUBM407_RS00095"
                     /old_locus_tag="SSUBM407_r0003"
     rRNA            21912..22027
                     /gene="rrf"
                     /locus_tag="SSUBM407_RS00095"
                     /old_locus_tag="SSUBM407_r0003"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
     gene            22033..22105
                     /locus_tag="SSUBM407_RS00100"
                     /old_locus_tag="SSUBM407_t0002"
     tRNA            22033..22105
                     /locus_tag="SSUBM407_RS00100"
                     /old_locus_tag="SSUBM407_t0002"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:22066..22068,aa:Val,seq:tac)
     gene            22108..22180
                     /locus_tag="SSUBM407_RS00105"
                     /old_locus_tag="SSUBM407_t0003"
     tRNA            22108..22180
                     /locus_tag="SSUBM407_RS00105"
                     /old_locus_tag="SSUBM407_t0003"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:22141..22143,aa:Asp,seq:gtc)
     gene            22226..22298
                     /locus_tag="SSUBM407_RS00110"
                     /old_locus_tag="SSUBM407_t0004"
     tRNA            22226..22298
                     /locus_tag="SSUBM407_RS00110"
                     /old_locus_tag="SSUBM407_t0004"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:22259..22261,aa:Lys,seq:ttt)
     gene            22302..22383
                     /locus_tag="SSUBM407_RS00115"
                     /old_locus_tag="SSUBM407_t0005"
     tRNA            22302..22383
                     /locus_tag="SSUBM407_RS00115"
                     /old_locus_tag="SSUBM407_t0005"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:22336..22338,aa:Leu,seq:tag)
     gene            22398..22470
                     /locus_tag="SSUBM407_RS00120"
                     /old_locus_tag="SSUBM407_t0006"
     tRNA            22398..22470
                     /locus_tag="SSUBM407_RS00120"
                     /old_locus_tag="SSUBM407_t0006"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:22431..22433,aa:Thr,seq:tgt)
     gene            22483..22554
                     /locus_tag="SSUBM407_RS00125"
                     /old_locus_tag="SSUBM407_t0007"
     tRNA            22483..22554
                     /locus_tag="SSUBM407_RS00125"
                     /old_locus_tag="SSUBM407_t0007"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:22515..22517,aa:Gly,seq:gcc)
     gene            22562..22645
                     /locus_tag="SSUBM407_RS00130"
                     /old_locus_tag="SSUBM407_t0008"
     tRNA            22562..22645
                     /locus_tag="SSUBM407_RS00130"
                     /old_locus_tag="SSUBM407_t0008"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:22596..22598,aa:Leu,seq:taa)
     gene            22664..22737
                     /locus_tag="SSUBM407_RS00135"
                     /old_locus_tag="SSUBM407_t0009"
     tRNA            22664..22737
                     /locus_tag="SSUBM407_RS00135"
                     /old_locus_tag="SSUBM407_t0009"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:22698..22700,aa:Arg,seq:acg)
     gene            22785..22858
                     /locus_tag="SSUBM407_RS00140"
                     /old_locus_tag="SSUBM407_t0010"
     tRNA            22785..22858
                     /locus_tag="SSUBM407_RS00140"
                     /old_locus_tag="SSUBM407_t0010"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:22819..22821,aa:Pro,seq:tgg)
     gene            22871..22944
                     /locus_tag="SSUBM407_RS00145"
                     /old_locus_tag="SSUBM407_t0011"
     tRNA            22871..22944
                     /locus_tag="SSUBM407_RS00145"
                     /old_locus_tag="SSUBM407_t0011"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:22905..22907,aa:Met,seq:cat)
     gene            22961..23034
                     /locus_tag="SSUBM407_RS00150"
                     /old_locus_tag="SSUBM407_t0012"
     tRNA            22961..23034
                     /locus_tag="SSUBM407_RS00150"
                     /old_locus_tag="SSUBM407_t0012"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:22995..22997,aa:Ile,seq:cat)
     gene            23041..23130
                     /locus_tag="SSUBM407_RS00155"
                     /old_locus_tag="SSUBM407_t0013"
     tRNA            23041..23130
                     /locus_tag="SSUBM407_RS00155"
                     /old_locus_tag="SSUBM407_t0013"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:23077..23079,aa:Ser,seq:tga)
     gene            23141..23214
                     /locus_tag="SSUBM407_RS00160"
                     /old_locus_tag="SSUBM407_t0014"
     tRNA            23141..23214
                     /locus_tag="SSUBM407_RS00160"
                     /old_locus_tag="SSUBM407_t0014"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:23175..23177,aa:Met,seq:cat)
     gene            23230..23302
                     /locus_tag="SSUBM407_RS00165"
                     /old_locus_tag="SSUBM407_t0015"
     tRNA            23230..23302
                     /locus_tag="SSUBM407_RS00165"
                     /old_locus_tag="SSUBM407_t0015"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:23263..23265,aa:Phe,seq:gaa)
     gene            23334..23407
                     /locus_tag="SSUBM407_RS00170"
                     /old_locus_tag="SSUBM407_t0016"
     tRNA            23334..23407
                     /locus_tag="SSUBM407_RS00170"
                     /old_locus_tag="SSUBM407_t0016"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:23368..23370,aa:Ile,seq:gat)
     gene            23420..23507
                     /locus_tag="SSUBM407_RS00175"
                     /old_locus_tag="SSUBM407_t0017"
     tRNA            23420..23507
                     /locus_tag="SSUBM407_RS00175"
                     /old_locus_tag="SSUBM407_t0017"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:23454..23456,aa:Ser,seq:gct)
     gene            23567..24403
                     /gene="mreC"
                     /locus_tag="SSUBM407_RS00180"
                     /old_locus_tag="SSUBM407_0017"
     CDS             23567..24403
                     /gene="mreC"
                     /locus_tag="SSUBM407_RS00180"
                     /old_locus_tag="SSUBM407_0017"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreC"
                     /protein_id="WP_012775464.1"
                     /translation="MNKFSKLVVVVSIFLLLSFSLLFVTFSKGLQVPYLNNIVRVVVT
                     PIQSVISVPTRFFSEQKDVLTDLMNAYEENKQLKETIMSLEGMAAENTSLKEENASLR
                     SSLGVVSDFPEKQLIPGSVLVRTPSSWSEHISINIGETSGVTYNALVVANGGLVGIVS
                     SLSSDSAVVTLFTNSDEFTKLPVKISVDSKEIYGILSGYDADTNSFIINQLNSADEIA
                     VGSNVVTSDLAGATPANVQIGKVLSVKSNSNSLNREVYVEPTASFSNIYSVLVVGQTN
                     AQ"
     gene            24393..24908
                     /locus_tag="SSUBM407_RS00185"
                     /old_locus_tag="SSUBM407_0018"
     CDS             24393..24908
                     /locus_tag="SSUBM407_RS00185"
                     /old_locus_tag="SSUBM407_0018"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreD"
                     /protein_id="WP_002935339.1"
                     /translation="MRNKMIEIFMFPILFFILLLDGQISTLVTNWSVGLFTISSHLVL
                     MLAIFYANYVSLGFSLFIFTLLGLVYDISYLNLIGIATTTLPLVLYCIYFFFQGAVSK
                     RGINILILLVAIFQFEFISYSFARIFHITNLSVFIFVFNKLLPSLLFNLVLFFVLQPL
                     FERLFGITNKT"
     gene            24993..26249
                     /locus_tag="SSUBM407_RS00190"
                     /old_locus_tag="SSUBM407_0019"
     CDS             24993..26249
                     /locus_tag="SSUBM407_RS00190"
                     /old_locus_tag="SSUBM407_0019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CHAP domain-containing protein"
                     /protein_id="WP_012774880.1"
                     /translation="MKKKILATIMLSTVVLSNANYVAVISANDVDSQIATKNQQISEL
                     TAQQAEAQQQVDAIQGQVDAIVSEQAKLTEENTRLEAESQTLAADIERLSADIVSRDG
                     ALKEQARSAQVDGSASSYINTILDSKSIIDAVSRVNAMREIISANNRMLEQQKADKEA
                     IVEKQKANQEAITTLAANRQKLEDDAQVLQVRQAELEAAKLNLAVQKATAEDEKNSLL
                     VQKAAAEEAARQAAARQAEYQAQQAALAQQQVASVSAPVVSTLVETTVTETVAAPTQT
                     VSQSTPTVSTPTTSTSSGSGSSAAANNARYDASSYPVGECTWGVKSQLSWVGPYWGDA
                     KQWLASARAEGFSTGSTPQVGAIAVWTGGYYGHVAVVTAVQSSTSIQVVESNYMGRRY
                     IGNHRGGYFNPTTTSEGAVYYIYPPY"
     gene            26352..27320
                     /locus_tag="SSUBM407_RS00195"
                     /old_locus_tag="SSUBM407_0020"
     CDS             26352..27320
                     /locus_tag="SSUBM407_RS00195"
                     /old_locus_tag="SSUBM407_0020"
                     /EC_number="2.7.6.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate diphosphokinase"
                     /protein_id="WP_002935337.1"
                     /translation="MAFTDLKLFALSSNQKLAEQVSKKIGIPLGKSSVRQFSDGEIQV
                     NIEESIRGTHVYILQSTSSPVNDNLMEILIMVDALKRASAESVNVVMPYYGYARQDRK
                     ARAREPITSKLVANMLQTAGVNRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERR
                     GMVGDGYVVVSPDHGGVTRARKLAQFLKTPIAIIDKRRSVDKMNTSEVMNIIGDIKDK
                     TCILIDDMIDTAGTICHAADALADAGATAVYASCTHPVLSGPAMDNISKSAIKKLVVL
                     DTIEIAEDRLIDKIEHISTAELLAEAIIRIHEKRPLSPLFEASRVK"
     gene            27407..28585
                     /locus_tag="SSUBM407_RS00200"
                     /old_locus_tag="SSUBM407_0021"
     CDS             27407..28585
                     /locus_tag="SSUBM407_RS00200"
                     /old_locus_tag="SSUBM407_0021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal phosphate-dependent aminotransferase"
                     /protein_id="WP_011922532.1"
                     /translation="MDLLNRFNKNLNRIEVSMIRQFDQSISDVPGILKLTLGEPDFTT
                     PDHVKEAAKAAIDADQSYYTGMAGLLELRQAAAEFVAEKYNLHYNPENEILSTIGATE
                     ALSASLVAILEAGDTVLLPAPAYPGYEPIVNMVGADIVEIDTTANDFVLTPEMLEEAI
                     IEQGDKLKAVILNYPANPTGVTYSREQIQAFADVLRNYPVFVLSDEVYAELTYTGQPH
                     TSIAEFLPEQTILIQGLSKSHAMTGWRIGLIMSQAPIIAQIIKSHQYLVTAASTAMQY
                     GAVEALKNGKDDALPMRAEYVKRRDYIIEKMTDLGFKIIKPDGAFYIFAKIPAGYNQD
                     SFSFLQDFARKKAVAFIPGAAFGQYGEGYVRISYAASMEKIQTAMARLKEYLEENGTN
                     "
     gene            28572..29354
                     /gene="recO"
                     /locus_tag="SSUBM407_RS00205"
                     /old_locus_tag="SSUBM407_0022"
     CDS             28572..29354
                     /gene="recO"
                     /locus_tag="SSUBM407_RS00205"
                     /old_locus_tag="SSUBM407_0022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecO"
                     /protein_id="WP_012775465.1"
                     /translation="MERIETRGLVLYNRNFREDDKLVKIFTEKAGKRMFFVKHASKSK
                     LVASIQPLTYADFIVKINDDGLSYIEDFHQVQPFKNINGDIFKLSYATYILALADAAL
                     QDKVYDPALFAFLVKTLDLMESGLDYEVLTNIFEIQLLGRFGISLNFHECAFCHRVGL
                     PFAYSYKYSGVLCPQHYQQDERRAYLDPNVPYLLDQFQAISFDELETISIKPEMKRKL
                     RFFIDQLYEEYVGIHLKSKKFIDDLSSWGQIMKPRTENEETE"
     gene            29351..30358
                     /gene="plsX"
                     /locus_tag="SSUBM407_RS00210"
                     /old_locus_tag="SSUBM407_0023"
     CDS             29351..30358
                     /gene="plsX"
                     /locus_tag="SSUBM407_RS00210"
                     /old_locus_tag="SSUBM407_0023"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate acyltransferase PlsX"
                     /protein_id="WP_011921644.1"
                     /translation="MKRIAVDAMGGDHAPQAVVEGVNQALAAFPDIEIQLYGDEAKIK
                     QYLTATERVSIVHTTEKINSDDEPVKAIRRKKEASMVLATKAVKDGQADAVLSAGNTG
                     ALLAAGVFVVGRIKNIDRPGLMSTLPTMDGKGFDMMDLGANAENIAHHLYQYGILGSF
                     YAEHVRGVKQPRVGLLNNGTEDTKGTPVHQEAYKLLAEDKSINFIGNVEARELLNSVA
                     DVVVTDGFTGNAVLKTIEGTAKSIVGQLTGSIKNGGLRAKLGGLLVKPTLKKALGAMD
                     YKTAGGAVLLGLKAPVIKAHGSSDAQSIFYTIKQTRSILEAGIVEKSVAKFSVVEESH
                     D"
     gene            30351..30599
                     /locus_tag="SSUBM407_RS00215"
                     /old_locus_tag="SSUBM407_0024"
     CDS             30351..30599
                     /locus_tag="SSUBM407_RS00215"
                     /old_locus_tag="SSUBM407_0024"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_011921645.1"
                     /translation="MTREQVYQRVVELIQDEKGEDFQVQPESTLADNIAADSVEIMEF
                     VLNLEDEFHVDVPDAAIEHFEVLSDIVDFIYKEVKKRS"
     gene            30717..31424
                     /locus_tag="SSUBM407_RS00220"
                     /old_locus_tag="SSUBM407_0025"
     CDS             30717..31424
                     /locus_tag="SSUBM407_RS00220"
                     /old_locus_tag="SSUBM407_0025"
                     /EC_number="6.3.2.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000043309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazolesuccinocarboxamide
                     synthase"
                     /protein_id="WP_011921646.1"
                     /translation="MKTDLLYSGKAKDIYATADSDQIVAVYKDQATAFNGGKKEQIVG
                     KGRLNNLISSLIFEKLNEAGVPTHFIKRLSDSEQLNKKVEIIPLEVVLRNVTAGSFSK
                     RFGVEEGITLSTPIVEFYYKKDELDDPFINDEHIAFLELASQDQIAYIKEETRRINEF
                     LKDLFAQIGLTLVDFKLEFGIDSSGQILLADEFSPDNCRLWDADGNHLDKDVFRRGLG
                     ELTEVYEVVLAKLQEVK"
     gene            31437..35156
                     /locus_tag="SSUBM407_RS00225"
                     /old_locus_tag="SSUBM407_0026"
     CDS             31437..35156
                     /locus_tag="SSUBM407_RS00225"
                     /old_locus_tag="SSUBM407_0026"
                     /EC_number="6.3.5.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001042262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="WP_012775466.1"
                     /translation="MAKRIFVEKKAAFQIKAEALRKELTHNLQLTSLSSLRLVQVYDV
                     FNLEEDLLEQAIKHIFTEQVTDKVLSDEELGLEGAVYFAIEALPGQFDQRAASSQEAL
                     LLLGSRQEVRVNTGQLYILNGDVQEEELVAIKNYLLNPVDSRFKDMDAPLVAQEFSVS
                     DTVIPSLDFFDSYGVEEFASYKREAGLAMEVEDLLFIQDYFKSIGRVPTETELKVLDT
                     YWSDHCRHTTFETELRSIDFSASKFQKQLQATYDKYLAMRTELGRTDKPQTLMDIATI
                     FGRYERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNETHNHPTEIEPFGG
                     AATCIGGAIRDPLSGRSYVYQAMRISGAGDITQPLTATRSGKLPQQIISKTAAHGYSS
                     YGNQIGLATTYVREYFHPGFVAKRMELGAVVGAAPKENVVREKPVAGDVVILLGGKTG
                     RDGIGGATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGAVTRLIKKSNDFGA
                     GGVCVAIGELADGLEIDLDKVPLKYAGLNGTEIAISESQERMSVVVRPEDVDAFIAAC
                     RQENIHAVVVAKVTEKPNLVMTWNGQTIVDLERSFLDTNGVRVVVDAKVVDSPVNLPE
                     TRTTSAQTLREDLKDLLSDLNHASQKGLQTIFDSSVGRSTVNHPLGGRHQLTPTESSV
                     QKLPVQQGVTTTASVMAQGYHPYLADWSPYHGAAYAVIEATARLVATGANWSKARFSY
                     QEYFQRMDKQAERFGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEDLTVPPTLVAF
                     GVTTADSCKVLSPEFKATGEHIYYLPGQILSEDIDFTLIKSNFKAFEKWQSDYVITAA
                     SAVKYGGVLESLALMSFGNQVGARVELADFETSLTGQLGGFVFTSQEDIPDAVKIGQT
                     TTDFTLVVNGVNLSGQDLQVAFEGKLEEVYPTEFEQATELQDVPAVTSSAVIKAKETV
                     EVPVVYIPVFPGTNSEYDSAKAFEQAGAKVNLVPFVTLDAESIENSVDTMVDNIAKAN
                     ILFFAGGFSAADEPDGSAKFIVTILRNAKVRSAIDQFIEKRGLIIGICNGFQALVKSG
                     LLPYGNFEEAGDTSPTLFYNDANQHIAKMVETRIANVNSPWLAGVQVGDIHAIPVSHG
                     EGKFVVTDEEFATLRDNGQIFSQYVDFTGQPSMDSKYNPNGSSHAIEGITSRNGQIIG
                     KMGHSERYEDGLFQNIPGKKDQGLFVSAVRYFTGK"
     gene            35159..36613
                     /locus_tag="SSUBM407_RS00230"
                     /old_locus_tag="SSUBM407_0027"
     CDS             35159..36613
                     /locus_tag="SSUBM407_RS00230"
                     /old_locus_tag="SSUBM407_0027"
                     /EC_number="2.4.2.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018377765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="WP_011921648.1"
                     /translation="MTYEVKSLNEECGVFGIWGHPQAAQVTYFGLHSLQHRGQEGAGI
                     LANDGGQLCRHRGTGLIAEVFKNPADLEALTGTAAIGHVRYATSGSASINNIQPFLFD
                     FADMQVGLAHNGNLTNAVSLKAELEKNGSIFSSSSDTEILMHLIRRSHNPDFMGKIKE
                     ALNTVKGGFAYLILLEDKLVAALDPNGFRPLSIGKMKNGAWVVASETCAFEVVGADWV
                     RDVEPGEIVVIDDSGIQYDSYTRDTQLAVCSMEYVYFARPDSVIHGVNVHTARKNMGR
                     RLAQEFKHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLIKNQYTQRTFIQPTQELRE
                     QGVRMKLSAVSSVVKGKRVVMIDDSIVRGTTSRRIVQLLRDAGAKEVHVAIGSPELKY
                     PCFYGIDIQTRRELISANHTVEEVCEIIGADSLTYLSLEGMIEAIGIETDAPKGGLCV
                     AYFDGEFPTPLYDYEEEYLRSLEEKTSFYIENVK"
     gene            36669..37691
                     /locus_tag="SSUBM407_RS00235"
                     /old_locus_tag="SSUBM407_0028"
     CDS             36669..37691
                     /locus_tag="SSUBM407_RS00235"
                     /old_locus_tag="SSUBM407_0028"
                     /EC_number="6.3.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009729529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine cyclo-ligase"
                     /protein_id="WP_012774882.1"
                     /translation="MTNKNAYAQSGVDVEAGYEVVERIKKHVARTERLGVMGALGGFG
                     GMFDLTKLDVKEPVLVSGTDGVGTKLMLAIQYDKHDTIGQDCVAMCVNDIIAAGAEPL
                     YFLDYIATGKNEPAKLEQVVAGVAEGCVQAGCGLIGGETAEMPGMYGEDDYDLAGFAV
                     GIAEKSQIIDGSKVQEGDILLGLASSGIHSNGYSLVRRVFADVSGDALLPELNGRALK
                     DVLLEPTRIYVQQVLPLVKAGLVNGIAHITGGGFIENVPRMFADNLAAEIEEDKIPVL
                     PIFTALETYGQIKHEEMFEIFNMGIGMVLAVSPGKVEKVRELVGEEVYEIGRIITKED
                     KSVVIK"
     gene            37688..38239
                     /gene="purN"
                     /locus_tag="SSUBM407_RS00240"
                     /old_locus_tag="SSUBM407_0029"
     CDS             37688..38239
                     /gene="purN"
                     /locus_tag="SSUBM407_RS00240"
                     /old_locus_tag="SSUBM407_0029"
                     /EC_number="2.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000717493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="WP_011922533.1"
                     /translation="MKRIAVFASGNGSNFQVIAEQFEVAFVFSDRRNAYVLERAEKLG
                     VPTFAFELKEFADKQAYEEAIIQLLDQHQIDLVVLAGYMKIVGPTLLAQYEGRIINIH
                     PAYLPEFPGAHGIEDAWNAGVAESGVTVHWVDSGIDTGQIIKQVRVPRLADDILETFE
                     ARIHEAEYQLYPAVLEELGAVKK"
     gene            38249..39796
                     /gene="purH"
                     /locus_tag="SSUBM407_RS00245"
                     /old_locus_tag="SSUBM407_0030"
     CDS             38249..39796
                     /gene="purH"
                     /locus_tag="SSUBM407_RS00245"
                     /old_locus_tag="SSUBM407_0030"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006146083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /protein_id="WP_011921652.1"
                     /translation="MTKRALISVSDKNGIVEFAQELTKLGWEIISTGGTKVALDNAGV
                     ATIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDVDSHLQAAKDHEIGLIDLVVVNL
                     YPFKETILRPDVTYDLAVENIDIGGPSMLRSAAKNHASVTVVVDPADYPTVLGEIAEQ
                     GQTTYPTRQRLAAKVFRHTAAYDALIADYFTKQVGEDKPEKLTITYDLNQPMRYGENP
                     QQNADFYQNALPTDYSIAAAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVVALKHM
                     NPCGIGQAETIEKAWDYAYEADPVSIFGGIVVLNREVDAATAEKMHPIFLEIIIAPSY
                     SAEALAILTNKKKNLRILELAFDAQDASEVEKEFTGVVGGLLVQDQDVVVESPADWQV
                     VTERQPSEQEWAAMEFAWKSSKYVKSNGIIITNDKMTLGVGPGQTNRVASVRIAIEQA
                     KDRLEGAVLASDAFFPFADNVEEIAAAGIKAIIQPGGSVRDQDSIDMANKYGLTMVFT
                     GVRHFRH"
     gene            39922..41184
                     /gene="purD"
                     /locus_tag="SSUBM407_RS00250"
                     /old_locus_tag="SSUBM407_0031"
     CDS             39922..41184
                     /gene="purD"
                     /locus_tag="SSUBM407_RS00250"
                     /old_locus_tag="SSUBM407_0031"
                     /EC_number="6.3.4.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009660198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="WP_011921653.1"
                     /translation="MKLLVVGSGGREHAIAKKLLESEQVEQVFVAPGNDGMTLDGIEL
                     VNIGISEHSAIINFAKENDVAWTFVGPDDALAAGIVDDFEQAGLKAFGPSRLAAELEW
                     SKDFAKQIMVKYGIPTAAFGTFSNFEEAKAYIEEQGAPIVVKADGLALGKGVVVAETV
                     EQAVEAAREMLLDNKFGDSGARVVIEEFLAGEEFSLFALVNGDQFYILPTAQDHKRAF
                     DGDQGPNTGGMGAYAPVPHLPQSVVDTAVDTIVKPILEGMIADGRSYLGVLYAGLILT
                     DQGPKVIEFNARFGDPETQIILPRLTSDFAQNIDDILHKRPTQLTWLDSGVTLGVVVA
                     SNGYPLDYEKGVELPAKTEGDITTYYAGARFAENSRALLSNGGRVYMLVTTADTVQDA
                     QEKIYSELKNQDTTGLFYRTDIGSKAVK"
     gene            41210..41698
                     /gene="purE"
                     /locus_tag="SSUBM407_RS00255"
                     /old_locus_tag="SSUBM407_0032"
     CDS             41210..41698
                     /gene="purE"
                     /locus_tag="SSUBM407_RS00255"
                     /old_locus_tag="SSUBM407_0032"
                     /EC_number="4.1.1.21"
                     /EC_number="5.4.99.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018363844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide mutase"
                     /protein_id="WP_011921654.1"
                     /translation="MNIPISIIMGSSSDWKTMKKAADMLDKFGVAYEKKVVSAHRTPD
                     LMFRHAEEARGHGFKVIIAGAGGAAHLPGMVAAKTTLPVIGVPVQSRALSGVDSLYSI
                     VQMPGGVPVATMAIGEAGATNAALTALRILSIEDQTIAAQLADFAKEQEKIAEAMTDD
                     LI"
     gene            41685..42764
                     /gene="purK"
                     /locus_tag="SSUBM407_RS00260"
                     /old_locus_tag="SSUBM407_0033"
     CDS             41685..42764
                     /gene="purK"
                     /locus_tag="SSUBM407_RS00260"
                     /old_locus_tag="SSUBM407_0033"
                     /EC_number="6.3.4.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide
                     synthase"
                     /protein_id="WP_012774883.1"
                     /translation="MTSSKTIGIIGGGQLGQMMAISAIYMGHKVITLDPAADCPASKV
                     SEVIVAPYHDVAALKQLAERCDVLTYEFENVDADGLDAVIKDGQLPQGTDLLRISQNR
                     IFEKDFLAKKAGVQVAPYKVVTSSLDLEGLDLSKNYVLKTATGGYDGHGQKVIREEAD
                     LVEASQLANSAECVLEEFVNFDLEISVLVSGNGSDYTVFPVQENIHRNNILYKTIVPA
                     RIFDELAEKAKTMALQIADKLHLVGTLCVEMFVAGQEILVNEIAPRPHNSGHYSIEAC
                     DFSQFDTHIRGILGEPLPPIRLLSPAVMINVLGQDMETVQTFLQENPTAHPHFYGKLE
                     AKHNRKMGHVTVLGEDAESVEEFEN"
     gene            42808..43569
                     /locus_tag="SSUBM407_RS00265"
                     /old_locus_tag="SSUBM407_0034"
     CDS             42808..43569
                     /locus_tag="SSUBM407_RS00265"
                     /old_locus_tag="SSUBM407_0034"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011921656.1"
                     /translation="MPLPQKIQEEIKRYCNNHLPNNDWYEKEFDFIHDVSLKNRIIRE
                     FKSIRYAYKLYEGITAEEEHLIFEIRSQILAYASIYEAVVEYVLETYYSDTQVYDDLV
                     HQNNVMTKIDIPEEKRKKLERELIHLVDNGTKNIEIHTFFYQRKRKASTSIRFDAKCR
                     AAEELNIISKIYQKGNKVVADLPSDIIEIYEYRNAIHLIAEQRKNIDYELELSQRAYR
                     RMKPFIEQIKDRLITDNKLIIKNTKDTLTDSSIKN"
     gene            43642..44868
                     /locus_tag="SSUBM407_RS00270"
                     /old_locus_tag="SSUBM407_0035"
     CDS             43642..44868
                     /locus_tag="SSUBM407_RS00270"
                     /old_locus_tag="SSUBM407_0035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011922536.1"
                     /translation="MLNKEWYFKNFNMVSELDISGEFIYTGISIVNNMDRIAPEMPTE
                     LFLALYNISVGVERLQKIILVLWEFDEVDSIEDFSESLKIHNQVELHSRIEKAINKKI
                     FSKQECQFLELLKEFYSNARYDRFSAVGNRWEYELISKFFSNNQISYEESVSDSQVIL
                     INDSIRKLIGRVLSRIVKNYYLLVEEGSNKSGTYSYELRNDSKAQKIFLHMENRRGLS
                     SIKIDERIALSEILIYLRNTSDKSSYLKFIEGIYPLDFDKMEISRYLSIILLEDRIPQ
                     DLIDEIEYIYAEKDIKVGERIENLDLLTKNNMQVTFDYPYLKEVYIILEEVKKQESIN
                     DDTISRLEESNCYIDDSDTQEIIESIIAVARQYRNNKILKEEFIKEFSSHYKTLEDNY
                     TLSYISNLMQLEVRSK"
     gene            44870..46162
                     /gene="purB"
                     /locus_tag="SSUBM407_RS00275"
                     /old_locus_tag="SSUBM407_0036"
     CDS             44870..46162
                     /gene="purB"
                     /locus_tag="SSUBM407_RS00275"
                     /old_locus_tag="SSUBM407_0036"
                     /EC_number="4.3.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000572892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate lyase"
                     /protein_id="WP_011921659.1"
                     /translation="MIERYSRPEMAAIWSEENKYEAWLEVEILADEAWAELGEIPKED
                     VALIREKATFDIDRILEIEEETRHDVVAFTRAVSESLGEERKWVHYGLTSTDVVDTAY
                     GYLYKQANDIIRRDLENFTTIIADKAREHKYTIMMGRTHGVHAEPTTFGLKLATWYSE
                     MKRNMERFDVAAKGVEAGKISGAVGNFANIPPFVEEYVCGKLGIRPQEISTQVLPRDL
                     HAEYFSALALIATSIERMATEIRGLQKSEQREVEEYFAKGQKGSSAMPHKRNPIGSEN
                     MTGLARVVRGHLVTAFENVALWHERDISHSSAERIITPDTTILINYMLNRFGNIVKNL
                     TVFPENMKRNMESTFGLIYSQRVMLSLIEKGMTREEAYDLVQPKTAQSWDNQVDFKPL
                     LEADERVTAKLSQEEIDELFNPDYYAKRVDDIFERLGL"
     gene            47099..47827
                     /locus_tag="SSUBM407_RS00280"
                     /old_locus_tag="SSUBM407_0037"
     CDS             47099..47827
                     /locus_tag="SSUBM407_RS00280"
                     /old_locus_tag="SSUBM407_0037"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775467.1"
                     /translation="MNMFRLIFKSVIHRRDVALFYAFAGLPILVPILSKFLVGVKAEY
                     TDNFLDFLGAALATQDGIVLPVLLLSLIISAVFRDEIDSGILFLYKDLNRTRLFNAKI
                     ISLVVMYASYVLLTVLTSAIAYFGFLNASGKVVSDDWSNVQSTFLSIFATISINVIGI
                     LLVSTVSIKAKSLQAVLAGVFWSLFTTTAPLLIGVRYVVPNGYAKMSLDQPLLAWSLV
                     VAITTFYTVATYLKGRSNFEKLEF"
     gene            47837..48415
                     /locus_tag="SSUBM407_RS00285"
                     /old_locus_tag="SSUBM407_0038"
     CDS             47837..48415
                     /locus_tag="SSUBM407_RS00285"
                     /old_locus_tag="SSUBM407_0038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CPBP family intramembrane metalloprotease"
                     /protein_id="WP_011921662.1"
                     /translation="MVVRYMRPVALSLALIVLASISYLLATSLVLFSSSQFLQLAYLF
                     SIMVGMPIGFILLPSMITKRYQLCQELSEVKFSWKSFVLLAIAIFLVNFWFIQSDEYV
                     NQFIIATCEEFLFRYLIYRILKSEYPTWLAMLVTSLLFGVLLHMNYSLLDNLIIRTPL
                     GLLFSVLATRFGLQYAIGGHWIYNLLVSRFPF"
     gene            48430..48858
                     /locus_tag="SSUBM407_RS00290"
                     /old_locus_tag="SSUBM407_0039"
     CDS             48430..48858
                     /locus_tag="SSUBM407_RS00290"
                     /old_locus_tag="SSUBM407_0039"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014636188.1"
                     /translation="MIFILLLSLFYICLTVASSQLLLSLSVPVLLLLTYLLPPIVNSI
                     CMGLQKDKSWKAWSAGIFPTMSMIFYAAFAYITSSNGQWEQFAQLHTVSDDVMSVELA
                     GELLVPSQMLFVAVLYYGTAIATYFIQQAGRKKEKGATYA"
     gene            48851..49723
                     /locus_tag="SSUBM407_RS00295"
                     /old_locus_tag="SSUBM407_0040"
     CDS             48851..49723
                     /locus_tag="SSUBM407_RS00295"
                     /old_locus_tag="SSUBM407_0040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006596701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011921665.1"
                     /translation="MLKINHLSKQFAGNEFYSLKDVSLEINKGEIVGLIGKNGAGKST
                     LMKLMAKSLKPSSGTITYKGTDIFSQDNLLADFGIMIDPVFYPEMTVMDNLKFYLDLH
                     GKKDLYPNIEKTLKLVELWDARNRKPKGFSFGMKQRTALAIALVAEPDFLILDEPFVG
                     LDPIGVQKLIDILKQWSSERQISMLISSHQLGELEALCSRYVYIESGELADAFEGKSH
                     PSVLVQLDTTKNLDSVKDLLNDHVVLEGEVLEISTATPTSELNQIFGVLTRQELIVKL
                     EVKENHLKEIFTKG"
     gene            49729..50502
                     /locus_tag="SSUBM407_RS00300"
                     /old_locus_tag="SSUBM407_0041"
     CDS             49729..50502
                     /locus_tag="SSUBM407_RS00300"
                     /old_locus_tag="SSUBM407_0041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012775420.1"
                     /translation="MKQIFPAVFRTIWKRKETQVYLLFTLFPFIYLVTSFIEGSNFMQ
                     IHAGEGYKVSLVAFTNMMVSSADSFILPSLTLYFLAISVFRKEVDEHTMFLYRDLGRK
                     QIFWSKYLGLLATIVIFYGLFFVTSAFVHYVRVIHLPFGSPAVFEASLAESLSNVFCI
                     VAYLLKDILSISLATALCLYLKNITTMITGFLVTITMMILAIVGGPVAMLFPTSYMTL
                     ASEGLTGAGLAYLGAICVTIIYVLVFTKIAAKKFKNLEF"
     gene            50505..52217
                     /locus_tag="SSUBM407_RS00305"
                     /old_locus_tag="SSUBM407_0042"
     CDS             50505..52217
                     /locus_tag="SSUBM407_RS00305"
                     /old_locus_tag="SSUBM407_0042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012774887.1"
                     /translation="MNKRLVGVLLKSLNKTMFLFGIVLSALGVGMGLFLPQFIGKLLD
                     QTYLSNLLTRPELLAGFILFFVSVYAVQALSNYFIGRSGSNALKQLQQYIYESLLTTS
                     VKDLDQYQSGDLASRLTNDMSVVLNFITVILPNFLMNGLMVMGSIYFLWTISPWLTGL
                     SLFLLPLLSMVMIPMNQRLEGYYSAYQEGLGQVSSRISHKFTTIRLMKAFQGEKHEQR
                     EMGKSFQYLSQTFEKMIGLSAVQHTLVSSLMTGFIILMLLIAGIEVTKGVMTMATLTT
                     FVLYMMQLIDPVTDIAASLNELTEFHAVSKRLVELLELNKEEQVDTELVDATSIQLEK
                     VRFSYHTDPILNGVSVRIPEGAHVAIVGPSGAGKSTIFALLMKYYQDYKGKIRIGQQC
                     LSDISTKEMRRLISFIPQDNTLFHGTIRENLLYGKNESVSEERIAYILKELGLSPLVA
                     ELEDGLDTRISENGTGLSEGQKQRFSIARALLLEHPIYLLDEATASLDTVTERVISKA
                     IDRLTAGKTRLTIAHRLHTVREADAILVLDKNGQVADYGHHQQLVERNHLYQDFLRGL
                     PQAS"
     gene            52319..52492
                     /locus_tag="SSUBM407_RS10615"
     CDS             52319..52492
                     /locus_tag="SSUBM407_RS10615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011921669.1"
                     /translation="MKQTTYTLSLGGSDRENSRVSKMEEKFEKYMEGIAERLQQSGKK
                     RIDKWFVHVRIEE"
     gene            52787..53788
                     /gene="ruvB"
                     /locus_tag="SSUBM407_RS00310"
                     /old_locus_tag="SSUBM407_0043"
     CDS             52787..53788
                     /gene="ruvB"
                     /locus_tag="SSUBM407_RS00310"
                     /old_locus_tag="SSUBM407_0043"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction branch migration DNA helicase
                     RuvB"
                     /protein_id="WP_004195448.1"
                     /translation="MTNRILDMEQMQDEEYVERTLRPQKLNEYIGQDKVKDQLKIFIE
                     AAKLRDEALDHTLLFGPPGLGKTTMAFVIANELGVNIKQTSGPVIEKAGDLVALLNDL
                     EPGDVLFIDEIHRMPMAVEEILYSAMEDFYIDIMIGAGEASRSVHLELPPFTLIGATT
                     RAGMLSNPLRARFGITGHMEYYELADLTEIVERTADIFDMEITHEAAIELARRSRGTP
                     RIANRLLKRVRDFAQIMGDGLIDDSITDKALTMLDVDREGLDYVDQKILRTMIEMYGG
                     GPVGLNTLSVNIAEERETVEDMYEPYLIQQGFLMRTRTGRVATAKAYEHLGYPYTEK"
     gene            53788..54534
                     /locus_tag="SSUBM407_RS00315"
                     /old_locus_tag="SSUBM407_0044"
     CDS             53788..54534
                     /locus_tag="SSUBM407_RS00315"
                     /old_locus_tag="SSUBM407_0044"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_011921670.1"
                     /translation="MAEQMRQAARLFGDWPETIIWTCLEGVMGDIYVDDSQLPQSALA
                     LYGRQSFFGFLAGQPHRDLLKICEGKDMILVPQNQNWSDLIEGTYGDGIRSFTRYATK
                     KDTEFDLGHLQKLVDDLPESFDMKRIDRNLYEACLVEEWSRDLVGNYIDVEQFLDLGL
                     GYVILHKGQVVSGASSYASYSAGIEIEVDTREDYRGLGLAKACAAQLILACLDRGLYP
                     SWDAHTLTSLKLAEKLGYQLDKPYQAYEWR"
     gene            54536..55171
                     /locus_tag="SSUBM407_RS00320"
                     /old_locus_tag="SSUBM407_0045"
     CDS             54536..55171
                     /locus_tag="SSUBM407_RS00320"
                     /old_locus_tag="SSUBM407_0045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-IA family hydrolase"
                     /protein_id="WP_011921671.1"
                     /translation="MTPTFIWDLDGTLLDSYEAILAGIQETYQEYVLPFDRAEVRKFI
                     LRYSVKDLLVRDADKYGLDSDELNRVRATSLKEKNTQIPLMAGAVEILNWTAEQGIQN
                     FVYTHKSDNAFQVLEDLGVRHHFTEILTSDSGFARKPSPEALLFLIEKYGLDKENTYY
                     IGDRLLDVETAVNAGIHSINLQIDGVEQNWKIVSLLDIKQILTDKSSHNNL"
     gene            55418..56323
                     /locus_tag="SSUBM407_RS00325"
                     /old_locus_tag="SSUBM407_0046"
     CDS             55418..56323
                     /locus_tag="SSUBM407_RS00325"
                     /old_locus_tag="SSUBM407_0046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_012775468.1"
                     /translation="MNDKEFGQRVRQLRESASMTREQFCDDELELSVRQLTRIEAGAS
                     KPTFSKIQYIATRLGMGLGLYELMPDYVSLPERYSKLKFDVLRTPTYGNEDLAEKRDA
                     MMTEIYDDYYDELPEEEKIAIDAIQSRIDTLESGTAGFGKEILEDYFEQIFRKRKYEL
                     NDLLIVRLHLEYVRLSSCDSEIFRQFLKIIEHLHEQINIINSNDLFVLRDTLLSCVNI
                     LGSKKYYEPIPKIFDSVDKIIQSTQDFQKKPIVSVLKWKYALFVDKDRDEAEKHYLDA
                     VLFAKLIENRELEQKIEEDWRVDNQ"
     repeat_region   56478..57997
                     /note="IS element, novel IS"
     gene            56728..57891
                     /locus_tag="SSUBM407_RS00330"
                     /old_locus_tag="SSUBM407_0047"
     CDS             56728..57891
                     /locus_tag="SSUBM407_RS00330"
                     /old_locus_tag="SSUBM407_0047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
                     /protein_id="WP_011921673.1"
                     /translation="MDVLYQSCAGIDVHQANIVVCILHGPLTSTRPKREMATFDTTTK
                     GLRACHDFLSQFHVEAVGMESTGVYWRPVWHALCDDFELILAQPAHMKAIPGQKTDKK
                     DAHWIAKLTRIGLLPRSFVPDETIQELRELTRQRKHYVESRNRETNRIHKFLQSGGIK
                     LTTYIEDIMGLSGRNLLQLLVDGTPITPRIVHQSVYTSLKKKVPQLLEALDGYFSDHH
                     RFMLKQSLEIYDFYQKQIELLEERITVYLSQYENHVETLDSIPGIDVITASVIISEVG
                     VDMSQFPTSGHLASWAGLCPGNNESAGKKRSTKIRHGNSYLKKCLCQAAFAARNQKGS
                     TLADRFYQIQSRRGSQKATIALAHQLLKIAYILLKEQMTYPEFLAQKRLLGTS"
     repeat_region   complement(58294..59456)
                     /note="IS element, novel IS"
     repeat_region   58294..58314
                     /note="Inverted repeat"
     gene            complement(58429..59367)
                     /locus_tag="SSUBM407_RS00335"
                     /old_locus_tag="SSUBM407_0049"
     CDS             complement(58429..59367)
                     /locus_tag="SSUBM407_RS00335"
                     /old_locus_tag="SSUBM407_0049"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 family transposase"
                     /protein_id="WP_011921674.1"
                     /translation="MLDQIKAHLLDSINDIVSTANQFLLHPKKDFSRKSQLTRNLDER
                     AAFIDMLKTSSFKQALVIMDRGYESYNVMVHCQERNWSYIIRIRVGNHSMKSGFNLPD
                     TPCFDEAFDLNICRKQTNEMKQLYRDFPNHYRCLPNHTSFDFLPNSSRKRDPLQFYDL
                     HFRMVRLEIKPGFFETLVTNTDYSPEKLKDLYAYRWGIETSFRDLKYSIGLTHFHAKK
                     KEGILQEIYARFINFNVCKWLTSHVTIKTSKLKQTYKICFSDAVYACRKFLREELTSF
                     QLETYIAKHLSIIRPNRTFQRKIKSQAPVSFTYRIS"
     repeat_region   complement(59436..59456)
                     /note="Inverted repeat"
     gene            59507..60727
                     /locus_tag="SSUBM407_RS00340"
                     /old_locus_tag="SSUBM407_0050"
     CDS             59507..60727
                     /locus_tag="SSUBM407_RS00340"
                     /old_locus_tag="SSUBM407_0050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional folylpolyglutamate
                     synthase/dihydrofolate synthase"
                     /protein_id="WP_012774890.1"
                     /translation="MLENWLNTKQGQVFHYKMEKIEYALELLGNPQFAVPVIHVAGTN
                     GKGSTIAFMRKLFQAHGMRVGSFVSPHMVSVHDRICIDSQPISDHDFQHYLQKVYDLE
                     QEIATRYEPFRYFEVMVLIMFLYFEAQQPDVALVEVGIGGLLDTTNVVAPALSVITSI
                     GMDHQDLLGSTLREIAEQKAGIIKESVPVVLGPLSPETTAICRQIAQDNQAPVYQFGQ
                     EFTYKAGQFSNPDIDLSELVLGLAGHHQEENAAVALQTFLLYMTNIQKDIQPQLIQQA
                     LAQTSWPGRLELVVQEPKIYLDGAHNVPAIERLLEFIQVQEEPVTILFSALRRKDFQE
                     MLELLEEKLPHTPLVLTSFAYDGALAEENRQGRDYVENYQQFIEDWQSSKQGILIVTG
                     SLYFISEVRRIFKK"
     gene            60918..62441
                     /locus_tag="SSUBM407_RS00345"
                     /old_locus_tag="SSUBM407_0052"
     CDS             60918..62441
                     /locus_tag="SSUBM407_RS00345"
                     /old_locus_tag="SSUBM407_0052"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Heme/copper-type cytochrome/quinol oxidase
                     subunit 1"
                     /protein_id="WP_011921677.1"
                     /translation="MTELDVVSDVVTHPEETYRRSRRASRRQQVQLNGEFHERVLKTK
                     YWPALVWSLVLSVFSVANPLLMPFATNIQTQNLYAGMAMANGQIPYGDFFGTSGLLFY
                     LLAFLGHLGGTFIIFGILQFIALLIAGVYFYKIVAYFSQSEHLAISSSHWFYVFIFAL
                     GFGGMYAEMFALPFLLTSVWFLVRYFENAVRDEAFILYGIDAALVFLIYPKSLILWLV
                     AGLVLFIFNIQHRQVTRGIYQLLATIFGFLLILYAVGYYAFEAQILGTAIQQTFLYNL
                     QLDFHHSYLYLALAIVSVFLLLSGFFKSFIQMVFSFKQGRHTYIKVLLLLTFLVQCVF
                     IIGNANFQWSQLILLLPYGFAMSVVYLRDEDVEDYSGYLRRQFFLPLAICLGIIAQPV
                     YLYLVQGDLRTDREQVANYIDEQTKDSDKIYVWDNSASIYLSSQRLSAATITTAEPYL
                     NTDDNKNSLMYDINKNEAKFVVVNKNLPILDEIKTNLESQYQSVQTTDYFTIYQKNE"
     gene            62559..64496
                     /gene="mutL"
                     /locus_tag="SSUBM407_RS00350"
                     /old_locus_tag="SSUBM407_0053"
     CDS             62559..64496
                     /gene="mutL"
                     /locus_tag="SSUBM407_RS00350"
                     /old_locus_tag="SSUBM407_0053"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009443753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair endonuclease MutL"
                     /protein_id="WP_012775469.1"
                     /translation="MSHIIELPEILANQIAAGEVIERPASVVKELVENSIDAGASQIE
                     ISVEEAGLKMIQITDNGEGIAPDEVALALRRHATSKIKNQSDLFRIRTLGFRGEALPS
                     IASVSHMIIETATADSAHGLHLEAKGGVIEKEEPVSRPVGTQITVSDLFYNTPARLKY
                     VRSQQAELSHIVDVVNRLSLAHPEIAFVLVNEGRELIRTAGTGKLRQAISGIYGIASA
                     KKMVEIEAEDLDFQISGYVSLPELTRANRNYISIFINGRYIKNFLLNRAILEGYGSKL
                     MVGRFPLAVISIEIDPYLADVNVHPTKQEVRISKEKELMTLIREAISQALKEQDLIPD
                     ALENLAQSSTRPKVKAEQGTLPLREPKIYYDTIKQDFFLKPDVVAEDVKPLEEDRQEI
                     VESPVENRPTSVQFAERQSVESEDQEHPNLSAKELAKLADKLDREETSTFPELEYFGQ
                     MHGTYLFAQGKTGLYIIDQHAAQERVKYEYYREKIGQVDNSAQQLLVPYIFEFPQNDA
                     LDLVHKMDALRQVGVNLEEYGSNQFILREHPIWMKEEEIESGIYEMCDMLLLTDQVSI
                     KQYRAELVIMMSCKRSIKANHALDDYSARDLLRQLSYCQNPYNCPHGRPVLVHFSKSD
                     MEKMFRRIQENHTSLRELGKY"
     gene            64535..65125
                     /gene="ruvA"
                     /locus_tag="SSUBM407_RS00355"
                     /old_locus_tag="SSUBM407_0054"
     CDS             64535..65125
                     /gene="ruvA"
                     /locus_tag="SSUBM407_RS00355"
                     /old_locus_tag="SSUBM407_0054"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015605957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction branch migration protein RuvA"
                     /protein_id="WP_011921679.1"
                     /translation="MYDYIKGILTKITAKYIVVETQGVGYILQVANPYAYSGQVQQEV
                     TVYTHQVIREDAHLLYGFATENEKSVFLSLISVSGIGPTTALAIIAVDDNDGLVRAIE
                     QKNITYLTKFPKIGKKTAQQMILDLEGKFVMSEEAGPVQQVAPSSENIALEEAMEAME
                     ALGYRPAELKKIKKFFEGTNDTAENYIKSALKMLMK"
     gene            65850..66419
                     /locus_tag="SSUBM407_RS00360"
                     /old_locus_tag="SSUBM407_0056"
     CDS             65850..66419
                     /locus_tag="SSUBM407_RS00360"
                     /old_locus_tag="SSUBM407_0056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="WP_012774893.1"
                     /translation="MSRCAWVNPNNPLYIAYHDEEWGKPLHDEQSLFELLCLESYQAG
                     LSWEIVLNKRQAFRSAFFNYDIQKVAAMTDSELDSLLTNPDIIRHKAKLYATRANAQA
                     FLRVQEEFGTFDTYLWEWVNFTSIDNPVKSFRELPTKNDLSERISKDLKKRGFKFVGP
                     VCIYSYLQAAGLLNEHEETCEIGKKLRTN"
     gene            66456..67637
                     /locus_tag="SSUBM407_RS00365"
                     /old_locus_tag="SSUBM407_0057"
     CDS             66456..67637
                     /locus_tag="SSUBM407_RS00365"
                     /old_locus_tag="SSUBM407_0057"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002262393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence/damage-inducible protein A"
                     /protein_id="WP_012774894.1"
                     /translation="MKAELIAVGTEILTGQIINTNAQFLSEKCAELGIDVYFHTAVGD
                     NEGRLLSTLEVASKRSNMVVLCGGLGPTEDDLTKQTLATFLGRNLVFDELAMAKLDRF
                     FASRPGRVRTPNNERQAQIVEGSQALQNPAGLAVGGMIEQDGVTYIVLPGPPSELKAM
                     FSESLLPLLSQSQQQLYSRVLRFFGIGESQLVTVLADVIDKQTDPTLAPYAKVGEVTL
                     RLSTKATSQEEANLRLNQLEEDILQHDKLADYFYAYGEDNSLVKTVATRLAEKRQTIA
                     IVEQGTGGLLQAELSLALADQPYFSGGKVVGQLGIESGWLSEEADCIRQELQADLGLA
                     VSVLIKPESTEDNVLAKVYLTLATPSGISQKEIDLGGYSWQYLRQLACLQAWDFVRNT
                     L"
     gene            67689..68840
                     /gene="recA"
                     /locus_tag="SSUBM407_RS00370"
                     /old_locus_tag="SSUBM407_0058"
     CDS             67689..68840
                     /gene="recA"
                     /locus_tag="SSUBM407_RS00370"
                     /old_locus_tag="SSUBM407_0058"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019318527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecA"
                     /protein_id="WP_011922545.1"
                     /translation="MAKKPGKKLEDITKKFGDERKKALDDALKSIEKDFGKGAVMRLG
                     ERAEQKVQVMSSGSLSIDIALGAGGYPKGRIIEIYGPESSGKTTVALHAVAQAQKDGG
                     IAAFIDAEHALDPAYAAALGVNIDELLLSQPDSGEQGLEIAGKLIDSGAVDLVVVDSV
                     AALVPRAEIDGDIGDSHVGLQARMMSQAMRKLGASINKTKTVAIFINQLREKVGVMFG
                     NPETTPGGRALKFYASVRMDVRGNTQIKGTGDKKDQNVGKETKVKIVKNKVAPPFKEA
                     VVEIMYGEGISRTGELIEIGSNLGIIQKAGAWYSYNGEKIGQGSENAKKFLADNPAIF
                     DEIDRKIRVHYGLIEADGVEEVATEEAPVVAEEIQDVILDLDGGIELED"
     gene            69076..69474
                     /locus_tag="SSUBM407_RS00375"
                     /old_locus_tag="SSUBM407_0059"
     CDS             69076..69474
                     /locus_tag="SSUBM407_RS00375"
                     /old_locus_tag="SSUBM407_0059"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017768833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator Spx"
                     /protein_id="WP_002939362.1"
                     /translation="MIKIYTVSSCTSCKKAKNWLNAHQLSYNEHNLAKEAITKEEILN
                     ILTKTENGIASIVSSKNRYAKSLDFDIEELSVNEVIDLITSNPRILKSPILIDEKRLQ
                     VGYKEDDIRAFLPRAVRNVENAQARMRAAL"
     gene            69574..69840
                     /locus_tag="SSUBM407_RS00380"
                     /old_locus_tag="SSUBM407_0060"
     CDS             69574..69840
                     /locus_tag="SSUBM407_RS00380"
                     /old_locus_tag="SSUBM407_0060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003045720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IreB family regulatory phosphoprotein"
                     /protein_id="WP_002939360.1"
                     /translation="MGFTEETVRFRLDDTDKQEISKTLTSVYRSLEEKGYNPINQIIG
                     YVLSGDPAYIPRYNDARNQIRKHERDEIIEELVRYYLKGNGIDL"
     gene            69840..70259
                     /gene="ruvX"
                     /locus_tag="SSUBM407_RS00385"
                     /old_locus_tag="SSUBM407_0061"
     CDS             69840..70259
                     /gene="ruvX"
                     /locus_tag="SSUBM407_RS00385"
                     /old_locus_tag="SSUBM407_0061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003071469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase RuvX"
                     /protein_id="WP_002939356.1"
                     /translation="MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIPIDEEKGEFGLER
                     LTELVEQYKVDKFVVGLPKNMNNTSGPRVEASQAYGDLLTERYKLPVDYQDERLTTVA
                     AERMLIEQADISRGKRKKVIDKLAAQLILQNYLDRTF"
     gene            70271..70591
                     /locus_tag="SSUBM407_RS00390"
                     /old_locus_tag="SSUBM407_0062"
     CDS             70271..70591
                     /locus_tag="SSUBM407_RS00390"
                     /old_locus_tag="SSUBM407_0062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1292 domain-containing protein"
                     /protein_id="WP_002939343.1"
                     /translation="MAHHHDHEHDHNHDERELITLVDDQGNETLFEILLTIDGQEEFG
                     KNYVLLIPASAEEDENGEVEIQAYSYIENENGTEGDLQPIPEDATAEWDMIEEVFNSF
                     MEEE"
     gene            70799..71377
                     /locus_tag="SSUBM407_RS00395"
                     /old_locus_tag="SSUBM407_0063"
     CDS             70799..71377
                     /locus_tag="SSUBM407_RS00395"
                     /old_locus_tag="SSUBM407_0063"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase family protein"
                     /protein_id="WP_012774895.1"
                     /translation="MKDSFTERSKKLSEELERCLLADKNILVILDIMDRLNLSDCWLC
                     AGTIRNFIWNQYSFDEETDVDLVFFDENISYEETMEIESNLYQNYPAYQWELKNQVYM
                     HIHSPNTKPYQSSRDAIEKFPERCTAIGICRTERNKLEIFAPFGLDDIYAYQVRPTPH
                     FLADPNRMELYRQRILKKQWKKRWLSLTVKEI"
     gene            71450..71716
                     /locus_tag="SSUBM407_RS00400"
                     /old_locus_tag="SSUBM407_0064"
     CDS             71450..71716
                     /locus_tag="SSUBM407_RS00400"
                     /old_locus_tag="SSUBM407_0064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014635810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014635810.1"
                     /translation="MEFETVCLKVRNLGRLYCYFKVKFRTHIEAIIRKQESQKCKFDR
                     LLHEDIHSLIQSPSLGNDELLMLWGLLRDYRKNLINDRLENMKN"
     gene            72039..72347
                     /gene="rpsJ"
                     /locus_tag="SSUBM407_RS00405"
                     /old_locus_tag="SSUBM407_0065"
     CDS             72039..72347
                     /gene="rpsJ"
                     /locus_tag="SSUBM407_RS00405"
                     /old_locus_tag="SSUBM407_0065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003046044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_011922546.1"
                     /translation="MANKKIRIRLKAYEHRTLDTAAAKIVETATRTGAQVAGPVPLPT
                     ERSFYTIIRATHKYKDSREQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL
                     "
     gene            72444..73070
                     /gene="rplC"
                     /locus_tag="SSUBM407_RS00410"
                     /old_locus_tag="SSUBM407_0066"
     CDS             72444..73070
                     /gene="rplC"
                     /locus_tag="SSUBM407_RS00410"
                     /old_locus_tag="SSUBM407_0066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002986659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_011921686.1"
                     /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETD
                     GYAAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGQEITVETFAA
                     GDVVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLAG
                     RMGGNRVTIQNLEVVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
     gene            73095..73718
                     /gene="rplD"
                     /locus_tag="SSUBM407_RS00415"
                     /old_locus_tag="SSUBM407_0067"
     CDS             73095..73718
                     /gene="rplD"
                     /locus_tag="SSUBM407_RS00415"
                     /old_locus_tag="SSUBM407_0067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012677212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_004195490.1"
                     /translation="MANVTLFDQTGKQAGEVVLNDAIFGIEPNQAVVFDVIISQRASL
                     RQGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKLP
                     QKVRRLALKSVYSEKVAENKFVAVNSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGN
                     EFAALSARNIPGVKVATATTASVLDIANADKLLVTQAAISKIEEVLA"
     gene            73718..74017
                     /locus_tag="SSUBM407_RS00420"
                     /old_locus_tag="SSUBM407_0068"
     CDS             73718..74017
                     /locus_tag="SSUBM407_RS00420"
                     /old_locus_tag="SSUBM407_0068"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006739217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_004195491.1"
                     /translation="MNLYDVIKKPVITESSMGQLEAGKYVFEVDTRAHKLLIKQAVEA
                     AFEGVKVANVNTINVKPKTKRVGRYVGRTNKVKKAIITLAADSKAIELFATADAE"
     gene            74035..74868
                     /gene="rplB"
                     /locus_tag="SSUBM407_RS00425"
                     /old_locus_tag="SSUBM407_0069"
     CDS             74035..74868
                     /gene="rplB"
                     /locus_tag="SSUBM407_RS00425"
                     /old_locus_tag="SSUBM407_0069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019790357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_002936663.1"
                     /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRN
                     NNGRITVRHQGGGHKRFYRLVDFKRNKDGVEAIVKTIEYDPNRSANIALVHYTDGVKA
                     YIIAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTVVHNIELKPGRGGELVRAAGA
                     SAQVLGQEGKYVLVRLQSGEVRMILGTCRATVGTVGNEQHGLVNLGKAGRSRWKGIRP
                     TVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNQ
                     K"
     gene            75119..75400
                     /gene="rpsS"
                     /locus_tag="SSUBM407_RS00430"
                     /old_locus_tag="SSUBM407_0070"
     CDS             75119..75400
                     /gene="rpsS"
                     /locus_tag="SSUBM407_RS00430"
                     /old_locus_tag="SSUBM407_0070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000533767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_000533766.1"
                     /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSF
                     IGYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
     gene            75418..75762
                     /gene="rplV"
                     /locus_tag="SSUBM407_RS00435"
                     /old_locus_tag="SSUBM407_0071"
     CDS             75418..75762
                     /gene="rplV"
                     /locus_tag="SSUBM407_RS00435"
                     /old_locus_tag="SSUBM407_0071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018371349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_002936662.1"
                     /translation="MAEITSAKATARTVRVSPRKSRLVLDNIRGKSVADAIAILKFTP
                     NKAAGIIEGVLNSAIANAENNFGLEKANLVVSEAFANEGPTLKRFRPRAKGSASPINK
                     RTAHITVVVAEK"
     gene            75775..76428
                     /gene="rpsC"
                     /locus_tag="SSUBM407_RS00440"
                     /old_locus_tag="SSUBM407_0072"
     CDS             75775..76428
                     /gene="rpsC"
                     /locus_tag="SSUBM407_RS00440"
                     /old_locus_tag="SSUBM407_0072"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000529931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_002936661.1"
                     /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRNFIKK
                     ELADASTSTIEIERAVNKVIVSIHTAKPGMVIGKAGSNVDALRAQLNKLTGKQVHINI
                     IEIKQPDLDAHLVGESIARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGAD
                     IARAEGYSEGTVPLHTLRADIDYAWEEALTTYGKLGVKVWIYRGEVLPARKNTKGGK"
     gene            76432..76845
                     /gene="rplP"
                     /locus_tag="SSUBM407_RS00445"
                     /old_locus_tag="SSUBM407_0073"
     CDS             76432..76845
                     /gene="rplP"
                     /locus_tag="SSUBM407_RS00445"
                     /old_locus_tag="SSUBM407_0073"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003029477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_002936660.1"
                     /translation="MLVPKRVKHRREFRGKMRGEAKGGKQVDFGQYGLQATTSSWITN
                     RQIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKV
                     MFEVAGVSEEIAREAFRLAGHKLPVKVKFVKREAE"
     gene            76855..77061
                     /locus_tag="SSUBM407_RS00450"
                     /old_locus_tag="SSUBM407_0074"
     CDS             76855..77061
                     /locus_tag="SSUBM407_RS00450"
                     /old_locus_tag="SSUBM407_0074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018369826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_002936659.1"
                     /translation="MKLQEIKDFVKELRGLSQEELAKKENELKKELFELRFQAAAGQL
                     EQTARLNEVKKQIARIKTVQSETK"
     gene            77085..77345
                     /gene="rpsQ"
                     /locus_tag="SSUBM407_RS00455"
                     /old_locus_tag="SSUBM407_0075"
     CDS             77085..77345
                     /gene="rpsQ"
                     /locus_tag="SSUBM407_RS00455"
                     /old_locus_tag="SSUBM407_0075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006738952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_000440801.1"
                     /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKK
                     YKAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
     gene            77370..77738
                     /gene="rplN"
                     /locus_tag="SSUBM407_RS00460"
                     /old_locus_tag="SSUBM407_0076"
     CDS             77370..77738
                     /gene="rplN"
                     /locus_tag="SSUBM407_RS00460"
                     /old_locus_tag="SSUBM407_0076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002460061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_002936658.1"
                     /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDIIVASVK
                     QATPGGAVKKGDVVKAVIVRTKTGARRADGSYIKFDENAAVIIREDKNPRGTRIFGPV
                     ARELRDGGFMKIVSLAPEVL"
     gene            77877..78182
                     /gene="rplX"
                     /locus_tag="SSUBM407_RS00465"
                     /old_locus_tag="SSUBM407_0077"
     CDS             77877..78182
                     /gene="rplX"
                     /locus_tag="SSUBM407_RS00465"
                     /old_locus_tag="SSUBM407_0077"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_011921687.1"
                     /translation="MFVKKGDKVRVIAGKDKGVEAVVVTALPKVNKVIVEGVNIVKKH
                     QKSNSENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
     gene            78206..78748
                     /gene="rplE"
                     /locus_tag="SSUBM407_RS00470"
                     /old_locus_tag="SSUBM407_0078"
     CDS             78206..78748
                     /gene="rplE"
                     /locus_tag="SSUBM407_RS00470"
                     /old_locus_tag="SSUBM407_0078"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018376779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_002936653.1"
                     /translation="MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGDA
                     VSNAKNLEKAAQELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLD
                     KLVTVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGMDIVIVTT
                     ANTDEESRALLTGLGMPFAK"
     gene            78763..78948
                     /locus_tag="SSUBM407_RS00475"
                     /old_locus_tag="SSUBM407_0079"
     CDS             78763..78948
                     /locus_tag="SSUBM407_RS00475"
                     /old_locus_tag="SSUBM407_0079"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011245027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type Z 30S ribosomal protein S14"
                     /protein_id="WP_002936651.1"
                     /translation="MAKKSMIAKNKRPAKFSTQAYTRCEKCGRPHSVYRKFKLCRVCF
                     RDLAYLGQIPGVTKASW"
     gene            79285..79683
                     /gene="rpsH"
                     /locus_tag="SSUBM407_RS00480"
                     /old_locus_tag="SSUBM407_0081"
     CDS             79285..79683
                     /gene="rpsH"
                     /locus_tag="SSUBM407_RS00480"
                     /old_locus_tag="SSUBM407_0081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009754342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_002936647.1"
                     /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIATILKNEG
                     FVKNVEFIEDDKQGIIRVFLKYGPNGEKVITNLKRVSKPGLRVYSKREDIPKVLNGLG
                     IAIISTSEGLLTDKQARQKNVGGEVIAYVW"
     gene            80149..80685
                     /gene="rplF"
                     /locus_tag="SSUBM407_RS00485"
                     /old_locus_tag="SSUBM407_0084"
     CDS             80149..80685
                     /gene="rplF"
                     /locus_tag="SSUBM407_RS00485"
                     /old_locus_tag="SSUBM407_0084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016399261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_004195502.1"
                     /translation="MSRIGNKVITLPAGVELAQNNGVVTVKGPKGELTREFPTAIEIR
                     VEGAEVTLHRPNDSKEMKTIHGTSRANLNNMVVGVSEGFKKELEMRGVGYRAQLAGNK
                     LTLAVGKSHPDEVVAPEGITFEVPTPTQIVVSGINKEVVGQTAAYIRSLRAPEPYKGK
                     GIRYVGEFVRRKEGKTGK"
     gene            80774..81130
                     /gene="rplR"
                     /locus_tag="SSUBM407_RS00490"
                     /old_locus_tag="SSUBM407_0085"
     CDS             80774..81130
                     /gene="rplR"
                     /locus_tag="SSUBM407_RS00490"
                     /old_locus_tag="SSUBM407_0085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018374469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_002936641.1"
                     /translation="MISKPDKNKIRQKRHRRVRGKISGTAARPRLNIFRSNTGIYAQV
                     IDDVAGVTLASASTLDKEVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYHG
                     RVKALAESARENGLKF"
     gene            81149..81643
                     /gene="rpsE"
                     /locus_tag="SSUBM407_RS00495"
                     /old_locus_tag="SSUBM407_0086"
     CDS             81149..81643
                     /gene="rpsE"
                     /locus_tag="SSUBM407_RS00495"
                     /old_locus_tag="SSUBM407_0086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018376782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_002936639.1"
                     /translation="MAFKDNAVEIEERVVAINRVTKVVKGGRRLRFAALVVVGDRNGR
                     VGFGTGKAQEVPEAIRKAVESAKKNMIEVPMVGTTIPHEVRSEFGGARVLLKPASEGS
                     GVAAGGATRAVIELAGIADVTSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISV
                     SDLA"
     gene            81658..81840
                     /gene="rpmD"
                     /locus_tag="SSUBM407_RS00500"
                     /old_locus_tag="SSUBM407_0087"
     CDS             81658..81840
                     /gene="rpmD"
                     /locus_tag="SSUBM407_RS00500"
                     /old_locus_tag="SSUBM407_0087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018376783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="WP_002936638.1"
                     /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNPAIL
                     GMVNAISHLVTVEEVK"
     gene            81976..82416
                     /gene="rplO"
                     /locus_tag="SSUBM407_RS00505"
                     /old_locus_tag="SSUBM407_0088"
     CDS             81976..82416
                     /gene="rplO"
                     /locus_tag="SSUBM407_RS00505"
                     /old_locus_tag="SSUBM407_0088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004225266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_002936637.1"
                     /translation="MKLHELQPATGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGG
                     GVRPGFEGGQTPLFRRLPKRGFTNINAKEYAIVNLDQLNAFEDGAEVTPVVLIEAGIV
                     KAEKSGIKILGNGELTKKLTVKAAKFSKSAEEAITSKGGSVEVI"
     gene            82430..83740
                     /gene="secY"
                     /locus_tag="SSUBM407_RS00510"
                     /old_locus_tag="SSUBM407_0089"
     CDS             82430..83740
                     /gene="secY"
                     /locus_tag="SSUBM407_RS00510"
                     /old_locus_tag="SSUBM407_0089"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018377724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_002936636.1"
                     /translation="MFFKLLKDALKVKLVRSKILFTIFILFVFRVGTHITVPGVNAKS
                     LEALSNLPFLNMLSLVSGNAMRNFSVFALGVSPYITASIIVQLLQMDILPKFVEWGKQ
                     GEVGRRKLNQATRYISLVLAFVQSIGITAGFNALSGAKLTNMPLNWQTYLLIGAILTT
                     GSIIVTWLGEQISEKGYGNGTSMIIFAGIISSLPGTFHEIYIDRFVNIESSRLGESAI
                     FVAALVVLIFFVVYFTTFVQQAEYKLPIQYTKRAQGAPSSSYLPLKLNPAGVIPVIFA
                     GSITAVPTSLIQYFASQNKSAGWLLTVQEYFDYSTAKGMIVYAGLIIAFTFFYTFVQV
                     NPEKTAESLQKSAAYIHGVRPGNGTEQFLSKLLTRLAVIGALFLSFVALLPILAQNLF
                     GLSSSIAFLGTSLIIVISTSIEGIKQLEGYLLKRKYVGFLEITE"
     gene            83834..84475
                     /locus_tag="SSUBM407_RS00515"
                     /old_locus_tag="SSUBM407_0090"
     CDS             83834..84475
                     /locus_tag="SSUBM407_RS00515"
                     /old_locus_tag="SSUBM407_0090"
                     /EC_number="2.7.4.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001050429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="WP_002936630.1"
                     /translation="MNLLIMGLPGAGKGTQAAKIVEKFNVAHISTGDMFRAAMANQTE
                     MGILAKSYIDKGDLVPDEVTNGIVKERLVQDDIKEKGFLLDGYPRTIEQAHALDENLA
                     DLGIELQGVINIEIDPSKLVERLSGRIIHKETGETFHKVFNPPVGDYKEEDFYQREDD
                     KPESVKRRLEVNIAQGQPIIDHYRAKGLVHDIEGDQDIDLVFQAIDTVLSKLQ"
     gene            84597..84815
                     /gene="infA"
                     /locus_tag="SSUBM407_RS00520"
                     /old_locus_tag="SSUBM407_0091"
     CDS             84597..84815
                     /gene="infA"
                     /locus_tag="SSUBM407_RS00520"
                     /old_locus_tag="SSUBM407_0091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003130554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="WP_002936627.1"
                     /translation="MAKEDVIEIEGKVVDTMPNAMFTVELENGHQVLATVSGKIRKNY
                     IRILVGDRVTVELSPYDLTRGRITYRFK"
     gene            84840..84956
                     /gene="rpmJ"
                     /locus_tag="SSUBM407_RS00525"
                     /old_locus_tag="SSUBM407_0092"
     CDS             84840..84956
                     /gene="rpmJ"
                     /locus_tag="SSUBM407_RS00525"
                     /old_locus_tag="SSUBM407_0092"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013773089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="WP_001808836.1"
                     /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPANPKHKQRQG"
     gene            84976..85341
                     /gene="rpsM"
                     /locus_tag="SSUBM407_RS00530"
                     /old_locus_tag="SSUBM407_0093"
     CDS             84976..85341
                     /gene="rpsM"
                     /locus_tag="SSUBM407_RS00530"
                     /old_locus_tag="SSUBM407_0093"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008809894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_002936622.1"
                     /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVR
                     VKDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNT
                     KNNARTRKGKAVAIAGKKK"
     gene            85359..85742
                     /gene="rpsK"
                     /locus_tag="SSUBM407_RS00535"
                     /old_locus_tag="SSUBM407_0094"
     CDS             85359..85742
                     /gene="rpsK"
                     /locus_tag="SSUBM407_RS00535"
                     /old_locus_tag="SSUBM407_0094"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003130556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_004195509.1"
                     /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSS
                     AGALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAG
                     LEVTAIRDVTPVPHNGARPPKRRRV"
     gene            85787..86725
                     /locus_tag="SSUBM407_RS00540"
                     /old_locus_tag="SSUBM407_0095"
     CDS             85787..86725
                     /locus_tag="SSUBM407_RS00540"
                     /old_locus_tag="SSUBM407_0095"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000568977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_011921691.1"
                     /translation="MIEFEKPTITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLA
                     SLPGAAVTSIKIDGVLHEFDTVPGVREDVMQIILNIKGIAVKSYVEDEKKIELDVVGP
                     AEVTAGDILTDSDIEIVNPDHYLFTIADGATFKAVLTVNSGRGYVPAEDNKKDDAPVG
                     TLAVDSIYTPVKKVNYQVEPARVGSNDGFDKLTLEINTNGTIIPEDALGLSARILMEH
                     LGLFTDLTEVAKSAEVMKEAEVASDDRMLDRTIEELDLSVRSYNCLKRAGINTVFDLT
                     EKTEPEMMKVRNLGRKSLEEVKVKLADLGLGLKKDK"
     gene            86740..87126
                     /gene="rplQ"
                     /locus_tag="SSUBM407_RS00545"
                     /old_locus_tag="SSUBM407_0096"
     CDS             86740..87126
                     /gene="rplQ"
                     /locus_tag="SSUBM407_RS00545"
                     /old_locus_tag="SSUBM407_0096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002887523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_012774898.1"
                     /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTV
                     EKMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSATALQKLFSEIAPRYAER
                     NGGYTRILKTEPRRGDAAPMAIIELV"
     gene            87770..89325
                     /locus_tag="SSUBM407_RS00550"
                     /old_locus_tag="SSUBM407_r0004"
     rRNA            87770..89325
                     /locus_tag="SSUBM407_RS00550"
                     /old_locus_tag="SSUBM407_r0004"
                     /product="16S ribosomal RNA"
     gene            89371..89443
                     /locus_tag="SSUBM407_RS00555"
                     /old_locus_tag="SSUBM407_t0018"
     tRNA            89371..89443
                     /locus_tag="SSUBM407_RS00555"
                     /old_locus_tag="SSUBM407_t0018"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:89404..89406,aa:Ala,seq:tgc)
     gene            89717..92627
                     /locus_tag="SSUBM407_RS00560"
                     /old_locus_tag="SSUBM407_r0005"
     rRNA            89717..92627
                     /locus_tag="SSUBM407_RS00560"
                     /old_locus_tag="SSUBM407_r0005"
                     /product="23S ribosomal RNA"
     gene            92713..92828
                     /gene="rrf"
                     /locus_tag="SSUBM407_RS00565"
                     /old_locus_tag="SSUBM407_r0006"
     rRNA            92713..92828
                     /gene="rrf"
                     /locus_tag="SSUBM407_RS00565"
                     /old_locus_tag="SSUBM407_r0006"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
     gene            92834..92906
                     /locus_tag="SSUBM407_RS00570"
                     /old_locus_tag="SSUBM407_t0019"
     tRNA            92834..92906
                     /locus_tag="SSUBM407_RS00570"
                     /old_locus_tag="SSUBM407_t0019"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:92867..92869,aa:Val,seq:tac)
     gene            92912..92982
                     /locus_tag="SSUBM407_RS00575"
                     /old_locus_tag="SSUBM407_t0020"
     tRNA            92912..92982
                     /locus_tag="SSUBM407_RS00575"
                     /old_locus_tag="SSUBM407_t0020"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:92944..92946,aa:Gly,seq:tcc)
     gene            93013..93086
                     /locus_tag="SSUBM407_RS00580"
                     /old_locus_tag="SSUBM407_t0021"
     tRNA            93013..93086
                     /locus_tag="SSUBM407_RS00580"
                     /old_locus_tag="SSUBM407_t0021"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:93047..93049,aa:Ile,seq:gat)
     gene            93093..93164
                     /locus_tag="SSUBM407_RS00585"
                     /old_locus_tag="SSUBM407_t0022"
     tRNA            93093..93164
                     /locus_tag="SSUBM407_RS00585"
                     /old_locus_tag="SSUBM407_t0022"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:93126..93128,aa:Glu,seq:ttc)
     gene            93173..93262
                     /locus_tag="SSUBM407_RS00590"
                     /old_locus_tag="SSUBM407_t0023"
     tRNA            93173..93262
                     /locus_tag="SSUBM407_RS00590"
                     /old_locus_tag="SSUBM407_t0023"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:93209..93211,aa:Ser,seq:tga)
     gene            93272..93345
                     /locus_tag="SSUBM407_RS00595"
                     /old_locus_tag="SSUBM407_t0024"
     tRNA            93272..93345
                     /locus_tag="SSUBM407_RS00595"
                     /old_locus_tag="SSUBM407_t0024"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:93306..93308,aa:Met,seq:cat)
     gene            93361..93433
                     /locus_tag="SSUBM407_RS00600"
                     /old_locus_tag="SSUBM407_t0025"
     tRNA            93361..93433
                     /locus_tag="SSUBM407_RS00600"
                     /old_locus_tag="SSUBM407_t0025"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:93394..93396,aa:Phe,seq:gaa)
     gene            93454..93534
                     /locus_tag="SSUBM407_RS00605"
                     /old_locus_tag="SSUBM407_t0026"
     tRNA            93454..93534
                     /locus_tag="SSUBM407_RS00605"
                     /old_locus_tag="SSUBM407_t0026"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:93488..93490,aa:Tyr,seq:gta)
     gene            93542..93612
                     /locus_tag="SSUBM407_RS00610"
                     /old_locus_tag="SSUBM407_t0027"
     tRNA            93542..93612
                     /locus_tag="SSUBM407_RS00610"
                     /old_locus_tag="SSUBM407_t0027"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:93574..93576,aa:Trp,seq:cca)
     gene            93620..93692
                     /locus_tag="SSUBM407_RS00615"
                     /old_locus_tag="SSUBM407_t0028"
     tRNA            93620..93692
                     /locus_tag="SSUBM407_RS00615"
                     /old_locus_tag="SSUBM407_t0028"
                     /product="tRNA-His"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:93653..93655,aa:His,seq:gtg)
     gene            93704..93775
                     /locus_tag="SSUBM407_RS00620"
                     /old_locus_tag="SSUBM407_t0029"
     tRNA            93704..93775
                     /locus_tag="SSUBM407_RS00620"
                     /old_locus_tag="SSUBM407_t0029"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:93736..93738,aa:Gln,seq:ttg)
     gene            93787..93870
                     /locus_tag="SSUBM407_RS00625"
                     /old_locus_tag="SSUBM407_t0030"
     tRNA            93787..93870
                     /locus_tag="SSUBM407_RS00625"
                     /old_locus_tag="SSUBM407_t0030"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:93821..93823,aa:Leu,seq:caa)
     repeat_region   93818..93906
                     /note="Direct repeat region flanking genomic island"
     gene            complement(93957..95090)
                     /locus_tag="SSUBM407_RS00630"
                     /old_locus_tag="SSUBM407_0097"
     CDS             complement(93957..95090)
                     /locus_tag="SSUBM407_RS00630"
                     /old_locus_tag="SSUBM407_0097"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000155506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_012774899.1"
                     /translation="MTVKKAKNGTWTVDISDGFHPVTKKRIRIIRKGFKTKKEALELE
                     QYIRVVELKEKRFDFLVTTDMLFDILEEEDRQNNRKISYISTQRNNYERHIKPYFINT
                     NLNKLSYEHIFEFREYLKIKPKKQNDSSTLSHNTVNKIMILLKKIFDTGVRKSLIDKN
                     PVENIRKLPISKPTINFWNVEEFNEFRKLITSDEISYDLFFTIAFFTGMRLGEIVALT
                     WYDINLITNSIHITKTAYFVNGTNHINSTKTRAGTRRITINHKLARMLADWKEKQKDL
                     LKEFTTDTENLQVIQSTPLPMTKNMIDKKFKQILARNDYLKKIRIHDLRHSHASLLIN
                     QGEDYLVVKERLGHASITTTIDTYSHLYPSKQKTLANKLDDIF"
     gene            complement(95080..95286)
                     /locus_tag="SSUBM407_RS00635"
                     /old_locus_tag="SSUBM407_0098"
     CDS             complement(95080..95286)
                     /locus_tag="SSUBM407_RS00635"
                     /old_locus_tag="SSUBM407_0098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3173 domain-containing protein"
                     /protein_id="WP_011921695.1"
                     /translation="MIATVNKNDLVALGFSEGTSKRIIRQGKELLIARGFRVYQNKRV
                     GTIPASIATELLGFDVSLGAHHDS"
     gene            complement(95347..96363)
                     /locus_tag="SSUBM407_RS00640"
                     /old_locus_tag="SSUBM407_0099"
     CDS             complement(95347..96363)
                     /locus_tag="SSUBM407_RS00640"
                     /old_locus_tag="SSUBM407_0099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013730066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation factor domain-containing
                     protein"
                     /protein_id="WP_011921696.1"
                     /translation="MNTVRIDYFAVTVKNIPPESVLTDILLIPLEDFTLNNWGINKYQ
                     RHYACSEIKVYFNEDRPSMGVFIELKGQGCRQYEEFLDGNENNWIALIGRLYQYSVNF
                     TRLDIAHDIFDGSLDVQRVYDYCKKGLCISKAKHFEYHEKSVLENGERVGETVAIGSR
                     GNQQWCIYNKRMEQLSKQELVEYPSWIRAELRCWQDKANIIAEQLFLKRPLSSIYFEA
                     INGHYRFVKPNATDTNRWRRKKVKWWLDYLKTENQTVLSVERTKPTLRQSEAWTEKQV
                     AKTLAKVYTAKYQAYDVQKAEDYIQGLLKEGLSRLTDNDEKDIEQYIREQNSSPLWGQ
                     KKTT"
     gene            complement(96368..96787)
                     /locus_tag="SSUBM407_RS00645"
                     /old_locus_tag="SSUBM407_0100"
     CDS             complement(96368..96787)
                     /locus_tag="SSUBM407_RS00645"
                     /old_locus_tag="SSUBM407_0100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011921697.1"
                     /translation="MTYNMTDTTLKIGQLDLDMTQFEVPKKIVILSAKVNNRYNEVNG
                     EKIKTEEVTKITCTALDADKVKVLTEMGISTDDLKAINLEIVGNVDKVATLAQNESLL
                     NVPIELVKPKVRLAWNMARSNWAGVKLVCEDIKILGA"
     gene            complement(97089..98444)
                     /locus_tag="SSUBM407_RS00650"
                     /old_locus_tag="SSUBM407_0101"
     CDS             complement(97089..98444)
                     /locus_tag="SSUBM407_RS00650"
                     /old_locus_tag="SSUBM407_0101"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014638884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsK"
                     /protein_id="WP_043032401.1"
                     /translation="MKLIKLNHAVRVRLNPYIITSKRLFLSRVGMDLFLGMLLINTWV
                     SPYSIPIKSVLSLIFIGIICSIEKFFKSVFISKIQNILYVRESLFDMLIGLNLYEESD
                     NVVTNSATLNFEILPNDIVMVEVPLFGNKFLKLLKNLEEYLVPTLGLPLLSKYEFPDH
                     VIYKLGKIEEIEQYIFNSQTLTRDFFEDIPTPIVKLSNTQQFSLKQNTNLGVYGRTGT
                     GKTIALQWYLFNALAKGCGIDTYLAIVDGKGADLYALGALLQEELGKQISVGSSPTSL
                     AKLSRQFVKIMDERFEVIKQNSSLNADAYDLGMTPNFLFIDELASIRDSCGSSKQGKE
                     LWNEILQNLGLIARKGRQAGCHLCLSTQDPNAENIPVELRNQISAVLYLGNIGDDRLK
                     MAFSMCELENVPTISDRKGEALFYADGLNSVEPVLTIVPFVDVKTKQDFLQVVRNILP
                     N"
     gene            complement(98380..98637)
                     /locus_tag="SSUBM407_RS00655"
                     /old_locus_tag="SSUBM407_0102"
     CDS             complement(98380..98637)
                     /locus_tag="SSUBM407_RS00655"
                     /old_locus_tag="SSUBM407_0102"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775471.1"
                     /translation="MKIYKFMFNITYPALVISLYIIFQMKGTMSPWFDTLFVAGGFLV
                     IPLLLLLLGYLSENDHGGTDNEANQAESCSTSEVESLYNNL"
     gene            complement(98692..99012)
                     /locus_tag="SSUBM407_RS00660"
                     /old_locus_tag="SSUBM407_0103"
     CDS             complement(98692..99012)
                     /locus_tag="SSUBM407_RS00660"
                     /old_locus_tag="SSUBM407_0103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011921700.1"
                     /translation="MKTFKDIFLSEGMEMPNINGIKRVQSFNSDKSVNFTLDDESRDF
                     LKENLPIEGVIYEPTLKKLAENIIILNRQKHRISDEFRISLMNKEIYQGYRETSFYTS
                     IIEA"
     gene            complement(99191..99712)
                     /locus_tag="SSUBM407_RS00665"
                     /old_locus_tag="SSUBM407_0104"
     CDS             complement(99191..99712)
                     /locus_tag="SSUBM407_RS00665"
                     /old_locus_tag="SSUBM407_0104"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012774902.1"
                     /translation="MCISNTTKLIIGVKMRSHLGVRLSYEAKYWLESIQAVIQEKLDA
                     KINEQDIENLEHATKSYLKEVDNELGATSVTLILKASASSVLEEAFEKTKSLSLKDWH
                     KLDNEMKHSISSIPKDKDVGTLSVRFFLENSIITSLESYQKEFMTSEMVRQVRLSYVL
                     KLVIFAYYKEIMQ"
     repeat_region   99856..99944
                     /note="Direct repeat flanking genomic island, partial
                     tRNA"
     gene            100040..100822
                     /locus_tag="SSUBM407_RS00670"
                     /old_locus_tag="SSUBM407_0105"
     CDS             100040..100822
                     /locus_tag="SSUBM407_RS00670"
                     /old_locus_tag="SSUBM407_0105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2971 domain-containing protein"
                     /protein_id="WP_012774903.1"
                     /translation="MKTLYHYTTVETLLLILNYKTLRFKSLLYVDDPLEPSTSDFGNL
                     GGFKYVSCWTDTPNSIPQWTMYSDNMTGVCIGISFDKETDVFLTEKFSLSESSEPIDM
                     VNALHPLKSGLLVTNNKYVPSLEQIRYTDDVSLITPRVVSSDDKSTTINLASNGIYKT
                     TDWSFQNEQRFSFQIFPLPIDLVLELMNANKGDLTEIINSFISVKPKEYFDLDLNPTI
                     FSNMTITFGKRCSAEDKLKVSKFLEDNKFHIPLFDSTVNIKP"
     gene            complement(100819..101094)
                     /locus_tag="SSUBM407_RS00675"
     CDS             complement(100819..101094)
                     /locus_tag="SSUBM407_RS00675"
                     /inference="COORDINATES: protein motif:HMM:NF012798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_014636196.1"
                     /translation="MSVFQSSPITITKNSIEKQYKKILERDAALKKIRIHDFRHSHAS
                     LLINRGEDYLVVKERLGHAFITTSIDTYSHLYPSKQKDLADKLDDLI"
     gene            <101090..101188
                     /locus_tag="SSUBM407_RS00680"
                     /pseudo
     CDS             <101090..101188
                     /locus_tag="SSUBM407_RS00680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004226747.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS982 family transposase"
     gene            101543..101986
                     /locus_tag="SSUBM407_RS00685"
                     /old_locus_tag="SSUBM407_0107"
     CDS             101543..101986
                     /locus_tag="SSUBM407_RS00685"
                     /old_locus_tag="SSUBM407_0107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix DNA-binding protein"
                     /protein_id="WP_012774904.1"
                     /translation="MNRIALEIEKYLHEIVLSSENQLEILVGSCQSTVKLTNTQEHIL
                     MLIEKAAYTNTEIAKELNVSQAAITKATKSLVAQGLLVAVRDDKDARIVRFSLTEAAK
                     PIAAEHAHHHAHTLEAYEELLENYSLEEQESIARFLSELVEKIRK"
     gene            101987..102691
                     /locus_tag="SSUBM407_RS00690"
                     /old_locus_tag="SSUBM407_0108"
     CDS             101987..102691
                     /locus_tag="SSUBM407_RS00690"
                     /old_locus_tag="SSUBM407_0108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003027299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter ATP-binding protein"
                     /protein_id="WP_002936595.1"
                     /translation="MRYITVEDLSFYYDKEPVLEHIHYYLDSGEFVTLTGENGAAKTT
                     LIKATLGILKPKQGKVSIAEKSIKGKKLRMAYLPQQIASFNAGFPSTVYEFVKSGRYP
                     RQGWFRRLTAHDEEHVRISLESVGMWEHRDKRLGALSGGQKQRAVIARMFASDPDIFI
                     LDEPTTGMDAGTKDAFYQLMHHSAKKHGKSVLMITHDPDELNKYADRNIHLVRDQQSP
                     WRCFNVHEADEEVAHV"
     gene            102684..103496
                     /locus_tag="SSUBM407_RS00695"
                     /old_locus_tag="SSUBM407_0109"
     CDS             102684..103496
                     /locus_tag="SSUBM407_RS00695"
                     /old_locus_tag="SSUBM407_0109"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002903540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter permease"
                     /protein_id="WP_002936593.1"
                     /translation="MFDLSVFHYDFMQRAFLAIIAMSLFSPILGVFLILRRQSLMSDT
                     LSHVSLAGVAFGLVLGISPTLSTVLVVIVAAVFLEYLRTIYKNFMEIGTAILMSTGLA
                     ISLIVMNKSGGKSGLSLEQYLFGSIVTISQEQVIALFTIAVIVIVLTLLFLRPMYILT
                     FDEDTAFVDGLPVRAMSIAFNVVTGVAIALMIPAAGALLVSTIMVLPASIALRLGKSF
                     KAVIFTGMGIGFFGMVMGLLTSYYAETPASASITLIFISIFLLVNVVQKFKK"
     gene            103506..105017
                     /locus_tag="SSUBM407_RS00700"
                     /old_locus_tag="SSUBM407_0110"
     CDS             103506..105017
                     /locus_tag="SSUBM407_RS00700"
                     /old_locus_tag="SSUBM407_0110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011836339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter substrate-binding protein
                     AdcA"
                     /protein_id="WP_011921705.1"
                     /translation="MKKVGLLFLSVSALLLGACGNSTASEDGKLNIVTTFYPVYEFTK
                     QVAGDEANVDLLVKAGTEVHGYEPSAKDIARIQEADAFVYENENMETWVHDVEKSLDT
                     TKVNVISATEGMLLLPGGEEEHEGHDHSEEGHSHAYDPHVWLSPERAITLVENIRDSL
                     VAKYPEKKDAFETNAAAYIEKLDALDAKYSETLSAAKQKYFVTQHTAFAYLALDYGLK
                     QVSITGVAADEDPTPSRLAELTEYINKYGIKYIYFEENASKSVAETLAKETGVQLDVL
                     NPLESLTDEDMKNGKDYISVMEDNLIALEKTTSQEGSEILPEEGAETAQTVYNGYFED
                     SAVKDRTLSDYAGEWQSVYPYLLDGTLDQVWDYKAKIKGGMTAEEYKTYYDTGYKTDV
                     DQINITDNTMEFVVGDKKEKFTYKYVGYKILTYKKGNRGVRFLFEATDANAGNYKYVQ
                     FSDHNIAPVKTGHFHIYFGGESQEKLLEELENWPTYYPVGLTGLEIGQEMLAH"
     gene            105120..105590
                     /locus_tag="SSUBM407_RS00705"
                     /old_locus_tag="SSUBM407_0111"
     CDS             105120..105590
                     /locus_tag="SSUBM407_RS00705"
                     /old_locus_tag="SSUBM407_0111"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CopY/TcrY family copper transport repressor"
                     /protein_id="WP_014636197.1"
                     /translation="MEQTISAAEWQVMRVLWAHPGATSQEIIQALQEGFDWQATTIKT
                     LLGRLRKKNYLRMAKETSKYHYYPLISEEEHLQGQVELLLAAICSTKQGQLVEKLLDT
                     GTFSKKSLENLASKISQLQRTAPEQIACRCLAGQCTCGHHHTLRKSTSDVVDLT"
     gene            105771..105980
                     /locus_tag="SSUBM407_RS00710"
                     /old_locus_tag="SSUBM407_0113"
     CDS             105771..105980
                     /locus_tag="SSUBM407_RS00710"
                     /old_locus_tag="SSUBM407_0113"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy-metal-associated domain-containing
                     protein"
                     /protein_id="WP_011921708.1"
                     /translation="MKQTLKLKNLSCQNCVKHVTNHLLDLDGVEEVKIQLEEQLAEVA
                     TSVAYDLERYQEVLEDTIYEVEELV"
     gene            complement(106008..106385)
                     /locus_tag="SSUBM407_RS00715"
                     /old_locus_tag="SSUBM407_0114"
     CDS             complement(106008..106385)
                     /locus_tag="SSUBM407_RS00715"
                     /old_locus_tag="SSUBM407_0114"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HIT family protein"
                     /protein_id="WP_012774905.1"
                     /translation="MTCIFCHQIEEIDILYQTEYFKVVWDIDPIQTGHLLIISKDHYD
                     TLSQVPPTIRYELSDLEVFLTEKLCQTLAIDGVTTACNDRLFNAGTHFHVHLIPRFRS
                     DGFWDQISLAQAQLDLTHFLKAL"
     gene            complement(106443..107699)
                     /locus_tag="SSUBM407_RS00720"
                     /old_locus_tag="SSUBM407_0115"
     CDS             complement(106443..107699)
                     /locus_tag="SSUBM407_RS00720"
                     /old_locus_tag="SSUBM407_0115"
                     /EC_number="6.1.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011184085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine--tRNA ligase"
                     /protein_id="WP_011922558.1"
                     /translation="MNIFEELKARGLVFQTTDEEALVKALTEGQVSYYTGYDPTADSL
                     HLGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKDTVDGWVTKIQ
                     GQLSRFLDFENGDNKAEMVNNYDWFSDISFIDFLRDVGKYYTVNYMMSKDSVKKRIET
                     GISYTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLRRKADKSGHVMT
                     VPLITDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDE
                     IAEIEKQFDAARHERLAQKILAKEVVTLVHGEEAYNQALNITEQLFAGNIKNLSAKEL
                     KQGLSNVPNYAVQAEDNLNIVELLVTSGIVNSKRQAREDVQNGAIYVNGERVQDLDYT
                     LSDSDKIDGELTVIRRGKKKYSVLTY"
     gene            107853..110276
                     /locus_tag="SSUBM407_RS00725"
                     /old_locus_tag="SSUBM407_0116"
     CDS             107853..110276
                     /locus_tag="SSUBM407_RS00725"
                     /old_locus_tag="SSUBM407_0116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="WP_011921713.1"
                     /translation="MATKSDKQDFKKKISALGLGDVVGVFLRTLKLLFNSVAVLVFLF
                     GLFGAGIGIGFVVSLFDDVKIPKTEELVAKVSEVSRISTVTYSDGSLVSEVNSDLLRV
                     PITSEEVSNYLKQAVIATEDETFETHNGVVPKAVLRAALGSVGLGSSSGGSTLTQQLI
                     KQQLVGDAPTFTRKANEIVSALALERNMTKEEILTIYLNVSPFGRNNQGRNIAGVEAA
                     AQGIFGKPAKDLTVPQAAFIAGLPQSPIVYSPYASDGTRKSDEDMVYGIERYQDVLFN
                     MYRASFLTKEEYETYKAYDIKQDFIAPAPVMADTKDYLYYKVMEEAQEVMFDYLVKRD
                     KVSKNDLKNDETKASYEELAKQELSQGGYTIKSTVDQKIYAAMQSVVANYGSVLDDGN
                     EYVETGSVLIDNATGAILGFVGGRDYATNQNNHAFDTLRSPASTIKPLLAYGIAIDQG
                     LIGSASILSDYPTNFSSGQPIMYGSGRGTGMMNLQTAIDRSVNIPAFWTYKMMRNAGV
                     DAKAYMDKMNYHIPMYDIESVPLGGGVEISVLTNTNAYQTLANGGVYNKHYIVESITA
                     SDGTVVYQHEATPVQVYSKATASIMNQLLRQVVNSGYTTTFKSRLSGLNPQAASSDFV
                     GKTGTSNEVNDVWLMLSTPRVTLGTWAGNDDNSEMYVWTGYHNNSQYVAHMVDALYNV
                     NADMFAGKFELDSSVIASSVVASTGQRAGTTQVNGRQVTVGGAMTTSYWAKNGAPVTS
                     YNFMVGGTDSDRAQAWNTIIGSQTATSSSSTQRSSSTRSSTSSSANNTNQSSETQTAT
                     SEQANNDSP"
     gene            110911..114483
                     /gene="rpoB"
                     /locus_tag="SSUBM407_RS00730"
                     /old_locus_tag="SSUBM407_0119"
     CDS             110911..114483
                     /gene="rpoB"
                     /locus_tag="SSUBM407_RS00730"
                     /old_locus_tag="SSUBM407_0119"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006595147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_002936570.1"
                     /translation="MAGHEVQYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDYG
                     LKEVFEDVLPVSNFTDTMELEFVGYELKEPKYTLEEARAHDANYSAPIYVTFRLVNKE
                     TGEIKTQEVFFGEFPIMTEMGTFIINGAERIIVSQLVRSPGVYFNDKVDKNGKVGYGS
                     TVIPNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIFDIFGDSELVR
                     NTIEKDIHKNPADSRTDEALKEIYERLRPGEPKTAESSRSLLTARFFDPRRYDLAPVG
                     RYKINKKLNLRTRLLNQTLAEHVINGETGEIVLEAGTVLSRDVLEKVEAQFDELNLVE
                     YIPNDNAVLLEPVLLQKFKIVAPKDPERVVTVIGNANPAENVRTVTPADILAEMSYFL
                     NLAEGLGRVDDIDHLGNRRIRAVGELLANQVRIGLTRMERNLRERMSVQDNEVLTPQQ
                     IINIRPVTAAIKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRD
                     VHYTHYGRMCPIETPEGPNIGLINNLSSYGHLNKYGFIQTPYRKIDRATGTVTNEIVW
                     LTADEEDAYIVAQSTSPLDENNRFVDKIVMGRHQGNNQEFPADSADFMDVSPKQVVAV
                     ATACIPFLENDDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAIIAQHD
                     GKVVYADADKVEVRREDGSLDVYHISKFRRSNSGTAYNQRTLVKLGDIVEKGDFIADG
                     PSMENGEMALGQNPIVAYMTWEGYNFEDAVIMSERLVKDDVYTSVHLEEYESETRDTK
                     LGPEEITREIPNVGEDALRNLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLL
                     HAIFGDKSREVRDTSLRVPHGADGVVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKI
                     KVGDKMAGRHGNKGVVSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLG
                     MAARNLGIHIATPVFDGASSEDLWSTVKEAGMDSDAKTILYDGRTGEPFDNRVSVGVM
                     YMIKLHHMVDDKLHARSVGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQ
                     EILTYKSDDVTGRLKAYEAITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDNNE
                     VELRDLDEGEDDDIIHVDDLEKARAKAAADAAAAFAAEEAEGKE"
     gene            114661..118308
                     /gene="rpoC"
                     /locus_tag="SSUBM407_RS00735"
                     /old_locus_tag="SSUBM407_0120"
     CDS             114661..118308
                     /gene="rpoC"
                     /locus_tag="SSUBM407_RS00735"
                     /old_locus_tag="SSUBM407_0120"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_012775472.1"
                     /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPERD
                     GLFDEVIFGPTKDWECSCGKYKRIRYKGITCDRCGVEVTRAKVRRERMGHIELKAPIS
                     HIWYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEHKSIMTEREYRERLR
                     EYGYGSFVAKMGAEAIQDLLKQVDLPKEIAALKEELKTASGQKRIKAVRRLDVLDAFY
                     KSGNKPEWMILNILPVIPPDLRPMVQLDGGRFAASDLNELYRRVINRNNRLARLLELN
                     APGIIVQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLG
                     KRVDFSGRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVARDIAGNVKAAKRLIE
                     RGDDRIWDILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNAD
                     FDGDQMAIHVPLSEEAQAEARILMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDA
                     GREGEGMVFKDADEAVMAYRNGYVHLHTRVGIATDSLDKPWKDNQKHKVMMTTVGKIL
                     FNAIMPEGLPYLQEPNNANLTEGTPDKYFLEPGSDIKAAIAELPINPPFKKKNLGNII
                     AEIFKRFRTTETSALLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIEESHERVEQ
                     IKKQFRRGMITDDERYAAVTDEWRSAKEKLEKRLVEKQDPKNPIVMMMDSGARGNISN
                     FSQLAGMRGLMSAPNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSG
                     YLTRRLVDVAQDVIIREDDCGTDRGLDIRSITDGKEMIEPLEERLQGRYTKKTVKHPE
                     TGAVIIGPNQLITEDIACEIVNAGVEQVTIRSVFTCNTRHGVCRHCYGINLATGDAVE
                     VGEAVGTIAAQSIGEPGTQLTMRTFHTGGVASNSDITQGLPRVQEIFEARNPKGEAVI
                     TEVKGEVIAIEEDASTRTKKVFVKGKTGEGEYVVPFTARMKVEVGDQVARGAALTEGS
                     IQPKRLLEVRDVLAVETYLLSEVQKVYRSQGVEIGDKHIEVMVRQMLRKVRVMDPGDT
                     DLLMGTLMDITDFTDANAEVVIAGGIPATARPVLMGITKASLETNSFLSAASFQETTR
                     VLTDAAIRGKRDNLLGLKENVIIGKIIPAGTGMARYRNLEPQAINEVEIIEDTVAEEL
                     AAEAELEAVTE"
     gene            118458..118823
                     /locus_tag="SSUBM407_RS00740"
                     /old_locus_tag="SSUBM407_0121"
     CDS             118458..118823
                     /locus_tag="SSUBM407_RS00740"
                     /old_locus_tag="SSUBM407_0121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1033 family protein"
                     /protein_id="WP_002936568.1"
                     /translation="MYQVIKMYGDFEPWWFLDGWEEDVTSRAAFDRYEDALNAFQKEW
                     VRLSEDFPMKKSKNGTMVAFWDESDQHWCEECDEYLQRYHSLMLVEARENLPAGFIKQ
                     PTQPRVRPCKLKQNNCVNE"
     gene            complement(118858..119801)
                     /locus_tag="SSUBM407_RS00745"
                     /old_locus_tag="SSUBM407_0122"
                     /pseudo
     CDS             complement(118858..119801)
                     /locus_tag="SSUBM407_RS00745"
                     /old_locus_tag="SSUBM407_0122"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936565.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="LD-carboxypeptidase"
     gene            119887..120837
                     /gene="tadA"
                     /locus_tag="SSUBM407_RS00750"
                     /old_locus_tag="SSUBM407_0123"
     CDS             119887..120837
                     /gene="tadA"
                     /locus_tag="SSUBM407_RS00750"
                     /old_locus_tag="SSUBM407_0123"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Flp pilus assembly complex ATPase component
                     TadA"
                     /protein_id="WP_011921718.1"
                     /translation="MIQEKARKMIEEAVADRVSDIYLVPRGECYQVYHRIMDDREFVQ
                     DLAEEEVTAIISHFKFLAGLNVGEKRRSQQGSCDYDYGSGEISLRLSTVGDYRGKESL
                     VIRLLYDNDKELKFWFEAAERLAEEIKGRGLYLFSGPVGSGKTTLMYHLARLKFPDKQ
                     ILTIEDPVEIKQEDMLQLQLNEAIGATYDNLIKLSLRHRPDLLIIGEIRDAETARAVI
                     RASLTGATVFSTVHARSISGVYARMLELGVGPEELNNALQGIAYQRLIGGGGVVDFAK
                     GNYQNHSADQWNAQIDRLFAAGHISLRQAETEKITLGSPA"
     gene            120758..121786
                     /locus_tag="SSUBM407_RS00755"
                     /old_locus_tag="SSUBM407_0124"
     CDS             120758..121786
                     /locus_tag="SSUBM407_RS00755"
                     /old_locus_tag="SSUBM407_0124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012130941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system F family protein"
                     /protein_id="WP_012774907.1"
                     /translation="MIGFLQQDISVFGRQKQKKLPLARQRKVIELFNNLFASGFHLGE
                     IVDFLKRSQLLADPYTQVLSDGLLAGKPFSSLLADLRFSDAVVTQVALAEVHGNTSLS
                     LIHIQSYLENVSKVRKKLIEVATYPIILLGFLLLIMLGLKNYLLPQLEEGNAATVLIN
                     HLPTIFLSLSGLSLVAVLAGMVWFRKTNKIKVFSCLAALPFFGKLIQTYLTAYYAREW
                     GSLIGQGLDLPQIVGLMQEQQSQLFREIGQDLEQSLSNGQSFHEHIKTYAFFKRELSL
                     IVEYGQVKSKLGSELTVYAAECWEDFFSRVNRAMQLIQPLVFLFVALMVVLIYAAMLL
                     PIYQNMEL"
     gene            121788..122069
                     /locus_tag="SSUBM407_RS00760"
                     /old_locus_tag="SSUBM407_0125"
     CDS             121788..122069
                     /locus_tag="SSUBM407_RS00760"
                     /old_locus_tag="SSUBM407_0125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011921720.1"
                     /translation="MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQK
                     KGDAAVVKVVESQMELYELEHDEEATVADLQAKGYITEKQAKQYATAKK"
     gene            122050..122457
                     /locus_tag="SSUBM407_RS00765"
                     /old_locus_tag="SSUBM407_0126"
     CDS             122050..122457
                     /locus_tag="SSUBM407_RS00765"
                     /old_locus_tag="SSUBM407_0126"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein"
                     /protein_id="WP_011921721.1"
                     /translation="MLRRKNKAFTLFESLLTLLVVSFLAVSLSGTVQTVFRSVQEEIF
                     LWEFEAIYKDSQKLAASSHKKVNLAIGGQEVTNGYQAVEVPRNVEVLEEKTIQFEEDG
                     GNSSLTKIRFHLSQKIVTYQLYIGSGRYKKTEE"
     gene            122429..122722
                     /locus_tag="SSUBM407_RS00770"
                     /old_locus_tag="SSUBM407_0127"
     CDS             122429..122722
                     /locus_tag="SSUBM407_RS00770"
                     /old_locus_tag="SSUBM407_0127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003086837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion pathway, pseudopilin PulG"
                     /protein_id="WP_011921722.1"
                     /translation="MVAIRKQKNKAYILLESLVALATLVTICSLILSAVDAGRRRQVW
                     ELEQQEVFNLAQMAVQTKQDDLALNGVAVQVQRTAERVAVFHEGKEVLSVVKK"
     gene            122709..123143
                     /locus_tag="SSUBM407_RS00775"
                     /old_locus_tag="SSUBM407_0128"
     CDS             122709..123143
                     /locus_tag="SSUBM407_RS00775"
                     /old_locus_tag="SSUBM407_0128"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_011922561.1"
                     /translation="MLKSKIPAFTLLECLVVLVILSGSLLIFEGLSKLLVQEAHYQGQ
                     TVQKEWLVFSSQLRSEWDQAELVKVENGKVYVNKGEQALAFGKSWSDDFRKTNDRGQG
                     YQPMLYQVDSAAISQENQLVRIDFSFKNGEERTFIYAFKEKS"
     gene            123121..123531
                     /locus_tag="SSUBM407_RS00780"
                     /old_locus_tag="SSUBM407_0129"
                     /pseudo
     CDS             123121..123531
                     /locus_tag="SSUBM407_RS00780"
                     /old_locus_tag="SSUBM407_0129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009909099.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComGG"
     gene            123588..124541
                     /locus_tag="SSUBM407_RS00785"
                     /old_locus_tag="SSUBM407_0130"
     CDS             123588..124541
                     /locus_tag="SSUBM407_RS00785"
                     /old_locus_tag="SSUBM407_0130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009569507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_011922562.1"
                     /translation="MNFEKIEQAYDLLLENVQTIQNQLGTNIYDAMIEQNATYVAGQH
                     ETDLVVKNNQTLKQLDLTKEEWRRAYQFLLIKANQTEPMQYNHQFTPDSIGFILSFLV
                     DQLVPTQKVTVLEIGSGTGNLAQTILNASQKELDYLGIEVDDLLIDLSASIADVMQAD
                     ISFAQGDAVRPQILKESQVILGDLPIGYYPDDQIASRYQVASPKEHTYAHHLLMEQSL
                     KYLEKDGFAILLAPNDLLTSPQSDLLKGWLQEQANIVAMIALPPNLFGKTAMAKSIFV
                     LQKKAARSLTPFVYPLQSLQEPEAIQKFMLNFKNWKQENAI"
     gene            124591..125778
                     /locus_tag="SSUBM407_RS00790"
                     /old_locus_tag="SSUBM407_0131"
     CDS             124591..125778
                     /locus_tag="SSUBM407_RS00790"
                     /old_locus_tag="SSUBM407_0131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014407217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetate kinase"
                     /protein_id="WP_012775473.1"
                     /translation="MSKTIAINAGSSSLKWQLYQMPEETVLAAGIVERIGLNDSISTV
                     KYDGKKESEVLDIPNHTVAVKILLEDLLKHNIIAAYEEITGIGHRVVAGGEIFKESVV
                     IGPKEVEQIEELSALAPLHNPAHVAAMRAFEEVLPEVLNVAVFDTAFHTTMPKHAYLY
                     PIPQKYYTDHKVRKYGAHGTSHYYVAHEAAKVLGRPIEELKLITAHIGNGVSITANYH
                     GESVDTSMGFTPLAGPMMGTRSGDIDPAIIPYLIANVEELKDAADVVNMLNKQSGLFG
                     VSGFSSDMRDIEAGIQAHNPDAVLAYNIFIDRIKKFIGQYLAVLNGADAIVFTAGMGE
                     NAPLMRNDVVEGLSWFGIELDPEKNVFGNYGDISTAESRVRVLVIPTDEELVIAREVE
                     RLK"
     gene            126092..126643
                     /locus_tag="SSUBM407_RS00795"
                     /old_locus_tag="SSUBM407_0132"
     CDS             126092..126643
                     /locus_tag="SSUBM407_RS00795"
                     /old_locus_tag="SSUBM407_0132"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="folate family ECF transporter S component"
                     /protein_id="WP_012775474.1"
                     /translation="MEKKIPKLTVQLLAAIAMTLALVMIAENHFSVRLSDTLQVQFTF
                     IPNTILGAIAGPVWAAVFAAISDPAFVLFSGQSMLFSFILIEAVSAFIYGWFFYRKPL
                     DTKNKADWLYVAGVVVLIQVVISFIMTPIALHFHFGTPWIVLYSSRLIKAVFEIPLRI
                     VVTMLVLPSLQKIPELAKLMGIK"
     gene            126699..127955
                     /locus_tag="SSUBM407_RS00800"
                     /old_locus_tag="SSUBM407_0133"
     CDS             126699..127955
                     /locus_tag="SSUBM407_RS00800"
                     /old_locus_tag="SSUBM407_0133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional folylpolyglutamate
                     synthase/dihydrofolate synthase"
                     /protein_id="WP_012775475.1"
                     /translation="MNYQETRRWLSSRPASDLENGVARVNWILERLDNPQLQVPTVHF
                     VGTNGKGSTLNALQSILRSSDYTVGRFTSPSIIDFREQIVFEQEMISEEDFARIVTDL
                     QPLIEDLDQTAGLDAISEFEIVVVAMFVYFAHYQRPDILLVEAGMGGLQDATNVLAPL
                     AVVCPSIGLDHQAFLGETHAAIARHKVAVLRERVPLLYATDQSEVVAAFEDHASQLQS
                     PTYAVGREILLENSRAGFAVSSTLGRVEELTLQMQGRHQEVNAALAVTTAQLLSPDFP
                     TITNETIRQGLSQAIWPGRLELIRPNLMIDGAHNNESIAVLTQLLEEKYADRDIEILF
                     AAINTKPVDQMLSQLSQFGPVSVTTFDDFRAVQLGDYPSGYERVQTYQEWLEQVDLDN
                     PKQLYLITGSLYFITYVRKYILEELV"
     gene            complement(128000..129061)
                     /gene="pepA"
                     /locus_tag="SSUBM407_RS00805"
                     /old_locus_tag="SSUBM407_0134"
     CDS             complement(128000..129061)
                     /gene="pepA"
                     /locus_tag="SSUBM407_RS00805"
                     /old_locus_tag="SSUBM407_0134"
                     /EC_number="3.4.11.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014712788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl aminopeptidase"
                     /protein_id="WP_012775476.1"
                     /translation="MTLFGKIKEVTELQSLPGFEGQVRNHIRQKITPHVDRIETDGLG
                     GIFGIKDTAVENAPRILVVAHMDEVGFMISQIKPDGTFRVVELGGWNPLVVSSQAFTL
                     QLQDGRTIPAISGSVPPHLSRGANAPGMPAIADIIFDAGFANYDEAWAFGVRPGDVLI
                     PKNETILTANGKNVISKAWDNRFGVLMVTELLESLSGQALPNQLIAGANVQEEVGLRG
                     AHASTTKFNPDIFLAVDCSPAGDIYGDQGKIGDGTLLRFYDPGHIMLKNMKDFLLTTA
                     EEAGVKFQYYCGKGGTDAGAAHLKNHGVPSTTIGVCARYIHSHQTLYSMDDFLEAQAF
                     LQTIVKKLDRSTVDLIKNY"
     gene            129754..130038
                     /locus_tag="SSUBM407_RS00810"
                     /old_locus_tag="SSUBM407_0135"
     CDS             129754..130038
                     /locus_tag="SSUBM407_RS00810"
                     /old_locus_tag="SSUBM407_0135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4651 domain-containing protein"
                     /protein_id="WP_012774909.1"
                     /translation="MKKKKTALLAGLLGAGVLTASAQFYRKIQEDRKKAQALQEVRDF
                     FADLGEIATVYVDETASTQTTLIGGVVMEAGQVFLFENTKGSIQYREEER"
     gene            130035..130355
                     /locus_tag="SSUBM407_RS00815"
                     /old_locus_tag="SSUBM407_0136"
     CDS             130035..130355
                     /locus_tag="SSUBM407_RS00815"
                     /old_locus_tag="SSUBM407_0136"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin family protein"
                     /protein_id="WP_011921732.1"
                     /translation="MIFPTNHEEVAALIEDGKPTVFLFVTTWCGDCHYIKPHVPAIEE
                     AFPDLRFVQLDRDDFMPLAQEWAILGIPSLVVLENGKEIGRFVDKNRKTKEEIMNFLS
                     GLGR"
     gene            130400..131356
                     /locus_tag="SSUBM407_RS00820"
                     /old_locus_tag="SSUBM407_0137"
     CDS             130400..131356
                     /locus_tag="SSUBM407_RS00820"
                     /old_locus_tag="SSUBM407_0137"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1002 domain-containing protein"
                     /protein_id="WP_011921733.1"
                     /translation="MKKSLGKILLAPVVLGLSLSLAPLVQAEIQTDVINEKWGKPTLV
                     YGGGLSDAQATEVNNLFGISDVNNVSRQVVVGTDMDQYLGTSEADTASLYSSVLVQKQ
                     DAGKGVVVDIKTPQNITLITETQYANAAITAGATDVLIDVASPIQVTGESALTGVYKA
                     LAANGETVDTARTEVAQQELETVNEVATAHTGDTNFDSSALDKAVAEIKTALADYKKS
                     NGQVASEADINTIINDVLAQNGLENVITADEVSKLVTFAKAYQETSAIDSAEVAAQLN
                     QFKQQAEQQISEAYKNLQDSGILEKIGAFFENLWKGLTGLFA"
     gene            131375..131998
                     /locus_tag="SSUBM407_RS00825"
                     /old_locus_tag="SSUBM407_0138"
     CDS             131375..131998
                     /locus_tag="SSUBM407_RS00825"
                     /old_locus_tag="SSUBM407_0138"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011284429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4479 and tRNA-binding domain-containing
                     protein"
                     /protein_id="WP_011921734.1"
                     /translation="MIFTYNKEHVGDVLMVIVAEDKGQAVQFERKGQVARVFLEETGK
                     TVAWNIFEASSLVELDGNGQVFLTDEQVATLNAELAKEGFTESLVNDNAPKFVVGQIV
                     ELVPHPDSDHLNICQVNVGDKTVQIVAGAPNAAQGLKTIVALPGAMMPSGSLIFPGKL
                     RGEDSFGMMCSPRELALPNAPQVRGIIELDDSAVVGEAFDPAKHWKG"
     gene            complement(132031..132810)
                     /locus_tag="SSUBM407_RS00830"
                     /old_locus_tag="SSUBM407_0139"
     CDS             complement(132031..132810)
                     /locus_tag="SSUBM407_RS00830"
                     /old_locus_tag="SSUBM407_0139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2785 domain-containing protein"
                     /protein_id="WP_011922565.1"
                     /translation="MKEFLMEKIQTSQPYTNAELDWLLENIGHPDPTIRDELVYASFC
                     HIFLEGLITREQAQSLLQFSQETKPFSLEGPTQKRSFTCLLYCLLLSVDNEPESIYHA
                     FLSTDDHELLFQQALDYLTIENDWSGYDEKLGWIHTAAHGADFLLATSCHDQFPAEKS
                     KEVWQTIVTCLTKQSKVFSAGEEIRLAQIPVYLLLNEKVSSQELTEWISKLDFPNQEP
                     VDYFRWLNLQHFLSSLYFQLKSQQASTEEIEQAIEGKIEPA"
     gene            132865..133260
                     /locus_tag="SSUBM407_RS00835"
                     /old_locus_tag="SSUBM407_0140"
     CDS             132865..133260
                     /locus_tag="SSUBM407_RS00835"
                     /old_locus_tag="SSUBM407_0140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000282448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_011921737.1"
                     /translation="MYNKTILIGRLTAQPELTQTPTGKNLTRVTVAVNRRFKTENGER
                     EADFLNVIFWGKLAETLVSYGSKGSLISIDGELRTRKYEKDGSNHYVTEILGQSFQLL
                     ESRAQRAMRENNTGDDLADLVLEEEELPF"
     gene            complement(133379..133624)
                     /locus_tag="SSUBM407_RS00840"
     CDS             complement(133379..133624)
                     /locus_tag="SSUBM407_RS00840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014917177.1"
                     /translation="MKFFRDLKIDYLESRFSAYESFAEWFLKRKLGFWGKMIFAYLLW
                     LVWWLLFSHPHYIIFFFYGVLLLSLIIMLIEWWKYRK"
     gene            133822..134103
                     /locus_tag="SSUBM407_RS00845"
                     /old_locus_tag="SSUBM407_0142"
     CDS             133822..134103
                     /locus_tag="SSUBM407_RS00845"
                     /old_locus_tag="SSUBM407_0142"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009730535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone GroES"
                     /protein_id="WP_012774911.1"
                     /translation="MLKPLGDRIAVKIEEKEQTVGGFVLAGASQEKTKEASVLAIGQG
                     IRTLNGDLVAPAVAVGDTVLIDAHAGLEVKDGDQNVHIIRETDILAIVE"
     gene            134114..135736
                     /gene="groL"
                     /locus_tag="SSUBM407_RS00850"
                     /old_locus_tag="SSUBM407_0143"
     CDS             134114..135736
                     /gene="groL"
                     /locus_tag="SSUBM407_RS00850"
                     /old_locus_tag="SSUBM407_0143"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012767614.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin GroEL"
                     /protein_id="WP_012774912.1"
                     /translation="MAKEIKFAADARESMVRGVDILADTVKVTLGPKGRNVVLEKAYG
                     SPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREG
                     LKNVTAGANPIGIRRGIEAAVATAVEALKAQASPVSNKAEIAQVAAVSSRSEKVGEYI
                     SEAMERVGTDGVITIEESRGMETELDVVEGMQFDRGYLSQYMVTDNEKMVAELENPFI
                     LITDKKISHIQDILPLLESILQANRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKA
                     PGFGDRRKAMLEDIAILTGGTVITEDLGLDLKDATIEALGQAAKVVVDKDGATIVEGA
                     GNPEAIANRVAVIKSQIEVTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKL
                     RIEDALNATRAAVEEGIVAGGGTALVNVIDSVAKLELKGDDETGRNIVLRALEEPVRQ
                     IAYNAGYEGSVIIDKLKNSELGTGFNAATGEWVNMMDAGIIDPVKVTRSALQNAASVA
                     SLILTTEAVVANKPEPAAPAMPQGMDGMGMGY"
     gene            135968..136381
                     /gene="rpsL"
                     /locus_tag="SSUBM407_RS00855"
                     /old_locus_tag="SSUBM407_0144"
     CDS             135968..136381
                     /gene="rpsL"
                     /locus_tag="SSUBM407_RS00855"
                     /old_locus_tag="SSUBM407_0144"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001142328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_002940030.1"
                     /translation="MPTINQLVRKPRKSKVEKSKSPALNVGYNSRKKVQTNVSSPQKR
                     GVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKD
                     LPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKG"
     gene            136398..136868
                     /gene="rpsG"
                     /locus_tag="SSUBM407_RS00860"
                     /old_locus_tag="SSUBM407_0145"
     CDS             136398..136868
                     /gene="rpsG"
                     /locus_tag="SSUBM407_RS00860"
                     /old_locus_tag="SSUBM407_0145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011285383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_002940031.1"
                     /translation="MSRKNQAPKREVLPDPLYNSKLVTRLINRVMLDGKRGTAASIVY
                     GAFDQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLR
                     WLVTIARNRGEHTMIDRLAKEIMDAANNTGAAVKKREDTHKMAEANRAFAHFRW"
     gene            137425..139506
                     /gene="fusA"
                     /locus_tag="SSUBM407_RS00865"
                     /old_locus_tag="SSUBM407_0146"
     CDS             137425..139506
                     /gene="fusA"
                     /locus_tag="SSUBM407_RS00865"
                     /old_locus_tag="SSUBM407_0146"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018374688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_011921743.1"
                     /translation="MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETH
                     EGASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGA
                     VTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHERLQANAH
                     PIQLPIGSEDEFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLEQAEEYREKLVEAV
                     AETDEELMMKYLEGEEITNDELKAAIRKATINVEFFPVLCGSAFKNKGVQLMLDAVID
                     YLPSPLDIPAIKGVNPDTDAEEERHASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVL
                     NSGSYVLNTSKGKRERIGRILQMHANSRQEIETVYAGDIAAAVGLKDTTTGDSLTDEK
                     AKIILESIHVPEPVIQLMVEPKSKADQDKMGIALSKLAEEDPTFRVETNVETGETVIS
                     GMGELHLDVLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDV
                     WIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPIVDVKAKLY
                     DGSYHDVDSSETAFKVAASLALKEAAKSAQPTILEPMMLVTITAPEDNLGDVMGHVTA
                     RRGRVDGMEARGNTQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQ
                     DEIIKKNGGNA"
     repeat_region   complement(139583..139686)
                     /note="Imperfect repeat RepSU1"
                     /rpt_family="RepSU1"
     gene            140495..142486
                     /locus_tag="SSUBM407_RS00870"
                     /old_locus_tag="SSUBM407_0147"
     CDS             140495..142486
                     /locus_tag="SSUBM407_RS00870"
                     /old_locus_tag="SSUBM407_0147"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014917178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M13 family metallopeptidase"
                     /protein_id="WP_012775478.1"
                     /translation="MRKKLKFSLVAVACATFLTACGTSNSSAPKAGEATPQTDFHSYI
                     NAQWLKNTKLGAGESQIDNLSQLSEKTQEAIQEMIDQLDMDYSKLQAGSDEKKLIDFY
                     RLAADFDTRNKLGLEPIKPYLEEIKKASTMEELNKILVALYGKNIRNLLHINVTQDIK
                     DSNKNTIYVDPHELSFPKENYDGTDEFSLKNQKAFKAYLQEVFSLSGETSKEASSKAD
                     LLFNLEKEMAAVQRPKEEANNFEAMYNEKTWDEVKALVPNLPIAELVSELGLQNAPTT
                     VVSDPDALKKLNELYQEKNLDALKALLQYRVIAHYNAYLSSNLIEAKAKYDGVATGAV
                     DTPSQKEVAQAAIDANFSDMIGKVYVKHHFSEESKANILSMVQEIKATYAERIKAVQW
                     MSEETKMRALKKLDTLVVKIGYPDQWKDYSQLAIQSKEEGGSLLSNFDMVKTLELREE
                     MGQFGKPFDKSQFGMPSHTVNAYYSPTNNEIVFPAGILQAPLYDPKASPEENLGGIGA
                     VIGHEISHAFDKAGSQFDEKGNLVNWWKPEDLEKFNKKVQQAADIYSKLEVAPGYYVN
                     GEISTGEIMADLGGLTVAIDIAQKKGYDTKKVFESYGKAWREVTTKEFAIANISDEHP
                     PAKYRVNNIVNQIDQFYTDFNVKEGDPMYVKPEDRLRVW"
     gene            142853..143863
                     /gene="gap"
                     /locus_tag="SSUBM407_RS00875"
                     /old_locus_tag="SSUBM407_0148"
     CDS             142853..143863
                     /gene="gap"
                     /locus_tag="SSUBM407_RS00875"
                     /old_locus_tag="SSUBM407_0148"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008090210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="WP_012775479.1"
                     /translation="MVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPVMLAHL
                     LKYDTTQGRFDGTVEVKDGGFEVNGKFVKVSAEREPGNIDWATDGVDIVLEATGFFAS
                     KEKAEQHIHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPM
                     AKALHDAFGVQKGLMTTIHGYTGDQMVLDGPHRGGDLRRARAAAANIVPNSTGAAKAI
                     GLVIPELNGKLDGAAQRVPVPTGSVTELVATLDKKVTAEEVNAAMKAAATESFGYTED
                     QLVSSDIVGISFGSLFDATQTKVIEVDGEQLVKVVSWYDNEMSYTAQLVRTLEYFAKI
                     AK"
     gene            144119..145318
                     /locus_tag="SSUBM407_RS00880"
                     /old_locus_tag="SSUBM407_0149"
     CDS             144119..145318
                     /locus_tag="SSUBM407_RS00880"
                     /old_locus_tag="SSUBM407_0149"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001096748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="WP_011921748.1"
                     /translation="MAKLTVKDVELKGKKVLVRVDFNVPLKDGVITNDNRITAALPTI
                     KYILEQGGRAILFSHLGRVKEEADKEGKSLAPVAADLAAKLGQDVAFIAGATRGAELE
                     AAINALEDGQVLLVENTRFEDVDGKKESKNDEELGKYWASLGDGIFVNDAFGTAHRSH
                     ASNVGISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLE
                     KADKVLIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKTLLEKANGKLILPVDSKEANA
                     FAGYTEVRDTDGEAVSEGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQA
                     GTIGVMDAIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPG
                     LAALTEK"
     gene            146125..146640
                     /locus_tag="SSUBM407_RS00885"
                     /old_locus_tag="SSUBM407_0150"
     CDS             146125..146640
                     /locus_tag="SSUBM407_RS00885"
                     /old_locus_tag="SSUBM407_0150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic acid exporter family protein"
                     /protein_id="WP_012775480.1"
                     /translation="MFKKYTFDPKKFRLGMRTFKSGLTVFLVILLFGFMGWQGIQIAA
                     LTAVFSLREDFDQSVHFGASRILGNSIGGFYALLFFILDRLFLDHFWVTAVFVPIFVM
                     LTIMTNVAMNNKAGIIGGVSALLIITLSIPAGDTIQYVFIRVFETFIGVFIAILVNYD
                     VNVIKKRFQDK"
     gene            146716..147087
                     /locus_tag="SSUBM407_RS00890"
                     /old_locus_tag="SSUBM407_0151"
     CDS             146716..147087
                     /locus_tag="SSUBM407_RS00890"
                     /old_locus_tag="SSUBM407_0151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002940041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_002940041.1"
                     /translation="MREKEFRRSLAIFPIGSVMKLTDLTARQIRYYEDQGLIKPDRNE
                     GNRRLYSLNDMDLLLEIKDFLDEGLNIAAIKKEYANREAKAKVQKQQKTLTDEDVRRI
                     LHDEFSRQGRFSSPSSIFRSS"
     gene            147116..148462
                     /gene="glnA"
                     /locus_tag="SSUBM407_RS00895"
                     /old_locus_tag="SSUBM407_0152"
     CDS             147116..148462
                     /gene="glnA"
                     /locus_tag="SSUBM407_RS00895"
                     /old_locus_tag="SSUBM407_0152"
                     /EC_number="6.3.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009731741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I glutamate--ammonia ligase"
                     /protein_id="WP_011921751.1"
                     /translation="MTFTVADIKRDIKEKNVTFLRLMFTDIMGVMKNVEIPATDEQVE
                     KVLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWTIFPWGDENGRVAGLICDIYTTDA
                     KPFAGDPRGNLKKSLRHMEEAGFSSFNLGPEPEFFLFKMDEQGNPTLEVNDKGGYFDL
                     APTDLADNTRREIVNVLTEMGFEVEASHHEVAVGQHEIDFKYADVLKACDNIQIFKLV
                     VKTIARKHGMYATFMAKPKFGIAGSGMHCNMSLFDKDGNNAFFDPEDPRGMQLSQTAY
                     HFLGGLIKHAYNYTAITNPTVNSYKRLVPGFEAPVYIAWAGKNRSPLVRVPASRGMGT
                     RLELRSVDPTANPYLAMAVLLEVGLEGIQNKIEAPAPVESNIYAMSDEERREAGITDL
                     PSTLHNALKALREDEVVRAALGDHIYTNFLEAKKIEWASYATYVSQWEIDNYLDMY"
     gene            complement(148685..150364)
                     /locus_tag="SSUBM407_RS00900"
                     /old_locus_tag="SSUBM407_0153"
     CDS             complement(148685..150364)
                     /locus_tag="SSUBM407_RS00900"
                     /old_locus_tag="SSUBM407_0153"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease J"
                     /protein_id="WP_002938522.1"
                     /translation="MSSVNLKPHEVGVFAIGGLGEIGKNTYGIEYKDEILIVDAGIKF
                     PEDDLLGIDYVIPDYSYIVENLDRVKGLVITHGHEDHIGGIPFLLKQANVPIYAGPLA
                     LALIRGKLEEHGLLRDATLHEINHNTELTFKHLKVSFFRTTHSIPEPLGIVVDTPQGK
                     IVCTGDFKFDFTPVGEPADLHRMAALGEEGVLCLLSDSTNAEVPTFTNSEKVVGQSIM
                     KLIEGIHGRIIFASFASNIFRLQQAADAAVKTGRKIAVFGRSMEKAIVNGIELGYIKV
                     PKDTFIEPNEIKEYPASEIMILCTGSQGEPMAALSRIAHGTHRQVQLQPGDTVIFSSS
                     PIPGNTTGVNKLINILIEAGVDVIHGKINNIHTSGHGGQQEQKLMLRLIKPKYFMPVH
                     GEYRMQKIHASLAVDTGVPKDNIFIMENGDVLALTKDSARLAGQFNAQDIYVDGNRIG
                     EIGAAVLKDRRDLSEDGVVLAVATVDFNSKMILAGPDILSRGFIYMRESGELIRESQR
                     VLFNAIRIAMRNKDANIQTVNGAIVNALRPFLYEKTEREPIIIPMILTPDR"
     gene            complement(150368..150598)
                     /locus_tag="SSUBM407_RS00905"
                     /old_locus_tag="SSUBM407_0154"
     CDS             complement(150368..150598)
                     /locus_tag="SSUBM407_RS00905"
                     /old_locus_tag="SSUBM407_0154"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000639444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-dependent RNA polymerase auxiliary subunit
                     epsilon family protein"
                     /protein_id="WP_002938523.1"
                     /translation="MIYKVFYQESKISPRREQTRALYLDIDAASELEGRIIARELVET
                     NRPEYNIEFIDLLSDNHLEYEKEHADFKITEF"
     gene            151149..151832
                     /gene="tsaB"
                     /locus_tag="SSUBM407_RS00910"
                     /old_locus_tag="SSUBM407_0155"
     CDS             151149..151832
                     /gene="tsaB"
                     /locus_tag="SSUBM407_RS00910"
                     /old_locus_tag="SSUBM407_0155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018371441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (adenosine(37)-N6)-threonylcarbamoyltransferase complex
                     dimerization subunit type 1 TsaB"
                     /protein_id="WP_011921754.1"
                     /translation="MKILALDSSNQALSVALVEDGRLQAETLLAVKKNHSISLMPVVD
                     FLVAQVGWTPKDLDRIVVAQGPGSYTGLRVAVATAKTLAYTLKIDLVGLSSLQSLVPP
                     SLTGLVVPLIDARRNCVYAGVYENGRAVEPDRYWSFEDLLSSLSGKENITFVGEVENF
                     MEQIEQALPTAQYQASLPSAYQLAVIGQDLPAVDVTSFEPNYLKHVEAEENWLKDNQV
                     GSESYIKRV"
     gene            151829..152269
                     /gene="rimI"
                     /locus_tag="SSUBM407_RS00915"
                     /old_locus_tag="SSUBM407_0156"
     CDS             151829..152269
                     /gene="rimI"
                     /locus_tag="SSUBM407_RS00915"
                     /old_locus_tag="SSUBM407_0156"
                     /EC_number="2.3.1.266"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002940070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S18-alanine
                     N-acetyltransferase"
                     /protein_id="WP_011921755.1"
                     /translation="MIEIKHYDGQENLAEAVLAVMQSVYDQSPWTLEQIVSSMTSQYE
                     DYYLAYEGQELVGFLAVQTVLDEMEILQIAVKTDFQRLGIASQLMAAVMDWDGDIFLE
                     VRESNSAAQALYTRQHFTKIGKRKDYYRHPVEDAVIMKRERDER"
     gene            152259..153266
                     /gene="tsaD"
                     /locus_tag="SSUBM407_RS00920"
                     /old_locus_tag="SSUBM407_0157"
     CDS             152259..153266
                     /gene="tsaD"
                     /locus_tag="SSUBM407_RS00920"
                     /old_locus_tag="SSUBM407_0157"
                     /EC_number="2.3.1.234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006595540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (adenosine(37)-N6)-threonylcarbamoyltransferase complex
                     transferase subunit TsaD"
                     /protein_id="WP_002938526.1"
                     /translation="MKDRLILAIETSCDETSVAVLRNDAELLSNVIASQIASHQRFGG
                     VVPEVASRHHVEVITACIEEALLEAEVTAEDLTAVAVTYGPGLVGALLVGISAAKAFA
                     WANGLPLIPVNHMAGHLMAARAVKELEFPLLALLVSGGHTELVYVSEAGDYKIVGETR
                     DDAVGEAYDKVGRVMGLPYPAGRVIDELAHEGQDIYDFPRAMIKEDNLEFSFSGLKSA
                     FINLYHNAQQKGETLSNADLSASFQACVMDILMAKTKKALEQYPVKTLVVAGGVAANQ
                     GLRERLAAEITDVEVIIPPLRLCGDNAGMIALAAVSEYNKENLAGWDLNAKPSLAFEN
                     L"
     gene            complement(153303..154139)
                     /locus_tag="SSUBM407_RS00925"
                     /old_locus_tag="SSUBM407_0158"
     CDS             complement(153303..154139)
                     /locus_tag="SSUBM407_RS00925"
                     /old_locus_tag="SSUBM407_0158"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_009909131.1"
                     /translation="MKIQPEFYVFNNRSYVDFYPIQFGMEACKPLHSFGPTMKQHYLF
                     HYIISGSGTFYDTSDQREYHLTAGQGFLISPDAICSYEADEKDPWTYIWLEFDGLKTE
                     HFLRQAGLSKEQPIFSQREMPTSSPVYHEMKQILALHHQKSALVLGHLYLFISCLIDC
                     SLTKTSSKHDENKEFYIREAINFVERNYEKAISVDDLAQVCNLNRHYFSRLFKEQMNI
                     SPQQFIIQYRLSEACELLKNTTKTLQEIAEEIGYSNQFNFSTAFKRHYQISPNRWRKI
                     HK"
     gene            154354..155628
                     /locus_tag="SSUBM407_RS00930"
                     /old_locus_tag="SSUBM407_0159"
     CDS             154354..155628
                     /locus_tag="SSUBM407_RS00930"
                     /old_locus_tag="SSUBM407_0159"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002939306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_012774915.1"
                     /translation="MKKIGRYVTLLAAAGLLAACSTSTESSKTTGGSSSGKTEISYAI
                     WDSGQEPGLRKIADEFEKKNPDIKINIQVSDWDSYWTMLEAGATGGSLPDTFWMHSNE
                     IYRYGSNEMLLPLDEYLAKSEDAKLANFPDGLNEIYNINGKQYAIPKDFDTIGLWYNK
                     KLFDEAGIPYPDDTWDWNKLKEVAKKLTKPDGSQYGFGAGLSNQEGYYNFIYQNGGKV
                     ITDDLKSGYADPKTIEALDYYFSFVKEKISPAITVDKERAEAFQNGQVAMSVFGSWNL
                     SGFTANDYIRENADVAVLPKGPDGTRATIFNGLGHAIAATTKHPDAAWKWVEYLSSKE
                     AQEMQATLGVAISAYKGAADTWVDSNKNFTIKNYVDMVDYAQIRPYSQTTIKWEDKAY
                     ELLKPAYLGEKATEEAAKETADMMNAELATEK"
     gene            155697..156590
                     /locus_tag="SSUBM407_RS00935"
                     /old_locus_tag="SSUBM407_0160"
     CDS             155697..156590
                     /locus_tag="SSUBM407_RS00935"
                     /old_locus_tag="SSUBM407_0160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002939305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_002939305.1"
                     /translation="MFRKKGSLNEAIWGWGMVAPTIIGLIVLNIIPIFQTMKMSFHKS
                     GDFGKGDIFVGLANYQRMLGDAQVWQATWNTLKYTILVVPATVALAMLLAVLLNSKIK
                     GKHIYRTIFFLPMVAAPAAVTMVWKWLYNTDFGLINYILRRLGLGAVNWIEDPKIALY
                     SIALIGIWSTVGYSMILILAGLQEIPTDFYEAARIDGASPAKQFFSITLPLVSPTLFF
                     VVVTSVIQSMQVFDVIYMMEDVRSPAYDKTVSLVYLFYNNSFKYSDKGYGSTIVMLLL
                     LIILVITFVQMKVQKKWVHYR"
     gene            156601..157431
                     /locus_tag="SSUBM407_RS00940"
                     /old_locus_tag="SSUBM407_0161"
     CDS             156601..157431
                     /locus_tag="SSUBM407_RS00940"
                     /old_locus_tag="SSUBM407_0161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002939293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="WP_011921761.1"
                     /translation="MKQSAFKSTIWMHAFLILVAMGMLIPFVWMVLTSFKTVTESTQM
                     NPFHFLPSNWMVSNYTEAIRTNNFPILYLNTILMMLWRIFSSVMFSAMAAYAFARLEF
                     PGRNFLFGLVLFQMMVPPQLFVIPQYLMIDQLGMRNTIFALVFPGIVSAFGTFLLRQF
                     FMGLPKELEESAKLDGCNIGQTFFKVMLPLAKSGLIALAIFTALFAFKDLLWPLIINS
                     EADKATLSSALSKIQGAYAVNYPQLMAASVLAIWPMLVLYVIFQKQFIQGIATSGGKL
                     "
     gene            157441..159642
                     /locus_tag="SSUBM407_RS00945"
                     /old_locus_tag="SSUBM407_0162"
     CDS             157441..159642
                     /locus_tag="SSUBM407_RS00945"
                     /old_locus_tag="SSUBM407_0162"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002939291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-galactosidase"
                     /protein_id="WP_011921762.1"
                     /translation="MGIIFHEKTKEFHLYNEFISYVLTVLPNGHIGSLYYGKRVTETA
                     SYQYVREDEYRALTSFVEDDDRFFSLQYANPEFACYGTTDYFSPTFELVQKDGSSLSH
                     FVYQGHAIYAGRSALKGLPHLYLDEEGQADSLDIYLLDEDSQTRLVLSYTIFRDYPAV
                     TRSARFEQLGEKSVCLNRALSMTLCLPDMDYDWLHLDGAWGRERHLQLSPLHQGCQSI
                     YSLKGASSAEHNPFMALKRPTADEQQGEVLGFSLVYSGNFLAQVDVSSFQKTRVSMGI
                     HPERFSWTLDKGEEFQTPEVVMVYSEHGLNGMSQTYHRLFQKHLVRGYWRDRERPVLL
                     NNWEAMSFDFDEETILSLAKEAAGLGVELFVMDDGWFGKRNHDRAGLGDWTVNREKLP
                     SGLTGIIDQVHAMGMKFGLWIEPEMVNRDSELYRAHPDWIFHHPQHSQSHGRHQYTLD
                     LSREDVYQNIHDQLHRLLAEHDIDYIKWDMNRYMTEVFTCTREADRQGETFHRYILNL
                     YRLYDSLIAAFPTVLFESCSSGGARFDPGMLYYAPQTWVSDDTDAMERLKIQYGTSMV
                     YPLNSMGCHVSASPNQQLGRATPLNTRANVAFFGSFGYELDLFECSQEELEEMKEQIA
                     FYKTHRKIFQQGIFTRLKSPFDGEITAWQVQSSDGQQVIVGYYRRLTTANLSYQRLYL
                     QGLEEEAVYHLDGEVYTGSQLMHTGLSIRHGDHVGDNKDFTSCLMVLQKQQ"
     repeat_region   complement(159722..159825)
                     /note="Imperfect repeat RepSU1"
                     /rpt_family="RepSU1"
     gene            159917..160618
                     /locus_tag="SSUBM407_RS00950"
                     /old_locus_tag="SSUBM407_0163"
     CDS             159917..160618
                     /locus_tag="SSUBM407_RS00950"
                     /old_locus_tag="SSUBM407_0163"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AzlC family ABC transporter permease"
                     /protein_id="WP_011921764.1"
                     /translation="MKKYAFREGMRDAIPTVLGYASIGLACGVVSVNSGISTVEMGLM
                     SLLIYAGSAQFVMCAMIFAGAPLLSIAVTVFFVNLRNFLMCLHATTIFQGNRLGSNIL
                     IGSFVTDESYAVLLRKQIEHHTITPEWMYGNNFASYASWVTFTTLGNLIGGLIPNPEQ
                     FGLDFALVAMFVGIFAGQLEAMVRTIPLKKIGLILLAVGLAYIGLSMMVSSYVAVLLA
                     TLLGCFVGVMIDDKN"
     gene            160605..160928
                     /locus_tag="SSUBM407_RS00955"
                     /old_locus_tag="SSUBM407_0164"
     CDS             160605..160928
                     /locus_tag="SSUBM407_RS00955"
                     /old_locus_tag="SSUBM407_0164"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AzlD domain-containing protein"
                     /protein_id="WP_012774916.1"
                     /translation="MIKTNILLIILMAALVTWVPRVLPFVLTQNKSLPPKLVKFLSFL
                     PITIIFALTLSSIMDEKVGSLPSFLPVESLAILPTFFVVLKTKNILLAVLVGVVTTAL
                     LRLIF"
     gene            160938..161960
                     /locus_tag="SSUBM407_RS00960"
                     /old_locus_tag="SSUBM407_0165"
     CDS             160938..161960
                     /locus_tag="SSUBM407_RS00960"
                     /old_locus_tag="SSUBM407_0165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YeiH family putative sulfate export transporter"
                     /protein_id="WP_011922574.1"
                     /translation="MVKENAKGVGLCFLLALVGQWLGHLFPLVGGPVFALLIGMGLYP
                     YFSSKNAFQSGLTFTSKKILQYAVICLGFGLNLSAVLAVGRQSLPIILSTISFALILA
                     FLMWKILPISSHLATLIGVGTSICGGSAIAATAPIIQADDEDVAQAISVIFLFNVLAA
                     LVFPSLATWLGFSTDSGQAFGMFAGTAVNDTSSVTAAASTWDSLYGLGSQTLDTAVTV
                     KLTRTLAIIPITTVLAIWQTRGKGLKADKKSLLAGFPTFILYFILASLITTIAGGFGI
                     GADWFAPLKSLSKFFICMAMVAIGLRTNVFALVKNGRAALMVGLVCWLGVTVLTLVWQ
                     AILGIW"
     gene            162423..167663
                     /locus_tag="SSUBM407_RS00965"
                     /old_locus_tag="SSUBM407_0166"
     CDS             162423..167663
                     /locus_tag="SSUBM407_RS00965"
                     /old_locus_tag="SSUBM407_0166"
                     /inference="COORDINATES: protein motif:HMM:NF019202.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015445096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1542 domain-containing protein"
                     /protein_id="WP_079397073.1"
                     /translation="MSYKDMFRKEQRFSFRKFSFGLASAVIANVILGGAIANSPVVHA
                     NTVTEAETAVAPANQDLGNETKTEEEPKEPIEAVRTDMENRAAEILPEALNASVTNQA
                     PVIPTIGDLPKDASGQNVHGKATDNKIYRVVYVFGNVAGTTETEDGKQNVAPTFNRND
                     ATKTFPITDPDSDIQTISYEVPADIASYTLDDPNSIVTNGTSPGPVSYLDGPNGSATL
                     TQDGYLTGSFPWGAGDLAGRRIKVTDATGNTTKSNPFYMVAYTVKPVDDKPLAVSNSS
                     ELTEQAIFDKLVVDKSAKTTSNSALVIDSSNYKHSIAGYRTVNSDGTKTETVEKTNLS
                     DFPTEGKYEVRVKTTNVYGQTIYNWIPVNAYKLDTAKDAEIRKYTDNQAPIHAIMQIG
                     QAGEKAAVILKDIPSDFSIENFNLKDGVADELAKRNLEFVRNDAVATTDTDGDGAKEG
                     IVGYIQPKTGGANSGVATYTGSNNLTYGFTYKAVETKDKANATEAKTLELDYTILFID
                     TKAPVMTPKSEYIRFVGEEYTVSVPGTDNAFLNTGKLNGTLSILKDGESGSLVSSDLG
                     TNTKITSELDPTGATANQGDDGQSSTKFNVKITGTGPATEGTGTYKLRVGEDNYPFGP
                     EGKLVDGNKPENVGLTSVKVTFVKHATVSTPVSVENPANLTPEEKAAVIAQIKKDNAD
                     NERLKGLPDSAFTVNSDGTVSVDYSAGGVNVDGATDIIKNATTNLADTRNEAKAEIDT
                     KLAEHKKAIEAKRDEAFSKIDDDISLRAEQRQAAKDAVAAAAGDALKELDNKATEAKE
                     KIDKATTASEINDAKTNGEINLDSAEAVGEKAINQAKEKELAKAEVENKAFEALEKVN
                     NNPNLLEEEKKAYFDDIKESKEVAVEKINNAENTAEITAAIDEAEIAYNEDVINAAQL
                     DALNKLEKDSEETKAAIDANPNLTPEEKAKAIAKVEELVNNAESDILSKPTPETVQAV
                     EDKADKDLAKVELQAAADDAKKGIEANPNLTPEEKDVAKKAVEDAVKVATDAIDKAST
                     PTEVDTATSDGVKAIDAEEFKATQKDAKNKIAKEAESAKKAIDDNPNLTPDEKESAKN
                     AVEEAAKVATAAIDKASTPDAVQVEEDKGVAAINLITAKADAKGVIAAKLADEIKKLE
                     DKQAEAEKAIDASTMTNEEKAIAKKALQDVVDKGKAELEDAARVATNEIHEATTTEKA
                     KAAELAGEKSLTDTGKEARDAVELAKDKELAKEAIRTEEEEATKIVEKLAEDTRKAIE
                     DNPNLSDEDKQAEIKKLTDAVAKTLATIRDNADKATQEAEKAQALADLEKAKETQKIA
                     DKAAIDRLTILVKDGELEATKQDAKNKIAKDAAAAKEAIGSNPNLTDAEKKTFTDAVD
                     AEVAKANDAISAATSPADVQKEEDAGVAAIAEDVLDAAKQDAKNKIAKESDAAKSAID
                     ANPNLTDAEKESAKKAVDADAKAATDAIDASTSPVEAQSAEDKGVGSIAQDVLDAAKQ
                     DAKNKIAKEVAAAKEAIDANPNLSDAEKEASKKAVDADAKAATDAIDASTSPVEAQSA
                     EDKGVGSIAQDVLDAAKQDAKNKIAKESDAAKSAIDANPNLTDAEKESAKKAVDADAK
                     AATDAIDASTSPVEAQSAEDKGVGAIAKDILDAAKQDAKNKIAKEAESAKSVIDSNPN
                     LTDAAKEAAKSEIDKAVEEAIVLINGVRTYQELEKIKLPMAALIKPAAKVTPVVDPNN
                     LTEKEIARIKAFLKENNNLP"
     gene            167697..168257
                     /locus_tag="SSUBM407_RS00970"
     CDS             167697..168257
                     /locus_tag="SSUBM407_RS00970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPXTG cell wall anchor domain-containing
                     protein"
                     /protein_id="WP_011921769.1"
                     /translation="MTIKYPDGTIDLLSPVEVVKQADKTAPTVANDGKGNIVIVPSEK
                     AVELVVSYVDNNGKSQTVVVTKGTDGLWTASNTVVIVDPVTGQVIVPGSVIKPGTVVT
                     AYSKDEVGNSSDSAEAEVVAVDENNSAAGVKVKSVTTNANNVEKKAKQLPNTGEEANS
                     ATSLGLVALGLGLALLAAKRRRDEEA"
     gene            complement(168477..170099)
                     /locus_tag="SSUBM407_RS00975"
                     /old_locus_tag="SSUBM407_0167"
     CDS             complement(168477..170099)
                     /locus_tag="SSUBM407_RS00975"
                     /old_locus_tag="SSUBM407_0167"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011921770.1"
                     /translation="MKTILRYSWYQEKYNLHRSVNGFFYYLRKLPLVGKCIPESIFKS
                     YSFKSSLFLVLHILSIPSRFLIKGFWLLFHFYHASFWMNMLVNGELTFWKILPNTWLL
                     GFMFWLLFVGLSYRLGKSLDPVISKADREFMQNFSLSQSSFLQSQLFIEPILTTIYYL
                     PASTIFCMITKEWLVFPIGLMTVLAGHLAGHALNRLLFERRIFSRRNSWHAWLWIAFV
                     FVLYVLAIVFRNQLSSGMLVPILLVQPFLIWFSYGYLKQQTNHLDYLSYCMDESLQMD
                     KKLFEMTKGNEYTRQGLQMQAKLNAKTGKDLSHLSGMTYLNALLFDRYKKVLYKKVQN
                     WVLAVVVILAALEGIRYFLDPFTFTEAYLLQFLPLSFMIMYVASSGKVVAQMVFVNCD
                     ISMLHYPFYREAKTIIAGFNYRFLQTCKLNLIFATSLFLAIMVLGRFAFSLETILLTA
                     LLLISLTALFSFHDLFIYYILQPFTNDMDVVNPLYKFLSGALYWVAYLNTRINVGSHT
                     YILLVSLAMIAYVSIGYWILLKKAPQTFRLKA"
     gene            complement(170109..170807)
                     /locus_tag="SSUBM407_RS00980"
                     /old_locus_tag="SSUBM407_0168"
     CDS             complement(170109..170807)
                     /locus_tag="SSUBM407_RS00980"
                     /old_locus_tag="SSUBM407_0168"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016184993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012774917.1"
                     /translation="MQLKLSSISKKFDHKSILEDASFQFEQGKIYGLLGRNGAGKTTL
                     FNCIARNLTLDNGSIQFVKGEETLDYDNTDIGFTQTYPQLPAFMTAYEFVRFYMDIHK
                     DKLKSPRSPEEWLNLVGIGEEDQHRLLKDFSHGMQNKVQLLLSLIVQPPVLLLDEPLT
                     SFDPVAAHEFKQLIREAKKDSVIIFSTHILQLAQDLCDEIVLLHHQELQAVPSDKLHD
                     PDFEQEVVALLTAD"
     gene            complement(171163..172338)
                     /locus_tag="SSUBM407_RS00985"
                     /old_locus_tag="SSUBM407_0169"
     CDS             complement(171163..172338)
                     /locus_tag="SSUBM407_RS00985"
                     /old_locus_tag="SSUBM407_0169"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="WP_012774918.1"
                     /translation="MNTVDTIIIGAGPAGMMAAISSSFYGKKTLLLEKNKRLGKKLSG
                     TGGGRCNVTNNGTLEDLLAGIPGNGRFLYSVFSQFDNHDIMNFFQENGVKLKVEDHGR
                     VFPTTDRSQTIIKCLEMKMLENGVDIRTGTEVVSVRKMDDLFHVKTSEEVFTAPQLIV
                     TTGGKTYPSTGSTGFGHDIARHFKLEVTEIEAAESPVLTDFPHKKLQGISLDDVTLTY
                     GKHVITHDLLFTHFGLSGPAALRLSSFVKGGETAFLDVLPTHSDQDLFEHLEKNREKS
                     VKNTLSELMPDRLADFFAENYDSKVKQVSQKDLTELVTLLKVLPIKITGKMSLAKSFV
                     TKGGVDLKEINPKTLESKKVPGLHFAGEVLDINAHTGGFNITYCLATGWVAGSSYSS"
     gene            172576..173976
                     /locus_tag="SSUBM407_RS00990"
                     /old_locus_tag="SSUBM407_0170"
     CDS             172576..173976
                     /locus_tag="SSUBM407_RS00990"
                     /old_locus_tag="SSUBM407_0170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 1 protein"
                     /protein_id="WP_012775481.1"
                     /translation="MVTEQREYRFPEGFLWGSSTSGPQSEGSVAGDGKGWNNWDYWYS
                     QEPELFHQQIGPEQTSTFYEHFQSDLDLLVETCHSIFRTSIQWSRLIPEGIGEVNPQA
                     VEFYRAVFAGIRERGIKLLVNLYHFDLPYVLQEKGGWENKEIVWAYEAYARQCFSLFG
                     DLVDHWITFNEPIVPVECGYLGSYHYPCKVDAKAAVVVAYHTQLASSLAVRACHQLHP
                     DHKISIVLNLTPAYPRSQSPEDLQAARIAELFQTRSFLDPSVLGQYPRELVDILEKHG
                     LRPETTEEELTIIKENRVDFLGVNYYQPLRVQAPSEDGWNGEPTFLSQYFQPYDKPDK
                     KINPPRGWEIYEEGLYDIAKNIQENYGNIEWLVTENGMGVEGEGVFEENGMIQDDYRI
                     HFMEDHLIQLHRGIDEGANCKGYMVWTFIDCWSWLNTYKNRYGLVSLDLQTQKRTVKK
                     SGYWFKQVSAKNGFIR"
     gene            174146..174640
                     /locus_tag="SSUBM407_RS00995"
                     /old_locus_tag="SSUBM407_0171"
     CDS             174146..174640
                     /locus_tag="SSUBM407_RS00995"
                     /old_locus_tag="SSUBM407_0171"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003081057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF536 domain-containing protein"
                     /protein_id="WP_012774919.1"
                     /translation="MGIEKTVSELAEILGVSRQAMNNRVKSLPEEFVDKNDKGVTVVN
                     RAGLIKLEEIYKTTIFEDEPISDEVKHRELMEILVDEKNAEIIRLYSQLKAKDKQLAE
                     KDEQLKVKDVQIAEKDKQLDQQQQLTLKAMADKEVLKLELDEVKAQAEEVQAKGFFAR
                     LFGK"
     gene            174908..176950
                     /locus_tag="SSUBM407_RS01000"
                     /old_locus_tag="SSUBM407_0172"
     CDS             174908..176950
                     /locus_tag="SSUBM407_RS01000"
                     /old_locus_tag="SSUBM407_0172"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BglG family transcription antiterminator"
                     /protein_id="WP_011922579.1"
                     /translation="MVDNRTMAILMELFATRKESLYELSIQTGIEKEQLHSNLELVNQ
                     LLQEHSFPQIQYKDSEFVISTELYNQKESVFSLFRNRQIYLSQEERQLLIYLYTFIRK
                     EFVSNVHYQELLSVSRNTTLTDIKNVKELCLDFQVRLEYTRAKGYHLIGREEDKHRLA
                     LYALSNCLQSSIGVWALDYILKSWGEENPIEELKIVSQQACNYYKVSALEERLDEYLY
                     FLIFLFIRQARVGNRINWNFEGKGGFVKDFLQRLWKLLRLKSTSTLELNAATQEYLSH
                     LLQGCLEGESGEKDDLFYHLTVEIVEEMERLSLITFEHRSEMIEGLQRHLIPAYYRLT
                     SRLVNVNSYTETIKEEHADLFYLVKKALRPLEEHLGFTIPDSEVSYFVIHFGGYIEAG
                     QQRSYRYRALVVCPNGVSSSLIVKENLRQLFPNIYFADTHSLQDWKMLDMTDYDMVFG
                     TIKLNIELPFFLVSQLMTSNHKKELFHLVNQHFPNAAYFPIEIEQLLSLVGKHATIHQ
                     EQALKYELVQFLNQRSHEQRGRSPMLEELITKETFQWSEEVLDWQKAVALAARPLVDK
                     GAIETRYIDAMIAKVEEFGPFIDLGKGIAIPHARPEDGVNEVGMSMLVLDKPVYLLDD
                     PSHEIRLFICIAAVDNQTHLRALSHLTKILREEENIQQLVGTKEFADVQHLLKEEQ"
     gene            176952..177236
                     /locus_tag="SSUBM407_RS01005"
                     /old_locus_tag="SSUBM407_0173"
     CDS             176952..177236
                     /locus_tag="SSUBM407_RS01005"
                     /old_locus_tag="SSUBM407_0173"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016397350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIB"
                     /protein_id="WP_002935998.1"
                     /translation="MLRIGTACGSGLGSSFMVQMNIESILRDLGVSDVHVEHYDLGGA
                     NPSEADVWIVGRDLADSATHLGDVRILNSIIDMNELRELVTAICQEKGLV"
     gene            177296..178636
                     /locus_tag="SSUBM407_RS01010"
                     /old_locus_tag="SSUBM407_0174"
     CDS             177296..178636
                     /locus_tag="SSUBM407_RS01010"
                     /old_locus_tag="SSUBM407_0174"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014917181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate transporter subunit IIC"
                     /protein_id="WP_043032419.1"
                     /translation="MDFLIDIAKTPAILVALIAILGLALQKKPAADLVKGGLKTFVGF
                     IVVGGGANIIVGSLEPFGQMFEQAFNLKGVVPNNEAIVAMALDKYGTATSLIMLLGMV
                     FNIAIARFTRFKYIFLTGHHTLYMACMIAVIMSVAGFTSVGLIVMGGLALGLIMTLFP
                     AFVQKYMIQLTGNDHVALGHFSALGYWLSGVVGGLVGDKSKSTEDINFPKGLAFLRDS
                     TVSIAISMSLIYMIVALFAGGDYIKENLSGGTNSMIYALTLGGTFAAGVFVILSGVRL
                     ILAEIVPAFKGISEKLVPNSKPALDCPVVYPYAPNAVLIGFISSFAGGIVSMIILALT
                     GGVVILPGVVPHFFCGATAGVMGNASGGVRGAVCGAFMQGVLISFLPVFLLPVLGDLG
                     FAGSTFSDADFGLSGIFLGVLAKNGGILTVSVGIFAVLALMLGLSLVKKEQKEG"
     gene            178638..179486
                     /locus_tag="SSUBM407_RS01015"
                     /old_locus_tag="SSUBM407_0175"
     CDS             178638..179486
                     /locus_tag="SSUBM407_RS01015"
                     /old_locus_tag="SSUBM407_0175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_002935995.1"
                     /translation="MTSGTADLKRFAKEIRYHTLATLNQLGFGHYGGSLSIVEVLAAL
                     YGEILDIRVQNFSSKERDHFILSKGHAGPALYSTLYLKGFFDRDFLLSLNQNGTHLPS
                     HPDRNLTPGVDMTTGSLGQGMSVATGVAYGKKIEQSPYYTYTLVGDGELNEGQCWEAA
                     QFAAHHELSKMILFVDDNKKQLDGRTHDICQTFDFVEKFQAFGWESVRVNGADIDAII
                     NAILTMKSSKSPQPKCIVLDTTKGQGVTFLEELESNHHLRLSGQLREDLEQVTLVLAR
                     ELEVTE"
     gene            179483..180409
                     /locus_tag="SSUBM407_RS01020"
                     /old_locus_tag="SSUBM407_0176"
     CDS             179483..180409
                     /locus_tag="SSUBM407_RS01020"
                     /old_locus_tag="SSUBM407_0176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_012774920.1"
                     /translation="MRQTKEMRLVYSDFLAQVGQEDTTIAAIEADLSSSMATNKLSSV
                     LGGRYVNVGIMEQEMVGVAAGLSLLGYKPYIHTFGPFASRRVYDQVFISLAYAQLNAT
                     IVGSDAGVSAEMNGGTHMPFEELGLMRLIPKARVYEVSDDVLFQAVLKETIKVDGLKY
                     IRTIRKAPTPIYQGGEDFSKGYCVLRQGEDMTLLASGIMVEQALKAADQLEAQGVSVQ
                     VIDLFRIKPIHEDISALLSGRPVLTVENHNRIGGLGSSICELMATDLTTPVHRIGIEE
                     SFGQVGQQAYLMDVYGLTAEYIVKQAQLMLQQ"
     gene            180600..182360
                     /locus_tag="SSUBM407_RS01025"
                     /old_locus_tag="SSUBM407_0177"
     CDS             180600..182360
                     /locus_tag="SSUBM407_RS01025"
                     /old_locus_tag="SSUBM407_0177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="WP_011921780.1"
                     /translation="MKKIQREFQKIYYNLDKILLLFFTLFTFMEFVWIPLNSWISEGL
                     LAMTGHAYLSPTNLLSVFAENLLVTGLFILLFFVNIAIAYLELALLFTGVWQLLDEKV
                     KHLTDYLRDVRDSMVAIIRHSSLPKVLFLLFYSVILLPFLRRVLNIYYFNKIVVPQFI
                     VDYLSNTVWLGILILIFLLLFFWLAARFMYALPNIYFEHRGVKESIAYSWEKTRGRKQ
                     IGSLFRLIWLVTFPVLLFTGVGGLFYLVQLLAEHFVPSASYWLAVVCYALLKLAYYGV
                     VALFMMGFVSLLTGKQLPIYRRKRLRHHLRLAILLVSGLVFGTQGALALYFPFDTLPV
                     TISHRGVDDGNAVQNSIEALEKTSQLKPDYIEMDVQETKDGQFIVMHDTDLLALTGNP
                     GGTHDYTLAELTGMTASENGMAAPVPSFDEYLEKADELGQKLLVEIKVTKADSPKLTQ
                     NFLKKYGQRLIAKGHQMQSLDYRTIIEIKQYSEKLVSFFILPFNSIYPTTVADGYTME
                     YTSLDQNFMTKSWIRGKSVYAWTPNEEESMTKMLLLQVDGIITDNMTDLQSLMEEMKE
                     NRRYPDLFFQQFQSLIYNFE"
     gene            complement(182404..182703)
                     /locus_tag="SSUBM407_RS01030"
                     /old_locus_tag="SSUBM407_0178"
     CDS             complement(182404..182703)
                     /locus_tag="SSUBM407_RS01030"
                     /old_locus_tag="SSUBM407_0178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014635688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YbaB/EbfC family nucleoid-associated protein"
                     /protein_id="WP_002941492.1"
                     /translation="MMNMQNMMRQAQKLQKQMEKSQAELAATQFTGSSVQDLVTATFT
                     GDKKLVSIDFKADVVDADDLETLQEMTIQAVNAALTKVDEATQKKLGAFAGKLPF"
     gene            182970..184139
                     /locus_tag="SSUBM407_RS01035"
                     /old_locus_tag="SSUBM407_0179"
     CDS             182970..184139
                     /locus_tag="SSUBM407_RS01035"
                     /old_locus_tag="SSUBM407_0179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SIS domain-containing protein"
                     /protein_id="WP_011922584.1"
                     /translation="MFRLAKEELEKLGAIITATEIYQQPGLWKEAYQLYFDQLEKIES
                     FLKSIKEKHDFVHVVFTGAGTSDFVGQSIANYLNQVNDLKHIRFSAIGTVELVSRPHD
                     YLQADVPTVLVSFARSGNSPESVAAVEVAKQLVDKLYQVTITCAPEGKLALAAEGDAE
                     NLLLLQPAGSNDKGFAMTGSYSCMALTALLVFSSASQEEKAAWVEIIARLGQDVLDRE
                     DYVQDLINLDFERVIYLGSGGFYGLAHEAQLKILELTAGKIATMYESPLGFRHGPKSF
                     INEKTLIFLFASNDAYTRQYDVDLLNEVHGDGIAERIVALSADKLVGTEAANFVLAEG
                     GADLPDVFLTFPYILFAQTVSIMAAIKCNNLPDTPSPTGTVNRVVQGVIIHPLEK"
     gene            184269..186158
                     /locus_tag="SSUBM407_RS01040"
                     /old_locus_tag="SSUBM407_0180"
     CDS             184269..186158
                     /locus_tag="SSUBM407_RS01040"
                     /old_locus_tag="SSUBM407_0180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922585.1"
                     /note="The YSIRK form of extended signal peptide directs
                     nascent proteins to the cross-wall site, while signal
                     peptides lacking YSIRK direct proteins instead to the cell
                     pole. A large fraction of YSIRK proteins are surface
                     proteins anchored by sortase-mediated processing of a
                     C-terminal LPXTG motif; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="G5 domain-containing protein"
                     /protein_id="WP_012775483.1"
                     /translation="METANKKFRYSIRKFKVGVGSVLIATCLLGAGVSTPTAFATTET
                     STATQVEAMAKVEEVQKLVKELEKELGELDKVPSYGDAQDYSYQKALWEEFLRIGKDN
                     MDYASKMKADDKFFHKVKGDLNDFKYQIKVENYIRQVAELRKKYPGDNTIEEEYNAHL
                     KQDEGKSIASQEGATLRDYVDREASEAMGRIKQRVAELEKSKQPQPSPADEPAPAPKE
                     EDTPAPTPKVEDETQEPKTEEKAPETKEETPTPTPKEEGIPAPKEDEVPAPKEEETPA
                     PKEEDTPAPDAAPAPAPTPEVDPAPTPIPDTPKAEEEAPTPVPDTPAPKEDEVPAPIP
                     DAPTPKVEEETQEPKTEEKAPETKEETPTPAPDAEPAPTPVPDTPAPDTPAPKEDEVP
                     APMPDAPAPKAEEEVPAPTPMPETPMDKPKTDKVESDKQMPEAKQPEMEQPKAEDMPK
                     EEMPKSEQPKAEDSAPKTAVPEVAPKTAEKPKLDFTTKERKVEEALPIKEEIRYDASL
                     PLGKSYLLQEGKAGKKVSVYQDVIVDGKVVATNLLSETVVEGQNRILVKGSLEMKKEE
                     VKTTPSVQSNPTLSHKGAPSANKATLPATGEQRNNLALVGLGLAGISLAVVATAINKK
                     SKDQI"
     gene            complement(186435..188702)
                     /locus_tag="SSUBM407_RS01045"
                     /old_locus_tag="SSUBM407_0181"
     CDS             complement(186435..188702)
                     /locus_tag="SSUBM407_RS01045"
                     /old_locus_tag="SSUBM407_0181"
                     /EC_number="3.4.14.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002941485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro dipeptidyl-peptidase"
                     /protein_id="WP_011921783.1"
                     /translation="MRFNQFSFIKKETSVYLQELDTLGFQLIPDASSKTNLETFVRKC
                     HFLTANTDFALSNMIAEWDTDLLTFFQSDRELTDQIFYQVAFQLLGFVPGMDYTDVMD
                     FVEKSNFPIVYGDIIDNLYQLLNTRTKSGNTLIDQLVSDDLIPEDNHYHFFNGKSMAT
                     FSTKNLIREVVYVETPVDTAGTGQTDIVKLSILRPHFDGKIPAVITNSPYHQGVNDVA
                     SDKALHKMEGELAEKQVGTIQVKQASITKLDLDQRNLPVSPATEKLGHITSYSLNDYF
                     LARGFASLHVSGVGTLGSTGYMTSGDYQQVEGYKAVIDWLNGRTKAYTDHTRSLEVKA
                     DWANGKVATTGLSYLGTMSNALATTGVDGLEVIIAEAGISSWYDYYRENGLVTSPGGY
                     PGEDLDSLTALTYSKSLQAGDFLRNKAAYEKGLAAERAALDRTSGDYNQYWHDRNYLL
                     HADRVKCEVVFTHGSQDWNVKPIHVWNMFHALPSHIKKHLFFHNGAHVYMNNWQSIDF
                     RESMNALLSQKLLGYENNYQLPTVIWQDNSGEQTWTTLDTFGGENETVLPLGTGSQTV
                     ANQYTQEDFERYGKSYSAFHQDLYAGKANQISIELPVTEGLLLNGQVTLKLRVASSVA
                     KGLLSAQLLDKGNKKRLAPIPAPKARLSLDNGRYHAQENLVELPYVEMPQRLVTKGFM
                     NLQNRTDLMTVEEVVPGQWMNLTWKLQPTIYQLKKGDVLELILYTTDFECTVRDNSQW
                     QIHLDLSQSQLILPH"
     gene            188884..189618
                     /locus_tag="SSUBM407_RS01050"
                     /old_locus_tag="SSUBM407_0182"
     CDS             188884..189618
                     /locus_tag="SSUBM407_RS01050"
                     /old_locus_tag="SSUBM407_0182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_012774921.1"
                     /translation="MLRKNEAIVPILRINNRAINQGFLEENLGMKTKLEDGPFADFGD
                     RTSPEAKLVLTESPGNRTRAVEGLKKLNKIVIKVDNASEIEALLAQGSQYSKLYQGKN
                     GYGFEALSPEGDTFLLHAEASVDDLKAILPPVPFKVQDDFSGLTAFTVESVWINTPQA
                     SISQDYYEAILPQQAFLRFVGAEGKDLLTPAEQVWDLEGLRFPVEQDFDWAHLESRLE
                     RPFFKDKKASFIQTVDPSGIELWFEK"
     gene            189615..190561
                     /locus_tag="SSUBM407_RS01055"
                     /old_locus_tag="SSUBM407_0183"
                     /pseudo
     CDS             189615..190561
                     /locus_tag="SSUBM407_RS01055"
                     /old_locus_tag="SSUBM407_0183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002941482.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase family protein"
     repeat_region   complement(190560..190665)
                     /note="Imperfect repeat RepSU1"
                     /rpt_family="RepSU1"
     gene            complement(190968..193313)
                     /gene="pflB"
                     /locus_tag="SSUBM407_RS01060"
                     /old_locus_tag="SSUBM407_0184"
     CDS             complement(190968..193313)
                     /gene="pflB"
                     /locus_tag="SSUBM407_RS01060"
                     /old_locus_tag="SSUBM407_0184"
                     /EC_number="2.3.1.54"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002941480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate C-acetyltransferase"
                     /protein_id="WP_011921786.1"
                     /translation="MSTKVKTKNVAEDIFAQAWEGFKGTDWQDKASVTHFVQANYTPY
                     DGDESFLAGPTERSLHIKKIIEETKAGYEDTRFPMDVDRATSIADIPAGFIDKENELI
                     FGIQNDELFKLNFMPRGGIRMAETTLIENGYTPDPLLHEIYTKHATTVNDGIFRAYTA
                     DIRRARHSHHVSGLPDAYSRGRIIGMYARLALYGADYLMEEKVADWNAITEIDEESIR
                     LREEINMQYQALQQVVRLGDHYGVDVRKPAMNTKEAIQWTNIAFMAVCRVINGAATSL
                     GRVPIVLDIYAERDLARGTFTEAEIQEFVDDFVLKLRTVKFARTKAFDEIYSGDPTFL
                     TTSMAGMGNDGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWSDQLPYSFRRYCMAMSH
                     KHSSIQYEGVTTMAKDGYGEMSCISCCVSPLDPESEDQRHNIQYFGARVNVLKALLSS
                     WNNGYDDVHKDYKVFDGVEPNTSEVFDYDQVVKNFEIALDWLTDTYVDAMNIIHYMTD
                     KYNYEAVQMAFLPTHLRANMGFGICGFANTVDSLSAIKYAQVKPIRDEDGFIYDYEVT
                     GDFPRYGEDDDRVDDIAKWLMEAFFTRLNKHKLYKNAEATVSILTITSNVAYSKQTGN
                     SPVHRGVFLNEDGSVNTTKVEFFPPGANPTSKARGGWLQNLNTLSKLNFKHANDGISL
                     TTQVSPKALGKTFDEQVNNLVTILDGYFEQGGQHVNLNVMDLNDVYEKIMAGEDVIVR
                     ISGYCVNTKYLTKEQKTELTQRVFHEVLSMDDHAAEVSGQA"
     gene            193629..194696
                     /gene="dinB"
                     /locus_tag="SSUBM407_RS01065"
                     /old_locus_tag="SSUBM407_0185"
     CDS             193629..194696
                     /gene="dinB"
                     /locus_tag="SSUBM407_RS01065"
                     /old_locus_tag="SSUBM407_0185"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV"
                     /protein_id="WP_011922586.1"
                     /translation="MLIFPLINDLSRKIIHVDMDAFFAAIEVRDSPALKGKPVIIGAD
                     PRLSGGRGVVSTCNYEARAFGIHSAMSSKEAYERCPQAIFISGNYEKYQEVGRQVREI
                     FHRYTDLVEPMSIDEAYLDVTENKLGISSAVKIAKLIQYDIWNELHLTASAGVSYNKF
                     LAKIASDMEKPHGLTLILPEDAVGILASLPVEKFHGVGKKTVERLHEMGVYTGQDLLD
                     VPEMVLIDRFGRFGFDLYRKARGISNSPVKVDRVRKSSGKERTYRKLLYREEDVLKEL
                     ISLCQRVAASLKRNGKKGRTIVLKVRYGDFSTLTKRHSLEVYTDQTETIEKEVRQLIE
                     EIGKIEKGIRLLGVTVTNFQT"
     gene            194739..195158
                     /locus_tag="SSUBM407_RS01070"
                     /old_locus_tag="SSUBM407_0186"
     CDS             194739..195158
                     /locus_tag="SSUBM407_RS01070"
                     /old_locus_tag="SSUBM407_0186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rrf2 family transcriptional regulator"
                     /protein_id="WP_012775484.1"
                     /translation="MQISSRFTIASHILVLLALEGEKEKQTSTSIAGSVGVNPVIIRN
                     ILSQLKEAGLVEVARGIGGARLAQGPDQITLLHVYQAVELFGEKGQLFAFHEQPNLSC
                     QVGRNIHPLLDSRLENAQSALENELAKTRLADLLAEL"
     gene            195397..196023
                     /locus_tag="SSUBM407_RS01075"
                     /old_locus_tag="SSUBM407_0187"
     CDS             195397..196023
                     /locus_tag="SSUBM407_RS01075"
                     /old_locus_tag="SSUBM407_0187"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_002935982.1"
                     /translation="MKIAIIAANGQAGQTIAKEAVERGHQVTAIVRSENKSVAQEVIQ
                     KDAFALTKEDLAGFDVVVNAFGAWTPETLPDHARLAEHLATILAGSPTRLLVVGGAGS
                     LYLDESQTAMLKDTPDFPAEYLPIAEAMGTGLDLYRQATAVNWTYISPAADFDAEGQK
                     SGAYTLAGEVFQVNAQGESYISYADYAVALVDIAEKGGYQQERISVLA"
     gene            196125..197045
                     /locus_tag="SSUBM407_RS01080"
                     /old_locus_tag="SSUBM407_0188"
     CDS             196125..197045
                     /locus_tag="SSUBM407_RS01080"
                     /old_locus_tag="SSUBM407_0188"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tagatose-6-phosphate kinase"
                     /protein_id="WP_011922588.1"
                     /translation="MIHLICPNPALDRTLLVEKIEKNIPLRPTEVRDYPGGKSFNVAY
                     ALRENGVTDYTIHTILGGQIGRYIQELNADGGNALRVVENSQNTRTCNIYVETSTGDV
                     VLFYEKGFELTEDLLNQFTQQIENSLQAGDILVFSGSLMKGMSDDYIQRFIEKYPEVL
                     TIVDTSGPALRAAYQARPALIKINNEELKDIYPELDEESPEAILGILKEVTPHENIII
                     TMGDKGSLAKIGQRFFRIQSPKKETRNPIAAGDFYLGLLVKGISQGQAPEIFLKEAAA
                     FATANCLNYFPEVEAEQFEAIVDTIVLEEL"
     gene            197093..197731
                     /locus_tag="SSUBM407_RS01085"
                     /old_locus_tag="SSUBM407_0189"
     CDS             197093..197731
                     /locus_tag="SSUBM407_RS01085"
                     /old_locus_tag="SSUBM407_0189"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein"
                     /protein_id="WP_014636205.1"
                     /translation="MRWGIVVEQLTVLYQNLKRRYGEFHWWNDENPIKDLVSMILIQQ
                     TTEANAKRALEQLEGRLTIHSLLEMPVEDLQECIRPAGFFKQKSLYIRSVVEWANQFD
                     GDFSRLDRVETAVLRKELLSLKGVGNETADVILLYLCRRSVFVADQYALRLFNRLGLS
                     QSQDYLSLRQEFTEQIKDWSVKDAQELHALIDEHGKQFRLTKGQLDESWLMI"
     gene            complement(198014..199213)
                     /locus_tag="SSUBM407_RS01090"
                     /old_locus_tag="SSUBM407_0191"
     CDS             complement(198014..199213)
                     /locus_tag="SSUBM407_RS01090"
                     /old_locus_tag="SSUBM407_0191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family protein"
                     /protein_id="WP_012774923.1"
                     /translation="MGKKEETIRNISGNILKTLFRHQKSSRTRISKSLKITPATITNM
                     ISYLVAEKKVIETGDEVRDYIGSGRSRRLITVNSQYRHYIGIEINANGIYLAVTDTIG
                     NLITNSNIKITEYDSKQINEIIIQLVTETLDKFSYLEFGALGIAVPGHFDSKSGHIIS
                     NNVKWIYFDLAVIKQSISIPIFLENNINCMAIGSYLFHPESSPEQFLFIHIGPGLFCS
                     FFDSEHILQNKNFYIGEIGHTVVDLNGPSCECGKRGCLQTYISDTWLINNARFLFENV
                     QGSIIKTLVEKPEDITLDVVYNAYRLGDGFIIEKIESGIDFLTTSIANTLIIYDSKKI
                     FINSQLLNYPGFSEKVNNLVDNQLQFIPSKNNLDIEFLSFNIFRGAIGAASLAVYNHF
                     ILENNSN"
     gene            199406..200734
                     /locus_tag="SSUBM407_RS01095"
                     /old_locus_tag="SSUBM407_0192"
     CDS             199406..200734
                     /locus_tag="SSUBM407_RS01095"
                     /old_locus_tag="SSUBM407_0192"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIC"
                     /protein_id="WP_012774924.1"
                     /translation="MNGLMHFLEHKLAPFGTKVGNQRHLKAVRDGFMMAMPLVLVGSF
                     FLLLISWPDQASGGFSVVGFLEQIGLLGILNRLNQSTMAIISLIATFGIAYRLSESYE
                     TDGPSAGVIALSSFILLAPRFSTMVFNESGEQINQVFAGAIPFGSLNASALFVAIAVG
                     LVSAEIYRFFIQRGITIKMPKNVPDVVGKSFAALLPALTTLIFWACVFQGLEAAGVEG
                     GLGAVLGLIVGKPLGLIAGSLGGMVLVVLVNSLFWFTGVNGGQVLNAFVDPVWLQFTE
                     ANQLAAAAGEKLPHIITLPFKDLFVFMGGGGATVGLALCLLVFSKSRTFKSLGRISFI
                     PSLFNINTAILFSFPTVLNPIMMIPFILTPTVNAIITYFAMATGLVPMTTGVVLPWTM
                     PPILGGFLATGGSIQGAILQIILIGVSFIIYYPFFKVADNKNLELEESGE"
     gene            200739..202625
                     /locus_tag="SSUBM407_RS01100"
                     /old_locus_tag="SSUBM407_0193"
     CDS             200739..202625
                     /locus_tag="SSUBM407_RS01100"
                     /old_locus_tag="SSUBM407_0193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008976002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4838 domain-containing protein"
                     /protein_id="WP_012774925.1"
                     /translation="MKLTIFDKVQNKTSQFAIDELTYYLKAIFDFELGKTTVEEDANV
                     LLSKEYLDNNDTIGIEMKNGNAILTGNSDVSILIAVYRLLSEFGAVFTRPGRKHELIP
                     SLTITDWNEKELSIHETASYKHRGVCIEGADSYQNTKEFLDWLPKINMNSFFIQFENP
                     YSFLKRWYEHEFNPYADKEDFNTEIAQQMSDLLDEELSKRGLIHHRVGHGWTGEVLGY
                     SSKYGWESGLKLPEEKKPLVAELNGKRELFNTAPILTSLCFSNPDVGERMCELIVNYA
                     KERKDVDYLHVWLSDARNNICECEKCKQEIPSDQYVRILNQLDRKLSEEGLNTKICFL
                     LYHELLFAPKHEVLENPERFTMMFAPITRTFEMSYADVDYENDVPLPNEYSRNNIVLP
                     NSLEENLSYLFSWQKVFNGDSFVYDYPLGRAHYGDLGYMKISKVIFRDVVYLKKLGLN
                     GYISCQELRAGFPHNFPNFVMGQMLWNRNLEYDELKALYFSSLYGSEWKSVVTYLEKL
                     SDYSSCDYFNSIGDRQNAELSMKYNISSKLAFNFINTLEENVAKNNGIQRDAWRQLGY
                     HREYVVKLANALHLMASGDHLDGQIRWKDFLDYIRNHEPDFQQYLDVYRIIEVAKNYA
                     GFKL"
     gene            202745..206461
                     /locus_tag="SSUBM407_RS01105"
                     /old_locus_tag="SSUBM407_0194"
     CDS             202745..206461
                     /locus_tag="SSUBM407_RS01105"
                     /old_locus_tag="SSUBM407_0194"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="right-handed parallel beta-helix
                     repeat-containing protein"
                     /protein_id="WP_012775423.1"
                     /translation="MNKKIFLKSAIILLSVTCLINAIKALDSSGVSSSTGEIVNQDRI
                     YNITLKVKTDGVYNDLGGNVISENNVLSGISGTKINLKVSTNSGYRFVGYQSFLESGN
                     STDGLLPIENDSFEISDKTGNVTVVAMFEKIPIDETIYFSDEFSTENINNYLLSENLI
                     GKIAVSNGKLNIHAPGVSSIKPILSRQIDESSTLGYEIQFSIQQIGEVKQWNTFRVVF
                     KENSDGSVYALEFTGKAVSIKKLSSIDAPNQTGEKYAETGHNLGSEEHRIRLVVRGDT
                     VTVSDNEIPLLSYSSPENWEGATASIVFTPISNRSVSLDDIIIRQTRALRSLLVVSRI
                     DGQEVTDIQPGSIRGNTSQVFVGDSLPLEVIEKPGYQFIGFKDEFGNVVDLSTFSVPN
                     DESDLVIYADFQTAEVVNRETKTFYIDSIEGNDTNSGESETNAWKTLEQLRKNTLIAG
                     DRVLLKRGSRFVGEDAALTFKGSGLEDAPILISSYGEGELPLLEAQGKIESVIKLYNQ
                     EYITIENLEITNLDPNFSTSFELNSNNNRSKILRGVHVIAEDYGVVHDIVLRNMYLHD
                     INGNLNSKWNGGIFFDVYGTTVPTKYDGILIENNYLERVDRSGIKLVGSTWANQNLKN
                     NKNIPLNWYPSTNVVVRGNRIEKAGGDSITVRDTDGALIEYNISADARYQDTGYNAGI
                     WPFQASNTVIQYNESFRTHGVQDGQGLDLDHVSNNSVMQYNYSHDNEGGFMLIMNWYE
                     QTSPTVRYNISQNDKDKIFELARGGAQGTAIYNNTIFSDSKLTGRAGVIDMPSTSGGT
                     GVKDIFLFNNIFYFTDGEKMFVEASDAGKYKDSIHFYNNAYVGVEVPDDPKAITEGIT
                     LKGVGTGPTENKSMIANAGKFLTGQLDGYRLPENSSLAKLGVSKEEAISYFYKKLGVQ
                     PTIDFQDNGSLTMSPTEAFALARQTNSVDAIARVYPAIEGVTYDTDFFGETLSSENLS
                     VGAAQEKKSVFEEKISDIEISDVKTGIGMRYKRSNQLADVNLSIRLINKDELQYTINA
                     NNPTFSYEIQLQKNFGEYMDLSESVTITIPIEADKKILNVLKINKNEQTESVKELPYR
                     IENNKIILETDELGSFIIEYQMEKIKKENNTNATISESGKSSLGLQNKENSDVQAVGD
                     KDYFSGLELSNKGEELSREDSKLMGNSINNLQTIKESESIFEGNLGRNKELSDMYQKS
                     LPKTGESNQAYIVLIGLFSLFVVLICQIFKKSID"
     gene            206480..207241
                     /locus_tag="SSUBM407_RS01110"
                     /old_locus_tag="SSUBM407_0195"
     CDS             206480..207241
                     /locus_tag="SSUBM407_RS01110"
                     /old_locus_tag="SSUBM407_0195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011921800.1"
                     /translation="MTKKIIFILLFFVVCVYFYSFIPLVQTVPSVFQTPYRTLVQSEF
                     EAIYKYNGIEISERNFWNKPINGRKPQDTLNEKATILFKKYNLLEKEAKKHEYKKEAL
                     DFNKVDWKTVSNRYIELKQIVIDEKIKDINQDEIERYYLANTENFERQDFISGNISIW
                     NDGIIISTESVDITEETVRNITERYPDLELELKNIEVGHQVSWGQNGVYYTFTCLSRE
                     EKGIIPLSEITDAVAMQCAEELVDNWLNKEIDSLK"
     gene            207458..208222
                     /locus_tag="SSUBM407_RS01115"
                     /old_locus_tag="SSUBM407_0196"
     CDS             207458..208222
                     /locus_tag="SSUBM407_RS01115"
                     /old_locus_tag="SSUBM407_0196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011921801.1"
                     /translation="MKMKSNKEQKYFWLTFSLIVALMIWWFLSNYDRTSRSFPNIILV
                     WNALLIMIDKGFIFEDIFSSLTSVFFGFTSGFLLSAPNALLMAWYSPYRNIVKPWIQF
                     IRNIPPLAYVPLVVISAGVGLLPQVIVIAIATFLTMTVTIYQGIINIDPNLIKAARIL
                     GASDFEIFKRILVPSSIPFIMTAVRLGTSISLTTIIAAESTGATSGMGMRIRSLNNSF
                     DSSGMLLYIILIGVIGLLLNKLVDLIERKLTGWQQK"
     gene            208207..208989
                     /locus_tag="SSUBM407_RS01120"
                     /old_locus_tag="SSUBM407_0197"
     CDS             208207..208989
                     /locus_tag="SSUBM407_RS01120"
                     /old_locus_tag="SSUBM407_0197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012775424.1"
                     /translation="MATEVKKIKVKIEDVSKSFQTNHGEVVALNQINLEIFENEIVTV
                     VGPSGCGKSTLLNLVAGLEPVTSGKIYCDDNEIVGIGVERGVVFQQYALFPWMSVLQN
                     VMFGPEMQGKSKLEASEIANKYIKMVGLQEFSNHYPKELSGGMKQRVAIARAYAVNPS
                     ILLMDEPFGALDALTRIQLQEELIEMLGQEQKTCFFITHDIEEAVLLGNRVIVMSPRP
                     GEIKEIVNVDLPFPRNQLTKFEKNFMDIKNHIWSLVYKDFLI"
     gene            209028..210059
                     /locus_tag="SSUBM407_RS01125"
                     /old_locus_tag="SSUBM407_0198"
     CDS             209028..210059
                     /locus_tag="SSUBM407_RS01125"
                     /old_locus_tag="SSUBM407_0198"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011921803.1"
                     /translation="MAKYMKYKNFIWFICSIITLIFLSSCSSIQTSSSGHSAKVDTIR
                     IAYMPNFASLHDIITGINSGIFKEEGLEVELIEFADGPTIIASLESGSIDIGNIGPGA
                     HKLAIEGRAEVVAFSQLGNADELIARSDRGIDSIEDLRGKKIGTASGTSAETILKLAL
                     LEADLSEKDVEIIDMDASAIVTAMLSGSIDVAATWSPNTTFIKRELKEKVVVLADNSR
                     YREQSPAIASYVTFPGYSEKNNEKISKFLKGLYRAMDYRAEHMKEVSKWVATQIGSDI
                     TAVQDQLQDGEWLTSRQMIQLINTGILQQYYEKQQKNLIESEIVDTSRNINEYVLIDQ
                     MNSILMEIK"
     gene            210153..210962
                     /locus_tag="SSUBM407_RS01130"
                     /old_locus_tag="SSUBM407_0199"
     CDS             210153..210962
                     /locus_tag="SSUBM407_RS01130"
                     /old_locus_tag="SSUBM407_0199"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine-6-phosphate isomerase"
                     /protein_id="WP_011921804.1"
                     /translation="MIEYYNFSKSELENHSRIPLIIKKNNEEIFISLALEMVELIKEN
                     NKKNEKTVIICPVGPVGHYPHFVRLVNQFKIDLSDVWFINMDEYLSEDLHWIDVVHPL
                     SFRGFMQKTVYSQIHPTLIMPEEQRIFPDPLDIDLISNKIKELGKIDLCIGGIGLNGH
                     IAFNEPDSTLTVQEFLKLESRVLPISVETKVMNCLTELKGAVEEVPNYCVTIGMSEIF
                     QAKKIRLAVFRDWHHAVIRKTVCSKPDTGFPSTLMQIHTNCSIYLNESLAN"
     gene            211124..211303
                     /locus_tag="SSUBM407_RS01135"
     CDS             211124..211303
                     /locus_tag="SSUBM407_RS01135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy-metal-associated domain-containing
                     protein"
                     /protein_id="WP_014635836.1"
                     /translation="MKTSIYNVNGMTCATCALTVEKALNKLDGIQNASVNLATEKTNI
                     QYDPAHLSLSDIDSC"
     gene            211452..212195
                     /locus_tag="SSUBM407_RS01140"
                     /pseudo
     CDS             211452..212195
                     /locus_tag="SSUBM407_RS01140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636211.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-IC family P-type ATPase"
     gene            212252..213214
                     /locus_tag="SSUBM407_RS01145"
     CDS             212252..213214
                     /locus_tag="SSUBM407_RS01145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-IC family P-type ATPase"
                     /protein_id="WP_011921806.1"
                     /translation="MFSLSITISVLVIACPCVLGLATPTAIMVGTGKGAENGLLFKSG
                     QTIKTLQGVNTIVFDKTGTITEGKPQVTDIHLLSTKNREQVLQLAASSEQYSEHPLAQ
                     ALLRSAEEESIPLLASQDFQALSGRGLSVTIAEQTIYLGNERLMREQGIDVSKGRAVA
                     ETFAHQAKTPVFLASQQELLAVIAIADKVKETSRQAVQALQTMELEVVMLTGDNEKTA
                     QAIAKEVGIEQVVSQVLPDDKANQVKFLQEQGKTVAMVGDGITLSDYYDHAFGKSYGV
                     LMREWNLLARAVFVLNADNEIVYVEYLDNVNEHPDYKAALEAVK"
     gene            complement(213253..215742)
                     /locus_tag="SSUBM407_RS01150"
                     /old_locus_tag="SSUBM407_0202"
     CDS             complement(213253..215742)
                     /locus_tag="SSUBM407_RS01150"
                     /old_locus_tag="SSUBM407_0202"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RecD-like DNA helicase"
                     /protein_id="WP_012774926.1"
                     /translation="MNEVYFTGTIDRIIFENPSNFYKILLLEIEETDADYDDYEIIVT
                     GTIADVIEGEDYRFYGNLVTHPKYGQQLQISRYERSKPTSAGLVKYFSSEHFKGIGRK
                     TAEKIVELYGEDTIDKILAEPEKLTQITGLSSKNMQAFVEKLRLNYGTELILAKLAEY
                     GIPNKLAFQIQDQYKEKTLQIIEENPYQLVEDVQGLGFTIADRIAENLGIASDSPQRF
                     RAGMLFSLIHRSMETGDTYVEARDLLEATLELLEKSRHTELDPAAVAKELTGLIADDK
                     VQQEGTKIFDNSLYFAEHGIHTNLTRLMGKNGFKPFPRADVEAAIAELESISSLTYDN
                     IQKEAIVQAITNPLFILTGGPGTGKTTVINGIIAVYAILHKIDLTRNREECPVLLAAP
                     TGRATRRMNELTGLPSATIHRHLGLVEGQEESYRDDYLDADFIIVDEFSMVDTWLANQ
                     LFQNISSQTQVLIVGDAEQLPSVSPGQVLADLLKIDKLPSITLERIYRQSDDSTIVTL
                     ASQIRQGALPSDFREKKADRSYFEAQNEQIPALIERIVGAAIKSGIPANEVQILAPMY
                     RGAAGIDQLNTMTQALLNPLEEGELEFLHNEQAFRQGDRVIHLVNDAEANVFNGDLGY
                     ITDLLPAKYTDSKQDEITINFDGSEVTYPRNEWYKITLAYAMSIHKSQGSEFQVVILP
                     ITRTSHRMLQRNLVYTAITRSKSKLILLGEISAFDYAVKNAGTVRKTYLVPRFQGEMA
                     EQESKESLIKKDESKTATTTQTQPPTQPDRKEQVKVVKENNQQLSLLDQDQPEKTSPQ
                     PTEYILTVDNLLTIDPMIGIEQADIEEFFKA"
     gene            complement(215983..216612)
                     /gene="lepB"
                     /locus_tag="SSUBM407_RS01155"
                     /old_locus_tag="SSUBM407_0203"
     CDS             complement(215983..216612)
                     /gene="lepB"
                     /locus_tag="SSUBM407_RS01155"
                     /old_locus_tag="SSUBM407_0203"
                     /EC_number="3.4.21.89"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="WP_011921809.1"
                     /translation="MGAIQKTKRSPLVAFLAEWGIFLLFMAAFFASRYFIWNPVSVDG
                     HSMDPTLQHQEKLIMLKTSSIDRFDIVVASETDSDGKEKLIVKRVIGMPGDTIRYEND
                     VLYVNDQKVDEPYLDEYLAAFQKDKLQEVYSYNKQFQAVAQSAEAFTQDANGYVDFTV
                     TVPEGQYYLMGDDRLVSLDSRSVGTFSRENIKGEVVFRMWPLNRIGTVD"
     gene            complement(216622..217512)
                     /locus_tag="SSUBM407_RS01160"
                     /old_locus_tag="SSUBM407_0204"
     CDS             complement(216622..217512)
                     /locus_tag="SSUBM407_RS01160"
                     /old_locus_tag="SSUBM407_0204"
                     /EC_number="3.1.26.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003077692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HIII"
                     /protein_id="WP_012774927.1"
                     /translation="MNTVVLKASAQQKQAMMAHYDRYRQTSKNPYIEAFFKLTGASLS
                     IYTSGKVVFQGEMAEQEASRWGYEPESSGQATIPGQNLPMIGTDEVGNGSYFGGLAVV
                     AGFVRPEDHSFLKSLGVDDSKKMTDQKICQIAPLLKEKIPHQALLLSPKKYNEVIEQG
                     YNAVSVKVALHNQAIFLLLQKGVQPEKIVIDAFTSSQNYQKYLKKEANQFANPVTLEE
                     KAEGRYLAVAVSSIIARSMFLENLVQLGQLVGMHLPSGAGSKSDQVAASILKQYGMAG
                     LNQTAKLHFANTQKAQKLLK"
     gene            217597..218580
                     /locus_tag="SSUBM407_RS01165"
                     /old_locus_tag="SSUBM407_0205"
     CDS             217597..218580
                     /locus_tag="SSUBM407_RS01165"
                     /old_locus_tag="SSUBM407_0205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="WP_012774928.1"
                     /translation="MEVQMKYKWATLGTGVIANELVQALQAMGGNLYSVANRTYDKGV
                     EFAQKYGIEKVYREIDEVFEDPEVDIIYISTPHNTHINYLRKALKAGKHVLCEKSITL
                     NSEELAEAIQLAEENQVVLAEAMTIFHMPIYRQLSEVVASGKLGELKMIQMNFGSYKE
                     YDMTNRFFNKNLAGGALLDIGVYALSFVRWFMIEKPNQVLSQVKLAPTGVDEQVGILL
                     SNDAGEMATIALTLHAKQPKRGTIAYDKGYIELYEYPRGQKAVITYTEDGSQEVIEAG
                     ETAKALSYEVADMEKAVAGIENTMHLAYTQDVMEIMTQLRKEWGLVYPEEM"
     gene            218929..219906
                     /locus_tag="SSUBM407_RS01170"
                     /old_locus_tag="SSUBM407_0206"
     CDS             218929..219906
                     /locus_tag="SSUBM407_RS01170"
                     /old_locus_tag="SSUBM407_0206"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysM peptidoglycan-binding domain-containing
                     protein"
                     /protein_id="WP_164925485.1"
                     /translation="MKRKRTNKPQHMRRKRKTSIMKNNKKMLYTSSLALSLFSTGMIS
                     TNVLAIEWAPRTVSEISPEIVQEEGMMTYTVQYGDTLSAIASAMNIDMDLLAKINQIA
                     DINLIFPDTVLTTTVDQNNQVTQVEIEAPVQGNTNETVQATVDLTTNQVTVEDTVVPL
                     DQISSVTDSAPVEEVVEQPVVEAPVEEVVEQPVVETPQVTALSTTTTSTSAYDVGLQP
                     QVAAFRAEVANAFGITSFSGYRPGDSGDHGKGLAIDFMVPESSALGDQVAAYAVANLA
                     SKNINYIIWKQRFYAPYDSIYGPAYTWNLMPDRGSITENHYDHVHVSFN"
     gene            complement(220320..221945)
                     /gene="treC"
                     /locus_tag="SSUBM407_RS01175"
                     /old_locus_tag="SSUBM407_0207"
     CDS             complement(220320..221945)
                     /gene="treC"
                     /locus_tag="SSUBM407_RS01175"
                     /old_locus_tag="SSUBM407_0207"
                     /EC_number="3.2.1.93"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006738831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha,alpha-phosphotrehalase"
                     /protein_id="WP_011921814.1"
                     /translation="MTIDKRKVVYQIYPKSYKDTTGNGVGDLRGIIEKLPYLKELGID
                     MIWLNPFYPSPQRDNGYDISDYTAVNPDFGTMADFEEMVTVGKELGIEFMLDMVLNHC
                     STDHEWFQKALAGDKYYQDFFILRDQPTDWVSKFGGNAWAPFGDTGKYYLHLFDVTQA
                     DLNWRNPHIREELFKVVNFWKDKGVKGFRFDVINLIGKDEVLEDCPINDGKPAYTDRP
                     ITHDYLKMMNNATFGSEKGFMTVGEMSATTIENCILYTAPERKELSMAFNFHHLKVDY
                     KDGQKWTIMDFDFEELKHLFHTWGEEMSVGNGWNALFYNNHDQPRALNRFVDVENFRK
                     EGATMLAASIHLSRGTPYIYMGEEIGMIDPDYDSMDDYVDVESINAYQMLLDQGHTPK
                     QAFKIIQAKSRDNSRTPMQWDASDNAGFSTGTPWLKAGKSYQTINVEQEKTGPIFTFY
                     QELIRLRKELPLISEGDYKAAYKDSQKVYAFERLLNDEKLLVLNNFFAEEVELDLADD
                     YAHGQVLISNYPDNKLGKKIILKPYQALAIQVK"
     gene            complement(222026..224020)
                     /gene="treP"
                     /locus_tag="SSUBM407_RS01180"
                     /old_locus_tag="SSUBM407_0208"
     CDS             complement(222026..224020)
                     /gene="treP"
                     /locus_tag="SSUBM407_RS01180"
                     /old_locus_tag="SSUBM407_0208"
                     /EC_number="2.7.1.201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system trehalose-specific EIIBC component"
                     /protein_id="WP_011921815.1"
                     /translation="MGKFEKEAKQLLEAIGGKENVNAVTHCATRMRFVLADEKKANVK
                     VIEDIPAVKGTFTNAGQFQVIIGNDVPIFYNDFTAVSGIEGVSKEAAKSAAKSNQNAI
                     QRVMTMLAEIFTPIIPALIVGGLILGFRNVLEGVQMEWLGQAMKDGQLVFDADGNPVW
                     NTIVQVSPFWNGVNHFLWLPGEAIFHFLPVGITWSVSRKMGTSQILGIVLGICLVSPQ
                     LLNAYAVPGTDAATIASDWSWNFGAFSIARIGYQAQVIPALLAGLALSYLEIFWRKVV
                     PEVVSMIFVPFLSLLPAIILAHTVLGPIGWTIGQWLSTVVLAGLTGPLKWLFGAVFGA
                     LYAPFVITGLHHMTNAIDTQLIADAGGTGLWPMIALSNIAQGSAVFAYFLMNRKNEKE
                     AQVSLPATISAYLGVTEPALFGVNVKYIYPFVAAMIGSSIAGLLSVTFNIQAASIGIG
                     GLPGILSIKAEYWGAFFMTMVVAIVVPMILTAVFKRTGAFSKKEETVEEVVAPTEAVV
                     ETGAAIELISPLTGQTKELSQATDPVFASGVMGQGVLIDPSEGILVAPVDGEVSVLFP
                     TNHAVGITATNGVELLMHIGMDTVGLEGKGFTAHVKQGDKVKAGDKLISFDIDVIKAA
                     GLIAETPVIVTNQTDFDTQVIGNLPRAISQGEAILTVTKN"
     gene            224254..224967
                     /gene="treR"
                     /locus_tag="SSUBM407_RS01185"
                     /old_locus_tag="SSUBM407_0209"
     CDS             224254..224967
                     /gene="treR"
                     /locus_tag="SSUBM407_RS01185"
                     /old_locus_tag="SSUBM407_0209"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose operon repressor"
                     /protein_id="WP_012774930.1"
                     /translation="MKKYQEIYNDLKEKIRTNVYPAESSLPTEQQLQEIYGVSRDTVR
                     KALAILTEGGLIQKVQGRGSMVLKQEILNFPVSGLTSYQELTNVLQLSTKTDVVSLDM
                     ITVNSSLSHLTGFEPYSKVWKVVRTRSIDGKVSVVDTDYLAVDVVPELTTAIAEKSIY
                     EYLENKLGLDIAYAQKEITVEPTNREERELMQSKDDYLVLIKSRVYLGDTQQFQYTES
                     KHKIDKFRFVDFARRKHSL"
     gene            225025..225336
                     /locus_tag="SSUBM407_RS01190"
                     /old_locus_tag="SSUBM407_0210"
     CDS             225025..225336
                     /locus_tag="SSUBM407_RS01190"
                     /old_locus_tag="SSUBM407_0210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002935948.1"
                     /translation="MANLNRYKFTFGEKQLTLTTEHDNLFMEEIERIAQEKYQAIKEK
                     MPTADPETLALLLAINALSVQLTREMAFEQKEQELASVKEKVLKKNVTLIDLDELEDK
                     V"
     gene            225333..225881
                     /locus_tag="SSUBM407_RS01195"
                     /old_locus_tag="SSUBM407_0211"
     CDS             225333..225881
                     /locus_tag="SSUBM407_RS01195"
                     /old_locus_tag="SSUBM407_0211"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CvpA family protein"
                     /protein_id="WP_002935945.1"
                     /translation="MISLAIILILAWSFYIGYSRGLVLQAFYSMGSIIALVVATATYK
                     KLASFLYLWVPFANATQGSSNYYFDEKYLFDLDMVFYAGLAFLLIYVLVYAIVRFIGI
                     FVHLLEAFNPDTKTTNLISGALAVLVTFISLQIVMVLLSTIPLAMIQDKLHSSFLANI
                     MIQYTPFTSSFLKSLWLSNIAG"
     gene            226032..228365
                     /locus_tag="SSUBM407_RS01200"
                     /old_locus_tag="SSUBM407_0212"
     CDS             226032..228365
                     /locus_tag="SSUBM407_RS01200"
                     /old_locus_tag="SSUBM407_0212"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009659728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease MutS2"
                     /protein_id="WP_012775425.1"
                     /translation="MNNKIIETLEFHKVRQKIEPYLLTEQGFEELRQLEPMVEVHRIQ
                     QAFDELTDIAQIFVENPYFSLAATSDIGPAMRRLELDTDLNIAELLAVKKVLEVSKSL
                     LDFYGNLENVSLSQLDKLFEKIELFPHLQGSLQSINDAGFVEDFASEKLARIRRKIRE
                     AEDQVRQVMQDILKTKGDMLSDSILASRNGRNVLPVKNTYRNKIAGVVHDISASGSTV
                     YIEPRAVVTLNEEISHLRAEERHELNRILQELSDMLRPHGGVIRNNAWLIGHIDFVRA
                     KHLFARDHQAVVPKLSEKQDIALLNVRHPLIAKPVPNDLYFGSQLTAIVITGPNTGGK
                     TIMLKTLGLTHLMAQSGLPILADKGSRVAIFKEIFADIGDEQSIEQSLSTFSSHMTHT
                     VEILRAADQDSLILFDELGAGTDPQEGASLAMAILDDLRLRGIKTMATTHYPELKAYG
                     IETSGIENASMEFDSNSLRPTYKFMQGVPGRSNAFEIARRLGLSDIIIQSAQSWTDTD
                     SDVNRIIEKLESQTVESRQRLDKIRDVEQENYKMNRALRKLYDELNRERENELNKARL
                     EAKEIVDMALAESEDILKNLHAAASLKPHQIIEAKAELKKLAPEVVDLSKNKVLKKAK
                     IKREAKVGDDIIVTAYGQRGTLTNQLKDGRWEAQVGLIKMTLAKDEFELVKAEKAEQP
                     KKRQVHTVKRANVRGPKARLDLRGKRYEEAMMELDEFIDQALLNNLAQVDIVHGIGTG
                     VIREGVTKYLRRNKQIKEFGYAPQNAGGSGCTIVTFK"
     gene            228389..229042
                     /locus_tag="SSUBM407_RS01205"
                     /old_locus_tag="SSUBM407_0213"
     CDS             228389..229042
                     /locus_tag="SSUBM407_RS01205"
                     /old_locus_tag="SSUBM407_0213"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_011921818.1"
                     /translation="MIIRKYQTSDEKGWVYCKALSYLFSPFFDDRETEKPELMTDVYD
                     HRVEWVAEVDGQIVGLIDIDIYTEECSQSYIYAPSKRTAYFTNLAVHPDFQGQGIAQA
                     LFEKAEQELRAQGVEKLAIFTREDDAANHLYQKWGGEVVCSDYLVVGAPQDVPTFRFG
                     IDLERGRLSFSDMEGQPVPYYLREGVYVVSEEAGLDLFDIEDVYQELTYVVDLTEKS"
     gene            229249..229563
                     /gene="trxA"
                     /locus_tag="SSUBM407_RS01210"
                     /old_locus_tag="SSUBM407_0214"
     CDS             229249..229563
                     /gene="trxA"
                     /locus_tag="SSUBM407_RS01210"
                     /old_locus_tag="SSUBM407_0214"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002941035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_012775426.1"
                     /translation="MVQVITDANFEVETQEGVVLVDFWAPWCGPCRMQAPILEQLADE
                     VDEDELRIYKMDVDENPNTARQFGIMSIPTLLFKKDGQVVKQVAGVHTKDQIKAILAE
                     IG"
     gene            229831..231360
                     /locus_tag="SSUBM407_RS01215"
                     /old_locus_tag="SSUBM407_0215"
     CDS             229831..231360
                     /locus_tag="SSUBM407_RS01215"
                     /old_locus_tag="SSUBM407_0215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="WP_012775486.1"
                     /translation="MSTISYKPLNLYRQFKTAAQEFPNVAIYFDKPYASFPELGLENT
                     YQTVFEAIQKRAAQFAAAGIGYGDKVILYKSPAFDTYLLAVAVTALGAVPVMISYHLP
                     SSNLDVFAERLEKSFIVYDQETEERVAGMTRTDLVTKIFLPQVLVQEAVAFEENLLPE
                     DVIQYMTHTSGTTGVPKLICHTAQTMGWRVAWQQTIFDKMTERGLLAFHISPVHSRYN
                     IGVSSAIGLGFPLYPLSSARKDDVERALALHRPSALETHPNNFVQWARLAKEKPEVFS
                     SIRYYHSTFDAINIGTLRAFLEASKEQDPVFMQVYGQSECGPMILRYHRLENLGTVSG
                     RDMGIGLEGYTEARITDAQGNPLPAGENGHIQFLSKGRAVTYYKEDARFQDNVYGAWW
                     DSGDYGCMTPEGTLLLKDRQVDLIEHIDSNLALEDLLLDKLDFLSEVVIIRDVNGAPQ
                     PIVALAEDAEMNWEAWWAMVADLPLLKEPILMAYDDIPRTATMKVQRLKMEAEMKEKN
                     L"
     gene            231400..232338
                     /gene="msrB"
                     /locus_tag="SSUBM407_RS01220"
                     /old_locus_tag="SSUBM407_0216"
     CDS             231400..232338
                     /gene="msrB"
                     /locus_tag="SSUBM407_RS01220"
                     /old_locus_tag="SSUBM407_0216"
                     /EC_number="1.8.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002941039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-methionine (R)-S-oxide reductase MsrB"
                     /protein_id="WP_011921822.1"
                     /translation="MKEIYLAGGCFWGMEGYFSQIDGILDTSVGYANGQVETTNYQLL
                     KQTDHAETLYLAYDETRINLREILLYYFRVIDPFSVNQQGPDKGRQYRTGIYYTDEAD
                     LPTIEQVMTEQSQLFGGRPLAVEVEPLAHYIPAEDYHQDYLKKNPQGYCHIDLGQAKI
                     PLIDVADYQKPDQQVLKDSLTDLQYQVTQEAATERPFENEFWNSEQAGIYVDITTGEP
                     LFLSTDKFDSGCGWPSFTKPISKEVATYFQDKSHGMNRIEVRSRAGHAHLGHVFDDGP
                     RDKGGLRYCINSAALRFIPREEMEEAGYGLFLDLLK"
     gene            232456..233334
                     /locus_tag="SSUBM407_RS01225"
                     /old_locus_tag="SSUBM407_0217"
     CDS             232456..233334
                     /locus_tag="SSUBM407_RS01225"
                     /old_locus_tag="SSUBM407_0217"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014635840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014635840.1"
                     /translation="MYRKVMKMILSKRFKNRRKELGFTQKELAEGICEQSLISRVEKL
                     GVAPTSDILFALSQRLQVSMDYFFDESVSDKAPDITVFKRLVDKALFTRSYDQLAYLV
                     EAEKQKEAVHSQESSEYLTYLACIVDFHHYHKEDIAIGCMEELSHRISKKSSFYLDVY
                     NSLVNFYALASRDEDLDGLYEGISEKLSHLDISNTECFHKYIKIRYNHAHYLFKRKRQ
                     SQAIDELTDLIETLRDKKSCYFLADMLCLIANVGEGFLSKDEILSYYREAECLFKFFG
                     PQNSYLSLKEYLSKVI"
     gene            233518..235503
                     /locus_tag="SSUBM407_RS01230"
                     /old_locus_tag="SSUBM407_0218"
     CDS             233518..235503
                     /locus_tag="SSUBM407_RS01230"
                     /old_locus_tag="SSUBM407_0218"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1430 domain-containing protein"
                     /protein_id="WP_012774933.1"
                     /translation="MKKVFTYLSTFSVCLFCIWLVSLQLDSLIYHYYPSVSILSRGEE
                     VTYEEVSDALTNLAEKENSLIAKTITETDDSGRTTTSYDVFGKGELPQGLVKADRLVA
                     SQANLAENYYVVKGNLDIKVVENVLQSLGLVDSYIYRPTLLNSLSLFLGRGAPSLGLI
                     IFILTNLALTVVGQIVYLRSAGIEMLSGVRSWQIASRFLRVDGRDIALATGGALVFGL
                     IAILILGWPMVYYRFVAIGIAFYACLLFFLSLSTSIGFMIALNISQLQKLIKGALPLK
                     AIFAILLVGQCLAVCIISIGASRTLTYVGVLHTLTIGEKAWQERQDVFSLSLNREAFI
                     ADEAMAQQQRMAWSHVILESYAKNNVMLVQHHLRHNTIKEHTIIESSKEIPLERVLYV
                     TPNYIQSEGGLYDFNQLEEIKQLGKGEIALLLPKSLQNDASVYQAYFEDMVGKLLADG
                     EGSISLHSNVYYISDEKRWFIYNHTPINYEQFLQAPLIVVLSPESFEETSYFWENALP
                     DFVFFKDKEMLEQLLDKYNLQNTIGSLLSSKQHYNTLRKNVQLEILMTLSPTILGIFT
                     SILLFNTMNLLYFETFKREIAIKRIAGMGFIELHGSYLGEQVGSALIGMGLAMFMTKS
                     VIVSLGVVVALLINSWMLLNNQAKREEKIQLSVLNGR"
     gene            235523..237508
                     /locus_tag="SSUBM407_RS01235"
                     /old_locus_tag="SSUBM407_0219"
     CDS             235523..237508
                     /locus_tag="SSUBM407_RS01235"
                     /old_locus_tag="SSUBM407_0219"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1430 domain-containing protein"
                     /protein_id="WP_012774934.1"
                     /translation="MKGKFVLVSTIILAVFMIWLGVSQKETMLVHYYPSVTTLSVSED
                     VTYSDVRQRLEDYSQQTDSVIARRVIEPSKSGGRTFSYDNFSQSPLPRGLEEFQASEK
                     VESALLTKYFIFQGKATVEELRSLLVSLGLDEVQIRKPSTIATLLVFLTQGGQFLAVL
                     VFLITYMALVVIANVRQLRTAGIRLIAGDSRWHLFLLSLQENAKEIALTIPFAVLPAV
                     GLAYLVGLDGYSVYYLVAALVGYHFLLGLIVLFFAATFTLAIRTYHFLPLLKGKMPLQ
                     GILTIMVMGQMLALLVVSFGMAQTVYYSGIWQEYQAGAQQWENEGDYYSLAWNISADG
                     RSGLNSPENWYPLLRQALEEDGALFVKSNLNAYLMGFQLEDGTRLDSYHPAGNTLYVS
                     PNYLQIQDVDLAEGEVALPLQEGEFQLLLPEKLRPESDAYLHLYQDYINRMVRPANQA
                     RSATIKGKVAYLKNGQKQFIYNHRSGQHVQYLTDPILVVLAPSSLGKESADFWLNEVD
                     SSMLFKNRDKLLRELKARNLFQFVNEVRSSSSLFTELLDRIRIETISTSMGAILGIVT
                     SIVLFNTMNLLYFEEFKREIVIKEIAGMGFLGIHKKYLTLQLLSLLLALGASMVVTGH
                     IFISSISFALFMVNALCLLRWQARKEGAWNVRILKGA"
     gene            237510..238142
                     /locus_tag="SSUBM407_RS01240"
                     /old_locus_tag="SSUBM407_0220"
     CDS             237510..238142
                     /locus_tag="SSUBM407_RS01240"
                     /old_locus_tag="SSUBM407_0220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005590322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011921830.1"
                     /translation="MFSVQSIQKKFGKRSLFSDVTLDLQAGKVYALIGASGSGKTTLL
                     NILAKLESYDAGDILYKGKDLKKLKPHLFFREELGYLFQNFGLLESQTIKENLDLGLI
                     SQKLSKDERKSRQEAALDAVGLSYLDLSQPIYELSGGEAQRVALAKVILKNPPLILAD
                     EPTAALDPKSSQEIMDILLSLKSPDRLIVIATHNPLIWERADLIIKMEDL"
     repeat_region   complement(238149..238252)
                     /note="Imperfect repeat RepSU1"
                     /rpt_family="RepSU1"
     regulatory      238355..238459
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00504"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="glycine riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="glycine"
                     /db_xref="RFAM:RF00504"
     gene            238566..239900
                     /locus_tag="SSUBM407_RS01245"
                     /old_locus_tag="SSUBM407_0221"
     CDS             238566..239900
                     /locus_tag="SSUBM407_RS01245"
                     /old_locus_tag="SSUBM407_0221"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003099435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:alanine symporter family protein"
                     /protein_id="WP_011921831.1"
                     /translation="MLELFKAINNLVWGPPLLLLLVGTGVYFTLRLGVFQIGKLPTAF
                     RLIFSSDQSGQGDVSSFAALCTALAATVGTGNIVGVATAITTGGPGALFWMWVAAFFG
                     MATKYAEGFLAIKYRTKDANGQAAGGPMHYITLGMGQKWKPLAVFFAISGVLVALLGI
                     GTFSQVNSITASLETSFGLEPPLVSVITAISIAFVVFGGIEKISDVSTKIVPFMAILY
                     ILASITVLAVHWDQLLPTLALVFKSAFTPAAAVGGFAGATVQQAIQRGIARGVFSNES
                     GLGSAPIAAAAAKSDNPVEQGLISMTGTFIDTLIICTLTGFTILVTDQWSVEGLAGAP
                     LTQAAFATVFGNTGSIALTISLVLFAFTTILGWSYYGERCIEFLFGTKSILPYRLVFV
                     AMVALGGFLKLDLIWTIADIVNGLMALPNLIALLALSPVIIKETRQYFAKKK"
     gene            239965..240813
                     /locus_tag="SSUBM407_RS01250"
                     /old_locus_tag="SSUBM407_0222"
     CDS             239965..240813
                     /locus_tag="SSUBM407_RS01250"
                     /old_locus_tag="SSUBM407_0222"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel family protein"
                     /protein_id="WP_002937530.1"
                     /translation="MNDFITKYLSQFNIEAIVTAGLNKVLSLVLLFVAFYIIKKIAKA
                     SVKKVLVPSLKVSTQDIGRQKTISRLVESILNYLLYFILIYCILSILGLPVSSLLAGA
                     GIAGVAVGLGAQGFLSDLVNGFFILIERQFDVGDVVKLTNGPITISGTIVSMGIRTTQ
                     VRDADGTLHFIPNRNILVVSNQSRGDMRAQIDIPLKFNTDLEQVYRVIEEVNLREISN
                     FDQITGVTVLGPQNAISGQFVFRVNLFVANGQQNKIYHQFFGFYQDALRQAGIDLPSS
                     GPTVLK"
     gene            240824..241411
                     /locus_tag="SSUBM407_RS01255"
                     /old_locus_tag="SSUBM407_0223"
     CDS             240824..241411
                     /locus_tag="SSUBM407_RS01255"
                     /old_locus_tag="SSUBM407_0223"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4352 domain-containing protein"
                     /protein_id="WP_014635842.1"
                     /translation="MQTKDFVVENGQMYYKKKPLHKQPLFWTTIAGAVLSFILGVTCF
                     IFMIGLSSANFDNWDTGSDGYIDETVEYTEYQVGDSVDFSNGLHVTVTSMGKDDSIEL
                     VDSYYSTAYVVEMEVENSTAKELYFDEYYFSLMDPVSQIPFTLDLRTYDVNLVEKLKP
                     GEKVQVKLIYGIDNETNFGFTYEDAMWTELVAEGI"
     gene            complement(241647..242993)
                     /gene="gdhA"
                     /locus_tag="SSUBM407_RS01260"
                     /old_locus_tag="SSUBM407_0225"
     CDS             complement(241647..242993)
                     /gene="gdhA"
                     /locus_tag="SSUBM407_RS01260"
                     /old_locus_tag="SSUBM407_0225"
                     /EC_number="1.4.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006597171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-specific glutamate dehydrogenase"
                     /protein_id="WP_011921833.1"
                     /translation="MSNAKAYIQASFEAVKARNPHETEFLQAVEELFSTLEPVFEAHP
                     EYIEENILARIVEPERIISFRVPWTDKDGNVQVNRGYRVQFNSAVGPYKGGLRFHPTV
                     NQSILKFLGFEQIFKNVLTGLPIGGGKGGSDFDPKGKTDAEIMRFCQSFMTELQKHIG
                     PSLDVPAGDIGVGGREIGYMYGQYKRLRQFDAGVLTGKPLGFGGSLIRPEATGYGLVY
                     FTDNMLAANGKSFKDQTVLISGSGNVAQYAVQKATELGAKVISVSDSNGYIIDETGID
                     FDLLVDIKEKRRARLTEYAAEKSTAKYFKGSVWNYDGKADIALPCATQNEINGKQAAA
                     LVKNGVYCVAEGANMPSDLDAIKVYKENGVLYGLAKAANAGGVAVSALEMSQNSLRLS
                     WTREEVDGRLKDIMANIFNTAKETAEKYDLGTDYLAGANIAAFEQIADSMIAQGLV"
     gene            243215..244153
                     /locus_tag="SSUBM407_RS01265"
                     /old_locus_tag="SSUBM407_0226"
     CDS             243215..244153
                     /locus_tag="SSUBM407_RS01265"
                     /old_locus_tag="SSUBM407_0226"
                     /EC_number="1.3.98.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011999807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate oxidase"
                     /protein_id="WP_012774937.1"
                     /translation="MVSTVTTLGGFTFDNCLMNAAGVWCMTKEELDAVKNSKAGTFVT
                     KTATLDYRAGNPEPRYQNVPLGSINSMGLPNQGLAYYLDYLLELQETEPERTFVLSVV
                     GMSPDETHEILRTVEASDFKGLTELNLSCPNVPGKPQIAYDFETTETILQEVFTYFTK
                     PLGIKLPPYFDIVHFDQAAAIFNQFPLKFVNCVNSIGNGLYIKDESVVIKPKNGFGGI
                     GGEYIKPTALANVHAFYQRLKPEIQIVGTGGILTGRDAFEHILCGASMVQVGTTLQKE
                     GVAAFGRITAELQAIMAEKGYETIEDFRGKLQHLDD"
     gene            244486..245718
                     /locus_tag="SSUBM407_RS01270"
                     /old_locus_tag="SSUBM407_0227"
     CDS             244486..245718
                     /locus_tag="SSUBM407_RS01270"
                     /old_locus_tag="SSUBM407_0227"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CapA family protein"
                     /protein_id="WP_012775487.1"
                     /translation="MERRANYIRRKRYASYRTKMHLFFICGLATIILAIIIVSEHLVP
                     RLNQASESMHSDNSVRIMAHGDLLYHLPILRGAEQPDGSYDFSENFTYVKPWIEQADF
                     AIADFEGTISPDIELAGYPLFNAPAIVANNIHDAGYDLVDLAHNHILDSHLSGLISTV
                     NTFRDAGVDTVGVYVEGNRATAPLYIREVNGIRIAVLAYAYGFNGMEALLSQEEYDAY
                     LSDFDKEKMRAEIERAEKEADITIVMPQTGVEYQLEPTEEQTSLYHQMIDWGADIVLG
                     GHPHVVEPTEILEKDGQRKLIIYSMGNFLSNQRIESMEDTPNAQWTERGVLMDLTIQK
                     ENGQTSIQTAQAHPTWVNRLSKGTYSTDGYEQFSYQTYILEDWVAGGRYYGQLDLDTQ
                     ARVDTAYQEMKDFVNLVW"
     gene            245730..246557
                     /locus_tag="SSUBM407_RS01275"
                     /old_locus_tag="SSUBM407_0228"
     CDS             245730..246557
                     /locus_tag="SSUBM407_RS01275"
                     /old_locus_tag="SSUBM407_0228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_012774938.1"
                     /translation="MIVRLIATDMDGTFLDGQGNFDRERFSRVLDQLDQKKIPFVIAS
                     GNGIGRLLQLCQGFEDRLIFVADNGAHVYQNGKTVIRRAIQQVEVEAILHFFKGRWAD
                     VCLMLSNDGNIYMQAGAGMPFAGTDLPIELAQMAAFQNRVTYLDNLSAYPVSESIHKV
                     GLWVPEARVESITEAFNQGFHGQLVAVTSGYGSVDILPQGIHKAWGLEQVLTGLDIEP
                     EQVMAFGDSDNDIELLSYVGYSYAMENATDKVKAVAKYMAPSHLEAGVLQVIEEYIL"
     gene            complement(246606..247388)
                     /locus_tag="SSUBM407_RS01280"
                     /old_locus_tag="SSUBM407_0229"
     CDS             complement(246606..247388)
                     /locus_tag="SSUBM407_RS01280"
                     /old_locus_tag="SSUBM407_0229"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2 family transporter protein"
                     /protein_id="WP_012775488.1"
                     /translation="MKKYISLYLYNIKVYMMAQMSFRVDFFIGLFSSLIEQIVYLIFL
                     NILFGNIKEIAGFNYGQMLFIYGIATVGRSIHLIFFDNLWMFGSRYIRQGEFERLLLM
                     PMNPLFQLICERIQPQGIGTTLIGSLALVQASNELGMEWSLGKLALLIFIAICIGLLY
                     AAIQLGPTALAFWIVESFPLTMGIFALNQMAQYPLNIYPKIIQILLIFVFPYAFTAYF
                     PALYFLDLSMWGLALPLVVVVLFSINYNLFRYGMTKFTSVGN"
     gene            complement(247390..248169)
                     /locus_tag="SSUBM407_RS01285"
                     /old_locus_tag="SSUBM407_0230"
     CDS             complement(247390..248169)
                     /locus_tag="SSUBM407_RS01285"
                     /old_locus_tag="SSUBM407_0230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003072733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2 family transporter protein"
                     /protein_id="WP_012774940.1"
                     /translation="MRKYLYMTRLTMMNAMQYKAFFLATFVSLAVKILVALYVWKTIF
                     FTQSEVNGFTLQTFTTYIIFANLLASLNSFSLGEDLSYSILKGSIAGEFLRPYSFILA
                     LFFKDLGNKLLELIKFAIVFIGILLVHQDFYLPDGKTILLFLVSSILGMFIVQLLDMA
                     FGFLAFFTVNAWGVMLLRMGLFNLASGALLPLSFYPQAVENFLKLLPYNYAVNVPVSI
                     LLGQESDLTALGLQVIWIPILACFIAALWSQAKRRIVIFGG"
     gene            complement(248162..249145)
                     /locus_tag="SSUBM407_RS01290"
                     /old_locus_tag="SSUBM407_0231"
     CDS             complement(248162..249145)
                     /locus_tag="SSUBM407_RS01290"
                     /old_locus_tag="SSUBM407_0231"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002941065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_011922607.1"
                     /translation="MIQAEHLSKTYSIIDKEVGLKGSIKAFFKPKKKSIPAVQDISLQ
                     VGKGKIIGYIGSNGSGKSTTIKMLTGVLFPDQGQVRINGLNPQENRKAVNKQIGVLFG
                     QKSHLDWNLPVQESFILHAKIYDVPDKVFKERLAVLIELLDLADIMKQPIRNLSLGQR
                     VRCEFAAIFIHQPAVVFLDEPTIGLDASVKETIRSFIRYMNQEYQTTFLITSHDMKDI
                     ESLCERIFIIDKGKKVYDGSLTVLKERFSTVKTILFSTEKPIEKDLQLEGWEFIRKDD
                     FHFEIHYQSKVWTSAQVIEQVFNHYSIEDVTMKELEIETMVRQIYEEGIHA"
     gene            complement(249230..249763)
                     /locus_tag="SSUBM407_RS01295"
                     /old_locus_tag="SSUBM407_0232"
     CDS             complement(249230..249763)
                     /locus_tag="SSUBM407_RS01295"
                     /old_locus_tag="SSUBM407_0232"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002952253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_011922608.1"
                     /translation="MRTDSRKERTRQAILEAMVTCLESQGFNDITTTHLAQTAGISRS
                     SFYTHYKDKYELIDSYQQGLFHKLEAIFDHYDGNRQSSFLEIFELLYREKLLSALLTH
                     NGTQEIQNFLINKVRLLVANDLAERLGKENLSQLEKEYSSIYFSHAFFGIMQVWIKNG
                     KQESPQYMTDFLIKMLP"
     gene            249889..252348
                     /locus_tag="SSUBM407_RS01300"
                     /old_locus_tag="SSUBM407_0233"
     CDS             249889..252348
                     /locus_tag="SSUBM407_RS01300"
                     /old_locus_tag="SSUBM407_0233"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YhgE/Pip domain-containing protein"
                     /protein_id="WP_012774941.1"
                     /translation="MLQKVKNIFKKPMTLITILGIACVPALYNISFLTSMWDPYGRLD
                     QLPVAVVNQDQSASFQDKTLTIGDDMVDNMKESKSLDFHFVSEKNAEKGLEEGDYYMV
                     ITLPEDLSEKATSLLTNQPEPITISYQTSKGHSFVASKMGESAMEKLKTSVSETITKT
                     YTTAVFDSMREIQTGMIEAADGSQKLTNGASQLESGSQTLSNGLTTLTTSGQVLVTGA
                     NQLATGVVSYTDGVNQAATGSQTLSSGLTIYTNGVASLVSGAEQLNANSSQLITGVGQ
                     LQSGASQVEQLVTGANQLQAGLEQLANSTSLSAEQSSQIQALLTGLPQLQVAINQLND
                     SLSSIGGLAVDNSTLSSLLTEMGAQAQGLLTAAQADKTASIEALQTTATYQNLTADQQ
                     AELVGALQNSPSATATVAQTILDQLSQLSQTLSSLQSLSGMATQMNQLQSAVGQINTA
                     ANQALPGATTAIESLSSGLSQVNTALNQQVLPGTQTLTSGVSQLQTQLSSGASQLMFG
                     VTAYTAGVAQLAAGGAQLVANNSSIQSGGGQLTSGLATLASNSSQLVSGSEQLASGSQ
                     QLIAGADQLASGGQALTSGISSLRTGSETLTNSLSSASQQLSVVSVEDKNAQAVSQPV
                     TLEHSDQDDVKTNGVGMAPYMVSVALMVAALSANVIFVKHIDNRSYKNRWDWAKGKLL
                     LNGIIASLAAVILYGVLRLIGIEPAHPMATLGIILLASWTFMALVTALVGWNNRFGSF
                     ASLIILLLQLGSSAGTYPIELSPRFFQVIQPYLPMTYSVSSLRQTISMVGNSSHQVWM
                     LSLFLVGFMGLGLLIYNQKDE"
     gene            complement(252398..253456)
                     /locus_tag="SSUBM407_RS01305"
                     /old_locus_tag="SSUBM407_0234"
     CDS             complement(252398..253456)
                     /locus_tag="SSUBM407_RS01305"
                     /old_locus_tag="SSUBM407_0234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4097 family beta strand repeat protein"
                     /protein_id="WP_011921843.1"
                     /translation="MKKKLTIAIIIGFVSLIAGLILAGIGFFTGGITRLEEVAAPTEV
                     HKTFTDLNTIKIDFIPHSVYIKESSDNNYHVTYANSDNNIQNPLKLSEKDGVLTLSAQ
                     ELEFAIEGIMQYLGESLAQRRINVFSVTIEVPKGKTLDKLEGHNLHFYDFGGFTIENI
                     HIKEANLSGGVTLDKVTIDSGQIEAGYFQATQSTLKDMHINLQGSSVRLYETSLENVT
                     IEGYSQLDSRQTTLLGDNRFTPSDTYSSTTFLDVTDKSLADSNLLITNQIDKKKLVEA
                     QGYYYEDGNDLGEMVNQDPYLKERLGEVGIFTSDKYTKFPVKTENDLQTLTLENKGSK
                     NKLTIEATNATINLGTPK"
     gene            complement(253453..254208)
                     /locus_tag="SSUBM407_RS01310"
                     /old_locus_tag="SSUBM407_0235"
     CDS             complement(253453..254208)
                     /locus_tag="SSUBM407_RS01310"
                     /old_locus_tag="SSUBM407_0235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1700 domain-containing protein"
                     /protein_id="WP_012775489.1"
                     /translation="MTRTEYMEQLEKYLKKLPHKEYFEAISFFNEYFDEAGPERETEI
                     IEELGSPKEAASELINNMLNKQIQEEKDQQEPIQLNWKLWVGLGALSMTGLFSFFLLF
                     IMGEFIGVIPLFATLILGAFFLGRYFRNFSQTKRTLWLAILAVISLPIAIPLLLILLA
                     SLLGLVALILALIVGAFVLGVGLLTSGGYLIWEAFSLMSEGFNIFLMGFGSGLSLIGG
                     AILIYILTGFFAYWSWRLVKACFKWILKRGKRA"
     gene            complement(254195..254521)
                     /locus_tag="SSUBM407_RS01315"
                     /old_locus_tag="SSUBM407_0236"
     CDS             complement(254195..254521)
                     /locus_tag="SSUBM407_RS01315"
                     /old_locus_tag="SSUBM407_0236"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003026733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="WP_002937550.1"
                     /translation="MHFPVPAVLTEFLIMAILESDDSYGYEICQTIKLIANIKESALY
                     PILKRLEQNDFLTTYSQEYQGRMRKYYSLTQLGHEELVRLKDDWDTYTNTINGIIEGS
                     VRHDKN"
     gene            254830..255210
                     /locus_tag="SSUBM407_RS01320"
                     /old_locus_tag="SSUBM407_0237"
     CDS             254830..255210
                     /locus_tag="SSUBM407_RS01320"
                     /old_locus_tag="SSUBM407_0237"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CidA/LrgA family protein"
                     /protein_id="WP_011921846.1"
                     /translation="MKLYVQFMIILVFSFLGEAISTIFHLPIPGSIIGLILLFLALEF
                     KLIRLRHIHTVGNFLLANMTILFLPAAVGIMERFDAIKDYLLPIIVVILGAIFLNILV
                     IGFVVQFVKQKFEGDYIDAEGNHD"
     gene            255203..255898
                     /locus_tag="SSUBM407_RS01325"
                     /old_locus_tag="SSUBM407_0238"
     CDS             255203..255898
                     /locus_tag="SSUBM407_RS01325"
                     /old_locus_tag="SSUBM407_0238"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003076265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LrgB family protein"
                     /protein_id="WP_014636215.1"
                     /translation="MTELFSNPIFGIMLSIAAYLIGMLIYRRFPHPITTPLLVATGLI
                     IVFLKMTGISYKEYYAGGSYLNMLIVPSTVALGIPLYRSFHLMKHHIRSILLGIFVAC
                     IVNTVFTALIAKWFGMDFFLAISLFPKSVTTAMAVGITDKMQGIATVTLVVVVATGIL
                     TSVLGPVFLKLLKIEDPVAVGLALGGTGHAIGTGTAIKCGHTQGAMAGLAIGITGIMY
                     VVISPIVAQIILQ"
     gene            complement(255931..256731)
                     /locus_tag="SSUBM407_RS01330"
                     /old_locus_tag="SSUBM407_0239"
     CDS             complement(255931..256731)
                     /locus_tag="SSUBM407_RS01330"
                     /old_locus_tag="SSUBM407_0239"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate/nitrite transporter family protein"
                     /protein_id="WP_011922611.1"
                     /translation="MGANQETLMYTLEKSIKKKADLFEHSFSAYAVRSILASLYLGLG
                     IVISLYTADKLNHVAEGLGKFSYGLMFGWGLLMILYMNAELGTSNMMYMTVASHRKTI
                     PTKTALKMLATCILFNFVGAVLVCYLVSLTLPYQHVDAHSYLFEATVAKLSKTPLTQF
                     IEGIFANIVVNIGVFTFLRIKDDAGRLISVIFIIFIFAFLGYEHVIANFSLFSLAFFA
                     NGGPVEGMTLLSVLSNFLFSGLGNYVGGGLFIGLLYSWLNNQSKLYVD"
     gene            256872..257717
                     /locus_tag="SSUBM407_RS01335"
                     /old_locus_tag="SSUBM407_0240"
     CDS             256872..257717
                     /locus_tag="SSUBM407_RS01335"
                     /old_locus_tag="SSUBM407_0240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007892286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aquaporin family protein"
                     /protein_id="WP_002937554.1"
                     /translation="MDVTWTVKYITEFLATALLIIIGNGTVANVDLKGTKGNNSGWIL
                     IAIGYGLAVMMPALMFGNVSGNHINPAFTLGLAVSGLFPWAHVAQYIVAQLLGAMFGQ
                     LVVVAVYKPYFLKTENSNHILGSFSTISALDNGTKESRKAATTNGFLNEFVGSFVLFF
                     GALALTKHFFGSELVGKLIEQGYDKTVAETMTAPYTSGSIAVAHLGIGFLVMALVAAL
                     GGPTGPGLNPARDLGPRIVHALLPKSVLGENKADSKWWYAWVGVCAPIIASIAAVALF
                     KFLYL"
     gene            257846..259378
                     /locus_tag="SSUBM407_RS01340"
                     /old_locus_tag="SSUBM407_0241"
     CDS             257846..259378
                     /locus_tag="SSUBM407_RS01340"
                     /old_locus_tag="SSUBM407_0241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF853 family protein"
                     /protein_id="WP_012774942.1"
                     /translation="MSDVIAFGYGSSRAKMQLKRLNRHGIIAGATGTGKTVTLKVLAE
                     QLSDAGIPVFLSDIKGDLNSLVAANTKEIDPSRLEKTHYLDYSPVGYPVELWDVLGEN
                     GTPIRMTISELGPVLLTRLLGLNDTQESILNIVFSVADERGLLLIDLMDLRAMLNFVA
                     ENAAELSQYYGNIPARSVGAILRSLVVLEQQGGKIFFGEPSLDIADLMRTAEDGRGVI
                     NVLQATQLFNQPTLYSTVLLSLLSELYEVLPEVGDLDKPKMVFFFDEAHVLFKDAPKV
                     LLEKIELIVRLIRSKGVGVFFVTQNPTDIPDSVAAQLGNRIQHGLRAFTPKELKTVAT
                     VAETFRQEGDEDLAKVIQELQVGEAVVSTLQADGTPSFADRVLIYPPKSMLGTVEPSA
                     LLSVINNSPLMEKYADAVNRESAHEQILAMTEAKEAELIKKAEQAEAEKQAEKEAKAA
                     AKMEEKAQKEAAKTAQKTSQPASRKTDSMMDRFTKNLMSQVGREVGRVVTRGIMGMLK
                     GK"
     gene            259490..260098
                     /locus_tag="SSUBM407_RS01345"
                     /old_locus_tag="SSUBM407_0242"
     CDS             259490..260098
                     /locus_tag="SSUBM407_RS01345"
                     /old_locus_tag="SSUBM407_0242"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA pyrophosphatase"
                     /protein_id="WP_011921852.1"
                     /translation="MTDQLQALLKDYQPQPLGEKRSYAVFLPLVWSDNQWQVLYEIRS
                     ESISQPGEVSFPGGGVEVGETPQQAAVREVMEELNIQPEQIDILGEIDYLVLECSTVH
                     CFVGRLNLDWTTILPNEEVARIFTVPLSTLLTTQPVYYQLDSQIVPDCDFPFERLRGG
                     VDYPFSHHKRSVPFYENLSENIWGMTAQFTHRFTEIVKSNLS"
     gene            260388..262685
                     /locus_tag="SSUBM407_RS01350"
                     /old_locus_tag="SSUBM407_0244"
     CDS             260388..262685
                     /locus_tag="SSUBM407_RS01350"
                     /old_locus_tag="SSUBM407_0244"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPXTG cell wall anchor domain-containing
                     protein"
                     /protein_id="WP_012775427.1"
                     /translation="MSKQKVVSSLLLSTVVLGGLAFYSTTTVKAESLEPDVTSVNASD
                     ATNKPVVPNEEGGDFLAEEELEDDDTLEEELNEKAEEVTEPSSPEALLQPRAMMSDSE
                     TSGMEEIPMNDEPSDNTEEKVEKQQSPLIQTSNADYKSGKDQEKLRTSVSINLLKAEE
                     GQIQWKVTFDTSEWSFNVKHGGVYFILPNGLDLTKIVDNNQHDITASFPTDINDYRNS
                     GQEKYRFFSSKQGLDNENGFNSQWNWSAGQANPSETVNSWKSGNRLSKIYFINQITDT
                     TELTYTLTAKVTEPNQQSFPLLAVMKSFTYTNSKSTEVTSLGAREITLEKEKTLPPKE
                     NPKPEPEAPKPDAPQAPSAPESPTEEPKKEDAPQTPQAPSTPEKQPEVPESPNPETPD
                     APSTPKDEPQAPSIPEEKPQVPEEPKQEAPSAPSTPEKQPEAPESPTEEPKKEDAPAP
                     STPEKQPEVPESPNPETPDAPSTPKDEPQVPSIPEEQPKETPAPEEPKKEDTPQTPQA
                     PSTPKEEAPKEEVPTPPAPSVPEEQPKETPTPEVPKQEDVQPEAPKSDKVESDKQMPE
                     TKKPDMKQPKADDMPKEQKPKADEPKAEQPQMDKPQMEAPKKDSEAPKSDKVETDKQL
                     PETKQPDMKQPKADDMPKEQKPKADEPKAEQPQMDKPQMEAPKKDSEAPKSDKVETDK
                     PMPETKQPDMKQPKADKPEAEKAQMPRTEGMKPESKASMMPKAEAPKATLPNTGEASS
                     AIGWLGGALATLATGLYLFKNKKEE"
     gene            263120..263839
                     /locus_tag="SSUBM407_RS01355"
     CDS             263120..263839
                     /locus_tag="SSUBM407_RS01355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_011921854.1"
                     /translation="MSKQKVVTNLLLSTAVLGGFLICHAPSVSAETGNLQEIPTESAT
                     VSSENQTATAVDGISPTDNQLPTSEEGDKQAPEEKLVSSDSTREESATQVATDPDAPS
                     QSLSVSGAEISTADSNIQQAEEKLIQESNYYRFDTHQGEQIRKAVSIEKISADNDEIK
                     WKVTFDRKNWTFSGEGSGYYFILPKGLQLTKIIDSQSEEDIFNKFPKDVNSEANSGGQ
                     PYRFFSREKNANNDERSFESQ"
     gene            263984..264880
                     /locus_tag="SSUBM407_RS01360"
     CDS             263984..264880
                     /locus_tag="SSUBM407_RS01360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPXTG cell wall anchor domain-containing
                     protein"
                     /protein_id="WP_043032413.1"
                     /translation="MQTFPVLAVVKNFKERIFFSRDEITSAAGLRLKVSESAKPNNEG
                     ITIIGDSSPESDRTPEPRGDRTPDIDVPKAEVPKVEQPKPKAPEVQLPAPKAPESVPP
                     KVMSPAPKVPDVKTPKEAPLPPKTPGVEVPKVIPPTPKAPEVEVPKVTPPTSKVPEVE
                     TPKVEQPKPKVPEVHLPAPKSPEVEVPKVTPPTSKIPDVKTPKSPEVAHPEVEKPAGI
                     QPEKGQPEVNKPNIIHSEVLQSEVKKTESGVSMAPKVGIQKETLPNTGETSNTLVWLG
                     GALATLASSLYLFKQHRQREEE"
     gene            complement(265351..265500)
                     /gene="rpmG"
                     /locus_tag="SSUBM407_RS01365"
                     /old_locus_tag="SSUBM407_0248"
     CDS             complement(265351..265500)
                     /gene="rpmG"
                     /locus_tag="SSUBM407_RS01365"
                     /old_locus_tag="SSUBM407_0248"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001265622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_002262412.1"
                     /translation="MRVNITLEHKESGERLYLTSKNKRNTPDRLQLKKYSPKLRKHVI
                     FTEVK"
     gene            complement(265516..265698)
                     /gene="rpmF"
                     /locus_tag="SSUBM407_RS01370"
                     /old_locus_tag="SSUBM407_0249"
     CDS             complement(265516..265698)
                     /gene="rpmF"
                     /locus_tag="SSUBM407_RS01370"
                     /old_locus_tag="SSUBM407_0249"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018380522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L32"
                     /protein_id="WP_002937589.1"
                     /translation="MAVPARRTSKAKKNKRRTHYKVAAPTVKFDETTGDYSRSHRVSL
                     KGYYKGRKIAKAASAE"
     gene            265974..267257
                     /locus_tag="SSUBM407_RS01375"
                     /old_locus_tag="SSUBM407_0250"
     CDS             265974..267257
                     /locus_tag="SSUBM407_RS01375"
                     /old_locus_tag="SSUBM407_0250"
                     /EC_number="6.1.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine--tRNA ligase"
                     /protein_id="WP_011921857.1"
                     /translation="MKLQKPKGTQDLLPQDSAKWQYVENFTRSIFKQYNYAEIRTPIF
                     EHYEVISRSVGDTTDIVTKEMYDFYDKGERHITLRPEGTAPVVRSYVENKLFAPEVQK
                     PAKFYYMGPMFRYERPQAGRLRQFHQIGVECFGSNNPATDVETIAMAYHFFEELGIKD
                     IRLHLNSLGNPESRAAYRQALIDYLTPLKEQLSKDSQRRLEENPLRVLDSKEKEDKVA
                     VENAPSILDYLDEESTVHFEAVRSMLDNLGITYTIDTNMVRGLDYYNHTIFEFMTEVG
                     GNDLTICAGGRYDGLVTYFGGPETPAFGFGMGIERLILVLEKQGIELPLDTQLDVYIA
                     VLGQEANGGALDLVQAIRKQGFRAERDYLDRKLKAQFKSADVFGAKAIITLGGSEIES
                     GQVVVKNNQTRSQVETSLEALKTDFASILEELEKQ"
     gene            complement(267338..268363)
                     /gene="adhP"
                     /locus_tag="SSUBM407_RS01380"
                     /old_locus_tag="SSUBM407_0251"
     CDS             complement(267338..268363)
                     /gene="adhP"
                     /locus_tag="SSUBM407_RS01380"
                     /old_locus_tag="SSUBM407_0251"
                     /EC_number="1.1.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase AdhP"
                     /protein_id="WP_011921858.1"
                     /translation="MKAVVVNPESTGVVVVEKELRPLEAGEALVQIEYCGVCHTDLHV
                     ANGDFGKVPGRVLGHEGIGIVTEIAPGVTSLKVGDRVSVAWFFQGCGMCEYCTTGRET
                     LCRTVKNAGYSVDGGMAEQCIVTADYAVKVPEGLDPAQASSITCAGVTCYKAIKEAHL
                     EPGQWIAIYGAGGLGNLAVQYAKKVFNAHVIAVDINNDKLELAKEVGADVTINGLEVE
                     DVPGYIKEITGGGVHSTVVTAVSKVAFNQAIDSVRAGGYVVAVGLPSEYMDLSIVKTV
                     LDGIKVVGSLVGTRKDLEEAFHFGAMGLVVPVVQKRPVEDAEAVFNEMVAGTIQGRMV
                     LDFCHSH"
     gene            268816..271467
                     /gene="adhE"
                     /locus_tag="SSUBM407_RS01385"
                     /old_locus_tag="SSUBM407_0252"
                     /gene_synonym="adhC"
     CDS             268816..271467
                     /gene="adhE"
                     /locus_tag="SSUBM407_RS01385"
                     /old_locus_tag="SSUBM407_0252"
                     /gene_synonym="adhC"
                     /EC_number="1.1.1.1"
                     /EC_number="1.2.1.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000763984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional acetaldehyde-CoA/alcohol
                     dehydrogenase"
                     /protein_id="WP_011922616.1"
                     /translation="MADKKVVSPEEKLVEARKHVDELVQKGLVALDEFRKLGQEEVDY
                     IVAKASVAALDKHGELAMHAFEETKRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEE
                     DDVTGLTLIAEPVGVVCGITPTTNPTSTAIFKSLIALKTRNPIVFAFHPSAQESSAHA
                     ARVVYEAAVAAGAPENCIQWVTKPSMEATSELMKHDGIATILATGGNAMVRAAYSCGK
                     PALGVGAGNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVAE
                     FKSYKTYFVNKKEKALLEEYCFGVKANSKNCAEGKLNADIVGRPAAWIAEQAGFSVPE
                     GTNILAAEVAEIGEKEPLTREKLSPVIAVLKVEGRAEGLEAARQMVEFHGLGHSAAIH
                     TEDAELAKEFGTIVRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNSISDNVS
                     AMNLLNIKKVGRRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDRAMVELGF
                     LDRIIEQLDLRRNKVVYQIFSDVEPDPDITTVYKGTELMRTFKPDTIIALGGGSPMDA
                     AKVMWLFYEQPTVDFHDLVQKFMDIRKRAFKFPELGKKSKFIAIPTTSGTGSEVTPFA
                     VISDKANNRKYPIADYSLTPTVAIVDPALVLTVPAHVTADTGMDVLTHATEAYVSTVA
                     NDFTDGLALQAIKLVFENLESSVKNADFVSREKMHNASTMAGMAFANAFLGISHSMAH
                     KIGGRFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYKADEKYQDIARLLGLPC
                     STPEEAVAAYAQAVYDLGERIGIQMNLKAQGIDEKELKEHSRELALLAYEDQCTPANP
                     RLAMVDHMQEIIEDAYYGYKERPGRIK"
     gene            271881..273365
                     /locus_tag="SSUBM407_RS01390"
                     /old_locus_tag="SSUBM407_0253"
     CDS             271881..273365
                     /locus_tag="SSUBM407_RS01390"
                     /old_locus_tag="SSUBM407_0253"
                     /EC_number="4.2.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006595200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="WP_012774945.1"
                     /translation="MTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPLSIPTVDLDF
                     SVLKDASYQDVAKLILSAFLDDFTADELDYCINNAYDSKFDTSVIAPVVKLKGQYNLE
                     LFRGSTIAFKDMALSILPYLMATATKKHGLENEIVILTATSGDTGKAAMAGFADVPGT
                     QIIVFYPRDGVSKVQELQMTTQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAA
                     KKLQFSSANSMNIGRLVPQIVYYVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILAAY
                     YAKQIGLPVGKLICASNDNNVLTDFFATGVYDKNRTFRVTTSPSMDILVSSNLERLIF
                     HLFGNDAAKTAELMEALNTAGQYDIQGADAEILSLFAAAFATEEETAAEIKRVYDESD
                     YIEDPHTAVASAVYKQYVEQTGDQTPTVIASTASPYKFPVVAVEAVTGQSGLSDFEAL
                     AKLHEISGVDLPPAVDGLETAPVRHNTVVAAADMQTEVERYLGV"
     gene            273494..275259
                     /locus_tag="SSUBM407_RS01395"
                     /old_locus_tag="SSUBM407_0254"
                     /pseudo
     CDS             273494..275259
                     /locus_tag="SSUBM407_RS01395"
                     /old_locus_tag="SSUBM407_0254"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002941225.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein/permease"
     gene            275252..276913
                     /locus_tag="SSUBM407_RS01400"
                     /old_locus_tag="SSUBM407_0255"
     CDS             275252..276913
                     /locus_tag="SSUBM407_RS01400"
                     /old_locus_tag="SSUBM407_0255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012678476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012775490.1"
                     /translation="MDKKEMPTRVLIPRLLQSMKHLLPRIAVAVCFAVLGQVVTIAIP
                     VMLVYLAFNALTGNPAPLWTLGILILLALLRGAFRYGEHYFGHYVAFHTLAAYRRLIF
                     AKLRALAPGKLDRQDSGSLLKMIGEDIEALEVFFAHTIAPICTGILVALGLTVYFGLS
                     SWGLAFLALVTYALLAIAIPNQFAQQLQPLLKEQNASRKGYVSYFIESLKSMKDLMQF
                     QQTDARFANLTQKSQEVNGQERRVAQTNFMQYAVSFLVVGLSIMGFAWLTFDLVGSQS
                     LDLATGVALLVSFISSFAPFLELSRLPLGFKRAMNAGRNIYALLDEKEAERTGELVEV
                     SVTDIAIEQLDFDYDVRETGLYRNLSVQFEQGGIIGLVGESGAGKSTLMKLIMRWYDW
                     QQGQIRLSGLDSRQVDKAHLQGAFAYVPQVPQIFRQTIRENLVLGRTDISDETIMDLA
                     EKCHMKERILAAPQGLDRLVEASDFSAGEGQRLELMRALLKNADCYIFDEPTSNLDSL
                     NEARFIQLVKEHCQGMVFLISHRSSTMACADTIFRLEDGQLVKEK"
     gene            276914..277507
                     /locus_tag="SSUBM407_RS01405"
                     /old_locus_tag="SSUBM407_0256"
     CDS             276914..277507
                     /locus_tag="SSUBM407_RS01405"
                     /old_locus_tag="SSUBM407_0256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014635664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MptD family putative ECF transporter S
                     component"
                     /protein_id="WP_011921864.1"
                     /translation="MKKLQVKDLMVTGAFAALYFVCVGLGTLLSLVFDRSGNMMYAPA
                     GAALLAGPVYMLLVAKVGKFGSISLVGAVMACFFFLSGYMTAAFLPSLTFGFLAEMVA
                     KSGHYKQKWTNLFSYIIFSFGNLGPIILMWFMRDAYEANLLARGKSAEYIARVMLDFT
                     PENVLWLSTTIILTALISGLFGQYMLQRYFKQSGYLS"
     gene            277504..278163
                     /locus_tag="SSUBM407_RS01410"
                     /old_locus_tag="SSUBM407_0257"
     CDS             277504..278163
                     /locus_tag="SSUBM407_RS01410"
                     /old_locus_tag="SSUBM407_0257"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy-coupling factor transporter transmembrane
                     protein EcfT"
                     /protein_id="WP_011922621.1"
                     /translation="MKLDARTKIILVIFTSFTYGMRLTILENAVLVLGLSLLFWFSGK
                     RKMAIMSPIAYSIFCLLSYITFLPAWLTHLLLVLTYTWPPLLAGHLLLMTTSGYELIH
                     GLRKWHLPEVFLLTLGVMFRFLPAIKQDARTICASLKVRGIFLRKRDVVCKPLQYMEF
                     FLVPLMMSLLRTAQELTVASLTKGLAVSTKSPAYIWSSWTVLDWSLCLCCLGFLILVR
                     L"
     gene            278127..279554
                     /locus_tag="SSUBM407_RS01415"
                     /old_locus_tag="SSUBM407_0258"
     CDS             278127..279554
                     /locus_tag="SSUBM407_RS01415"
                     /old_locus_tag="SSUBM407_0258"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002941239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012774948.1"
                     /translation="MLSRFSDSRPAVTVKNVALTYSGADKPALQIEDLTIPEGQCVVL
                     CGQSGSGKSSFLKVLNGLTPEYYPAQLSGQIFLGDLDLQKSSLEEISRHIASVFQHPS
                     TQFFHSQVLQELVFPCENQGLSREEIENRLAWVMELFGLASLSQRTISSLSGGQQQRL
                     ALAVATMQGTDVLVLDEPTANLDQEGIVIVEDILKTLKSQGKTIIIAEHRLSYLSQLA
                     DRYLYFQDGQVVTDYLADEFLSRTEECRQDMGLRCYDSEPYGRAIAELADQFVNDKEG
                     LLVENLSVSQKENTLYEIEKLCLAPGQVVGLVGANGSGKTSLARYLVGLAEDKKSRIS
                     WQGQTLSSRQRLEKTAFVMQDVRLQLFAESVERELTLGRKNRAVDEHLVARFGLSDLL
                     ERHPVSLSGGEQQRVMIVASLLADKEIFIFDEPTSGLDLRRMQQVASALVDLKMKNKL
                     VLLISHDEELLNLVCDKIVDIKQLK"
     gene            279560..280837
                     /locus_tag="SSUBM407_RS01420"
                     /old_locus_tag="SSUBM407_0259"
     CDS             279560..280837
                     /locus_tag="SSUBM407_RS01420"
                     /old_locus_tag="SSUBM407_0259"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002938993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family efflux transporter"
                     /protein_id="WP_012775491.1"
                     /translation="MNKQTYKEILTIAFPAMGENLLQMLMGVVDSYLVASIGIVALSG
                     VSLANNILAVYQAVFIALAVAVSSRLAQALGEGGSEGIGGTASESVKFTVFIGLLLGI
                     FSVLAGPIVLTSLGAESEVVQAGGLYLILVGGGAPFLGLMTSLSAILRTLGEPRFPMY
                     ISLLSNVLNALFSAFAVFVLHAGVAGVAIGTVLSRLIGCSLLWSRLPISLKPWTWSFD
                     KELLRLALPATGERLMMRVGDVVVVALITSLGTATVAGNAIGETLTQFNYMPALGIAT
                     ATIILTAKHRQDKAMVRHIFRTSFGISLLFMFLVAGVTYFAGSFLIDLYTKDIQAAQA
                     SQTVLFYAMLGVPFTAGTLIMTALWQGLGNARLPFYATTIGMWLVRIGIAYLLVTFFK
                     IGLSAIWIATILDNAFRSGVLFFQYRYSKQESI"
     gene            281192..282127
                     /gene="mvk"
                     /locus_tag="SSUBM407_RS01425"
                     /old_locus_tag="SSUBM407_0260"
     CDS             281192..282127
                     /gene="mvk"
                     /locus_tag="SSUBM407_RS01425"
                     /old_locus_tag="SSUBM407_0260"
                     /EC_number="2.7.1.36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mevalonate kinase"
                     /protein_id="WP_012774950.1"
                     /translation="MSVVGKANGKIILMGEHAVVYGHPAIAMPFSAVEIIAQVTAQGE
                     ALTVACDFYKGLVHKMPKIWESLKHAIRFSLYRIGAPTDPAIHIEISSTIPAERGMGS
                     SAAVAVAVARALFAYYEKELTDSELWDIVQSSEKIAHGNPSGIDAATTSGKSPVFFIK
                     HQPIEPFELKLHAHLVVADTGVTGNTLEAISDVADLLEKKPEAIKLVEELGNLTRQAK
                     EDLATDQAELLGSRMNQAHALLQKLGVSDPSLDKLVSLAQENGALGAKLTGGGRGGCM
                     IALARTAQDAQKLAHILDQAGARQTWIQYLGETND"
     gene            282120..283145
                     /gene="mvaD"
                     /locus_tag="SSUBM407_RS01430"
                     /old_locus_tag="SSUBM407_0261"
     CDS             282120..283145
                     /gene="mvaD"
                     /locus_tag="SSUBM407_RS01430"
                     /old_locus_tag="SSUBM407_0261"
                     /EC_number="4.1.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diphosphomevalonate decarboxylase"
                     /protein_id="WP_011921869.1"
                     /translation="MTKQIGIARAHTNIALIKYWGKRDKELFLPMNSSLSLTLDAFYT
                     DTKVVFDPELTADEFYLNGILQKEKEILKISRFLDLFCEYIGERAFARVESLNFVPTA
                     AGLASSASAFAALALATATALDLDLSPATLSTLARRGSGSSTRSLFGGFVEWGMGTGS
                     EDSMAHPIDDADWDIGMVVLAVNTGPKKIASREGMDHTVATSPFYTAWVETAKQDLVD
                     IKAAIASRDFEKLGQITEHNGMKMHATTLSANPPFTYWSADSLVAQEAVRQVREATGL
                     SAYMTMDAGPNVKVLCRASQMDELVAGLAKVFPREKIITSKPGPAAYVLSEKDWQASQ
                     TAFEKGI"
     gene            283147..284226
                     /locus_tag="SSUBM407_RS01435"
                     /old_locus_tag="SSUBM407_0262"
     CDS             283147..284226
                     /locus_tag="SSUBM407_RS01435"
                     /old_locus_tag="SSUBM407_0262"
                     /EC_number="2.7.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomevalonate kinase"
                     /protein_id="WP_012774951.1"
                     /translation="MKVQVKIPGKLFLAGEYAVVEAGYPAVIAAVGQYLTVTIETSDQ
                     GSLHSSQKADLYLTWERKEGAVRIQGSHPYALIESAMQVTEAYLTAKGYACHGTYSLS
                     VQSDLDDQASGAKYGLGSSGAVTVATVKALLTYYGHQADALLTYKLAALTQSKLGMTG
                     SFGDLAASSFGGLIAYHSLDRSWLLGKMAELSLLDVVESDWQSLSISPIQLPQGLDLL
                     VGWTGSAASTDSLVSQMESQKSQTEKEQIHSQFLADSKTCVEQLIVACQTNDSVSARQ
                     ALSANRKLLQDFARGMGLVIETPQLSQLCDLAQTYGAVAKSSGAGGGDCGICLVDSKE
                     QKAAIETAWQEAGIFPLTLNIASRE"
     gene            284237..285334
                     /locus_tag="SSUBM407_RS01440"
                     /old_locus_tag="SSUBM407_0263"
     CDS             284237..285334
                     /locus_tag="SSUBM407_RS01440"
                     /old_locus_tag="SSUBM407_0263"
                     /EC_number="5.3.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 2 isopentenyl-diphosphate Delta-isomerase"
                     /protein_id="WP_011921871.1"
                     /translation="MFYLGEFGLDRKDQHVGLANQQYSATPAKDFTETLFVHHSLPQT
                     KVDEVDISTSVAGLDFAFPFFINAMTGGSKKTREINRLLGIMGHFGKIALASGSVSAA
                     IKDPSVAETFSVMRRENPYGIIFANLGAHHSVENAKRAVDLLEANAIQIHVNAPQEIV
                     MPEGDRDFTMWLKNIETLVREMEVPVIVKEVGFGMSRETVAQLASAGVQTIDVSGTGG
                     TDFAKIENARRTFNDYAYLEGWGQSTVTSLVEAMSVSEEVCPSLIASGGIKTPLDIVK
                     SLALGADLVGMSNHFLQYVKDGKGHRFDDGLQAIKVYQWQIAEIMTMLGAKNIAELRQ
                     KDLVLAPNVQNWCEARGIDWKAYARRSANVS"
     gene            complement(285429..287177)
                     /locus_tag="SSUBM407_RS01445"
                     /old_locus_tag="SSUBM407_0264"
     CDS             complement(285429..287177)
                     /locus_tag="SSUBM407_RS01445"
                     /old_locus_tag="SSUBM407_0264"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012774952.1"
                     /translation="MLSKTKQASVFLRLLSYLKAYRLLTVLALSFLLLTTVVRSLIPL
                     LASYFIDHYISTISETAVAILAAYFALYLLQMVLQYFGNLWFAKVSYSIVRDIRRDAF
                     GRMEKLGMAYFDQTPSGSIVSRITNDTESISEMFSGILSSFISALFIIVTTLSTMFAL
                     DWKLTSLIVLFLPVIFILVDQYRKRSAPIVAKTRSLLSAINSKLAESIEGIWIIQAFS
                     QEERLKEEFEAINQEHLDYASRSMALDSLFLRPALSLVKILAYALLMTYFGLDWSQAG
                     ISAGLIYAFIQYVNRLFDPLLDVTQHFSTLQTSMVSAGRVFTLMDQTIEEPLQLDRGA
                     KIDKGHIVFEDVYFSYDGKRQILDKVSFEVRQGQTIAFVGATGSGKSSIINVFMRFYE
                     FQSGRILIDGQDIRSFSQEELRSAIGLVLQDPFLFHGTIASNIQMYQDISQEEIEEAA
                     RFVDAAPFIEKLPEKYDHLVTERGSAFSTGQRQLLAFARTMASQPKILILDEATANID
                     SETEKTVQTSLEKMRKGRTTIAIAHRLSTIQDADCIYVLDKGKIIESGNHEELLALKG
                     HYHRMYQLQAGQLTAT"
     gene            complement(287167..288909)
                     /locus_tag="SSUBM407_RS01450"
                     /old_locus_tag="SSUBM407_0265"
     CDS             complement(287167..288909)
                     /locus_tag="SSUBM407_RS01450"
                     /old_locus_tag="SSUBM407_0265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000022464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_012774953.1"
                     /translation="MKIIKQLWWFFSLEKKAYLIGILSLCLVSLLNLLPASIMGQLID
                     QIASGQLTEHRLLLGVAGLILSALAMYGLRYLWRMNILATSYRLGKIMRARLFDHFMH
                     LSPSFFQQHRTGDLMAHATNDINALTRLAGGGVMSFVDATVTALVTLITMSLSISWQM
                     TLVAILPLPFMTLTTNFLGRRTHENFKASQAAFSELNNKVQEAVSGIKVTKSFGYQEQ
                     ETAAFQEVNQAAFLQNIKTMRYDALFNPAVLFFIGLSYLLTLLVGSHFISQGQVSLGQ
                     LVTFMTYLDLLVWPLMAIGFLVNISQRGDVSYNRIQTLLSISSEVIETDQPLPAPSNG
                     ELVYEISEFAYDNIPVLQDIQFQIKKGQTIGLVGLTGSGKTSLLKLLMREYDVINGQI
                     LLNQENIKNYKLADLRRLIGYVPQDQFLFATSITENIRFGNPDLSLNQVEEAARAVHV
                     YEDIQDMPDRFETMVGEKGISLSGGQKQRLAMARAMILNPDILLLDDSLSAVDAKTEH
                     AILETIKQERLDKTTIITAHRLSAIVHADLILVLEDGKIVERGRHQELLDEKGWYYDT
                     YMMQQLEKEESDAL"
     gene            289166..289432
                     /locus_tag="SSUBM407_RS01455"
                     /old_locus_tag="SSUBM407_0266"
     CDS             289166..289432
                     /locus_tag="SSUBM407_RS01455"
                     /old_locus_tag="SSUBM407_0266"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003017242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ACT domain-containing protein"
                     /protein_id="WP_011921874.1"
                     /translation="MKAIVTVVGKDKSGIVAGVATKIAELGLNIDDISQTVLDEYFTM
                     MAVVSSDEKKDFTKLRAELEAYGQALNVKINIQSAAIFDAMHNL"
     gene            289444..290781
                     /locus_tag="SSUBM407_RS01460"
                     /old_locus_tag="SSUBM407_0267"
     CDS             289444..290781
                     /locus_tag="SSUBM407_RS01460"
                     /old_locus_tag="SSUBM407_0267"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018166727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PFL family protein"
                     /protein_id="WP_011921875.1"
                     /translation="MDIRQVRETIEMIEEQNFDIRTITMGISLLDCIDSDIDKAAEKV
                     YTKIVTKAKNLVAVGDEIAAELGIPIVNKRVSVTPIALIGAATDATDYLPLAHALDKA
                     AHEIGIDFIGGFSALAQKGYQKGDEILINSIPQALAQTSKVCSSVNIGSTKTGINMTA
                     VRDMGRIIKETAEASDMGAAKLVVFANAVEDNPFMAGAFHGVGEADVVINVGVSGPGV
                     VKRALEKVRGESFDVVAETVKKTAFKITRIGQLVGNMASERLGVKFGIVDLSLAPTPA
                     VGDSVARVLEEMGLETVGTHGTTAALALLNDAVKKGGVMACNQVGGLSGAFIPVSEDE
                     GMIAAVQNGSLNLEKLEAMTAICSVGLDMIAIPETTPAETIAAMIADEAAIGVINQKT
                     TAVRIIPLGKEGDMIEFGGLLGTAPVMKVNQASSVDFINRGGQIPAPIHSFKN"
     gene            290857..291552
                     /locus_tag="SSUBM407_RS01465"
                     /old_locus_tag="SSUBM407_0268"
     CDS             290857..291552
                     /locus_tag="SSUBM407_RS01465"
                     /old_locus_tag="SSUBM407_0268"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine phosphatase family protein"
                     /protein_id="WP_011921876.1"
                     /translation="MADVRLYISRHGKTMFNTIGRVQGWCDTPLTKVGEEGIRELGLG
                     LKDAGLDFKLAVSSDLGRTVQTMTIAQRELGILGKIPYYQDKRIREWCFGSFEGMYDA
                     ELFQGVLPRLKGTVDATGMSFAEIAAGIQEADTAGWAESWEVLSNRILTGFESIAQDL
                     EKQGGGNALVVSHGMTIATLAHLLEPERGANVFLDNGSITVLKYENGKLLIEAVGDLS
                     YRKRGAELIAQGK"
     repeat_region   complement(291739..291830)
                     /note="Imperfect repeat RepSU1"
                     /rpt_family="RepSU1"
     gene            291871..292905
                     /gene="hrcA"
                     /locus_tag="SSUBM407_RS01470"
                     /old_locus_tag="SSUBM407_0269"
     CDS             291871..292905
                     /gene="hrcA"
                     /locus_tag="SSUBM407_RS01470"
                     /old_locus_tag="SSUBM407_0269"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003052532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat-inducible transcriptional repressor HrcA"
                     /protein_id="WP_012774954.1"
                     /translation="MITQRQNDILNLIVELFTRHHEPVGSKALQEMIASSSATIRNDM
                     AKLEQLGLLEKAHTSSGRMPSRAGFQYFVNHSLNLKHINEEDVYQVVKAFDFEAFKLE
                     DILERASQVLADLTGYTSVILDVEPTSQQLTSFDIVQLSSHDALAVLTLDQSKPVTVQ
                     FAIPKNFLTRDLEVLKRLVDERFVGQTVLAIHYKLRTEIPQVVQRYFATTDNVLDLMD
                     YIFSNLFQESVFISGKVASLTYGNLATYQLLDSPQLLAPELRQGLAPNQQTSISVAEH
                     REPALADVTVIHHRFPIPYRGMGQMSLLGPVDMDYRRQMSLINIISRILFMKLTDYYR
                     YLSSNHYEVN"
     gene            292918..293430
                     /gene="grpE"
                     /locus_tag="SSUBM407_RS01475"
                     /old_locus_tag="SSUBM407_0270"
     CDS             292918..293430
                     /gene="grpE"
                     /locus_tag="SSUBM407_RS01475"
                     /old_locus_tag="SSUBM407_0270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide exchange factor GrpE"
                     /protein_id="WP_002943082.1"
                     /translation="MSEEIKNEEIVEEVEATEEVVETPEKSELDLANERAEEFENKYL
                     RAHAEMQNIQRRANEERQTIQRYRSQDLAKKILPSLDNLERALQVEGLTEDVKKGLEM
                     VQESLIQALKEEGVEEVATDVFDPNLHMAIQTVPATDDCPAEHIAQVFQKGYKLHERL
                     LRPAMVVVSE"
     gene            293527..295356
                     /gene="dnaK"
                     /locus_tag="SSUBM407_RS01480"
                     /old_locus_tag="SSUBM407_0271"
     CDS             293527..295356
                     /gene="dnaK"
                     /locus_tag="SSUBM407_RS01480"
                     /old_locus_tag="SSUBM407_0271"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002946936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaK"
                     /protein_id="WP_012775492.1"
                     /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKN
                     GEIIVGDAAKRQAVTNPDTIISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAE
                     EYLGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKTDK
                     DEKILVFDLGGGTFDVSILELGDGVFDVLATAGDNKLGGDDFDQKIIDHMVAEFKKEN
                     GIDLSADKMALQRLKDAAEKAKKDLSGVTSTQISLPFITAGAAGPLHLEMTLTRAKFD
                     ELTYDLVERTKIPVRQALSDAGLSLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPN
                     KSVNPDEVVAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPT
                     SKSQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDI
                     DKNGIVSVKAKDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRKEEVDLR
                     NDVDQAIFATEKTLKETEGKGFDAERDQAQAALDELKAAQEANNLDDMKAKLENLNEK
                     AQALAVKLYEQAAAAQQAAAGQEGAQTANNADDDVVDGEFTEK"
     gene            295788..296924
                     /gene="dnaJ"
                     /locus_tag="SSUBM407_RS01485"
                     /old_locus_tag="SSUBM407_0272"
     CDS             295788..296924
                     /gene="dnaJ"
                     /locus_tag="SSUBM407_RS01485"
                     /old_locus_tag="SSUBM407_0272"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002905343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_012775428.1"
                     /translation="MNNTEFYDRLGVSKNASPDEIKKAYRKLSKKYHPDINKDPGAED
                     KYKEVQEAYETLSDPQKRSAYDQYGPAGANGGFGGGAGGFGGFDGAGFGGFEDIFSSF
                     FGGGGATRNPNAPRQGDDLQYAVNLKFEEAIFGVEREVSYNREATCRTCTGSGAKPGT
                     SPVTCGRCHGSGVINVDTQTPLGTMRRQMTCDVCHGRGKQIKDPCTTCHGTGHEKQAH
                     TVTVKVPAGVETGQRIRLAGQGEAGFNGGPYGDLYVVIQVQPSDKFEREGTTIHYKLN
                     LNFVQAALGDTVHVPTVHGDVDMVIPEGTQTGKTFRLKGKGAPSVRGGAIGDQYVTVN
                     IVTPTGLNDRQKAALKEFAAAGNIDVKPHKKGFFDKVKDAFEDL"
     gene            297200..298027
                     /locus_tag="SSUBM407_RS01490"
                     /old_locus_tag="SSUBM407_0273"
     CDS             297200..298027
                     /locus_tag="SSUBM407_RS01490"
                     /old_locus_tag="SSUBM407_0273"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoate--protein ligase family protein"
                     /protein_id="WP_011921881.1"
                     /translation="MKSWVENVTIKKYEDRSGLTGLKQEPLVWTEVFLREVNRQSNTG
                     ILHFWPMDQTVILGMMDSQVAQLDKGLASIGQAGYSPIIRSLGGLAVVADEGILNVTL
                     ILSNPSGHKVDLRESYQVMVDLIAQALSDFPFEVVSGEVATSYCPGTYDLSIKGRKFA
                     GLAQRIYQEAIAISAYISVSGNQVKRGQVVADFYVASFAPQEVSDRFPQVNPDSMANL
                     SDLVGQDVTVEDMKKRIEQVLVENGTRLSTFYPSSDNMADFMTFGKTIKQSMEKYGI"
     gene            298037..299485
                     /locus_tag="SSUBM407_RS01495"
                     /old_locus_tag="SSUBM407_0274"
     CDS             298037..299485
                     /locus_tag="SSUBM407_RS01495"
                     /old_locus_tag="SSUBM407_0274"
                     /EC_number="3.5.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_011921882.1"
                     /translation="MIWKDATAMAQAVNQKQVFAKELVQETIDRIEKLNPTLNAVVSK
                     QYEEALKEAEKEDYLGKPFAGVPFLLKDLGQNEKGQPSSAGSRLLAGRPAGHTDTYVQ
                     RLKDLGFIIVGRTNTPEFGFKNISDASLHGPVNLPLDPSRNAGGSSGGAAAALASGMV
                     SIAAASDGGGSIRIPASFNGLIGLKTSRGRIPVGPKSYRGWQGASVNFALTKSVRDTQ
                     RLLYHFQDYQLEAPFPLAKLSEEEVFGKLSRPLKIAYYTKSPVGSKVSLEAVEAVQKA
                     CHHLANLGHEVVELTEYPLDGVALMKSFYLMNSVDTAQMFDEIEAAFGRQMTLDDMEV
                     MSWAIYQSGQTIPAKLYSKALLDWDQFGASMARFHEEYDLLLTPTVADVAPKHGQFDL
                     PVDLLDRLKQTQNYSMEEQQDLIWQMFEDSLALTPFTQQANICGQPAISLPTYVRADS
                     LPIGVQLTASKGREDLLLQLADQMEAAGLLNL"
     gene            299610..300485
                     /locus_tag="SSUBM407_RS01500"
                     /old_locus_tag="SSUBM407_0275"
     CDS             299610..300485
                     /locus_tag="SSUBM407_RS01500"
                     /old_locus_tag="SSUBM407_0275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000751024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="WP_012774956.1"
                     /translation="MLKKVLASALLVSTLTLAACSSSSSNTSSSSAEQTQWEKIQEAG
                     VLKVATPGTLFPTSYYNDAKELVGYEIDMINEIGKRLKLEIEYQEIGVAEAFTAVDSG
                     KVDISVNNFDMTEARKEKYNFSIPYKYSVGGYIVREDGSSGIEAADLSDWTGKKAGGG
                     AGTQYMKIAEKQGAEPVIYDNVTNDVYLRDVSTGRTDFIPNDYYTQVMAIKWANANFP
                     DIKVKMGEAKYNPTEQGIVMSKADTSLKEKIDEALEAMKADGTLKAISEKYYAGQDLT
                     VPVENADKLPVIEVE"
     gene            300576..301247
                     /locus_tag="SSUBM407_RS01505"
                     /old_locus_tag="SSUBM407_0276"
     CDS             300576..301247
                     /locus_tag="SSUBM407_RS01505"
                     /old_locus_tag="SSUBM407_0276"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_011921884.1"
                     /translation="MDINWQAVFNADIAREAIPQILEGLPYTLSLSLIGFALGTFCGF
                     FVALMRMSKFGPLRWLAMAHISLMRGIPLMVLLFFIYFGLPFMGLQLDAISASIIAFT
                     SMSSAYISEIIRASLSAIDKGQWEAARSLGLRTNVIHRKIIIPQAFRIALPPLSNVLL
                     DMVKSTSLTAMITVPEIFNKAKIVGGAKSDYMTVYICVALIYWVICTLYAFGQLKLEK
                     RLATY"
     gene            complement(301371..301580)
                     /locus_tag="SSUBM407_RS01510"
                     /old_locus_tag="SSUBM407_0277"
     CDS             complement(301371..301580)
                     /locus_tag="SSUBM407_RS01510"
                     /old_locus_tag="SSUBM407_0277"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_012774957.1"
                     /translation="MEMIRVNLDKVLKDRQMTSKDLAEQVGITEANLSILKTGKAKGI
                     RFNTLMSICRILDCQPGDILEYVEE"
     gene            complement(301582..302106)
                     /locus_tag="SSUBM407_RS01515"
                     /old_locus_tag="SSUBM407_0278"
     CDS             complement(301582..302106)
                     /locus_tag="SSUBM407_RS01515"
                     /old_locus_tag="SSUBM407_0278"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011922625.1"
                     /translation="MKTNLLKTAGIVAACVRYFFYLLIASYIFFSLAGLGGDSFAIGS
                     WEYTFNKPIDQISVWLILLATGLILVVLVALSHIAHLIQKLCKLLLEEDYFASASMEL
                     YQKLFISLLVLTAGQFCLTSLITLTNAAGPNNFLNLRWSDFILNALFIFLTYFVWTLV
                     QKGQQLETENSEFI"
     gene            complement(302241..304109)
                     /locus_tag="SSUBM407_RS01520"
                     /old_locus_tag="SSUBM407_0279"
     CDS             complement(302241..304109)
                     /locus_tag="SSUBM407_RS01520"
                     /old_locus_tag="SSUBM407_0279"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011528775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal translocating P-type ATPase"
                     /protein_id="WP_012775493.1"
                     /translation="MTLVTNLKQHSHIITTALCLALILIGILLFQTGQGWAPILFISA
                     FVIGGYQSAKEGISELIFDKHLSVDLLMILAAIGSGLIGYWMEGALLIFIFSLSSTLE
                     ELAMEKSKNAIAALMNMTPPTARKIEENGDITVLDTAAIRIGDLLQVRKGDTVPLDAT
                     LISPQSIFDESMITGEPLPAEKMAGDAVIGGTINQGPTVTVQVTAEKGDALFDKIVQM
                     VENAQESKSKTATFIENMEDTYVKVVLVVVPLFILLAHFALGWDWLTAFYRGMILLTI
                     ASPCALVASSSPATLSAISRAARKGMIIKGGDIADNIANLEAIVFDKTGTLTIGKPEV
                     VGATYLGDEELIKQVVQAVEKQSSHPIAQALMTYTADSSAIALQSLEDVTGKGLVAGY
                     EGDSWKIGKAGFVADSLVSPLSAGLLAQIDEAESTGKTLVYVSQNDVLVAIFMVEDSL
                     KPESKQLIAQLKEMGVTPILLTGDQEKTARYVASQVGIDRVIANCLPTDKAAVIQELQ
                     TEFASVGMVGDGINDAPALAQANVSYAMGSGTDIAMESADIVLMEDLTRIPYSIRLSK
                     KMRGIIKQNIIFALSVIALLIISNLFQSINLPLGVVGHEGSTILVILNGLRLLYFK"
     gene            complement(304272..304727)
                     /locus_tag="SSUBM407_RS01525"
                     /old_locus_tag="SSUBM407_0280"
     CDS             complement(304272..304727)
                     /locus_tag="SSUBM407_RS01525"
                     /old_locus_tag="SSUBM407_0280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor"
                     /protein_id="WP_012774959.1"
                     /translation="MELHSHFNAENQTAFEHVIQHLKEKGIRITETRKAVVAYIIESD
                     DHPSAEMIYQDLIPNYPNMSLATVYNNLKLLLEEGFVTKLKRTNDNTTYYDFMGHEHL
                     NVICEVCGKITDFMDVEIPSLKKEAHTQTGYKITKEVLSIYGICPDCQN"
     gene            304894..305643
                     /gene="truA"
                     /locus_tag="SSUBM407_RS01530"
                     /old_locus_tag="SSUBM407_0281"
     CDS             304894..305643
                     /gene="truA"
                     /locus_tag="SSUBM407_RS01530"
                     /old_locus_tag="SSUBM407_0281"
                     /EC_number="5.4.99.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011999919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine(38-40) synthase TruA"
                     /protein_id="WP_011922628.1"
                     /translation="MTRYKAIISYDGHDFSGFQRQPHARTVQEEIEKTLVRLNSGQPV
                     TVHGAGRTDAGVHAYGQVIHFDLAGSRDVEKLRFALDTQTSEDIDVVSVEQVADDFHC
                     RYAKHSKTYEFLVDIGRPKNPMMRHYATFYPYDLDLSLIEEAIQDLVGTHDFTGFTAS
                     GTSVEDKVRTITVASMEYDQQRQFLIFTFSGNGFLYKQVRNMVGTLLKIGNGRMPVGQ
                     IKRILAEKDRGLAGPTAAGNGLYLKEIIYED"
     gene            305633..306394
                     /locus_tag="SSUBM407_RS01535"
                     /old_locus_tag="SSUBM407_0282"
     CDS             305633..306394
                     /locus_tag="SSUBM407_RS01535"
                     /old_locus_tag="SSUBM407_0282"
                     /EC_number="2.7.4.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005591722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional hydroxymethylpyrimidine
                     kinase/phosphomethylpyrimidine kinase"
                     /protein_id="WP_011922629.1"
                     /translation="MKTKYILALSGNDIFSGGGLHADLTTYTVHGLHGFVAVTCLTAM
                     TEKGFEVIPTETAVFAQQLASLKDVPFSAIKIGLLPSVEIAEQALEFIKTHQEIPVVL
                     DPVLVCKETHDTEVSQLRDEILKFLPYVSIITPNLAEAQLLLQKDIKTVEEMKQVAVA
                     LYDLGAKAVVIKGGNRLGGSEAVDVFYDGQEVVVLQSPLLSENNVGAGCTFASSIASQ
                     LLLGQEPLEAVRLSKDFVHAAIEKSDDYGVVQYEK"
     gene            306384..306869
                     /locus_tag="SSUBM407_RS01540"
                     /old_locus_tag="SSUBM407_0283"
     CDS             306384..306869
                     /locus_tag="SSUBM407_RS01540"
                     /old_locus_tag="SSUBM407_0283"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ECF transporter S component"
                     /protein_id="WP_012774960.1"
                     /translation="MRNKQTQELVLLAILTALSLVLAFVHVPTATGFVTLLDVGVYFT
                     AFYLGKKEGAIVGGLSGLLIDFLLGYPQWAFFSLVFHGAQGYFAGWTGKKRILGLVLA
                     TLSMVGGYYLASRLYFNDLKAIESVLSNTLQNTVGLVVGYVLAQAIERIGAVNHVIKG
                     N"
     gene            306850..307416
                     /locus_tag="SSUBM407_RS01545"
                     /old_locus_tag="SSUBM407_0284"
     CDS             306850..307416
                     /locus_tag="SSUBM407_RS01545"
                     /old_locus_tag="SSUBM407_0284"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR01440 family protein"
                     /protein_id="WP_011921892.1"
                     /translation="MLLREIKDQTKQVVQEVLELSDLQKGQIFVLGLSSSEVIGGHIG
                     KNSSLEVGEVVVETILEILDQKGIYLAVQGCEHLNRALVVERELAIQKDLEIVNVLPT
                     LHAGGSGQLAAFKYMKDPVEVEFITAQAGVDIGDTAIGMHIKHVQVPIRPSLREIGQA
                     HVTALASRPKLIGGVRAAYQEDEIRKGS"
     gene            307416..308030
                     /locus_tag="SSUBM407_RS01550"
                     /old_locus_tag="SSUBM407_0285"
     CDS             307416..308030
                     /locus_tag="SSUBM407_RS01550"
                     /old_locus_tag="SSUBM407_0285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1349 domain-containing protein"
                     /protein_id="WP_012775494.1"
                     /translation="MKEFTVKDLVWTRPPRQFTISDEEITITTHPQTDLWQKTYYHFV
                     NDNAPVLQMETEEDYFSFTVKTDFAGSHTRFDQCGIVLYQDSENWLKCSIEYENDDFQ
                     HLGSVVTNHGFSDWATTEVSSQIKSMWFRLSRRGADYCFENFEDGIHFKQMRVCHFHQ
                     GAGKIAFGLYACSPENSSFTARFTNMELSDCKWQAHDGQEPDEI"
     repeat_region   complement(308074..308177)
                     /note="Imperfect repeat RepSU1"
                     /rpt_family="RepSU1"
     gene            308456..309067
                     /locus_tag="SSUBM407_RS01555"
                     /old_locus_tag="SSUBM407_0286"
     CDS             308456..309067
                     /locus_tag="SSUBM407_RS01555"
                     /old_locus_tag="SSUBM407_0286"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003076049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032498902.1"
                     /translation="MSETEHSFWPKATGLETAVPEDRRIDGIAEVTYQKLLAPIGGRR
                     QTALAFEDEVNVFRRTLMHMGFPYSSRWYHTSTQAQTQLRDVLYFRRKDGVKSGSFKK
                     FVQDGLASQLATISGVTEVRTQVYLPWNKATWNTPNVAHDNPKEDHLHASIIPGFADQ
                     AAREAFYANQAPQLNAEVVQYSSAVHAYHIEKTLPFVLDGKRM"
     gene            309348..309779
                     /locus_tag="SSUBM407_RS01560"
                     /old_locus_tag="SSUBM407_0287"
     CDS             309348..309779
                     /locus_tag="SSUBM407_RS01560"
                     /old_locus_tag="SSUBM407_0287"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rrf2 family transcriptional regulator"
                     /protein_id="WP_012774961.1"
                     /translation="MDTKFSVALHILTMISESKEILSSQALAESVGTNASYIRKVIAL
                     LKNAGLITSHQGRSGYQLSKSPKDISLLEIYLATQEVEHIRLFQIHQNANLSCPVGQH
                     IEGAMVPIFSSVEQELENQLSRQSLDNVITNLYQSAQVTRI"
     gene            309859..310860
                     /locus_tag="SSUBM407_RS01565"
                     /old_locus_tag="SSUBM407_0288"
     CDS             309859..310860
                     /locus_tag="SSUBM407_RS01565"
                     /old_locus_tag="SSUBM407_0288"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent oxidoreductase"
                     /protein_id="WP_011921897.1"
                     /translation="MKAAQHTSYNKNNIALNLTEIAKPQIKPNQVLVKVTAAGVNPLD
                     NMISRGDVKLIVPYKLPQTAGNEVVGLVEEVGSSVTTFAAGDRVFGRLPLDSIGAFAE
                     YVAVDAQALAKVPAYLTDEEAAAVPLTALTIMQALDLMGAQSGKTIFISGGTGGVGGM
                     AIPIAKAKGLTVITNGDGASAERVLSLGADRFIDYKTEDYTKTLSDVDYVLDTLGGAE
                     TEKQMSIMKKGGQLVSLRAMPNGEFAKRMNLPKWKQILFGLAGRSFDKMAKKYGVHYH
                     FIFVESNGRQLQEVADIFNKLEIKPSIDTVYPFEEVNAALDKVANGRSRGKTVLSFN"
     gene            310886..311731
                     /locus_tag="SSUBM407_RS01570"
                     /old_locus_tag="SSUBM407_0289"
     CDS             310886..311731
                     /locus_tag="SSUBM407_RS01570"
                     /old_locus_tag="SSUBM407_0289"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_011921898.1"
                     /translation="MSYITTKNQYITVSNNKIAYRELSKGKSDIPLVMLVHLAATLDN
                     WDPKLLDLLAEKHHVIILDLPGVGASQGKVAPTIPGMAEQAVAIIKALGHEKINLLGL
                     SMGGFIAQEIVRLDSQLVNRLILAGTGPRGGFEVDKVTGKTFRYMLKAGLERVDPKRY
                     IFYNHDEAGRLEAEKVLGRMGQRSAAHADKDMNVPGFLTQLKAIKRWGREPQDDMTFI
                     TQPTLIVNGDKDMQVPTENSYTMHEKIKNSQLIIYPNAGHGSIFQNAEEFSKALLAFL
                     EESNA"
     gene            311724..312593
                     /locus_tag="SSUBM407_RS01575"
                     /old_locus_tag="SSUBM407_0290"
     CDS             311724..312593
                     /locus_tag="SSUBM407_RS01575"
                     /old_locus_tag="SSUBM407_0290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_011921899.1"
                     /translation="MPKTILITGSTDGIGKHLAMKLASEGHEVILHGRNSEKLRVALS
                     DIQLKTGSKKIHGYLADFSKLADVYRFSQEIKRDFEQIDVLLNNAGAYFGDARVATAE
                     NIEMTFMLSVQVPYILTTELLPLLEKAAGRVIHTSSLMHHFAQTRGLDFGLEQSYSAA
                     MAYNNAKLYTIWLAIAQAEALEKQGSSVTVNAYHPGLIATNLGNDGIKRNLRSRILTS
                     LMKPFSKDLDQGIETGYYLSLSPEVAGVSGRYFAEKRLANVSLKGFDLAKSQALLAYL
                     DKKIQVFKESYGD"
     gene            312586..313761
                     /locus_tag="SSUBM407_RS01580"
                     /old_locus_tag="SSUBM407_0291"
     CDS             312586..313761
                     /locus_tag="SSUBM407_RS01580"
                     /old_locus_tag="SSUBM407_0291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavin oxidoreductase"
                     /protein_id="WP_012774962.1"
                     /translation="MTKILLENLQLPNGQVLDNRFFKSAMSETLADSQGAPSDDLIAL
                     YDFWAKQGVGVLVTGNVMVDGRYLGEPGNVVLDSDAHLAQFRKWAAVGKKNGVPIWLQ
                     LNHPGKQMYRSINQTPIAPSAIPISGGSASAFRPPREMTVFDIKEARDKFIAAGLRAK
                     AAGFTGVQLHAAHGYLTNQFLSPADNQRTDRYGGSLDNRMQFLVEVYQGLREKVGPDF
                     TIALKLNASDFKEEGFGFEDCKHVVKIMSDLGIDLIEISGGNYETPVFGSDYENGAGF
                     VTYALALADLTSVSIVSTGGFRKVTQMEEAIKDGVSMIGLARPFVLRPSLVNDYRQVG
                     DLQADGERTGRYILGGEELVLNSKGESVISYADYAIGMIDEIATGDHLKARISLVSE"
     gene            313771..314220
                     /locus_tag="SSUBM407_RS01585"
                     /old_locus_tag="SSUBM407_0292"
     CDS             313771..314220
                     /locus_tag="SSUBM407_RS01585"
                     /old_locus_tag="SSUBM407_0292"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rrf2 family transcriptional regulator"
                     /protein_id="WP_012775495.1"
                     /translation="MQISNKFTIAIHALAFIHLFQDQQRVTSKVLANSIQANPVIIRS
                     VLSGLKEAGIVDAKQGSGGFRLAKTLDDISLYDIFVTVDNIDKKGLFNFHENPHPDCI
                     VEGNIHAAVDDKLVQVQTAMEKELKTMYMSDVLVDLEKAIEEKVKRI"
     gene            complement(314480..314989)
                     /locus_tag="SSUBM407_RS01590"
                     /old_locus_tag="SSUBM407_0293"
     CDS             complement(314480..314989)
                     /locus_tag="SSUBM407_RS01590"
                     /old_locus_tag="SSUBM407_0293"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014917199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_014636225.1"
                     /translation="MERVKRKESLFVESVVEALWELLEDKSFEKISVSELVERAGIGR
                     VTFYRNFSNKEEVLERSFNLESQAWLTERQIDLSDWSDAHLLLALRQFFDFWYEQQDK
                     IRLLTANHLDYLLEEVLDRYFKEKLGDLTDDFHLQFIVGGFFRVLKTWVARGCKESPD
                     DIMRLMSEQ"
     gene            315130..316053
                     /locus_tag="SSUBM407_RS01595"
                     /old_locus_tag="SSUBM407_0294"
     CDS             315130..316053
                     /locus_tag="SSUBM407_RS01595"
                     /old_locus_tag="SSUBM407_0294"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014638889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase"
                     /protein_id="WP_012774964.1"
                     /translation="MKKVLIGIGILIACFGIGFLYLASKPSVASNYTEVVETGGAVEK
                     KYLGQGNYDVSYLEINALQNFKKYELYYPTNIETETRKFPVVIFSNGTGVRASKYASV
                     LKHLASWGFIVIGTEEEYSWNGFSSEMSLRLAIKLNDNKTVEGLKSNPFFSKVDLDKI
                     GLSGHSQGGVGVFNAVTEQKHGHMIKTIYAASPANLELSSNLEWDYDPSLISVPTFLV
                     SGTGGGYEDLVVSGKQLTQIYETLPATITKVMARRKEAGHGDMLRLPNGYMVAWFMWR
                     LQGAPEAETAFQGNSPEIVQNKLYQDQRIMN"
     gene            316160..317179
                     /locus_tag="SSUBM407_RS01600"
                     /old_locus_tag="SSUBM407_0295"
     CDS             316160..317179
                     /locus_tag="SSUBM407_RS01600"
                     /old_locus_tag="SSUBM407_0295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_011921904.1"
                     /translation="MKKFKKIILWTLGIVASLGIIAYVSVTNHPQLVVGVIQSFMYKE
                     SSPNSYSPLYDPIDGLKENGQYLKSEIAYSKDYPNSFLDITYPDQNLEADRPTLFYFH
                     GGGFFGGSKNMGAPLSASQATYLIDDIVSKGYNVVNVDYALVPDHHFPTPVIQMNQAI
                     AYMKEHAEEYHLNMDNVVLMGSSAGAIMAAQYGSVLANQEYAQLLNIEPSIAKEDVKA
                     LVIDDAPLDYAKFSLGTKILVGNYVSETIYLSEEEINAYNPISHVNKDYPASFLLGSE
                     DRTDMVSLNKALKQAGVENELVDPLAEEGLEKPHGFVANLRTDPVSAKAFERLMIFID
                     DRTKE"
     gene            317401..318684
                     /locus_tag="SSUBM407_RS01605"
                     /old_locus_tag="SSUBM407_0296"
     CDS             317401..318684
                     /locus_tag="SSUBM407_RS01605"
                     /old_locus_tag="SSUBM407_0296"
                     /EC_number="5.2.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009443222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="WP_011921906.1"
                     /translation="MSVSFEAKETNRGVLTFTIGQDAIKPELDRVFNKVKKDINLPGF
                     RKGHLPRAVFNQKFGEEALYQDVVNALLPAAYEAAVAEAGLEVVAQPKIDVVSMEKGQ
                     DWTITAEVVTKPEVKLGDYKNLAVSVEATKEVTDEEVDAKIEAARNNLAELVIKEGPA
                     AEGDTVVIDFVGSIDGVEFDGGKGENFSLGLGSGQFIPGFEAQLVGHAAGEEVNVEVT
                     FPEDYQAADLAGKQALFVTKIHEVKAKEVPALDDELAKDIDEEVETLDELKAKYRKEL
                     EASKEVAFDDAVESAALELAVENAEIVELPEEMIHEEVHRAINEFLGGMQQQGISPDM
                     YFQITGTTREDLHKQYEADAEKRTKTNLVVEAVAKAEGFEATEEEINKEIEDLAATYN
                     MEVAQVRSLLSPEMLKHDIAVKKAVEVITSTATVK"
     gene            318735..319619
                     /locus_tag="SSUBM407_RS01610"
                     /old_locus_tag="SSUBM407_0297"
     CDS             318735..319619
                     /locus_tag="SSUBM407_RS01610"
                     /old_locus_tag="SSUBM407_0297"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_012774965.1"
                     /translation="MLQRNSLKNLVRPMQKWENVISVGGVVQVSQGVRITDGEVSHYQ
                     LPWSVLPCLQAIEYDCSFLGSRILLDYLQSNLIISGAFGLFYKEYVIAVGGYDRQTLG
                     EDMELVMKLHYFCRNNNIPYRICYETSAICWSQAPSSIGDLCKQRRRWFLGLYQCLKK
                     YRKMLSRVRFGAVGYFSYAYYMLFEFLAPFIETFGCFVILLSLIYHQLNISFFISLFF
                     LHSAFCSLITFASFLQRVYSQDLFIGPMDLCKAFLATLFRYFFLHWVLNIVRLTSFIG
                     YKKRKREWGEIKRVKQFV"
     gene            319728..320648
                     /locus_tag="SSUBM407_RS01615"
                     /old_locus_tag="SSUBM407_0298"
     CDS             319728..320648
                     /locus_tag="SSUBM407_RS01615"
                     /old_locus_tag="SSUBM407_0298"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000744528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter substrate-binding protein"
                     /protein_id="WP_012774966.1"
                     /translation="MLKKVIRGCFVALFGFVLAACSAQKEASQVQPGMKIVTSFYPIY
                     SLVKEVSGNKNDVRMIGSRQGIHSYEPSAADIKAIYDADVFIYHSRILESWAGRLEPN
                     LQGSSVKVLEASTNLPLTKVPGLEDMEAGQGIDEASLYDPHTWLDPVLVGQEAVAIGE
                     LLAESDPKNADYYRQNAATLEGKAQKLADKYSPIFLKATSKTFVTQHTAFSYTAQRFG
                     LKQLGIAGVSEEEPSPRQLAEIKEFVDTYNVQTIFTEKGASDKLAKALASSTGVDLKV
                     LDPLEADPENNLTYLENLEQVLETLAQELK"
     gene            320682..323837
                     /locus_tag="SSUBM407_RS01620"
                     /old_locus_tag="SSUBM407_0299"
     CDS             320682..323837
                     /locus_tag="SSUBM407_RS01620"
                     /old_locus_tag="SSUBM407_0299"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pneumococcal-type histidine triad protein"
                     /protein_id="WP_012775496.1"
                     /translation="MKKKAVVGSVAALVLGMSLCSYQLGRFQAMEEQKNRVSYIEDSQ
                     SVQTTVAEQLTPDQVSAKENIDAEQIVVKITDQGYVTSHGDHFHYYNGKVPFDAIFSE
                     ELVMKDPNYVLQDSHIINEVQDGYVIKVDGKYYLYLKDPSKHKNVRSKEEVERQKGIS
                     SADSKNQAAGNSKDGRYRTDDGYVFNPTDVIEDTGDGFIVPHGDHFHFIPKKDLSAAE
                     LKAAQDYWNQKGSVSSASGSQYGDRNNRAQQTTISAGQGQDLASLLAQLDATPLSQRH
                     VEADGLVFDPRTITKKTAAGVIVPHGDHYHFIPYSQMSPLEEKISRMIGVNGAGVSSG
                     AQASRSQHTLTQPNRPVTPIGTVTTQPVSPTQPVLPTQPKQSTGKVVSYKGRQIPAYG
                     KGLDGKAYFTSDGYTFSKDSITSVDDQGLIASHGDHFHYVGFGELEDFEIKQVEEWVN
                     EKAGKQVPPKTSEQVGNDAKPTTPSQGNDSKPVKPIQEENRPAFEYKQVTAKRKLAGK
                     VVYEMEVGGKTYTYGRDELDLMKISFAELTLAEKDKQYIFDIAPLAEGDLKPAMLVGM
                     DQIPMKGANATYDTGQSFIIPHIDHIHVLPYTWLSKEQIATIRYIMQHPEIRPSAWTT
                     SGHGDGEATDLVPPILNATPKANRLGLKNWQIIHTAEEVMDARAKGKFATNDGYIFSA
                     EDVLDPASFVFSQAFSLPRATGGSLRSISKKDLSKEELEAVQTLLDKRDAEELAKNVT
                     PIEKRAGLKNWQIVHSAEELAEAKAAGKYTTKDGYIFDPADLLDPKVKIGTDNYRIPR
                     VITDGYRRINKSDLNYLSELIPAEAMVAQREKSNSSLPSTPAPTETGASAGETTTPEQ
                     PQVAKETAEEIYNRVEAKKVVPFEALTYNAGYATEVRNGTLVIPHQDHYHYVSFKWFD
                     QGSARSPEGYSLEDFLATVKYYMTNPQERPVSDDGWGVFTPNTPSESTEETETEESDE
                     EIISEETEEIDEFTEELKRRAEEFGMDFKTFEQSLVTLSDRYKVSFEAFEYDAASKVV
                     RLVDKDGVKRTISLPSLEEQV"
     gene            323964..324545
                     /locus_tag="SSUBM407_RS01625"
                     /old_locus_tag="SSUBM407_0300"
     CDS             323964..324545
                     /locus_tag="SSUBM407_RS01625"
                     /old_locus_tag="SSUBM407_0300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006530996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit delta"
                     /protein_id="WP_011921912.1"
                     /translation="MELNVFAGQEKSELSMIEVARAILEERGRDNEMYFNDLVNEIQN
                     YLEKSNSEIRAALPTFYSDLNVDGSFIPLGENKWGLRSWYAIDEIDEEVITLEEDDED
                     APKRKKKRVNAFMDGDDDAIDYGHDDPEDEDNYPGSVSSEYDDENPDDEKDEVESYDS
                     EINEIIPDDELDEEDVDLGEDDDEYSDEEVVDE"
     gene            324738..326342
                     /locus_tag="SSUBM407_RS01630"
                     /old_locus_tag="SSUBM407_0301"
     CDS             324738..326342
                     /locus_tag="SSUBM407_RS01630"
                     /old_locus_tag="SSUBM407_0301"
                     /EC_number="6.3.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000170456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthase"
                     /protein_id="WP_011921913.1"
                     /translation="MTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYI
                     NIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKE
                     RKGEYLGATVQVIPHITDALKDKIKRAARTTDADVIITEVGGTVGDIESLPFLEALRQ
                     MKADVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPAG
                     QGIKNKLAQFCDVAPEAVIESLDVEHLYQIPLNMQAQNMDQIVCDHLKLDVPPADMTE
                     WTAMVNKVLNLQKKVKIALVGKYVELQDAYISVVEALKHSGYANDAAIELDWVNANDL
                     TAENVAERLGQAQGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCVEFA
                     RHVLGLEGANSFELDPETKYPIIDIMRDQIGVEDLGGTLRLGLYPSKLKRGSKAAAAY
                     DNQEVVQRRHRHRYEFNNDFREQFEKAGFVFSGVSPDNRLVEIVEIPENKFFVACQYH
                     PELQSRPNRPEGLYTAFVSAAMENEK"
     gene            326623..326708
                     /locus_tag="SSUBM407_RS01635"
                     /old_locus_tag="SSUBM407_t0031"
     tRNA            326623..326708
                     /locus_tag="SSUBM407_RS01635"
                     /old_locus_tag="SSUBM407_t0031"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:326657..326659,aa:Leu,seq:aag)
     gene            326943..327824
                     /locus_tag="SSUBM407_RS01640"
                     /old_locus_tag="SSUBM407_0302"
     CDS             326943..327824
                     /locus_tag="SSUBM407_RS01640"
                     /old_locus_tag="SSUBM407_0302"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001018994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="WP_011922635.1"
                     /translation="MPLVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKQAP
                     VLIQTSMGAAKYMGGYKVARNLIANLIESMNITVPVAIHLDHGHYEDALECIEVGYTS
                     IMFDGSHLPVEENLAKAKEVVELAHAKGISVEAEVGTIGGEEDGIVGSGELAPIEDAV
                     AMVATGIDFLAAGIGNIHGPYPANWEGLDLDHLRKLTEAVPGFPIVLHGGSGIPDAQI
                     QEAIKLGVAKVNVNTECQIAFANATRKFAAAYEANEAEYDKKKLFDPRKFLADGVKAI
                     QASVEERIDVFGSANKA"
     gene            328217..328405
                     /locus_tag="SSUBM407_RS01645"
                     /old_locus_tag="SSUBM407_0303"
     CDS             328217..328405
                     /locus_tag="SSUBM407_RS01645"
                     /old_locus_tag="SSUBM407_0303"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008536053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_001140948.1"
                     /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKP
                     KKVWASARALKSGKVERV"
     gene            329020..330575
                     /locus_tag="SSUBM407_RS01650"
                     /old_locus_tag="SSUBM407_r0007"
     rRNA            329020..330575
                     /locus_tag="SSUBM407_RS01650"
                     /old_locus_tag="SSUBM407_r0007"
                     /product="16S ribosomal RNA"
     gene            330621..330693
                     /locus_tag="SSUBM407_RS01655"
                     /old_locus_tag="SSUBM407_t0032"
     tRNA            330621..330693
                     /locus_tag="SSUBM407_RS01655"
                     /old_locus_tag="SSUBM407_t0032"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:330654..330656,aa:Ala,seq:tgc)
     gene            330967..333877
                     /locus_tag="SSUBM407_RS01660"
                     /old_locus_tag="SSUBM407_r0008"
     rRNA            330967..333877
                     /locus_tag="SSUBM407_RS01660"
                     /old_locus_tag="SSUBM407_r0008"
                     /product="23S ribosomal RNA"
     gene            333963..334078
                     /gene="rrf"
                     /locus_tag="SSUBM407_RS01665"
                     /old_locus_tag="SSUBM407_r0009"
     rRNA            333963..334078
                     /gene="rrf"
                     /locus_tag="SSUBM407_RS01665"
                     /old_locus_tag="SSUBM407_r0009"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
     gene            334083..334155
                     /locus_tag="SSUBM407_RS01670"
                     /old_locus_tag="SSUBM407_t0033"
     tRNA            334083..334155
                     /locus_tag="SSUBM407_RS01670"
                     /old_locus_tag="SSUBM407_t0033"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:334116..334118,aa:Asn,seq:gtt)
     gene            334178..334249
                     /locus_tag="SSUBM407_RS01675"
                     /old_locus_tag="SSUBM407_t0034"
     tRNA            334178..334249
                     /locus_tag="SSUBM407_RS01675"
                     /old_locus_tag="SSUBM407_t0034"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:334211..334213,aa:Glu,seq:ttc)
     gene            334368..336386
                     /gene="recG"
                     /locus_tag="SSUBM407_RS01680"
                     /old_locus_tag="SSUBM407_0304"
     CDS             334368..336386
                     /gene="recG"
                     /locus_tag="SSUBM407_RS01680"
                     /old_locus_tag="SSUBM407_0304"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="WP_012774967.1"
                     /translation="MKRLCDELSVLPGIGPKSAEKFLKISIQNINDLLTYYPFRYEDF
                     ESKSIYDLQDGEKAVVVGEVVSPANVQYYGYKRNRLRFSMKQGEVVLAVSFFNQPYLA
                     DKIVLGQDIAVWGKWDKAKASLTGMKILAQVSDELQPVYHVAQGISQVNLVKAIKTAI
                     DQGYLHLLEENLPSVLRERYRLMNRREAVFAMHFPTNLEEYRQALRRMKFEELFYFQL
                     QLQMLKANNRDILNGLKIAYDADRLAMQIRQLPFVLTDAQSGALAEILSDMKSYGHMN
                     RLLQGDVGSGKTVVAGLAMFAAVTAGMQAAIMVPTEILAEQHFESLRQLFPELSIALL
                     TGGMKAAERRTALEAISSGQVDIIVGTHALIQESVTYHKLGLVVTDEQHRFGVKQRRL
                     FREKGDNPDVLMMTATPIPRTLAITAFGDMDVSIINQLPAGRKPIITRWVKHQQLPTV
                     LDWLERELEVGAQVYFISPLIEESEALDLKNAVDLQSDLQAHFGEQVTVDLLHGKMKN
                     DEKDAIMQAFKERKTNILVSTTVIEVGVNVPNATVMVIMDADRFGLSQLHQLRGRVGR
                     GHKQSYAVLVANPKTESGKERMKIMTETTDGFILAEADLKMRGSGEIFGTRQSGLPEF
                     QVANIIEDYPILEEARRVASQIVSVENWQEDPNWSILLANLKDREELD"
     gene            complement(336450..337409)
                     /locus_tag="SSUBM407_RS01685"
                     /old_locus_tag="SSUBM407_0305"
     CDS             complement(336450..337409)
                     /locus_tag="SSUBM407_RS01685"
                     /old_locus_tag="SSUBM407_0305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015911840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparaginase"
                     /protein_id="WP_012775497.1"
                     /translation="MKKILVLHTGGTISMQTNHQGEVAASKTNPMTQIDSPLEETQVT
                     SLDFLNVPSPHIRLEHMMTLYQKIKEEQMNFDGFVITHGTDTLEETAYFLDTMAIPEK
                     PIVLTGAMRSSNELGSDGIYNYRTALRVATDDKSADKGVLVVMNDEIHAAKYVTKTYT
                     TNVSTFQTPTHGPLGLVTKREILYFKTAEPRVRFDLSTVTGTVPIIKAYADMDSILLD
                     SLTASSISGLVIEALGAGNLPPTILPAIKKLLDQKIPIILVSRCFNGIAEPVYAYQGG
                     GIQLEKDGILFVKELNAQKARLKLLIALNAGLEEQSLADYIQG"
     gene            337479..338324
                     /locus_tag="SSUBM407_RS01690"
     CDS             337479..338324
                     /locus_tag="SSUBM407_RS01690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cof-type HAD-IIB family hydrolase"
                     /protein_id="WP_014636226.1"
                     /translation="MTIKAVFFDIDGTLLTDNRMVSSSTILAINALKEKGILVGLATG
                     RDPRFVLQYMASLGLDLAIAYNGQYIFSREEVIYSQSLEPKQIEQIMEYAQTHHKDLS
                     FGTAKGIFGSKIMSAGTGNFAYRVTRMIPESWAGIINFIFNRLVRWISPQQETNLKGF
                     LFQPIYQLMLLTTERETQSLEVLFPNLSFTRSSPYATDIISKGNSKLSGIVKVADRYG
                     FELDEVMVFGDSNNDFEMLNEIQHSVAMGNGTKKVKHAASFVTDTNNRDGIYKALIHF
                     GVIEG"
     gene            338326..338844
                     /locus_tag="SSUBM407_RS01695"
     CDS             338326..338844
                     /locus_tag="SSUBM407_RS01695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_014636227.1"
                     /translation="MFQSKDDNFNRVKDFHFLMDGETQELPSVYDGQTALYRAGFKLE
                     ELVEFLHAASESEVEFHDFIQQLHQDLDTAAAKVSGKRGFGVSMQDQVDALLDILYFT
                     YGSFVLMGVDPEPIFQIVHTANMGKTFPDGKAHFDPITHKILKPDDWEERFAPEEKIQ
                     EELKRQMKRLDS"
     gene            complement(338860..339312)
                     /locus_tag="SSUBM407_RS01700"
                     /old_locus_tag="SSUBM407_0307"
     CDS             complement(338860..339312)
                     /locus_tag="SSUBM407_RS01700"
                     /old_locus_tag="SSUBM407_0307"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015445117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_004195772.1"
                     /translation="MTQSYKTILVAVDGSKGAELALHKAIHVALRNQARLIIAHVIDT
                     RALHNVVAFDASVYESLEREAELLLEEYKQEALNAGLTDVQIRIEFGNPKTLLAIDIP
                     KETGADLMLLGATGLNAFERLLIGSSSEYIMRHATIDLLIVRDGEKSL"
     gene            339467..340681
                     /locus_tag="SSUBM407_RS01705"
                     /old_locus_tag="SSUBM407_0308"
     CDS             339467..340681
                     /locus_tag="SSUBM407_RS01705"
                     /old_locus_tag="SSUBM407_0308"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011836593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal phosphate-dependent aminotransferase"
                     /protein_id="WP_011921925.1"
                     /translation="MKQFNKSTKLDDVAYDIRGPVLEEAMRMRANGEQILRLNTGNPA
                     EFGFTAPDEVIRDLIHNARKSEGYSNSKGIFSARKAIMQYCQLKKFPNVDIEDIYLGN
                     GVSELIVMSMQGLLDNGDEVLVPMPDYPLWTAAVSLAGGKAVHYVCDEVAEWYPDLAD
                     MESKVTSRTKAIVLINPNNPTGALYPKEILKGIIDIARRHELIIFSDEIYDRMVFDGA
                     VHIPIATLAPDLFVVTMNGLSKSHRICGFRVGWMVLSGPKKHVKGYIEGLNMLSNMRL
                     CSNVLAQQVVQTSLGGYQSVDELLMPGGRLYEQREFITKAINDIPGLSAVKPKAGLYV
                     FPKIDREMYRVEDDEQFVLDFLKQEKVLLVHGRGFNWKDPDHFRIVYLPRVDELAEIQ
                     EKMSRFLRQYRR"
     gene            341090..341878
                     /gene="codY"
                     /locus_tag="SSUBM407_RS01710"
                     /old_locus_tag="SSUBM407_0309"
     CDS             341090..341878
                     /gene="codY"
                     /locus_tag="SSUBM407_RS01710"
                     /old_locus_tag="SSUBM407_0309"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016399190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-sensing pleiotropic transcriptional
                     regulator CodY"
                     /protein_id="WP_011921926.1"
                     /translation="MTTLLEKTRNITSILKRSEEQLAEELPYNAIAEHLSAIIDCNSC
                     IINSEGEVLGYHMSYETNNDRVEEFFQNKQFPEGYVKAVAQVYDTQVNLPVESELTAI
                     PVESRSTYPNGLTTIAPIHVTGIRFGSLIIWRNDEQFHDDDLILVEIAATVVGIQLLN
                     FQREEDEKNIRRRAAVNMAVNTLSYSEMKAVAAILGELDGNEGQLTASVIADRIGITR
                     SVIVNALRKLESAGIIESRSLGMKGTYLKVLIPAIFDEIKKRDY"
     gene            341891..342421
                     /locus_tag="SSUBM407_RS01715"
                     /old_locus_tag="SSUBM407_0310"
     CDS             341891..342421
                     /locus_tag="SSUBM407_RS01715"
                     /old_locus_tag="SSUBM407_0310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine hydrolase"
                     /protein_id="WP_029693245.1"
                     /translation="MDYIVDFVADEGKLTAGKSAQAISKRIAQVTQEAFENGDYIFFA
                     IDGHEEGDEFHPEAQLFPSHNIIGTQGRDLYGPLADFYQKHKGHARVRWMDKRHYSTF
                     SGTDLDVRLRERGVDTVVLTGVLSDICVLHTAIDAYNKGYRIEVVSSAIAALTEENHQ
                     FALNHLRHVLGATIID"
     gene            342675..343022
                     /gene="rplS"
                     /locus_tag="SSUBM407_RS01720"
                     /old_locus_tag="SSUBM407_0311"
     CDS             342675..343022
                     /gene="rplS"
                     /locus_tag="SSUBM407_RS01720"
                     /old_locus_tag="SSUBM407_0311"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005590628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="WP_011921928.1"
                     /translation="MNPLIQSLTEGQLRTDIPSFRPGDTVRVHAKVVEGNRERIQIFE
                     GVVISRKGQGISEMYTVRKISGGVGVERTFPIHTPRVDKIEVVRYGKVRRAKLYYLRA
                     LQGKAARIKEIRR"
     gene            343183..343857
                     /locus_tag="SSUBM407_RS01725"
                     /old_locus_tag="SSUBM407_0312"
     CDS             343183..343857
                     /locus_tag="SSUBM407_RS01725"
                     /old_locus_tag="SSUBM407_0312"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_012774968.1"
                     /translation="MSEQFIPSVLSDLRQDIVQMPEVIKECSGIRIYGRRIRSVLFTT
                     DVSIIANHNADAILAVYPFTPSPAIIKSIMLVASVPVLAGVGGGLTTGMRSANMSLLS
                     ESEGAYAVVVNGPTDVKTIEAINKVVDIPIIYTVVSEKSDLTSRIKAGVDILNVSCGM
                     ETPRVVKKIREAFPDFPIIATGGPTEDSIRRVIEAGANAVSYTAPSNGELFKGKMEKY
                     RKHAKD"
     gene            344074..344376
                     /gene="gatC"
                     /locus_tag="SSUBM407_RS01730"
                     /old_locus_tag="SSUBM407_0313"
     CDS             344074..344376
                     /gene="gatC"
                     /locus_tag="SSUBM407_RS01730"
                     /old_locus_tag="SSUBM407_0313"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007892147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase
                     subunit GatC"
                     /protein_id="WP_011921930.1"
                     /translation="MKISEAEVRHVAKLSKLEFSDQETAEFATSLSKIVDMVELLNEV
                     DTTGVAVTTTMADRKNVLRADIAQKGESREELFKNVPESQDNFIKVPAILDGGGDA"
     gene            344376..345842
                     /gene="gatA"
                     /locus_tag="SSUBM407_RS01735"
                     /old_locus_tag="SSUBM407_0314"
     CDS             344376..345842
                     /gene="gatA"
                     /locus_tag="SSUBM407_RS01735"
                     /old_locus_tag="SSUBM407_0314"
                     /EC_number="6.3.5.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013904071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase
                     subunit GatA"
                     /protein_id="WP_011921931.1"
                     /translation="MTFNNKTIDELHDLLVKKEISAVELTKATLEDIKSREGAVDAFL
                     TITEDAALAQAAALDEKGIDADNVMAGIPLAVKDNISTKGILTTAASKMLYNYEPIFD
                     ATSVAQAYAKDMIIVGKTNMDEFAMGGSNENSAFKPTKNAWDQTKVPGGSSGGSAAAV
                     ASGQVRLSLGSDTGGSIRQPAAFNGIVGMKPTYGTVSRFGLIAFGSSLDQIGPFSQTV
                     KENAQLLNVISGHDVKDATSTINEIADFTSKIGQDIKGMKIALPKEYMGEGIDPQVKE
                     TILKAAKHLESLGAIIEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGFRAEDA
                     TNLDEIYVKTRSQGFGEEVKRRIMLGTFSLSSGYYDAYFKKAGQVRTLIIQDFEKVFA
                     DYDLILGPTAPTVAFGLDTLNHDPVAMYLADLLTIPVNLAGLPGLSIPAGFVEGLPVG
                     LQLIGPKYSEETIYQVAAAFEATTDYHKQQPVIFGGAN"
     gene            345842..347281
                     /gene="gatB"
                     /locus_tag="SSUBM407_RS01740"
                     /old_locus_tag="SSUBM407_0315"
     CDS             345842..347281
                     /gene="gatB"
                     /locus_tag="SSUBM407_RS01740"
                     /old_locus_tag="SSUBM407_0315"
                     /EC_number="6.3.5.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017770317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase
                     subunit GatB"
                     /protein_id="WP_011921932.1"
                     /translation="MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSF
                     PGVLPVLNKGVVDAGIKAALALNMDIHKDMHFDRKNYFYPDNPKAYQISQFDEPIGYN
                     GWIEIELEDGSTKKIRIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMR
                     SPEEAYAYLTALKEIIQYTGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNS
                     FNYVRKGLQHEVERQAKILRSGGQIQQETRRYDESTGETILMRVKEGSADYRYFPEPD
                     LPLYEIDDSWIEEVRAELPVFPKARRAHYVENLGLTAYDAGQLTSTKALSDFFEAAVA
                     AGGDAKQVSNWLQGEVAQFLNAEGKTIEQIALTPENLVEMIALIADGTISSKIAKKVF
                     VHLAKEGGSAKAYVEKAGLVQISDPAVLIPIIHQVFADNEAAVADFKSGKRNADKAFT
                     GFLMKATKGQANPQVAQQLLAQELAKLLD"
     repeat_region   complement(347332..348961)
                     /note="IS element"
     gene            complement(347512..348804)
                     /locus_tag="SSUBM407_RS01745"
                     /old_locus_tag="SSUBM407_0316"
     CDS             complement(347512..348804)
                     /locus_tag="SSUBM407_RS01745"
                     /old_locus_tag="SSUBM407_0316"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_086558053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
                     /protein_id="WP_162038636.1"
                     /translation="MLSKYVGRQTSSIENDIAKTRNHSRQRGNIMRVVFGIDVSKASS
                     EVAILVNGEKVHGYTISNDAIGFARLLGDLRTVHKPEIIFEATGVYSRRLQTFLDDNG
                     YAYTRLNPLEAKKQLDSLRVRKTDQIDAEKLAQSQFVLNRKPTYVQEEVYQNLRDLSR
                     FYQNLTEDIVRAKNRLHKVLQVTFPELENILSTPSGEQYWNLVIAFPCKDCVLELSND
                     ELSKSIRLSTSKRISDKRVAYLAEKLIALANQSYCAVKKTSPILEEVRYYTKELLRLS
                     EQRQAVLDEMVELAQPLPEYDILLSIPGIAETTATSIIGELGDIRRFQSANQINAFIG
                     IDLRHYESGNFLAKEHITKRGNPYARKILFKCIHNIASANHTNPCHIADFYKKRKRQS
                     QTTSTKLHTIASIHRLIRTMYYLIMHNKFYDYASTQNR"
     gene            349025..350374
                     /gene="dgt"
                     /locus_tag="SSUBM407_RS01750"
                     /old_locus_tag="SSUBM407_0317"
     CDS             349025..350374
                     /gene="dgt"
                     /locus_tag="SSUBM407_RS01750"
                     /old_locus_tag="SSUBM407_0317"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dNTP triphosphohydrolase"
                     /protein_id="WP_012774969.1"
                     /translation="MSKDFDDFLREHEENVNKLKKRDKETESDKERARDEFSRDYSRV
                     IYSNSFRRQQGKMQLFAVNGRAFHRNRLTHSFEVAQIARGIVDYLKKNTSNNIDIDFN
                     SMSVVVETGALVHDIGNPPFGHHGERILNDLAKDIGFEGNAQGLRVLKNIEKKSPDHK
                     GLNLTYRTLASILKYYVPYRKSRKTEKFIYKEDYEEFKKRFKEMDVFVRTIDVQIVDL
                     ADEIAYCAHDLEDALASNYFTIDQFVFLLEQKLGEDQTLEDFKEWIEEAKNKAKRSKS
                     NDDYDFYFRRELLSIIVNKFIEDIDIVELNEKDKKKLGTDQDQELGLGHYKKLAGALK
                     KTIFEGVTNSDDIILYENVGTKVLTRLFALFMNEEYNRESFLMPIEYRFEKDDTQSDK
                     KRKVLDYISGMMDTYAIEMYIKHFGTDPFLEKYDAAIFKKGTGKKLIECLAQNFLHK"
     gene            complement(350433..351431)
                     /locus_tag="SSUBM407_RS01755"
                     /old_locus_tag="SSUBM407_0318"
     CDS             complement(350433..351431)
                     /locus_tag="SSUBM407_RS01755"
                     /old_locus_tag="SSUBM407_0318"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002939037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_012774970.1"
                     /translation="MVTIKDIAKQAHLSSATVSRVLKGDLTLSVSQETRDRIFNLAQE
                     LGYTKHIKKQAPQQKGTIGIVQWYTESEELADLYYYSIRASIEHTASLLGYQIVRSFN
                     DLTNPLLQEVDGIIAVGKFSSGQIAELSSLSSKIIFVDSDTLTEGFSCVTTDFEHSVQ
                     TVIDHFHSQGLTDIGLLVGQEETTDGHQLPTDPRLTAFRDYLDTLGMLQEDYIYQGKF
                     STQSGYELMSQAIEDLGDKLPPAFFMANDTLAVGALRALQERQIAVPDRIQLITFNDT
                     AITRQVYPALSSISVFTEEMGQEAMQLLDRIITSPTPHHPRKIKLGTQLVIRESSY"
     gene            351565..352737
                     /locus_tag="SSUBM407_RS01760"
                     /old_locus_tag="SSUBM407_0319"
     CDS             351565..352737
                     /locus_tag="SSUBM407_RS01760"
                     /old_locus_tag="SSUBM407_0319"
                     /EC_number="2.7.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002939036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactokinase"
                     /protein_id="WP_011921936.1"
                     /translation="MNTEQLKQAFLDVFGQEADATFFSPGRINLIGEHTDYNGGHVFP
                     AAITLGTYGAARKRDDQVLRFYSANFEELGIIEVDLNNLVFDKADNWTNYAKGVLKFL
                     KEAGHVIDTGMEVFVYGNIPNGSGLSSSASLELLIGIIAEELYGLELTRLDLVKIGKQ
                     TENHFIGVNSGIMDQFAIGMGADNRAIYLDTNSLEYELVPLDLGDHVIVIMNTNKRRE
                     LADSKYNERRAECEKAVEELNAVLNIQTLGELDEWTFDQYSYLIKDENRIKRARHAVL
                     ENQRTLQARKALEEGDLATFGRLVNASHVSLEHDYEVTGLELDTLAHTAWEQEGVLGA
                     RMTGAGFGGCGIAIVHKDKVEAFKENVGKTYTEVVGYAPSFYVAEIAGGSRVLSRK"
     gene            352747..354228
                     /gene="galT"
                     /locus_tag="SSUBM407_RS01765"
                     /old_locus_tag="SSUBM407_0320"
     CDS             352747..354228
                     /gene="galT"
                     /locus_tag="SSUBM407_RS01765"
                     /old_locus_tag="SSUBM407_0320"
                     /EC_number="2.7.7.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose--hexose-1-phosphate
                     uridylyltransferase"
                     /protein_id="WP_011921937.1"
                     /translation="MMTGLVDRFVEQVIANSDFEEMDAIYLRNRVLALVGDQVLTVQT
                     DLEDLIELKDELLAHGVRTGFVGELLEEQDMVGSCLMDLMTPSPSQVNRDFWQTYQDS
                     PEQAISDFYELSKRNDYIKMAAIAKNIYYPVSTEYGDLEITINLSKPEKDPKSIAAAT
                     KAEASNYPKCLLCMENEGYQGRINHPARANHRIIRLELGQEKWGFQYSPYAYYNEHAI
                     FLNQEHVPMVISPRTFEQLLDLLDLLPGYFVGSNSDLPISGGSILTHNHYQGGRHSFA
                     MDQAPIEHQLVFEGFESVSAGIVKWPMSVIRLSSADKPSLLGLAAKILEKWRSYSDDS
                     VQIKAETDGTPHHTITPIARKRGDLYELDLVLRDNQTSEEFPDGIYHPHPDVQHIKKE
                     NIGLIEVMGLAILPPRLKAELAEVEKFLLGQDSQVADYHQPWAESLKTAHPDVTEETV
                     EQVVRESVGQIFARVLEDAGVYKRTPEGQAAFLRFVEFVGLAT"
     gene            354304..355212
                     /locus_tag="SSUBM407_RS01770"
                     /old_locus_tag="SSUBM407_0321"
     CDS             354304..355212
                     /locus_tag="SSUBM407_RS01770"
                     /old_locus_tag="SSUBM407_0321"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter"
                     /protein_id="WP_012774971.1"
                     /translation="MAEKRLGTLITVIAGIAWGLSGVSGQYLMSRGVSVDMITSLRLL
                     VSGLFLVGLAYATAKEQLLAVLKDKNALLGIFIFAMLGLVLNQTAYLQAIYHTNAGTA
                     TVLQYLCPILVLAYTCLKNREKPSGIELISIILAIAGTFLIATHGKLDELAVTPIGLF
                     WGIFSAFTYALYIILPGKLIRQYGSITVIGLGMLMGGFVVTLGLQTWQHRLPIDGGSF
                     LGLLGIVGVGTIFAYTAFLKGVSMVGPVNGSLLASIEPIASVFFAVWLVNEQFYAIDF
                     VGMLLILLAVLLISLKDILVAQKSIG"
     gene            355260..355889
                     /locus_tag="SSUBM407_RS01775"
                     /old_locus_tag="SSUBM407_0322"
     CDS             355260..355889
                     /locus_tag="SSUBM407_RS01775"
                     /old_locus_tag="SSUBM407_0322"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper homeostasis protein CutC"
                     /protein_id="WP_012774972.1"
                     /translation="MIKEFCSENHVGVMKALSLGAKRIELCDNLAVGGTTPSYGVVKH
                     VCQLAHENEATVMTMIRPRGGDFCYDKAEVEMMVEDCKAAIELGADGLVYGLLTEENW
                     LDEPALERLFAVSQDCQIVFHMAFDQIPRERQFEALDWLVEHGVTRILMRGSLTGSAL
                     NNVEWLQEIVAYAQGKIEILIGGGLTVDNVPTLLEALPINQVHGTRLFW"
     gene            356096..356470
                     /locus_tag="SSUBM407_RS01780"
                     /old_locus_tag="SSUBM407_0323"
     CDS             356096..356470
                     /locus_tag="SSUBM407_RS01780"
                     /old_locus_tag="SSUBM407_0323"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002935151.1"
                     /translation="MNPLRKELRTVAVEVSDLALDYAVRLAQSLNSTLRYHNYDSLIA
                     IAKTKGVEPKGKDCQSFSEYRQRYSLYDAKKLIYRALAWRLFDDSHADYGHALTILGL
                     DEDESGVEQIGFAFSKFTLDID"
     gene            356642..357181
                     /locus_tag="SSUBM407_RS01785"
                     /old_locus_tag="SSUBM407_0324"
     CDS             356642..357181
                     /locus_tag="SSUBM407_RS01785"
                     /old_locus_tag="SSUBM407_0324"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006595718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YqeG family HAD IIIA-type phosphatase"
                     /protein_id="WP_011921940.1"
                     /translation="METTVSLENYMPDFALEKAYDVTVESLKKHGIKVVFVDLDNTLI
                     AWNNPDGTPEMRQWLHDLQDAGIPVVVVSNNKYERVKRAVEKFGIEFEAFALKPFTFG
                     INRALKRFDVQPYEVIMIGDQLMTDIRAAKRAGLKSVLVKPLIKTDSINTQINRWRER
                     RTMKKIIAKYGAIDYKREM"
     gene            357182..358288
                     /gene="yqeH"
                     /locus_tag="SSUBM407_RS01790"
                     /old_locus_tag="SSUBM407_0325"
     CDS             357182..358288
                     /gene="yqeH"
                     /locus_tag="SSUBM407_RS01790"
                     /old_locus_tag="SSUBM407_0325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018363769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome biogenesis GTPase YqeH"
                     /protein_id="WP_011922650.1"
                     /translation="MEELFCIGCGAQIQTLDKAVAGFTPQSALEKGLETGQLYCQRCF
                     RLRHYNEISDVNISDDDFLKLLHSVGESDALVVNVIDIFDFNGSVIPGLPRFISGNDV
                     LLVGNKQDILPKSVKTGKVTQWLTERAHEIGMRPVDVVLTSAQNKQAIKDLIEKIEQH
                     RKGRDVYVVGVTNVGKSTLINAIIQEITGDKDVITTSRFPGTTLDKIEIPLDDGSYIY
                     DTPGIIHRHQMAHYLTAKNLKYISPRKEIKPKTYQLNPEQTLFLAGLGRFDFVAGERQ
                     GFTAFFDNELQLHRTKLQGASEFYQKHAGSLLVPPTSKELKEFPELVRHEFTINEKTD
                     VVFSGLGWIRVNEKAKIAAWAPKGVDVVIRKAII"
     gene            358558..358869
                     /gene="yhbY"
                     /locus_tag="SSUBM407_RS01795"
                     /old_locus_tag="SSUBM407_0326"
     CDS             358558..358869
                     /gene="yhbY"
                     /locus_tag="SSUBM407_RS01795"
                     /old_locus_tag="SSUBM407_0326"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002896287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome assembly RNA-binding protein YhbY"
                     /protein_id="WP_024379048.1"
                     /translation="MMLTSKQRAFLNSQAHSLKPIIQIGKNGLNDQIKTSVRQALDAR
                     ELIKVTLLQNTDENIHEVAEILEEEIGVDTVQKIGRILILFKQSSKKENRKISKQVKE
                     I"
     gene            358882..359514
                     /locus_tag="SSUBM407_RS01800"
                     /old_locus_tag="SSUBM407_0327"
     CDS             358882..359514
                     /locus_tag="SSUBM407_RS01800"
                     /old_locus_tag="SSUBM407_0327"
                     /EC_number="2.7.7.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018363771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide adenylyltransferase"
                     /protein_id="WP_004195296.1"
                     /translation="MAIELLTPFTKVELEVEKKETNRKQVGILGGNFNPVHNAHLIVA
                     DQVRQQLKLDQVLLMPEFIPPHVDKKETIDEYHRYSMLKMAIAGIEGLGIETIELERR
                     GVSYTYDTMKLLKEKNPDTDYYFIIGADMVDYLPKWHRIDELVQLVQFVGVQRPRYKA
                     GTSYPVIWVDVPLMDISSSMVRSFIKQGRVPNFMVPHEVLDYIEEKGLYQ"
     gene            359511..360098
                     /locus_tag="SSUBM407_RS01805"
                     /old_locus_tag="SSUBM407_0328"
     CDS             359511..360098
                     /locus_tag="SSUBM407_RS01805"
                     /old_locus_tag="SSUBM407_0328"
                     /EC_number="3.6.1.41"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013730149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bis(5'-nucleosyl)-tetraphosphatase (symmetrical)
                     YqeK"
                     /protein_id="WP_011921943.1"
                     /translation="MIAADLTFDRQALLEKIRVAMKPARFQHVLGVEQAALVLADQYG
                     CDPKKASLAALLHDYAKEVEDQVFLDLIAKYDLDKDLLNWDNNIWHGVVGAYKIAEDF
                     GLEDEEIFQAIQRHTVGAGQMTLLDKVLYVADYIEPNRDFPGVDEARRIAKESLDKAV
                     AYETAQTISYLAKKGIPIYPQILETYNGYVVWLKE"
     gene            360256..360366
                     /locus_tag="SSUBM407_RS01810"
     CDS             360256..360366
                     /locus_tag="SSUBM407_RS01810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histone acetyltransferase"
                     /protein_id="WP_011921944.1"
                     /translation="MTVAEEDKGFVAPNVRSLADAWLYRENGSGKELDGF"
     gene            360629..360931
                     /locus_tag="SSUBM407_RS01815"
                     /old_locus_tag="SSUBM407_0329"
     CDS             360629..360931
                     /locus_tag="SSUBM407_RS01815"
                     /old_locus_tag="SSUBM407_0329"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_074390292.1"
                     /translation="MWADEQVVGFALIDIDEDIQQYMLWRFMIGQEFQGRGYGQAALE
                     VVIAMAQSHPVCDHLIAAYVKGNQKMAHLLEKNNFVLDSEEERELVFRLETPGVQL"
     gene            360928..361438
                     /locus_tag="SSUBM407_RS01820"
                     /old_locus_tag="SSUBM407_0330"
                     /pseudo
     CDS             360928..361438
                     /locus_tag="SSUBM407_RS01820"
                     /old_locus_tag="SSUBM407_0330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935141.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine hydrolase"
     gene            361440..361799
                     /gene="rsfS"
                     /locus_tag="SSUBM407_RS01825"
                     /old_locus_tag="SSUBM407_0331"
     CDS             361440..361799
                     /gene="rsfS"
                     /locus_tag="SSUBM407_RS01825"
                     /old_locus_tag="SSUBM407_0331"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002903960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome silencing factor"
                     /protein_id="WP_011921947.1"
                     /translation="MKELDLVKVVVQAADDKRAEDLVVIDVQGVTSLTDYFVIASSMN
                     SRQLEAIAENIREKVADVGIKSSRVEGDSNGGWVLLDLGGVVVHIFSEEMRDLYNLEK
                     LWHEGSFLEVADFLEEE"
     gene            362101..362844
                     /locus_tag="SSUBM407_RS01830"
                     /old_locus_tag="SSUBM407_0332"
     CDS             362101..362844
                     /locus_tag="SSUBM407_RS01830"
                     /old_locus_tag="SSUBM407_0332"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015605324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_011921948.1"
                     /translation="MATYETFAAVYDEIMDDSLYDKWTDFSLRNLPQDTKTILELACG
                     TGIQAVRFAQKGYEVTGLDLSYEMLELAQKKAEAAGVMMELAQADMMALEGVGDFDAV
                     TCYSDSLCYMSDREAVLRVFEGVHSVLNQGGTFLFDVHSIYQMEEVFAGYSYHENYED
                     FAFVWDTYEGEHAHSIVHELTFFVKDEASQEERFIRRDEVHEERTYPIETYVELLKEA
                     GFASVEVFADFEDEAPTETSQRWFFKCKK"
     gene            362939..366991
                     /locus_tag="SSUBM407_RS01835"
                     /old_locus_tag="SSUBM407_0333"
     CDS             362939..366991
                     /locus_tag="SSUBM407_RS01835"
                     /old_locus_tag="SSUBM407_0333"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012774973.1"
                     /translation="MESLHRKISNWGQKIFLQFKNRTPNVEGISFNRLTSNKNIDLER
                     ENPSFKQALDFAIQDDELKNVAITGNYGSGKSSLLDSYEAKYSNKKFLHISLADYKEN
                     DLSGYKENDSSESGKKLNVRQINVIEGKIINQLLHQIHPKHVKKSIFKTLSRTPRRIP
                     LLLTVYIVLFFITLSYFLKPNFLKALVTADKVFGWDANTVFSWLFLILLFIGSLTTIW
                     YIVENKTIKSLTIGGKNVSSEIDIFSDQSMRVSYFDKYLDDVLYLLNESRADVIVFED
                     IDRFENNTIFAKIKELNVLVNNKRKIAKKSSKLVFLYLIRDDLFISKERTKFFDFIIP
                     VLPVITSSNSSDKLTTTLKEMGIKSGLADDFLFRISLYIDDMRLLNNICNEFYSYQLE
                     LTHDKTGEKNALDLDLKKIFAMIVYKNIFPKDFSELQNNQGFLYSLFNEKEVRRSEKL
                     TKIDSEKLHLENKLRKIQSEHIQDEIELYGTIFKIPNGRKVVSVNDKFQDEFTSYHDF
                     ISEMLVEGSRIISYVDFDDAYRNVGIKTENMDSIFPEKDSPEFKERLDTVRSRNNSKE
                     LQQKIASLNQKRSFVEKQLIADIYTNQEIHEFAKSREEFIDIEKNQQFDIIYFLLKNS
                     YIDETYPDYLTYFYGNVLTKNDKEFLRNISSGRGAGFDFRLVNISNIYHHLQLKDFRN
                     EEVLNFDLIEYMLKNLELQSREENLSAILLQEDNLDFLVELAKKLYDSKSEKYNLEQF
                     GQLMEFWLSTNPQRFIDYMKSTKVEYQAPLKNKFIRALMNQVNLDSVDNEIKALVARY
                     INENNDLISPNEDFTSFFKTNLKAINLKFTHFREPDDDAPRTTTFLELIDFIFGNSLY
                     EINKENLRFFMRWFKGSTDWSEEDFKHKNFELLHTNDNYSPLLEYSRLKITDYVYAYL
                     EICEGTILDNSEYIVELLQRNEVYESGFNLGTLEEERQIDRILQFLPDNSINFNSDDF
                     RQLVEEDILEEGNYLTLLSLLVQTSKAVVDTDIILSYFTENQNYDNSLINFINNARDL
                     KFEEDIFNLLEKEEQRNFFTKTVECMELDDTKYELILSTLGWHYTDTFNKSGIESSKL
                     RILIDLEIIQFNSKNIEFFRDNYPEDTLYLIKKHLSEYLDTKSKIYKEDELLALLDDD
                     IISDDEKTNIADHILKISIKNKQYSEKLTAHILENQFDEEDLSYIISSQFFDNQSLSL
                     KELVKQIAIENLDTIAEEFYAQISNNLMRKLIAESQLNTLKKLIYNYYVYTPNLDENE
                     KREQFSKYLNLFALSDNITALKELNVFDEWDSVLKTLNKPGTRWGQVQKTTINLAFAR
                     YLDSNNFVSSINERSNDIRLNSYKDKTIPL"
     gene            367050..368141
                     /locus_tag="SSUBM407_RS01840"
                     /old_locus_tag="SSUBM407_0334"
     CDS             367050..368141
                     /locus_tag="SSUBM407_RS01840"
                     /old_locus_tag="SSUBM407_0334"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006595726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase"
                     /protein_id="WP_011922652.1"
                     /translation="MSISGIIAEYNPFHTGHKYLLEQAEGLKIVVMSGNFMQRGEPAI
                     VDKWTRAQMALEHGADLVVEMPFLVSVQSADHFAKGAISILHRLGVEKLVFGTEEMLD
                     YQKIADIYVDKSEEMENFVKNLPDNFSYPQKTQAMWQEFAGLTFTGDTPNHILALAYA
                     KGVAGTGIQLSPVQRQGAGFHSEEVETSYASAIAIRKGADQLDLVRDFLPSASLFEEA
                     TKVSWRNYFPLLRYQITTHPDLSQVFQVNEELASRIRSAIGSVATVEELVEAVTTKRY
                     TKARVRRVLTYILINAVETPLPDAVHVLGFSARGQAYLKQVKERVGLVTRIGKEPWDS
                     LTQQADLVYQLGADAMAEQTYGRVPVRVE"
     gene            368237..368956
                     /locus_tag="SSUBM407_RS01845"
                     /old_locus_tag="SSUBM407_0335"
     CDS             368237..368956
                     /locus_tag="SSUBM407_RS01845"
                     /old_locus_tag="SSUBM407_0335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_011922653.1"
                     /translation="MKTVKEMSQLSGISVRTLHYYDEINLLTPSFIAENGYRYYDNEA
                     FEKLQEILLFRELEFPLKEIKKIVGNAAYDRESALKDQIRLLELKKKHLEKVIKHAKS
                     LQQKGENYMNFEVFDKSDLLAFQEEAKERWGNTAAFQEFSAKTNQEGFAHISAEMSGI
                     MMEFGKMKSLSADDSKVHKQVEVLKAYISENFYNCTNEILASLGQMYIADNRFTQFID
                     QVGGEGTASFVSQAIAVYCKE"
     gene            369052..371586
                     /locus_tag="SSUBM407_RS01850"
                     /old_locus_tag="SSUBM407_0336"
     CDS             369052..371586
                     /locus_tag="SSUBM407_RS01850"
                     /old_locus_tag="SSUBM407_0336"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dynamin family protein"
                     /protein_id="WP_012774974.1"
                     /translation="MTKIKIISNPFHKSIVFQKQQPITEVWEEITFESNPNSRLVREN
                     IQKGVLSFHIQEIVDILVAEYDDGTGIDLLFEGNSDEFQELKTFVQSLNNSSISLKKS
                     AYSLTNARDILPEVLSIFDKTQVILPEELEHDAAIQKFQDATKPQIPLLVLGNYSAGK
                     STFINSLVGYELLPASDQPTTAKIIQIEKFAEKWIEIEGTLLRNKVCIRIDEDGFEVE
                     GDRIDETIIKDLESIRQSLPQTTPQILARAVLAYLNAREDSDLNIITVKTAFTDSPLS
                     KSSHRYIIFDTPGSNSSTNMEHLQLLREAMAGMSNGLPIFISEYTSLDTVDNDKLYQE
                     LEQIDGIDLRYTILVVNKADTAALSTFQDHQVLNQALPRKLSTKRVYFLSSLMGLGSK
                     TSGLFQEPDYERVYQKSLAEFTDASNPYYQQLYTYNILPTQQKLAQELQSKEERNLLY
                     ANSGLYSLESEIEVFSTKYAAYNKCVQADQYLQHIISQTQSIIEDSKKTIEQEKDRLE
                     KKLEKDKLALVNDLKRQQADFFNSSSTVYQQNLNEKVRDEKHYAPLQLFIKERDSLWS
                     KAVDDFQLKSYQKEMAESPKKALNNIKNSLGKAWDKKNIEILGSAFVNGFNDTGKVFS
                     KVDDYNKMKTKAKGQVRDQLITFARFEYIKQVEEVGKDFTTLSIHYWKEQTGLIKDRF
                     SQLIGDASVLSDQKRAAIKEIIFQFQQPVLYHDSKQLFDQKSLVEGFRLGDIQIFGDA
                     NKIDLQKLEKRYNSLLKTAYKHINEQLISHHQATFYKWVEALLHLVTENIVEFSPDLH
                     STNLLIQDNRVKIEELSTNLQNLHEYSKDLHDLMAWKDDEEVANGY"
     gene            371576..374914
                     /locus_tag="SSUBM407_RS01855"
                     /old_locus_tag="SSUBM407_0337"
     CDS             371576..374914
                     /locus_tag="SSUBM407_RS01855"
                     /old_locus_tag="SSUBM407_0337"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_012775498.1"
                     /translation="MVIKKMIKKVATKAADGVSKLSELSPEQLEKVQAQMATYRDQIP
                     DLSGEAAEEYFRKQLAIAGVEVYNAYLPQLKDLYLPIDNKTEFRLEDEGVLIDEGEFK
                     SGYNIRYINITKWVTDKQENSLEKLVSVYEVLSTTPCNISLVFHRKQEETSVYLAVTN
                     TENADSNADVDSYRKRLVSAIKGNFPGAAWKEEVGRGSLPCFEDYIPYSVATASNIPT
                     EKSEKFISQTIEKLLDGIVPENKEQEYILVLLATPVLDVTDRKLHLSQIYSNLSPYAT
                     WQTQFQLTESDSRGSSATVGVNIGASVGSQTGHNLTQTHSQGQTESRGTSETETNTKG
                     SGWQAGVNIKILNGGHNWNKSKSIAKGITNTIGKTASVANAVGKTVSSSLGANFGANF
                     ARTSSVTATIGKNEGISQSFVNHHVQHALKNLDKQMERLELSTALGLWDFSAYVLSED
                     PTIANNVAHSYLALTQGEESHLSQTVVNLWRGDVQMERDKAKALTAYLRDLRHPLFGF
                     NPEILEIDEEFAVYPEIVTAATPLSGKELAYALNFPQKSIAGLPVLECAQFGRNISTF
                     EEKDDQEQLPLGNIFHMNHEENTAVQLSLPSLASHTFITGSTGTGKSNTVYQLLAQAR
                     EKGIKFLVVEPAKGEYKQVFGSDEDVAVFGTNPTITPLLKINPFSFPEGIHILEHLDR
                     LVELFNVCWPMYAAMPAVLKKAIEQAYQDCGWDLISSVNTYSKTIFPTFADVLRTIRE
                     IIDSSEYDNDNKGAYKGALLTRLESLTTGIYQLMFTEDEISSEKLFDENVIVDLSRLG
                     SSETKSLIMGLLILKMQEYRMVSSQGMNQQLRHVTVLEEAHNLLKRTSTEQATESSNL
                     LGKSVEMLTNAIAEMRTYGEGFIIADQSPGLLDLAVIRNTNTKIILRLPEYSDRELVG
                     KSANLNEEQINELAKLPKGVAAVYQNEWLEPVLCKVAKYDSTEMVFQQPTQLVRTESP
                     YHRLAILELLTTSPNLDSTLSFEELQELTLAVGLDSLTQVRIFNFLRTTSPDNFSMHE
                     LAHILGKVYPELVEKIRLKAEKGLEPPALTQVLQQEIDSSIPETISEQARRDLVQGLM
                     TCYYLFELKDHKAMQDWLRNGDLI"
     gene            374911..375510
                     /locus_tag="SSUBM407_RS01860"
                     /old_locus_tag="SSUBM407_0338"
     CDS             374911..375510
                     /locus_tag="SSUBM407_RS01860"
                     /old_locus_tag="SSUBM407_0338"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775499.1"
                     /translation="MIEGLKTVAEAVKPVVNEVGKRAIDAFEKPIDSDKRLEAASDNK
                     TTFRYDGLSKPQEFLAQAQGFPKEIAKDIYNSQELKHYMDIGMRAVQFGQKENGEPRF
                     CLIPKDLSFDRVVDSQGRTNAERLQSGLLPIKDGQPLEVHHIGQKNGGHYALLTKEEH
                     IKNGNKEMLHKPGKSDVDHSLDFARDKRSITKVLMEEQV"
     gene            375507..375917
                     /locus_tag="SSUBM407_RS01865"
                     /old_locus_tag="SSUBM407_0339"
     CDS             375507..375917
                     /locus_tag="SSUBM407_RS01865"
                     /old_locus_tag="SSUBM407_0339"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SMI1/KNR4 family protein"
                     /protein_id="WP_012774976.1"
                     /translation="MSQLVDKIKVVQGLYSGSPASEQEVAVAESKLQLIFPAEYKDYL
                     KEYGVISFYGTEWNGLKGDTWTDVVATTLEARSLYENFPKEKFILEDLHFDDMLVLAD
                     STGKVFLWHNGLEKEIHSSIASYLEECVARKDTP"
     gene            375914..376324
                     /locus_tag="SSUBM407_RS01870"
                     /old_locus_tag="SSUBM407_0340"
     CDS             375914..376324
                     /locus_tag="SSUBM407_RS01870"
                     /old_locus_tag="SSUBM407_0340"
                     /EC_number="3.5.1.88"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009247020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_012774977.1"
                     /translation="MIQPIMKDIFFLQQKSEPATQLDVQVGQDLQDTLAANAHACVGM
                     AANMIGVKKRIIIVNMGFTNLVMYNPVLISKAKPYQTEEGCLSLEGTRPTTRYQEIEV
                     EFFDASWKKISLKLTDFQAQIVQHELDHLEGIII"
     gene            376629..378728
                     /locus_tag="SSUBM407_RS01875"
                     /old_locus_tag="SSUBM407_0341"
     CDS             376629..378728
                     /locus_tag="SSUBM407_RS01875"
                     /old_locus_tag="SSUBM407_0341"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding subunit"
                     /protein_id="WP_012775500.1"
                     /translation="MNNNFNNFNNMDDIFNQLMGNMGGYSTERRRYSINGREVTPEEF
                     AMYRQTGRLPQTEEVAQTQAKGQIKSDGILAKLGRNLTQDAREGKLDPVIGRNKEIQE
                     TSEILARRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGLEA
                     GTQYRGAFEENVQNLVDEVKKAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKPAL
                     SRGELTVIGATTQDEYRNTIHKNAALARRFNEVKVNAPSAEDTYQILKGIKPLYEAHH
                     NIELPDEVLRAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDIQTLEAEMAE
                     AKQLQLEAAEKEDYEKALNEKVRIDKLQKQIDNHTEQQKVVATVNDVAQAVERMTGIP
                     VSQMGASDIERLKELKNRLAANVIGQDDAVEAVSRAIRRNRAGFDDGNHPIGSFLFVG
                     PTGVGKTELAKQLALDLFGNKDAIIRLDMSEYSDRTAVSKLIGTTAGYIGYDDNSHTL
                     TERVRRNPYSIVLMDEIEKADPQVITLLLQVLDDGHLTDGQGNQVNFKNTIIIATSNA
                     GFGYGMAEGEENQDIMDRIAPFFRPEFLNRFNAVIEFKHLDKDDLKAIVELLLAQVNN
                     TLAKKGIQLTVTEAAKEFLMEEGYDKAMGARPLRRVIENQIRDKVTDFYLDHVDVKYL
                     EADVVDGSIQIKEQSFA"
     gene            378911..380419
                     /gene="malQ"
                     /locus_tag="SSUBM407_RS01880"
                     /old_locus_tag="SSUBM407_0342"
     CDS             378911..380419
                     /gene="malQ"
                     /locus_tag="SSUBM407_RS01880"
                     /old_locus_tag="SSUBM407_0342"
                     /EC_number="2.4.1.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-alpha-glucanotransferase"
                     /protein_id="WP_011922661.1"
                     /translation="MTNRTSGILMHITSLPGKFGIGTFGQSAYDFVDFLVETKQTYWQ
                     ILPLTTTSYGDSPYQSFSAIAGNTHLIDFDLLVEDGLLATEDFQDVNFGDNPEKVDYA
                     LIYQVRRPILEKAVQAFLQDDKKKAAFLEFEKANSSWLTDYAEFMAIKEYFGNKALQE
                     WEDKKVVARNEEALDKYRLELANQIDYYKVTQYFFFSQWKQLKEYANKHHIKIIGDMP
                     IYVSADSVEVWTKPQLFKLDSERKPLYVAGVPADNFSADGQLWGNPIYDWPEHEKTGY
                     NWWIYRIHESFKLYDVLRIDHFKGFSDFWQVDGKAEVAKVGTWEPGPGYNLFKAVKET
                     LGDLPIIAEDLGNIDAKARKLLADCGYPGMKILEFGFFDVTGKSIDAPHRCIPNSVAY
                     TGTHDNEVVNGWYNNLDPEQQEYVDAYSNRKPIEKVSQAMLRMLFATVSDTAIATMQD
                     VLDLGEESRMNMPSTIGGNWEWRMKAEDLTQERKDFLTKMTLLYQRGNENHD"
     gene            380412..382676
                     /locus_tag="SSUBM407_RS01885"
                     /old_locus_tag="SSUBM407_0343"
     CDS             380412..382676
                     /locus_tag="SSUBM407_RS01885"
                     /old_locus_tag="SSUBM407_0343"
                     /EC_number="2.4.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018364851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen/starch/alpha-glucan family
                     phosphorylase"
                     /protein_id="WP_012774979.1"
                     /translation="MTKFTTFAETNTSKKLADLTNEEIYLQLLNYVKDAAASKPKNTG
                     KRKVYYISAEFLIGKLLSNNLINLGVYKDVQAELAAAGKSLAQVEDVEPEPSLGNGGL
                     GRLASCFVDSMSTLAINGEGVGLNYHCGLFRQVFKKNEQEAEPNFWIENDSWLIPTTI
                     SYDVPFKNFTLKSKLDRLDILGYKKETKNYLNLFDIESVNYDLITDGISFDKTDIKEN
                     LTLFLYPDDSDKNGELLRIYQQYFMVSNAAQLLIDEAIERGSNLHDLADYAYVQINDT
                     HPSMVIPELIRLLTEKHGIEFAEAVAIVKNMTGYTNHTILAEALEKWPLEFLEEVVPH
                     LVDIIKELDALIRAEIKDPAVQIIDESGRVHMAHMDIHFSNSVNGVAALHTEILKNSE
                     LKAFYELYPEKFNNKTNGITFRRWLEFANQDLADYIKELIGDEYLTDATKLEKLLAFA
                     DDKEVHAKLAEIKFNNKLALKRYLKDNKGIELDENSIIDTQIKRFHEYKRQQMNALYV
                     IHKYLEIKNGNLPKRKITVIFGGKAAPAYIIAQDIIHLILCLSELINNDPEVNKYLNV
                     HLVENYNVTVAEKLIPATDISEQISLASKEASGTGNMKFMLNGALTLGTMDGANVEIA
                     ELAGMDNIYTFGKDSDTIIDLYDKAGYVSADYYNGDANIKRAVDFIVSDEVKALGNEE
                     RLGRLHHELISKDWFMTLIDLAEYIEVKEQVFADYEDQDSWNKKVVHNIAKAGFFSSD
                     RTIEQYNEDIWHSN"
     gene            complement(382904..383611)
                     /locus_tag="SSUBM407_RS01890"
                     /old_locus_tag="SSUBM407_0344"
     CDS             complement(382904..383611)
                     /locus_tag="SSUBM407_RS01890"
                     /old_locus_tag="SSUBM407_0344"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018367901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTRA domain-containing protein"
                     /protein_id="WP_004194205.1"
                     /translation="MSKYKKVYQDIKKKIEEQVWSTGQALPTENELMEVYSYSKDTIR
                     KALSLLEMDGYIQKKQGKSSIVIEHGLMKDQYLSEIKTAGELNKRSQHQIQTQLTSLY
                     IIQGQEDLMSTFEVDDKVDFYRVSRVRTIDGERLEYDISYFDRRVVPYLSKEIAESSI
                     YRYLEEELHLTISHSRREISFRFANEEEKQLMDLGDYDMVVVVTSITYLSNGQAFQYG
                     TISYRPDKVSFVSMAKR"
     gene            383810..384601
                     /locus_tag="SSUBM407_RS01895"
                     /old_locus_tag="SSUBM407_0345"
     CDS             383810..384601
                     /locus_tag="SSUBM407_RS01895"
                     /old_locus_tag="SSUBM407_0345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase family
                     protein"
                     /protein_id="WP_011921968.1"
                     /translation="MKLLTINVHAWLEERQDEKLDVLAQTIAEKAYDVIALQEVNQLI
                     TADLVTKDLKADNYGLILLEKLRTLGQFDYSYYWSNSHIGYDKYEEGIAFLTKLPVYE
                     VDQFYCSQNKSIDSILSRKIMGLTVFYQDQLIDLYSCHINLPGSEEEDQLDNIRTIVE
                     RTGNRRFKILMGDFNTDAFSDREAYEAITELGLYDSYNLAMEKDQGITVEKAIDGWAG
                     HSQEKRLDYIFLNQKKEVLSSLVIFNGENRPIISDHFGVEVEINV"
     gene            384635..386803
                     /locus_tag="SSUBM407_RS01900"
                     /old_locus_tag="SSUBM407_0346"
     CDS             384635..386803
                     /locus_tag="SSUBM407_RS01900"
                     /old_locus_tag="SSUBM407_0346"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013730154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS glucose transporter subunit IIABC"
                     /protein_id="WP_011922665.1"
                     /translation="MKKFLSFEFWQKFGKCLMVVIAVMPAAGLMVSIGNSIPLISPES
                     ELLIRIGNIIAQIGWGIIGNLHLLFALAIGGSWAKEKAGGAFSAGLAFILINLITGHF
                     FGVTTDMLADAAATVTTVFGTEIPVSGYFVNILGQPALNMGVFVGIIAGFVGATTYNK
                     YYNYRKLPDVLTFFNGKRFVPFVVIYRSVLVALGLAIFWPVVQTGINSFGKWIASSQD
                     TAPILAPFVYGTLERLLLPFGLHHMLTIPMNYTSLGGTYDILTGAQAGTQVFGQDPLW
                     LAWITDLINLKDAGDMAQYNDLLANITPARFKVGQMIGSSGILMGLTYAMYRNVDEDK
                     KHKYKGMFISSALAVFLTGVTEPIEFMFMFAAMPLYVVYAFVQGAAFAMADIVNLRMH
                     SFGNIEFLTRTPMAIKAGIGMDVINFIWVTALFAVGMYFIANFMIKKFNLATAGRNGN
                     YDTETTDVVSNSNVDTADANSQVVQIINLLGGRDNIADVDACMTRLRVSVKDVAQVGD
                     ENAWKQAGAMGLIIKDSGVQAVYGPKADVLKSDIQDLLESGVAIPRTEIVATEEVAPE
                     TQFKGVTETVYSVAEGQAIAITEVKDPVFSQKMMGDGYAVEPSSGNVYAPVSGIVTSV
                     FPTKHAVGILSDKGVEVLVHVGLDTVALNGAPFSTKVTDGQRVEAGDLLLVADLEAIR
                     SAGRETTIVVAFTNTAEIKSVSLENLGQVSQDSQVATVEL"
     gene            complement(386874..387500)
                     /locus_tag="SSUBM407_RS01905"
                     /old_locus_tag="SSUBM407_0347"
     CDS             complement(386874..387500)
                     /locus_tag="SSUBM407_RS01905"
                     /old_locus_tag="SSUBM407_0347"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2812 domain-containing protein"
                     /protein_id="WP_011922666.1"
                     /translation="MIRHKLFTSLQEEEHWINSIQSEGYQLVKVTPWTATYHFEKCSR
                     TPHPVRLDFHEHIAKGEYSNYLSLFEDCGWQPIQGSRRCGIHYFQQTIETSSTEIFSD
                     TESKKAFYSRYQNYAYSYFGLFLTLFFIHYQVGLQNGYTLWNPKSWYLTPGLWERTGT
                     SFWFGFLFETPFALFRSGIIPLFFLAWSIYFLHIAEKGKKEAKKLEKY"
     gene            complement(387511..387822)
                     /locus_tag="SSUBM407_RS01910"
                     /old_locus_tag="SSUBM407_0348"
     CDS             complement(387511..387822)
                     /locus_tag="SSUBM407_RS01910"
                     /old_locus_tag="SSUBM407_0348"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000827864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_004194196.1"
                     /translation="MKRNKHLPLTETTYYILLALLEPAHGYHIMQKVEDMSDGDVKIA
                     AGTMYGAIENLLKLKWICSVPSSDKRRKVYQVTATGQEIIKLETQRIQKLHHIAKELG
                     F"
     gene            387983..388699
                     /locus_tag="SSUBM407_RS01915"
                     /old_locus_tag="SSUBM407_0349"
     CDS             387983..388699
                     /locus_tag="SSUBM407_RS01915"
                     /old_locus_tag="SSUBM407_0349"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008088325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YebC/PmpR family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_004194195.1"
                     /translation="MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKGDPDPETN
                     SALKFVIDRAKQAQVPKHIIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSN
                     VNRTAANVRSAFGKNGGNMGASGSVSFMFDKKGVVVFAGDDADAIFELLLEADVEVDD
                     VEAEDGTITVYTAPTDLHKAIVALKESGIQEFNVTELEMIPQSEVSLEGDDLATFEKL
                     YDALEDDEDVQKIYTNVDGF"
     gene            389200..390048
                     /locus_tag="SSUBM407_RS01920"
                     /old_locus_tag="SSUBM407_0350"
     CDS             389200..390048
                     /locus_tag="SSUBM407_RS01920"
                     /old_locus_tag="SSUBM407_0350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-l-methionine hydroxide
                     adenosyltransferase family protein"
                     /protein_id="WP_004194192.1"
                     /translation="MSNNLLVLQSDFGLVDGAVSAMIGVALQESRDLVVHHLTHDITP
                     YNIFEGSYRLFQTVEYWPEGTTFVSVVDPGVGSKRKSVVALTEQNHYIVTPDNGTLSF
                     IKKYVGIKAVREISEVANRRANTEHSYTFHGRDVYAYTGAKLASGHISFEEVGPELSV
                     DKIVEIPTVPTEVGSDYVKGAIDILDVRFGSLWTSITREEFYTLQPQFEDRFEVTIYN
                     NDMLVYQNQVTYGKSFADVRIGQPLIYINSLYRVGVAINQGSFAKAYNVGVGQNWHIE
                     IKRISN"
     gene            390069..390614
                     /locus_tag="SSUBM407_RS01925"
                     /old_locus_tag="SSUBM407_0351"
     CDS             390069..390614
                     /locus_tag="SSUBM407_RS01925"
                     /old_locus_tag="SSUBM407_0351"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003077954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ECF-type riboflavin transporter
                     substrate-binding protein"
                     /protein_id="WP_011921974.1"
                     /translation="MKNNSIKTVVATGIGAALFVVIGHLINIPTFVPNTSIQLQYAVQ
                     SLLAVVFGPVVGFLVGFIGHTLKDSLTYGPWWSWILASGVFGLVVGLTKKRLRIQEGI
                     FEGKDILFFNLVQIAANVLAWGVIAPVLDILIYSEAANKVFAQGLVAGIANSITIAIA
                     GTLLLVVYAKSQTKTGSLSKD"
     gene            390722..391642
                     /locus_tag="SSUBM407_RS01930"
                     /old_locus_tag="SSUBM407_0352"
     CDS             390722..391642
                     /locus_tag="SSUBM407_RS01930"
                     /old_locus_tag="SSUBM407_0352"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012774980.1"
                     /translation="MVWTEEKLGPIIHSILNPDEEVLSLYQSKTTKSIYGCILWNNYY
                     YKVFRVSNHPSQSTYKQPTFYDFHGEFYMKGAIRTYLYHTNSWYELSKQGYYLLLFFQ
                     KLWDEKQEVEASWQNGRMQIRLVVEEEGWQVHYRFPDNQAREVERLLGSGMLVAIRSS
                     RNFIKIRTSRFVAPYIALIKQRQLYRKKPSKAMLQWEKYQSQLIEIQRTYRLVEESAP
                     QTFFGHWLNKVQLYLCSAIASYWEEVIKGVEWQEAREIKEQRKAEKPHNPIEDKWKEN
                     IARRHKRKMDQLIGHDTLEKLRQLKTELDD"
     gene            391855..392838
                     /locus_tag="SSUBM407_RS01935"
                     /old_locus_tag="SSUBM407_0353"
     CDS             391855..392838
                     /locus_tag="SSUBM407_RS01935"
                     /old_locus_tag="SSUBM407_0353"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-related sulfurtransferase"
                     /protein_id="WP_009909407.1"
                     /translation="MSKDIRVLLYYKYVPIENAKEYAAEHLAFCKSIGLKGRILIADE
                     GINGTVSGDYETTQKYMDYVHANPLFSDLWFKIDEENEQAFKKMFVRYKKEIVHLGLE
                     DNDFDNDIDPLVTTGAYLSPKEFKEALLDEDTVVLDTRNDYEYDLGHFRGAIRPDIRN
                     FRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKD
                     PEVRGELWDGKMYVFDERIAVDVNHVNPVVVGKDWFDGTPCERYVNCGNPFCNRRILT
                     SEENEHKYVRGCSAECRAHERNRYISENGLTRQEWAERLEAIGETLTPANA"
     repeat_region   complement(392978..393076)
                     /note="Imperfect repeat RepSU1"
                     /rpt_family="RepSU1"
     gene            393165..393407
                     /locus_tag="SSUBM407_RS01940"
                     /old_locus_tag="SSUBM407_0354"
     CDS             393165..393407
                     /locus_tag="SSUBM407_RS01940"
                     /old_locus_tag="SSUBM407_0354"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactoylglutathione lyase"
                     /protein_id="WP_011921977.1"
                     /translation="MPKGGNLILMQADSFAQRVPFQVVASGNEVLISLNVASREEVDR
                     IIERVEANGGQITGCPTDARGFYGASFTDLDGIILM"
     gene            393525..395198
                     /locus_tag="SSUBM407_RS01945"
                     /old_locus_tag="SSUBM407_0355"
     CDS             393525..395198
                     /locus_tag="SSUBM407_RS01945"
                     /old_locus_tag="SSUBM407_0355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011921978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011921978.1"
                     /translation="MKKIIEFKDFTFKYQAQQEPTLKDIQLTIYQGEKVLIIGPSGSG
                     KSTIGQCLNGIIPNIYKGEHSGSLLLDGQEAFNLSVYDKSLLVSTVLQDTDGQFIGLS
                     VAEDLAFALENDMESQVVMKQKVGDWAERLSLTDLLAHRPQDLSGGQKQRVSLGGVLI
                     DESPILLFDEPLANLDPKSGQDTIDLIDRLHKQEGTTTIIIEHRLEDVLYRQVDRVVL
                     INDGRILFNGGPDDLLRTSLLQENGIREPLYLSTLRALGYPIAQAERLSSVWEIDIEA
                     LNIASLPTLHFENGEKEALLEVKHLYFSYPNKQVLTDIQLTIHKGERLAIVGKNGAGK
                     STLAKVLCGFIQGEGEILWKGQSIKEDSVKERAERIGYVLQNPNQMISQTMIFDEVAL
                     GLRMRGVTEEEIEHRVHHILKVCGLYPFRNWPISALSYGQKKRVTIASILVLNPEIIL
                     LDEPTAGQDQRHYREMMEFLDQLNAQGHTIVMITHDMQLMLDYSDRAVVVVDGQIIED
                     ASPAEILSDDTVIERANLKETSIFHLAERVGVNPLELTTFYMQEERRGR"
     gene            395195..396028
                     /locus_tag="SSUBM407_RS01950"
                     /old_locus_tag="SSUBM407_0356"
     CDS             395195..396028
                     /locus_tag="SSUBM407_RS01950"
                     /old_locus_tag="SSUBM407_0356"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy-coupling factor transporter transmembrane
                     protein EcfT"
                     /protein_id="WP_011921979.1"
                     /translation="MSQQKLIGYHPGTGLIHSLSAVSKLLFFLIVSILAMITYDTRLI
                     LFIAVFSLALFKMSGIRYKEISLVLILTIIFAAMNALMVHLFAPRYGVELYGADTPLL
                     SGLGVYSLTSQQAFYLVNLLLKYFCTVPLAIIFLMTTHPSQFASSLNQIGVSYKVAYA
                     VSLTMRYIPDIQEEFYTIRMSQEARGLELSKKGKLMDRIKGNLSLVIPLIFSSLERID
                     TISTAMELRRFGKNKKRTWYTQQPLQRIDYAVLLFILALVVVTIYLFFVNQGRFYNPW
                     R"
     gene            396188..396391
                     /locus_tag="SSUBM407_RS01955"
                     /old_locus_tag="SSUBM407_0357"
     CDS             396188..396391
                     /locus_tag="SSUBM407_RS01955"
                     /old_locus_tag="SSUBM407_0357"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="WP_004195223.1"
                     /translation="MVQGTVKWFNAEKGFGFIAQENGPDVFAHFSEIQSNGFKSLEDG
                     QKVTFEVEQGQRGLQATNITKIG"
     gene            complement(396433..397146)
                     /gene="rsmG"
                     /locus_tag="SSUBM407_RS01960"
                     /old_locus_tag="SSUBM407_0358"
     CDS             complement(396433..397146)
                     /gene="rsmG"
                     /locus_tag="SSUBM407_RS01960"
                     /old_locus_tag="SSUBM407_0358"
                     /EC_number="2.1.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004252494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (guanine(527)-N(7))-methyltransferase
                     RsmG"
                     /protein_id="WP_011921980.1"
                     /translation="MKPEVFYKTLADQGIQLTDQQKHQFHRYFQLLVEWNEKINLTAI
                     TEESEVYLKHFYDSIAPLLQGHIQNEPLRLLDIGAGAGFPSLPMKIIFPQLDVTIIDS
                     LNKRINFLHLLAEELELEGVHFYHGRAEDFAQDKNFRAQFDLVTARAVARMQILSELT
                     IPYLKLHGKLIALKASSAEDELTQAKNALNLLFAKVIENHDYTLPNGDPRTLTIVEKK
                     KETPNKFPRKAGMPNKRPL"
     gene            complement(397205..399379)
                     /locus_tag="SSUBM407_RS01965"
                     /old_locus_tag="SSUBM407_0359"
     CDS             complement(397205..399379)
                     /locus_tag="SSUBM407_RS01965"
                     /old_locus_tag="SSUBM407_0359"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005591061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PBP1A family penicillin-binding protein"
                     /protein_id="WP_014636231.1"
                     /translation="MKTTTIKKALLITANILLAGAIIACLAGAALVVYYIQSAPELTE
                     ESLTATVSSKIYDKNGNLIADLGAEKRSSAKTEEIPTDLVNAIVAIEDQRFFNHRGVD
                     VIRIAGSLINNLSGGRLQGGSTLDQQFIKLTYFSTSVEDQNLKRKIQEAWLATQLERR
                     NTKQEILTYYINKVYMSNGNYGMKTAALAFYGKELKDLTLPQLALLAGMPQAPNQYDP
                     YTNPEDAKARRDLVLAEMLEEKYIDNTQYEQAVLTPVTDGLQPLSNAAAYPAYMDNYL
                     KQVVEEVEAKTGYNLLTTGMDVYTNVDPAAQQQLWNIYNTDMYVSYPDDLLQVASTVV
                     DVSNGKVVAQLGGRKQETNVSFGTNQAVETNRDFGSTMKPITDYAPAFENGIYTSTAD
                     LILDGPYNYPGTPTPVNNWDKQYYGNISVKTAIQYSRNVTAVKALEATGLENALKFLN
                     SVGINYPDIHYSNAISSNTSDTSSKYGASSEKMAAAYAAFANGGTYYAPQYVNKIVFS
                     DGTVTEYAPKGTKVMSAETAYMMTDMMKAVMSYGYGLNASVSGVPMAGKTGTSNYTDS
                     ETDTILASIPEANYSYMVVPDENFVGYSSQYAMAVWTGYTNRMTPILDNSMRIATDVY
                     HNMMLFMHSDYTATDWEMPSGLVRYGSNYYLRGSRSLSNAYNTYTSSSTSSSSSTETS
                     ETTEATTTSSETSSGTATETATSSTETATTGNNPATGQTDGQ"
     gene            complement(399360..399977)
                     /gene="recU"
                     /locus_tag="SSUBM407_RS01970"
                     /old_locus_tag="SSUBM407_0360"
     CDS             complement(399360..399977)
                     /gene="recU"
                     /locus_tag="SSUBM407_RS01970"
                     /old_locus_tag="SSUBM407_0360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase RecU"
                     /protein_id="WP_004194173.1"
                     /translation="MVNYPHKVSKKINRTSPISSQRVNFANRGMSFEAAINDSNQYYL
                     AHDIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYSGVFKRHYIDFEAKET
                     RQKASMPMKNFHAHQIEHMKQVVKQGGICFVLLHFSTLKETYLLPATHLIEFYQVDMG
                     SKSMPLTFIRQYGFEIQMGRFPSIPYLEIVEKNLLGGESFENYNN"
     gene            400043..400582
                     /locus_tag="SSUBM407_RS01975"
                     /old_locus_tag="SSUBM407_0361"
     CDS             400043..400582
                     /locus_tag="SSUBM407_RS01975"
                     /old_locus_tag="SSUBM407_0361"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1273 domain-containing protein"
                     /protein_id="WP_004194171.1"
                     /translation="MDTKSLLVTGYRHTDLGIFSEKDPRLHIIKSAIRRNFIRFLEEG
                     VSWFILTGQLGFEYWSLEVLEDLRAEGYQLSIATIFPFENHGEQWNEANQAKLARFKQ
                     VDFVKYAYPRYENPGQFRDYNQFLLDNTTGCYLFYDSENETNLKYLYHMVLKKEGYNR
                     KTLTFEELNEEAENFSNSE"
     gene            400653..400988
                     /gene="gpsB"
                     /locus_tag="SSUBM407_RS01980"
                     /old_locus_tag="SSUBM407_0362"
     CDS             400653..400988
                     /gene="gpsB"
                     /locus_tag="SSUBM407_RS01980"
                     /old_locus_tag="SSUBM407_0362"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division regulator GpsB"
                     /protein_id="WP_004194167.1"
                     /translation="MASIKFTTKDIFEQDFKIGFRGYDQDEVNDFLDDIMKDYDAYEA
                     IIKELKGEIARLKAQAANSPKTTLPTEESNDVLRTERPSSATNFDILRRLNRLEKEVF
                     GKQIVQDQE"
     gene            401127..401491
                     /gene="rnpB"
                     /locus_tag="SSUBM407_RS01985"
                     /old_locus_tag="SSUBM407_m0002"
     ncRNA           401127..401491
                     /ncRNA_class="RNase_P_RNA"
                     /gene="rnpB"
                     /locus_tag="SSUBM407_RS01985"
                     /old_locus_tag="SSUBM407_m0002"
                     /product="RNase P RNA component class B"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00011"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00011"
     gene            401545..402711
                     /locus_tag="SSUBM407_RS01990"
                     /old_locus_tag="SSUBM407_0363"
     CDS             401545..402711
                     /locus_tag="SSUBM407_RS01990"
                     /old_locus_tag="SSUBM407_0363"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent RNA methyltransferase"
                     /protein_id="WP_011921983.1"
                     /translation="MKKQFELIATAAAGLEAVVGREIRNLGYECQVENGRVRFQGDVK
                     SIIETNIWLRSADRIKIIVGQFPAKTFEELFQGVFNLDWENYLPLGCKFPISKAKCVK
                     SKLHNEPSVQAISKKAVVKKLQKHFSRPEGVPLQEMGAEFKIEVSILKDVATVMIDTT
                     GSSLFKRGYRVEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAAMLAKN
                     IAPGLKRSFAFEEWPWVEDQLVVALRKEAQASIKTDLVLDITGSDIDARMIEIAKKNA
                     FAAGVEQDIVFKQMRVQDLRTDKINGVIISNPPYGERLLDDEAIVTLYREMGETFEPL
                     KTWSKFILTSDELFETRFGQQADKKRKLYNGTLKVDLYQFFGQRVKRQVQEVQG"
     gene            402721..404175
                     /locus_tag="SSUBM407_RS01995"
                     /old_locus_tag="SSUBM407_0364"
     CDS             402721..404175
                     /locus_tag="SSUBM407_RS01995"
                     /old_locus_tag="SSUBM407_0364"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011921984.1"
                     /translation="MGEKNSHHLPLDEEKVLDFEVAKDLTIEEAVKKHKEIEAGVTED
                     DGLLDRYIKQHRAEIESQKFETKINHLPLVEVADEEKNQGHESAEEVEANESSLTEVS
                     EEIAPIVEELSVTPMETLEETVIASTVAMEGLSSVADDSSLELEEDETEDLDHSEGAD
                     RDQKKKFYFWSAVGLSMIGVMATALVWMNSVNKSNTATSSSSTSTSQTSSTASSSTDA
                     NVTAFEQLYNSFFTDSSLTKLKNSEFGKLAELKVLLEKLDKNSDSYTKAKEQYDHLEK
                     AIAAIQAINGQFDKEVVVNGEIDTTATVKSGESLSATTTGISAVDSLLASVVNFGRSQ
                     QEVASATVASEAAVTRNQGADETVSTGVPATTEVASTTVSGSTTDFGIAVPAGVVLQR
                     DRSRVPYNQAMIDDVNNEAWNFNPGILENIVTISQQRGYITGNQYILEKVNIINGNGY
                     YNMFKPDGTYLFSINCKTGYFVGNGAGHSDALDY"
     gene            complement(404558..405040)
                     /locus_tag="SSUBM407_RS02000"
                     /old_locus_tag="SSUBM407_0365"
     CDS             complement(404558..405040)
                     /locus_tag="SSUBM407_RS02000"
                     /old_locus_tag="SSUBM407_0365"
                     /EC_number="4.4.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003044751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-ribosylhomocysteine lyase"
                     /protein_id="WP_004194159.1"
                     /translation="MKKEVTVESFELDHTIVKAPYIRLISEEVGPKGDIITNFDIRLI
                     QPNENAMDTAGLHTIEHLLAKLIRQRIDGLIDCSPFGCRTGFHMIMWGKQDSEKIAQV
                     IKSSLEEIAEGITWEDVPGTTIESCGNYKDHSLHSAKEWAKLILSQGISTDAFERKPI
                     "
     gene            405170..406783
                     /locus_tag="SSUBM407_RS02005"
                     /old_locus_tag="SSUBM407_0366"
     CDS             405170..406783
                     /locus_tag="SSUBM407_RS02005"
                     /old_locus_tag="SSUBM407_0366"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018166893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease Y"
                     /protein_id="WP_011921986.1"
                     /translation="MNIITVVVTLVSALIGLVLGYFAISLKMKSAKETAELTLLNAEQ
                     EASNVRGRAEEQAEVILKTAERDRQTLKKELLLEAKEEARKYREEIAEEFKSERQELK
                     QIESRLTERATSLDRKDDNLTNKEKTLEQKEQSLTDKAKHIDEREQEVVKLEEQKALE
                     LERVAALSQEEAKEIILTDTRDKLTHEIATRIKEAEREVKERSDKMAKDLLAQAMQRI
                     SGEYVAEQTITSVHLPDDAMKGRIIGREGRNIRTFESLTGIDVIIDDTPEVVVLSGFD
                     PIRREIARMTMETLLQDGRIHPARIEELVEKHRVEMDNRIREYGEAAAYEVGAPNLHP
                     DLIKIMGRLHFRTSYGQNVLRHSIEVAKLAGVLAAELGENVNLARRAGFLHDVGKAID
                     REVDGSHVEIGTELAKKYKENPIVINAIASHHGDVEATSTIAVIVAAADALSAARPGS
                     RRESMEAYIKRLQDLEEIANSFEGIKQSYAIQAGREIRIIVHPNKVTDDQITILAHDV
                     REKIENNLDYPGNIKITVIRETRATDVAK"
     gene            406938..407564
                     /gene="gmk"
                     /locus_tag="SSUBM407_RS02010"
                     /old_locus_tag="SSUBM407_0367"
     CDS             406938..407564
                     /gene="gmk"
                     /locus_tag="SSUBM407_RS02010"
                     /old_locus_tag="SSUBM407_0367"
                     /EC_number="2.7.4.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="WP_012774981.1"
                     /translation="MKERGLLIVFSGPSGVGKGTVRKEIFESSDNKFEYSVSMTTRPQ
                     RPGEVDGVDYFFRSREEFEDLIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLE
                     IEVQGALQVKKKVPDGVFIFLTPPDLEELQDRLIGRGTDSEEVIAQRIERAKEEIALM
                     REYDYAVVNDEVPLAAERVKRIIEAEHFRVDRVIGRYDEMIREQIVER"
     gene            407588..407902
                     /locus_tag="SSUBM407_RS02015"
                     /old_locus_tag="SSUBM407_0368"
     CDS             407588..407902
                     /locus_tag="SSUBM407_RS02015"
                     /old_locus_tag="SSUBM407_0368"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001817694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="WP_004194153.1"
                     /translation="MMLKPSIDTLLDKVPSKYSLVILEAKRAHELEAGAKPTQEFTSV
                     KSTLRALEEIESGNVVIHPDPEAKREAVRRRAEEAKRLAEEEERKIKAQIAKEKEEGE
                     KI"
     gene            408095..410485
                     /locus_tag="SSUBM407_RS02020"
                     /old_locus_tag="SSUBM407_0369"
     CDS             408095..410485
                     /locus_tag="SSUBM407_RS02020"
                     /old_locus_tag="SSUBM407_0369"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009732335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal protein N'"
                     /protein_id="WP_012774982.1"
                     /translation="MLAQIIVDVPLMQTDQAYSYRVPAELEEGLKVGVRVHVPFGKGN
                     RLIQGIVVDLIDEDDENSLQDLKELAEVLDYSPVLNQEQFWLADQMRKSVFSYKITLL
                     KSMLPSLLNSTYDKLIRPGIGLEMAEQISLFGDKEQIRFSDLDVTEQGKIMRLAQSGK
                     ILVDYVAKDKKQIKTEKWYRVCLEKLREADISNRAKKRQQLREFLLEQSEDQLLSNLK
                     SDYSADTLRYFQEKGYIEVWEEEVSRTQGVFDKVEKTQALDLNPEQAIAVREIVASIG
                     QESQTFLLQGVTGSGKTEVYLQVIDRVLKMGKTAIMLVPEISLTPQMTNRFISRFGQQ
                     VAILHSGLSDGEKYDEWRKIEAGNAQVVVGARSAIFAPLTNLGVIIIDEEHEATYKQD
                     SNPRYHARDVAKLRADYNRATLVLGSATPSLETRARASRGVYGRLTLNQRANPLARIP
                     EVEVVDFRDYIGQQEASNFTPVLIEKIREKLARKEQVVLMLNRRGYSSFVMCRDCGSV
                     DQCPNCDISLTLHMDTKTMNCHYCGFQKGIPQTCPNCQSRSIRYYGTGTQKAYDELQE
                     LLPEARILRMDVDTTKKKGAHEDLLERFGRGEADILLGTQMIAKGLDFPNVTLVGVLN
                     ADTALNLPDFRSSERTFQLLTQVAGRAGRADKEGEVLIQTYNPNHYAIAFAKEQDYEG
                     FYRYEMDIRKNLGYPPYYFTVGLTFSHKSEEFVVKKAYETVAFLRQHLTDAIQILGPT
                     PKPIARTHNLYHYQIILKYRHEDRLEEVLNQILDWTQERENQDLRLIIDNEPQNMM"
     gene            410617..411555
                     /locus_tag="SSUBM407_RS02025"
                     /old_locus_tag="SSUBM407_0370"
     CDS             410617..411555
                     /locus_tag="SSUBM407_RS02025"
                     /old_locus_tag="SSUBM407_0370"
                     /EC_number="2.1.2.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013730159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="WP_011921989.1"
                     /translation="MTKLIFMGTPAFSATVLRGLLADGNYNILAVVTQPDRAVGRKKV
                     IQMTPVKEVALEYNLPVYQPEKLSGSQEMDELMNLGADGIVTAAFGQFLPTKLLNSVD
                     FAVNVHASLLPKYRGGAPIHYALINGDERAGVTIMEMVKEMDAGDMISSDSIAIEESD
                     NVGTLFEKLAVVGRDLLLQTLPAYIAGDLKPVAQNPEQVTFSPNIQPEEEVLDWNKTA
                     RQLFNQIRGMYPWPVAHTYWQGERFKIQEAVEAEGEGSVGRVIARSKKELIIATGQGA
                     LSLKTVQPAGKPKMTIADFLNGAGRDIAVGDQFGDQ"
     gene            411545..412855
                     /gene="rsmB"
                     /locus_tag="SSUBM407_RS02030"
                     /old_locus_tag="SSUBM407_0371"
     CDS             411545..412855
                     /gene="rsmB"
                     /locus_tag="SSUBM407_RS02030"
                     /old_locus_tag="SSUBM407_0371"
                     /EC_number="2.1.1.176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (cytosine(967)-C(5))-methyltransferase
                     RsmB"
                     /protein_id="WP_014636233.1"
                     /translation="MINKHETARSLALSVLEQVFDQGAYSNIALNKALESSRLSAQDK
                     GLATELVYGTVSRKITLEWYLAHFIEDREKLDTWVYYLLMLSLYQLVYLDKLPTHAVV
                     NEAVNIAKRKPGTDKFVNAILRKLSQDSLPKPADIKRKNKRLSVQYSVPVWLVQTLIA
                     EYGDERAEKIFQSLHDRNKASVRVTDGQQVERLAEELGAQHSQLSPVGLVKPHGHFAG
                     TDYFKEGLITIQDETSQLVAPTLDIQGDEIILDACAAPGGKTCHMASYLTDGKVYALD
                     LYDHKLNLIEENARRLGLADKIETKGLDASRVHEEFGPDTFDKILVDAPCSGIGLIRR
                     KPDIRYNKASMDFDSLKTIQLQILDSVCQSLKIGGIITYSTCTIIAKENQEVIQEFLQ
                     NHPNFEQVTLEHPQTDIMVDGCLLITPEQYKTDGFFIGQLRRKS"
     gene            412893..413630
                     /locus_tag="SSUBM407_RS02035"
                     /old_locus_tag="SSUBM407_0372"
     CDS             412893..413630
                     /locus_tag="SSUBM407_RS02035"
                     /old_locus_tag="SSUBM407_0372"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Stp1/IreP family PP2C-type Ser/Thr phosphatase"
                     /protein_id="WP_012774983.1"
                     /translation="MEIALLTDVGQKRSNNQDYINRYKNRAGIDLVVLADGMGGHRAG
                     HIASEMAATDLGAAWVDTQLVTLNDVREWMVAIIDAENQKIHELGQTEEYKGMGTTLE
                     AVVVIDNQMIYAHVGDSRVGLIRDGEYTRLTNDHSLVGALVRAGQLTEEEAQRHPQKN
                     IVTQSIGQAEPIEPDIALKTLEVGDYVLINSDGLTNMIPTEDIRDIVLSDVSIESKVE
                     TLVRFANNAGGLDNITVGLLHITEEAR"
     gene            413630..415624
                     /gene="pknB"
                     /locus_tag="SSUBM407_RS02040"
                     /old_locus_tag="SSUBM407_0373"
     CDS             413630..415624
                     /gene="pknB"
                     /locus_tag="SSUBM407_RS02040"
                     /old_locus_tag="SSUBM407_0373"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014635866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Stk1 family PASTA domain-containing Ser/Thr
                     kinase"
                     /protein_id="WP_011921992.1"
                     /translation="MIQIGKIFAGRYRIVRQIGRGGMADVYLARDLILDGEEVAVKVL
                     RTNYQTDQIAIQRFQREARAMAELDHPNIVRISDIGEEDGQQYLAMEYVNGLDLKRYI
                     KENAPLSNDVAVRIMGQILLAMRMAHTRGIVHRDLKPQNVLLTSNGVAKVTDFGIAVA
                     FAETSLTQTNSMLGSVHYLSPEQARGSKATIQSDIYAMGIILFEMLTGRIPYDGDSAV
                     TIALQHFQKPLPSVREENANVPQALENVVLKATAKKLNERYKSVAEMYADLASALSMD
                     RQNEPRVELEGNKVDTKTLPKLSQANVETKVPHTNSSAQVSATDKGSGKKEVAKSGNK
                     PVSKPRPGIRTRYKVLIGAILLTVIAAGLMFFNTPRTVTVPDVSGQTVEKATEMIEVA
                     GLEVGNITEEATATVDEGLVIRTSPAAKTTRRQGSKIDIVVATAALASIPDVVDKESD
                     TARQELEALGFQVTIKEEYSEKVAQGLVIKTDPGANSSAEKGAKITLYVSKGVAPQVV
                     PNVVGKSQENATQILQTAGFSIGTITQEYSSSVTAGQVISTDPVANTELAKGSIINLV
                     ISKGKELIMPDLTSGNYTYSQARSQLQALGVNAESIEKQEDRSYYSTTSDIVIGQYPA
                     AGATIDGTVTLYVSVASTRTSSDSSAGSSTSTSTSTGSGQ"
     repeat_region   415648..415761
                     /note="Region similar to ISSs2"
     repeat_region   complement(415760..415863)
                     /note="Imperfect repeat RepSU1"
                     /rpt_family="RepSU1"
     gene            416036..416740
                     /locus_tag="SSUBM407_RS02045"
                     /old_locus_tag="SSUBM407_0374"
     CDS             416036..416740
                     /locus_tag="SSUBM407_RS02045"
                     /old_locus_tag="SSUBM407_0374"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall-active antibiotics response protein"
                     /protein_id="WP_014636234.1"
                     /translation="MEKMRKVQFFLLIESMIFTMAAFDVVANEASRTLLLFSALLLVI
                     WYFLGRKVNSVLLVSSLSLLFLVFVLNPFFIIGIMLLVVYMLINFFSRYEKRNQYTHI
                     VFSDYSLQVQKEKNRWFGNHDHSQDRFGFEDINIVRLFGNDVVDLDKTVLVGRDNIVV
                     IRKTFGRTKIIVPIDVEVALSATSIYGRVSFLGESYWDLRNESIAVNSPDYQESHKRV
                     KVVTNNILGDVEVVRV"
     gene            416737..417753
                     /locus_tag="SSUBM407_RS02050"
                     /old_locus_tag="SSUBM407_0375"
     CDS             416737..417753
                     /locus_tag="SSUBM407_RS02050"
                     /old_locus_tag="SSUBM407_0375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_002937028.1"
                     /translation="MRKRTYLLLAWFACLIVFVVIASTLPLLNYSLLDVTLWISTEQL
                     VFTLILLVIVLTLFLAVMVQTVSLASTQVMRTKLQAILKNKSIRTDTESDQLLLQLSD
                     KVRNLTRQVQLVDNQDLVKKEEIVEGERKRIARDLHDTVSQELFATSMILSGLSSNLS
                     TLPQETLQEQLMLVKDMIESAQRDLRILLLHLRPSELESKTLVEGFELILREVSDKSN
                     IIVHFQHEVEELPKLIEEHLFRIAQEIISNTLRHAKAKHLDVYLLQKETELQLKMTDD
                     GIGFQQGADDELSYGLQNIRERVEDMAGTIKIRTAPNKGVAIDIRIPLLKGKEDEYDS
                     SDAG"
     gene            417725..418366
                     /locus_tag="SSUBM407_RS02055"
                     /old_locus_tag="SSUBM407_0376"
     CDS             417725..418366
                     /locus_tag="SSUBM407_RS02055"
                     /old_locus_tag="SSUBM407_0376"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_002937025.1"
                     /translation="MNTIRVMLVDDHEMVRLGLKSYLNLQPDVEVVAEASDGEEGLAK
                     ALEVKPDVVVMDLVMPKMTGVEATLALLKEWPQAQIVILTSYLDNEKIYPVLEAGARG
                     YMLKTSSADEILAAIRKVALGEYAIETEVEKKVEHHKRHPDLHDDLTAREREILTLLA
                     KGYDNQRIADESFISLKTVKTHVSNILSKLAVSDRTQAVVYAFQHGLVAQEDQ"
     gene            418416..419816
                     /locus_tag="SSUBM407_RS02060"
                     /old_locus_tag="SSUBM407_0377"
     CDS             418416..419816
                     /locus_tag="SSUBM407_RS02060"
                     /old_locus_tag="SSUBM407_0377"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cof-type HAD-IIB family hydrolase"
                     /protein_id="WP_011921996.1"
                     /translation="MDAKLRYKAKKIKIVFFDIDDTLRVKNTGYIPESIQQVFKSLKE
                     KGILTGIASGRTPYGLVPEIKALKPDFFAMINGSYVEDAKGQVVYHQPMPQNLVESVL
                     NWAKEIGIEYGMLSSQKGTLSARTDRISQVIDLIYEGLETKPTFYKENDIYQLLTFEK
                     DGHEVELPEELQAELRSVRWDAISSDIVLKGSSKATGVAKVVEKLGLKPENVLVFGDG
                     LNDIELFDYAGISIAMGHSHPELQKHADYITKKVEEDGIFDALEKLGMVEKEKYFPQL
                     DLENVTGPVAHIKTNHGKLTVKLFPEIAPKTVANFVALSKDGYYDGIIFHRIIKDFMI
                     QGGDPTGTGMGGESIYGTAFEDEFSMEAFNLRGALSMANAGPNTNGSQFFIVQNQNFP
                     YNAKELERGGWPKEVAEAYVKNGGTPYLDQRHTVFGHLVDEESFVVLDAIAAVATDSA
                     DCPHEDVVIETIEIED"
     gene            419818..420189
                     /locus_tag="SSUBM407_RS02065"
                     /old_locus_tag="SSUBM407_0378"
     CDS             419818..420189
                     /locus_tag="SSUBM407_RS02065"
                     /old_locus_tag="SSUBM407_0378"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S1 RNA-binding domain-containing protein"
                     /protein_id="WP_011921997.1"
                     /translation="MKIGDKLKGTVTGIQPYGAFVQLENGTTGLIHISEIKTGFVDNI
                     YDHLKLGQEVLVQVVDFDEYTEKASLSIRTLEEEQQKIPCHHRFTNERNKIGFSPLAK
                     QLPKWIEEAKGYLKEHKEKKV"
     gene            complement(420215..421141)
                     /gene="cysK"
                     /locus_tag="SSUBM407_RS02070"
                     /old_locus_tag="SSUBM407_0379"
     CDS             complement(420215..421141)
                     /gene="cysK"
                     /locus_tag="SSUBM407_RS02070"
                     /old_locus_tag="SSUBM407_0379"
                     /EC_number="2.5.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase A"
                     /protein_id="WP_012774985.1"
                     /translation="MAIYQNITQLVGKTPVIKLNNIVPEGAAEVYVKLEAFNPGSSVK
                     DRIALAMIEDAEKAGTIKPGDTIVEPTSGNTGIGLAWVGAAKGYNVIIVMPETMSVER
                     RKIIQAYGAELVLTPGSEGMKGAIAKAKEIAEEKNGWVPFQFANPSNPKVHEDTTGQE
                     ILEDFGTTGLDAFVSGVGTGGTVSGVSHVLKTANPDIAIYAVEADESAVLSGEAPGPH
                     KIQGISAGFIPDTLDTSAYDGIIRVKSDDALATGRAIGGKEGFLVGISSGAAIHAAIE
                     VAKELGTGKKVLAILPDNGERYLSTALYEFND"
     gene            complement(421231..421863)
                     /locus_tag="SSUBM407_RS02075"
                     /old_locus_tag="SSUBM407_0380"
     CDS             complement(421231..421863)
                     /locus_tag="SSUBM407_RS02075"
                     /old_locus_tag="SSUBM407_0380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YigZ family protein"
                     /protein_id="WP_014636235.1"
                     /translation="MKEFKTIREDGIVEEEIKKSRFICFMKRVTSEEEARDFINKIKK
                     EHYKATHNCSAFVLGENMEIKRSSDDGEPSGTAGVPMLTVLENHELTNVATVVTRYFG
                     GIKLGAGGLIRAYAGAVANAVKEIGVVEVKEQEGISLSMSYAQYQEFANWRAEQGLEE
                     FDTQFTTEVSTMIFVDKEFLEQTLASLTDFYHGKVSTEKANSRIVEVPVY"
     gene            421920..423212
                     /locus_tag="SSUBM407_RS02080"
                     /old_locus_tag="SSUBM407_0381"
     CDS             421920..423212
                     /locus_tag="SSUBM407_RS02080"
                     /old_locus_tag="SSUBM407_0381"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_012774986.1"
                     /translation="MKELENYYGRLFTKYQLTAKEREIAEKVPSITKKNNCFRCGTTF
                     EEENKLPNDAYYCRACLLLGRVRSDEKLYHFPQKDFPITKCLKWKGQLTDWQQRISDG
                     LVANVENNRATLVHAVTGAGKTEMIYHTVASVIDKGGAVCLASPRIDVCIELYKRLQN
                     DFSVPISLLHGESEPYFRTPLVVATTHQLLKFYQAFDLVLIDEVDAFPYADNPMLYRA
                     ADNAVKEAGVQVFLTATSTDELDKKVRTGKLSRLSLPRRFHGNPLVVPQKVWFSKFDD
                     TLKKNRLVPKLKKAIEEQRKSCFPLLIFVPEISKGQEFTKIMKKTFPEETIGFVSSQT
                     ENRLEIVEGFRKREITVLISTTILERGVTFPCVDVFVVQANHYLYTVSSLVQIAGRVG
                     RSMERPTGLLQFYHEGSTGAIEKAVAEIKQMNKEAGYV"
     gene            423205..423870
                     /locus_tag="SSUBM407_RS02085"
                     /old_locus_tag="SSUBM407_0382"
     CDS             423205..423870
                     /locus_tag="SSUBM407_RS02085"
                     /old_locus_tag="SSUBM407_0382"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009909437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ComF family protein"
                     /protein_id="WP_004194119.1"
                     /translation="MSNCLLCGQAMKNKTRFSDLIFFSKEKSGICEECFSTFEEIAEQ
                     HCPHCYKNGESESCKDCQYWQNQGKPVVHTALYQYNQAMAHYFSRYKFQGDYVLRNIF
                     AKKLRIALSQFPDYTIVPIPISQKRLSERGFNQVEGLLDATNIPYQSLLGKYESQKQS
                     SKNRAERLEAKQMFYLLDEKEVPEKILLFDDIYTTGATIQLAVELFMKIGRKEIKTFS
                     LTR"
     gene            423947..424489
                     /gene="raiA"
                     /locus_tag="SSUBM407_RS02090"
                     /old_locus_tag="SSUBM407_0383"
     CDS             423947..424489
                     /gene="raiA"
                     /locus_tag="SSUBM407_RS02090"
                     /old_locus_tag="SSUBM407_0383"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated translation inhibitor RaiA"
                     /protein_id="WP_004194117.1"
                     /translation="MIKFSIRGENLEVTEALRTYVEEKVAKIEKYFNEEQELNAKVNL
                     KVYRDKRAKVEVTIPVGAVTLRAEDISQEMYGSIDLVVDKIERQIRRNKTKIERKHRQ
                     KVATGQVFTDELVEQTGEEVKVVRTKQVDLKPMDMEEAVLQLELLGHDFFIYTDANDG
                     TTNVLYRREDGDLGLLEVRQ"
     gene            424821..426376
                     /locus_tag="SSUBM407_RS02095"
                     /old_locus_tag="SSUBM407_r0010"
     rRNA            424821..426376
                     /locus_tag="SSUBM407_RS02095"
                     /old_locus_tag="SSUBM407_r0010"
                     /product="16S ribosomal RNA"
     gene            426422..426494
                     /locus_tag="SSUBM407_RS02100"
                     /old_locus_tag="SSUBM407_t0035"
     tRNA            426422..426494
                     /locus_tag="SSUBM407_RS02100"
                     /old_locus_tag="SSUBM407_t0035"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:426455..426457,aa:Ala,seq:tgc)
     gene            426768..429678
                     /locus_tag="SSUBM407_RS02105"
                     /old_locus_tag="SSUBM407_r0011"
     rRNA            426768..429678
                     /locus_tag="SSUBM407_RS02105"
                     /old_locus_tag="SSUBM407_r0011"
                     /product="23S ribosomal RNA"
     gene            429764..429879
                     /gene="rrf"
                     /locus_tag="SSUBM407_RS02110"
                     /old_locus_tag="SSUBM407_r0012"
     rRNA            429764..429879
                     /gene="rrf"
                     /locus_tag="SSUBM407_RS02110"
                     /old_locus_tag="SSUBM407_r0012"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
     gene            429885..429957
                     /locus_tag="SSUBM407_RS02115"
                     /old_locus_tag="SSUBM407_t0036"
     tRNA            429885..429957
                     /locus_tag="SSUBM407_RS02115"
                     /old_locus_tag="SSUBM407_t0036"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:429918..429920,aa:Val,seq:tac)
     gene            429960..430032
                     /locus_tag="SSUBM407_RS02120"
                     /old_locus_tag="SSUBM407_t0037"
     tRNA            429960..430032
                     /locus_tag="SSUBM407_RS02120"
                     /old_locus_tag="SSUBM407_t0037"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:429993..429995,aa:Asp,seq:gtc)
     gene            430078..430150
                     /locus_tag="SSUBM407_RS02125"
                     /old_locus_tag="SSUBM407_t0038"
     tRNA            430078..430150
                     /locus_tag="SSUBM407_RS02125"
                     /old_locus_tag="SSUBM407_t0038"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:430111..430113,aa:Lys,seq:ttt)
     gene            430154..430235
                     /locus_tag="SSUBM407_RS02130"
                     /old_locus_tag="SSUBM407_t0039"
     tRNA            430154..430235
                     /locus_tag="SSUBM407_RS02130"
                     /old_locus_tag="SSUBM407_t0039"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:430188..430190,aa:Leu,seq:tag)
     gene            430250..430322
                     /locus_tag="SSUBM407_RS02135"
                     /old_locus_tag="SSUBM407_t0040"
     tRNA            430250..430322
                     /locus_tag="SSUBM407_RS02135"
                     /old_locus_tag="SSUBM407_t0040"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:430283..430285,aa:Thr,seq:tgt)
     gene            430335..430406
                     /locus_tag="SSUBM407_RS02140"
                     /old_locus_tag="SSUBM407_t0041"
     tRNA            430335..430406
                     /locus_tag="SSUBM407_RS02140"
                     /old_locus_tag="SSUBM407_t0041"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:430367..430369,aa:Gly,seq:gcc)
     gene            430414..430497
                     /locus_tag="SSUBM407_RS02145"
                     /old_locus_tag="SSUBM407_t0042"
     tRNA            430414..430497
                     /locus_tag="SSUBM407_RS02145"
                     /old_locus_tag="SSUBM407_t0042"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:430448..430450,aa:Leu,seq:taa)
     gene            430516..430589
                     /locus_tag="SSUBM407_RS02150"
                     /old_locus_tag="SSUBM407_t0043"
     tRNA            430516..430589
                     /locus_tag="SSUBM407_RS02150"
                     /old_locus_tag="SSUBM407_t0043"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:430550..430552,aa:Arg,seq:acg)
     gene            430637..430710
                     /locus_tag="SSUBM407_RS02155"
                     /old_locus_tag="SSUBM407_t0044"
     tRNA            430637..430710
                     /locus_tag="SSUBM407_RS02155"
                     /old_locus_tag="SSUBM407_t0044"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:430671..430673,aa:Pro,seq:tgg)
     gene            complement(<430902..>430970)
                     /locus_tag="SSUBM407_RS02160"
                     /pseudo
     CDS             complement(<430902..>430970)
                     /locus_tag="SSUBM407_RS02160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012677188.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(431267..432619)
                     /gene="rlmD"
                     /locus_tag="SSUBM407_RS02165"
                     /old_locus_tag="SSUBM407_0384"
     CDS             complement(431267..432619)
                     /gene="rlmD"
                     /locus_tag="SSUBM407_RS02165"
                     /old_locus_tag="SSUBM407_0384"
                     /EC_number="2.1.1.190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014917211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA (uracil(1939)-C(5))-methyltransferase
                     RlmD"
                     /protein_id="WP_012775501.1"
                     /translation="MNLQVNQRIPLKIKRMGINGEGIGFYQKTLVFVPGALKGEEIFC
                     QITSVKRNFVEAKLLKINKESKFRVKPACDIYRACGGCQIMHLRYDKQLDFKQDLLQQ
                     ALKKFKPAGYENYTIYPTIGMDKPSHYRAKLQFQTRSFKDQVKAGLYAENSHRLIGIT
                     NCYVQDAETQEIINGIAKLLTKHRIPIYNERKQHGIRTVMVRKARKTGQVQVIFITSC
                     QVNLIKLIDELTSQFPSIITIALNWNRQKTSDIYGEKTEILWGEQAIDEAVLDYEFSL
                     SPRAFYQLNPQQTEILYGEAVKALDISGDEDLIDAYCGVGTIGFAFAKKVKSVRGMDI
                     IPEAIEDAKANAKRMGLSNTHYEAGKAEEIIPKWYQEGYRADALVVDPPRTGLDEKLL
                     KTILNYKPAKMVYVSCNVSTLARDLVELSKAYKVEYIQSVDMFPHTARTEAVVKLSKK
                     "
     gene            432657..433433
                     /gene="recX"
                     /locus_tag="SSUBM407_RS02170"
                     /old_locus_tag="SSUBM407_0385"
     CDS             432657..433433
                     /gene="recX"
                     /locus_tag="SSUBM407_RS02170"
                     /old_locus_tag="SSUBM407_0385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015605548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombination regulator RecX"
                     /protein_id="WP_012774987.1"
                     /translation="MRITKIEKKKRLYLLEVDGQDSLYITEDTIVRFMLSKGKEITEQ
                     EFRELRDFAQFSYGKNLALYYLSFKQRTKKEVSNYLKKYEIEENNIVKIVTVLEEEKW
                     LDDGNYVDSYVRQNALNGDKGPAMIRQKLMQKGIPKTLIDKRLAEEDFSELAGKIGEK
                     LVGRYQRKLPLRALQDKVVQGLMGKGFSYEAAKQSLGQLELVADEENEDDLIAKELDK
                     QYRKYSRKYEGYELKQRLIQALARKGYDFDRIQAVLRDYL"
     gene            433509..434042
                     /locus_tag="SSUBM407_RS02175"
                     /old_locus_tag="SSUBM407_0386"
     CDS             433509..434042
                     /locus_tag="SSUBM407_RS02175"
                     /old_locus_tag="SSUBM407_0386"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000775318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF402 domain-containing protein"
                     /protein_id="WP_004194106.1"
                     /translation="MKLPKEGDFITIQSYKHDGEIHRTWRDTMVLKTTENAIIGVNNH
                     TLVTENDGRRWVTREPAIVYFHKKYWFNIIAMIRENGVSYYCNLASPYVLDNEALKYI
                     DYDLDVKVFADGEKRLLDVDEYERHRKAMKYSDDIDFILKENVKILVDWINNQRGPFS
                     PAYVNIWYKRYLELRSR"
     gene            434100..434417
                     /locus_tag="SSUBM407_RS02180"
                     /old_locus_tag="SSUBM407_0387"
     CDS             434100..434417
                     /locus_tag="SSUBM407_RS02180"
                     /old_locus_tag="SSUBM407_0387"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002942715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF960 domain-containing protein"
                     /protein_id="WP_004194104.1"
                     /translation="MAFEQTNGRYASFGVVTSLPGEVIDSFWYVIDHYLKGVIPLKSV
                     IRFSIKNRRGKITLVFSQEGYKNVLAVDLSSRFDPFYPSTILVMDKQGKETITLPDEV
                     TLL"
     gene            434517..435248
                     /locus_tag="SSUBM407_RS02185"
                     /old_locus_tag="SSUBM407_0388"
     CDS             434517..435248
                     /locus_tag="SSUBM407_RS02185"
                     /old_locus_tag="SSUBM407_0388"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_012774988.1"
                     /translation="MVSQTVEKPLYLQLVDELEVAIRERMAPNDKLFSERELTQVYGV
                     SRITVRLALQELEKRGLVYKKHGKGTYVSEISDTAVDLSQAYSFTEQMKKIGKVPRTS
                     ILSFELVKASDYIAQHLQLSQGEEVFEVERLRLADEIPMMLERTYVPASVFPGLAAQR
                     MKSTPLYEIFSEDYHQVIRLAEEEFYASIALDNEAKILGIPSNSPVLHLVRKTYNDKN
                     RIIEFTFSIARADQFRYKITHQRGY"
     repeat_region   complement(435253..435344)
                     /note="Imperfect repeat RepSU1"
                     /rpt_family="RepSU1"
     gene            complement(435388..436098)
                     /locus_tag="SSUBM407_RS02190"
                     /old_locus_tag="SSUBM407_0389"
     CDS             complement(435388..436098)
                     /locus_tag="SSUBM407_RS02190"
                     /old_locus_tag="SSUBM407_0389"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_004194099.1"
                     /translation="MKVPKYQLIQNDLRQQIVSGKFENGDKFYTESELTKLFNVSSIT
                     VIRAVNELVKDGYLVRQQGKGTFVSRSRKGRLVEFSDIEIFPMDKDKVTVLSCEKGNK
                     PDILEKLNLDKNEFYYKIVRVRAAEDTPYIFHNSYIPQRYIQNPDAPLEHYQSIYQRF
                     KLDYNIHMSEEPFVETNEIVSPCPKEVATHLKLKATEPAVLQNKTTTNSTSGEVMEYT
                     ETYKHWKYYKFEITANHR"
     gene            436305..438077
                     /locus_tag="SSUBM407_RS02195"
                     /old_locus_tag="SSUBM407_0390"
     CDS             436305..438077
                     /locus_tag="SSUBM407_RS02195"
                     /old_locus_tag="SSUBM407_0390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="WP_012775502.1"
                     /translation="MKEFYIGDQFYLDGEPFKILSGAIHYFRVHPDDWYHSLYNLKAL
                     GFNTVETYVPWNMHEPRKGEFCYEGILDIERFLKLAQELGLYAIVRPSPYICAEWEWG
                     GLPAWLMKEELRVRSSDSVYLQHLDEYYVSLIPKLAKLQLAQGGNVLMFQVENEYGSY
                     GEEKAYLRAVAGLMRKHGLTAPLFTSDGSWRATLRAGTLIEDDVFVTGNFGSKARENF
                     ANMTAFFNEHQKNWPLMCMEFWDGWFNRWGDEIIRREPEEMVDSVMECIELGSLNLYM
                     FHGGTNFGFMNGCSARGQIDLPQVTSYDYDAILDEAGNPTKKFYILQQRLKEVYPELE
                     YAEPLVKEAKAFSDVSLHDKVSLSATLENVSDCVKGFYPKNMEELDQSTGYILYRTEL
                     ERDKTEAERFRVVDARDRIQIYADGKFVATQYQTEIGDDVELDFKDDKLTLDILVENM
                     GRVNYGHKLTAPTQSKGIGRGAMADLHFIGHWETYPLHLESVEDLDFSKGWEEGQAAF
                     YRYQFELDELADTYLDMTGFGKGVVFVNNVNIGRFWEKGPILYLYIPKGYLKKGANEI
                     VVFETEGKYREKIHFSQRPVIKDL"
     gene            438131..438616
                     /locus_tag="SSUBM407_RS02200"
                     /old_locus_tag="SSUBM407_0391"
     CDS             438131..438616
                     /locus_tag="SSUBM407_RS02200"
                     /old_locus_tag="SSUBM407_0391"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004195634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system
                     mannose/fructose/N-acetylgalactosamine-transporter subunit
                     IIB"
                     /protein_id="WP_011922009.1"
                     /translation="MAIIATRIDGRLIHGQVANLWTTKLNIGRIMVIDDAVAQNDIEK
                     QGLKLACPPGVKLSILPIEKAANNIKEGKYDSQRLLIVARRPENFLRLVEYGVELAEL
                     NVGNMSQTPETRSVTRSINVVDKDIADFDALAAKGVKLFAQMVPGDSPKDFMPLLDKV
                     R"
     gene            438655..439557
                     /locus_tag="SSUBM407_RS02205"
                     /old_locus_tag="SSUBM407_0392"
     CDS             438655..439557
                     /locus_tag="SSUBM407_RS02205"
                     /old_locus_tag="SSUBM407_0392"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002922767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS
                     mannose/fructose/sorbose/N-acetylgalactosamine transporter
                     subunit IIC"
                     /protein_id="WP_024378992.1"
                     /translation="MMQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGN
                     MEVGLLIGASLQLVVLGVGTFGGASRIDATSGAVLATAFSISQGLDPEIAISTIGVPV
                     AGLLVYTDILGRFTTTFFAHRVDAAIERFDYAGIERNYLLGAIPWALSRALPVFLALA
                     FGGGLVETLVTTIELPEYKWIAAGLTLAARMLPGLGFAILLHYLPLKRNLHYLAVGFA
                     LTAMLTVLYGNVSALGGAVAGIVGTLPEDAGVSFVNNFKGLSMIGIAIVGAFLSVIHF
                     KNSQKVTVVAPSNSESGEIEDDEI"
     gene            439544..440362
                     /locus_tag="SSUBM407_RS02210"
                     /old_locus_tag="SSUBM407_0393"
     CDS             439544..440362
                     /locus_tag="SSUBM407_RS02210"
                     /old_locus_tag="SSUBM407_0393"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system mannose/fructose/sorbose family
                     transporter subunit IID"
                     /protein_id="WP_012774989.1"
                     /translation="MTKSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLYMILP
                     QLRKMYGDGTPELKEMMKLHTQFFNTSPFFHTIITGIDLALEESDGVASKDAVNGVKT
                     GLMGPFAPIGDSIFGSLVPAIMGTVAATMGKEGSPVGIFLWVAVAIAYDIFRWKQLEV
                     AYKEGTKLITTMRDRLTALVDAASVMGVFMMGALIATMINFEVTWAPAIGEKVIDIQD
                     ILNTIFPRLVPAIFTGFVFWLLGRRGMTSTKAILIIIVLALGFSAIGHFLFGMV"
     gene            440362..440763
                     /locus_tag="SSUBM407_RS02215"
                     /old_locus_tag="SSUBM407_0394"
     CDS             440362..440763
                     /locus_tag="SSUBM407_RS02215"
                     /old_locus_tag="SSUBM407_0394"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003098595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIA"
                     /protein_id="WP_004194089.1"
                     /translation="MVRSLVLVSHGIFCEELKKSTEMIMGPQEDIYTVALLPEEGPED
                     FQKKFEETIAGLEDFVVFADLLGGTPANVVSRKLIEGGQFDLYAGMNMPMVIGFLNGV
                     LLGEAVDYVEFGTSNLVHVNSLLTSDEDDDE"
     gene            440979..441980
                     /locus_tag="SSUBM407_RS02220"
                     /old_locus_tag="SSUBM407_0395"
     CDS             440979..441980
                     /locus_tag="SSUBM407_RS02220"
                     /old_locus_tag="SSUBM407_0395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactose mutarotase"
                     /protein_id="WP_011922012.1"
                     /translation="MIEVKTFDEKAKLYCLENKNGMQVTLTDFGARVVEVLLPVEENG
                     GLRNVSLAAKSDDDYRKTDLYPGSTIVPVAGRISGAQAEIEGTSYHFTENEPGRTLHG
                     GVDTANEQYWDVELDHERNQVTFGMVLKDGFNGFPGDVRVKAIYCLTDKNELTVDYQA
                     VSDKDTIFNPTNHIYFNLTGDFQRSVAEHRIKIAANHYAPLGEDNLPTGVLEDVTGTP
                     FDFRDFAPFAQGFDSQYPQNVLVKGYDHPWLLEEVDIPVEVLSPDGKIGLSVKTNQPA
                     VVIYTYNFPVEALACYHGVFSLECQALPNACNVDGFGSILLEQGEEFLSKTTYRFTW"
     gene            442090..442344
                     /locus_tag="SSUBM407_RS02225"
                     /old_locus_tag="SSUBM407_0396"
     CDS             442090..442344
                     /locus_tag="SSUBM407_RS02225"
                     /old_locus_tag="SSUBM407_0396"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006740106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1912 family protein"
                     /protein_id="WP_002943432.1"
                     /translation="MTKEQEFLKEFEAWVNTQVMVNEMAVEESRRVLEEDKDERAADA
                     YIRYESKLDAYRFIQGKFANYHAGKGFHDLPDELFGQRHY"
     gene            442359..442745
                     /locus_tag="SSUBM407_RS02230"
                     /old_locus_tag="SSUBM407_0397"
     CDS             442359..442745
                     /locus_tag="SSUBM407_RS02230"
                     /old_locus_tag="SSUBM407_0397"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="WP_012774990.1"
                     /translation="MAKKKVNRKKQLKKQLADLKRAGRVGLERAAEVVETVAHKAEAV
                     VERTVEQVKEVVAEVTSSATSLEDFLALPELEGIAAARLETFYEAGIQSVADFANHTE
                     KELLALKGIGPATIKQLKEKGIELKA"
     gene            442987..443376
                     /locus_tag="SSUBM407_RS02235"
                     /old_locus_tag="SSUBM407_0398"
     CDS             442987..443376
                     /locus_tag="SSUBM407_RS02235"
                     /old_locus_tag="SSUBM407_0398"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_011922679.1"
                     /translation="MLHHVEIYVSDLETSRAFYDFLLTKLGYSLYQEWDKGLSYKKAE
                     QYLVFVQTPEDFLEVGYHRCRTGLNHLAFHAGTPDEIDQWRKEFLTRRVKLLYDDRYP
                     HAGGPDHYALYLEDPDGIKIELVGEGV"
     gene            443373..443948
                     /locus_tag="SSUBM407_RS02240"
                     /old_locus_tag="SSUBM407_0399"
     CDS             443373..443948
                     /locus_tag="SSUBM407_RS02240"
                     /old_locus_tag="SSUBM407_0399"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="WP_011922016.1"
                     /translation="MNLIIIGAQASGKMTVGQEVAKLTGMTLFHNHDSIDFSLRFIPE
                     FSEDMFDLNTRITFAVYDVFARSGRPLIGTALINFKNLIEVQFLTTVQTIFHHHGQEI
                     LFVELETALEERLRRNRTENRLTHKPLKRHIEVSEAEILSTADTCRYTSLGIPEGIQH
                     YLKINNTHLSANDVAQLIIQKMEELEQEQTK"
     gene            444063..446714
                     /locus_tag="SSUBM407_RS02245"
                     /old_locus_tag="SSUBM407_0400"
     CDS             444063..446714
                     /locus_tag="SSUBM407_RS02245"
                     /old_locus_tag="SSUBM407_0400"
                     /EC_number="6.1.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014623308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valine--tRNA ligase"
                     /protein_id="WP_011922017.1"
                     /translation="MSKELSPKYNPAEVEAGRYQTWLDQDVFKPSGDAEAKPYSIVIP
                     PPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQG
                     VTRYDLGREKFLDKVWEWKDEYAATIREQWGKLGLSLDYQRDRFTLDEGLSKAVRKVF
                     VELYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVAT
                     TRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIVNKPIPIVADEHADPEFGTGVVKIT
                     PAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAGEFAGMDRFEARKATVAKLQELGALV
                     EIENRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTADKVEFYPPRFNDT
                     FLQWMENVHDWVISRQLWWGHQIPAWYNESGEMYVGEEAPAGDGWVQDEDVLDTWFSS
                     ALWPFSTMGWPDENAADFQRYFPTSTLVTGYDIIPFWVSRMIFQGIEFTGKSPFKNAL
                     IHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDA
                     SWNFINKIWNISRYILMNNEGLTLDAARENVAKVAAGEAGNVTDRWILHNLNETIAKV
                     TENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVMTRSVLLYTLDQI
                     LRLLHPIMPFVTEEIFAQYAEGSIVVAAYPVVNPAFENAEAHKGVESLKDLIRSVRNS
                     RAEVNVAPSKPITILIKTADSELETFFKANENYIRRFTNPEQLEISSSIAAPELAMSA
                     VITGAEIFLPLADLLNVEEELARLDKELVKWQKELDMVGKKLSNERFIANAKPEVVEK
                     EKEKQADYQAKYDATVARIEEMKKLVK"
     gene            446792..449575
                     /locus_tag="SSUBM407_RS02250"
                     /old_locus_tag="SSUBM407_0401"
     CDS             446792..449575
                     /locus_tag="SSUBM407_RS02250"
                     /old_locus_tag="SSUBM407_0401"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775503.1"
                     /translation="MMIILICLSLFIISRTMNGFRLFLDSTIIIGFICLFFYYCCFDL
                     IFISLTNLVLILILLVYSFSDILFGIRIIGLSIPFIRSIVLKYIDCKGFLQNKIRNHL
                     VEIREIILVTFLFLIFGVQVQLQLPYINFTNYSLIEILGFDIAIFSLYGIYVAFLQFL
                     TENDKVYYLGVSKIRFMLDNSVWSQLTRAKLFHIILLVSVLIPLFSKSNIEFNYQLQN
                     IEYLWQTCYIISIVVYIFLLKLSISIVYGVFRLNLENVSKTVKKEDVKEKDSRHKEKI
                     FNRFGITDKINISVQRSFKDEFWKIYKNQNQYRDDYIKVRLQERITLVEKADRDELIF
                     TIFGRENWENYNLSESIFVFIENIDSDEGKQFFRFYKNFCIHKWNFLRDYQTDISPRT
                     WVKLVEQDILIFDKLVKSDSTFNIFKIEFSDNAISRNLNLEKNKKIKEFLFELLLDKE
                     GVNLDDVLISIKKEIQRFSQNKSDQFYRYTYDFLKFRLVTILDKYENDDVNINLPEYK
                     SLSDAFQNGQRNDYENSILYSKICFNYLDRGRIEDFSHTKVEADDSKEREKQKLKAQK
                     IQGLILSMNEEYRMAFMLYQLFYTDRTQWDENLAFYDNNIQSIMKHGKQYHGYLFDQV
                     KNIILSETDIDHRITESFLDKIWETKNETIMDFSWFDQFGDQHQMSNFKILYVQWILS
                     GATTSYLKSRINFERGFPIKVRNSLVGKIKGKENRKMSVKDLKWRIRRKEERIGHLCR
                     DYLLLTDQLTTIFTKVPSDKHNLQISVEYLLHSGKVNLSDVIDNISVTSLLRLEWLLR
                     WNYYHYHRESNYTSRTFFDEMTSNDRYYWSAGRGILEFFIAKIVDNFYRDLYQDKEFM
                     AGFKYHLESQLNSLNKTVEEYVELIAERVSGIDNLSILQKGQIISKLNYILFGQDNNI
                     KIRQKENIAINKF"
     gene            449802..450608
                     /locus_tag="SSUBM407_RS02255"
                     /old_locus_tag="SSUBM407_0403"
     CDS             449802..450608
                     /locus_tag="SSUBM407_RS02255"
                     /old_locus_tag="SSUBM407_0403"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fic family protein"
                     /protein_id="WP_011922020.1"
                     /translation="MQPTYNIDNPNLSYEAKQELWETGFGLQKVDGLTPSVYMEELAE
                     RQARGEYTYEQVYEEITKYHQSTDASTQEADIVSLRIVEMLSQNGFSLRPTTLLHIHK
                     ELFHDIFDSSIPVVEYRTVNITKNELVLKGDTVIYSDFPLIAATLDYDFQQERDFSYA
                     RLDKKAIVAHIQSFISGVWQIHPFREGNTRTITVFLIKYLRSLGFEIDNEPFQKHAKY
                     FRDALVLDNAKLVNKRSDFLTAFFENLLLNGQNDLSSERMYEELGLDEYQ"
     gene            450703..453411
                     /locus_tag="SSUBM407_RS02260"
                     /old_locus_tag="SSUBM407_0404"
     CDS             450703..453411
                     /locus_tag="SSUBM407_RS02260"
                     /old_locus_tag="SSUBM407_0404"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase family protein"
                     /protein_id="WP_011922021.1"
                     /translation="MSYYYEKLTGKVAKHLARFPYYATDKILNLMQFQDNNQQFLISD
                     KHLYDYFEEQKHQLSTDEKLSILFNLFKGRIDVYAKSYIDENGKINYFPSYNYGWKKR
                     PVEKRTCQPLTKQVLLAHLRGEISIGIFPMSLSDTCSFLAIDFDKNNWREEVSILRDT
                     AEQHGFEGHIEISRSGNGAHLWFFFEEEIACQQARNVGKRLLELAMQESKDIRFSSFD
                     RMFPNQDILPKGGFGNLIALPLQGEAFKKGRTVFVDKHFQPFSEQWTYLQQVQKIGQK
                     KILDFLGQEFSDTVDDTVLDCSLSNVIRVEKRAISSKTNYLLRKLASFPNPEFYLKQA
                     TRQPTYQTPERIYLFEETNEALHLPRGILAKLQEIFETVTIRDNRNSLSPIQISFKGR
                     LRFEQELALADLLASENGLLCAETGFGKTVLGAALIAQRKCRTIILVHNRQLLEQWLE
                     RLGEFLEIEEEEAVRYTPSGRVKVIGHIGQYGASKKWRSKLVDVVMIQSLFQLDVISD
                     FLSDYDMMIVDECHHVTALQFEKVVAQFASQYLYGLTATPECKNGHQPIVFQRIGPIL
                     HTAQSGQYDFKKRLLLHLTSFGKLDLEQSNSTNFASLNDWLAKDLHRNTLIVQDIFKL
                     YQEKRNILVLVNRREHIELLEKLLIEKEMPNIFCLSGASKRRDTKELLKRISELDENS
                     PFVLISTGKFIGEGFDMPKLDTLILAAPLSWKNNLIQYAGRLHRPYQGKTEVRIVDYL
                     DIHVPYLERMYQKRQIAYRKMAYQVGEKEQTQVLFSGRDYEEKFREDLRNTRSTVYLQ
                     LHSFTSSRIQELLGLLRGKQVVIHVSKNHKLSEWLMGLNSDNVKVKLVPERIGTTAVI
                     LDSNLVWYGNLSPFTYQSDDQASLLRLESQSIATELLEKFENSNIK"
     gene            453527..454249
                     /locus_tag="SSUBM407_RS02265"
                     /old_locus_tag="SSUBM407_0405"
     CDS             453527..454249
                     /locus_tag="SSUBM407_RS02265"
                     /old_locus_tag="SSUBM407_0405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012774992.1"
                     /translation="MEKEVFTPDQSQSIVDAILKGYKSYLDERIEKRRTMHVSAGYVW
                     TKANHIDGALATANLNFIDKFELKHASQSWEFLEFNSENQLLGRVCFVLKGLTRLRQV
                     FPTAVKSGKGYLFDYAQINTSYLENLSRHTDESTLFPVQMELFDDNLFELLNRSEQSI
                     NNFFFITYQADELHHLTNIQVIMPDSRTGKLIEIQNLSTFISTSNVDFNDEKYQELQG
                     LSEIDDVADFEIIPRLASEKEA"
     gene            454262..455416
                     /locus_tag="SSUBM407_RS02270"
                     /old_locus_tag="SSUBM407_0406"
     CDS             454262..455416
                     /locus_tag="SSUBM407_RS02270"
                     /old_locus_tag="SSUBM407_0406"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_011922023.1"
                     /translation="MFNGSRLEELRLLNGLTRADLARELEVTEQAIWQFETGVTLPKM
                     KNKIAMARFFQVEVDYFDAVDKNGSFSLSRIAFRNADLEAKKNIHIQMVYLEKMNQMI
                     DYLENFVSIPNQIIYQLVDSIEQKLQQHESLEFIADHVREVLAVSVDNANLLYSLEKS
                     GIYISERLINGNADAYSAWSRNGRPFIVLGLGKSAVRHNFDLAHELGHLLLHNQVDFE
                     ELSKEELEEKEKEANQFASYFLLPRKQFLMDFVNIVGKRVSNPDQYILLKKRFGVSIQ
                     ALEYRAYKLGLLTPQQNSYFYRQISKKGYKAVEPLDLEIPLKKPSKIRSILDVILSNN
                     LLTLSDIERNQRVSKNFISQLFSFDVKFFDKYLLQLDTFDNVIPLFSRKQ"
     gene            455431..456489
                     /locus_tag="SSUBM407_RS02275"
                     /old_locus_tag="SSUBM407_0407"
     CDS             455431..456489
                     /locus_tag="SSUBM407_RS02275"
                     /old_locus_tag="SSUBM407_0407"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MmcQ/YjbR family DNA-binding protein"
                     /protein_id="WP_012774994.1"
                     /translation="MNKINSYKIHLPSLLPFGFLFANNCYTYREVFMEGQFEAVVEVD
                     EAGQLSSYVWDCEMEEVYTAHLVTAPSGAFVGQVRESYQSILDRVEEACCIALPFTKD
                     QSNRIAQLIKEQWGDLPDYPFAKLPTYGAFRHPNNNKWYALVSQIPRDKLDGSGSQEE
                     VEIVNLKVAGREIAELLSRSGIFPAYHMSKKTWVSVLLDDTVEDQTVFALLEKSRYLV
                     GPKSYKATQGPDYWVIPANPKVYDIDTEFAENKVVYWPQKSTIQVGDIVAIYVTAPVQ
                     AIRYVCRVLGENLENHGESDIPTEKKLMQVELLAQFSDDVLPRARMMDLGVKAVRGPR
                     RLTKELIDVLTSEVINIY"
     gene            456573..457565
                     /locus_tag="SSUBM407_RS02280"
                     /old_locus_tag="SSUBM407_0408"
     CDS             456573..457565
                     /locus_tag="SSUBM407_RS02280"
                     /old_locus_tag="SSUBM407_0408"
                     /EC_number="6.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016466857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate--ammonia ligase"
                     /protein_id="WP_011922684.1"
                     /translation="MKKSFIHQQEEISFVKNTFTQYLKDKLEIVEVQGPILSRVGDGM
                     QDNLSGVENAVTVNVKLIPDATYEVVHSLAKWKRHTLARFGFHEGEGLFVHMKALRPD
                     EDSLDPIHSVYVDQWDWEKVIPDGRRNLAYLKETVEQIYKAIRLTELAVEARYDIESV
                     LPKKITFIHTEDLVKNFPDLTPKERENVVAKEYGAVFLIGIGGELADGKPHDGRAPDY
                     DDWTSPSEAGYKGLNGDILVWNEALGSAFELSSMGIRVDEEALKRQVAITGDEDRLEF
                     DWHRALLNGLFPLSIGGGIGQSRLAMFLLRKKHIGEVQSSVWPQEVRDNFENIL"
     gene            457698..459545
                     /gene="typA"
                     /locus_tag="SSUBM407_RS02285"
                     /old_locus_tag="SSUBM407_0409"
     CDS             457698..459545
                     /gene="typA"
                     /locus_tag="SSUBM407_RS02285"
                     /old_locus_tag="SSUBM407_0409"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002943010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translational GTPase TypA"
                     /protein_id="WP_012775504.1"
                     /translation="MTKLREDIRNVAIIAHVDHGKTTLVDELLKQSQTLDERTQLDER
                     AMDSNDIEKERGITILAKNTAVAYNGTRINIMDTPGHADFGGEVERIMKMVDGVVLVV
                     DAYEGTMPQTRFVLKKALEQNLTPIVVVNKIDKPSARPEEVVDEVLELFIELGADDDQ
                     LEFPVVYASAINGTSSLSDNPADQEETMAPIFDTIIEHIPAPVDNSDEPLQFQVSLLD
                     YNDFVGRIGIGRVFRGTVKVGDQVTLSKLDGTTKNFRVTKLFGFFGLERKEIQEAKAG
                     DLIAVSGMEDIFVGETVTPTDAVEALPVLRIDEPTLQMTFLVNNSPFAGREGKWVTSR
                     KIEERLLAELQTDVSLRVDPTDSPDKWTVSGRGELHLSILIETMRREGYELQVSRPEV
                     IIKEIDGVKMEPFERVQIDTPEEYQGSVIQSLSERKGDMLDMVATGNGQTRLVFLVPA
                     RGLIGYSTEFLSMTRGYGIMNHTFDQYLPVVQGEIGGRHRGALVSIDQGKATTYSIMC
                     IEERGTIFVNPGTEVYEGMIIGENSRENDLTVNITTAKQMTNVRSATKDQTSVIKTPR
                     ILTLEESLEFLNDDEYMEVTPESIRLRKQILNKAERDKAAKKKKLATEE"
     gene            459563..459811
                     /locus_tag="SSUBM407_RS02290"
                     /old_locus_tag="SSUBM407_0410"
     CDS             459563..459811
                     /locus_tag="SSUBM407_RS02290"
                     /old_locus_tag="SSUBM407_0410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3165 family protein"
                     /protein_id="WP_011922026.1"
                     /translation="MFYLILAIMLVLFYIFIAPSNIKGTMNLIAAVFLLVALAIALVL
                     GFLRIMQFPKEIWVGLLMILIGFWAMRDIYQLNDDTKF"
     gene            460518..460778
                     /locus_tag="SSUBM407_RS02295"
                     /old_locus_tag="SSUBM407_0411"
     CDS             460518..460778
                     /locus_tag="SSUBM407_RS02295"
                     /old_locus_tag="SSUBM407_0411"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004194478.1"
                     /translation="MDVKNLRKLKRIELYEIMLAQSEEIDCLRNQLEKIKTELADRRI
                     MISQSGSIAEASMKLTNIFEEAQKAADLYLYNVKNKIGDVHE"
     gene            460771..461361
                     /gene="lepB"
                     /locus_tag="SSUBM407_RS02300"
                     /old_locus_tag="SSUBM407_0412"
     CDS             460771..461361
                     /gene="lepB"
                     /locus_tag="SSUBM407_RS02300"
                     /old_locus_tag="SSUBM407_0412"
                     /EC_number="3.4.21.89"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="WP_012774995.1"
                     /translation="MNSSNLKGKELPKTSELKELYQHERYRHTFWRTVKSTVFMLVVV
                     AAFAILIAVLFLPILRIYGDSMKGTLNSGDIVVSVKSNDFESSDVVAFYYNNNILVKR
                     VIAEAGDWVDMDKQGNVYVNNQRLDEPYLANRDYGHTDIEFPYQVPENRIFVMGDNRK
                     ESIDSRNNAIGTVSNEQIVGKLVFKIWPLSELGWIE"
     gene            461393..461542
                     /locus_tag="SSUBM407_RS02305"
     CDS             461393..461542
                     /locus_tag="SSUBM407_RS02305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease G"
                     /protein_id="WP_011922028.1"
                     /translation="MRDWLNLEKIQGWRRKYKKLVNIIAFLVVFATTYALILPAITLD
                     QEKAE"
     gene            461558..466369
                     /locus_tag="SSUBM407_RS02310"
                     /old_locus_tag="SSUBM407_0413"
     CDS             461558..466369
                     /locus_tag="SSUBM407_RS02310"
                     /old_locus_tag="SSUBM407_0413"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="InlB B-repeat-containing protein"
                     /protein_id="WP_044475450.1"
                     /translation="MQETPVTTEISKLTEPMVTTQQTPIVGSSADEVQSPATETVPDP
                     AEQVSTESASKPQTDQERITEPTTIVHKTNDYEVTATFDASAQFPKDVEFNVRELDSQ
                     SEEYRTHYEKNKEKLGVKKLVYARFFDIHFSSQGQEVEPASPVKITIRNKELVQRPDD
                     SKLKIVHFEENSQIEVLEAETKENEQQISEISFDASHFSVYGDVLANYYTVKFTYTDT
                     AGQEQVITSLIDKTVGTSLGSLPEAPFKNGYVFSHWINKDTGDRIDENTVITGDLTAV
                     AVFNNINIYTIDVTYFYHNVSKNQDITIDKETVQLEASDAPYQLTPPASTEVSNKEDT
                     TLPADAIYYPEKPLLEFTADQLERLDVADGVDDNYISERVQYVPYNAEYDVIYRLKNL
                     TGSGYSDIQTVHVRGVLGSTVTPQILTYNYADFERADTAKIENTSGQKLYVYYTRKTF
                     TLSYNSNGGSNIPQQQGLYDSQIKISTTTPTKEGYTFEGWYDNPGLTGNKITGSLTLK
                     KDTTLYAKWTPNRVRYIIGYYKEVYDNNTGTTSYVYDSSAAGWGLVGTTVKGTDSNIG
                     PPPPTQTTIGSIGYEKDVTKSAASSIEIAADGTSVLKVYYKLKRYTFEFFLNDNNANI
                     TINGKTYSDRNRYMIRDVVLGQDVSKLWPASITNPKEVYDDKVYYDSYGRPIRYFFDY
                     WIFGNLLFKTDRFEVVESMLPTSGTTSKFTAYWNTQGTQANVEYWLQQPDGSYKKSDI
                     YSQSFLKTAGLLPKEIFGYSYYTDASFTEAGIRYYGTQGNTYRFYYKRQAFKIDYYYN
                     STGLDSKSNILFESNINTATYNYQPPRSTGVDADYTWGGWYTDSLLTEKYNFNKMPAN
                     NLVLYAKWIAPKFKVTFDINGGNGTAPVDQSVEKYKYAKAPADPTREHYNFLGWSTED
                     GKLYSWSDQVTKDVKLTAKWELKPLTYTVRYLEAGTNTQLAADKVITSPALVLNQAIT
                     EKALGITGYRPDKSSQTINLNFRGNEITFYYTPKVKDVVYTIKYVLKDNPAIEVAPTV
                     TRKVDGSIIRAKEAAADVNKQHLQSQSGVTAEMLEMDYYPTVNTQSLILTSSDANNVI
                     VFEYVGFDTQTFTVNYLDMDGKKIDGQEPLVVYRKKPGSFVVDHKTINGYTYDHSLDS
                     ENAADKTVYRVSKGGHITIDLYYKKNLTLTALDKSKVYDGTALSSSGLSDLNPSYSSE
                     LKTGDKLVAISYDGSQTNAGSSATTPKLANISNASGADRTNFYHITYQPGNLRVDQQP
                     VVVVIDGEKKSKIYDGKAEAVGYKVTEIRDSSGLYKKTDIKFNGSSSEQSVKKKDAGI
                     YPLLLSNRFSNTNQNFQVDFLISDGELRIDRRQLTITSDSASKAYDGSELRADNITVS
                     VPAGVDYTGFVDGEGIIPTFLGGPIDSGMMPNFFEYALKSGTNLANYELDIQFGQLKV
                     KEVIKIQKTDLAWQALSGGKFELTKWDGLNWAQVDGVQEFAITSKDGIRIPVGLEAGR
                     YRLQELAAPDGFIVLDSYIYFSIKEIFNEDKTSSFYTVSLSDEAGKDASPERATLTKV
                     SGDASHRIQVANEQGRALPSTGGDGQKWFILSGLVLIAISYLMHLFVQRRR"
     gene            466476..467918
                     /locus_tag="SSUBM407_RS02315"
                     /old_locus_tag="SSUBM407_0414"
     CDS             466476..467918
                     /locus_tag="SSUBM407_RS02315"
                     /old_locus_tag="SSUBM407_0414"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SpaH/EbpB family LPXTG-anchored major pilin"
                     /protein_id="WP_012775505.1"
                     /translation="MKKLQQFFTSLVAVLTVFAFGSTALAQTVDSGKSGAGTITVSNA
                     SQGQTYTAYKLFDATVTTDGSGISYKLPAGKTATNFGGDTWFEVDSKGNITAKEGATV
                     SSEAFAAWAKNFGTEVTSATANDNSLVFTHLTFGYYFVTSSLGAVLTVDSTTPNATVI
                     DKNTTNPTIPDSNNGGGKKILSNGATTSETTAKIGDTINFQIKFNATNYVTKDRQTKQ
                     IVSYTIEDSPTALAIDQNSVNVKVDGVDITAKISKTFDATGKMNLVITWADAAASNKT
                     IYNSPAEVIITYSAVVTKDAKEGEATNSATIGYNTIDNPTTPPTPVDPDKPTETTKVT
                     THRFTLKKTNNVGETLTGAEFKLYDAANNGTEIKVVKESDGVYRVAQADEQGVVIEAG
                     EVVIKGLKHSTTYYLEEMKAPNGYNILTERQSIEVKENNTAQANIVNKKGGVLPSTGA
                     IGTTLFYLVGSILLLVALVYTISKRRMNNI"
     gene            468032..468901
                     /locus_tag="SSUBM407_RS02320"
                     /old_locus_tag="SSUBM407_0415"
     CDS             468032..468901
                     /locus_tag="SSUBM407_RS02320"
                     /old_locus_tag="SSUBM407_0415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013730204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class C sortase"
                     /protein_id="WP_012774996.1"
                     /translation="MIKWLKKKGPSFIMPLIFILGIGLLAYPSVSDYWNSFHQSEAIM
                     SYSDTVSDMTADQYKEIIDSARQYNQEKPLNWNVTASDIEAYNQELNFNKDGIMGYIE
                     IPKIDVKLSIFHGTDETVLETSIGHLEGTSLPVGGLGTHSVLSGHRGLPSARLFSDLD
                     KLREGDIFTIHVLNETLTYKVDQIRVVEPSDLSALTMEPQKDLLTLVTCTPYGINTHR
                     LLVRGYRIENVNGSALVTSDAIQIKAIFIAPFIATPILFVILIYIFITTSKTFRSRNR
                     NQVLDDFLVPKKF"
     gene            complement(<469015..469302)
                     /locus_tag="SSUBM407_RS02325"
                     /old_locus_tag="SSUBM407_0416"
                     /pseudo
     CDS             complement(<469015..469302)
                     /locus_tag="SSUBM407_RS02325"
                     /old_locus_tag="SSUBM407_0416"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000018958.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS982 family transposase"
     gene            469473..470822
                     /locus_tag="SSUBM407_RS02330"
                     /old_locus_tag="SSUBM407_0417"
     CDS             469473..470822
                     /locus_tag="SSUBM407_RS02330"
                     /old_locus_tag="SSUBM407_0417"
                     /EC_number="6.3.2.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018370885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoyl-L-alanine--D-glutamate
                     ligase"
                     /protein_id="WP_011922693.1"
                     /translation="MKMIDIVKNKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFE
                     ENPTAQSLLEDGIRVICGSHPLELLDEDFALMVKNPGIRYDNPMVEKAIGKGIPVWTE
                     VELAYLVSDVPIVGITGSNGKTTTTTMIAEVLNAGKKPAKLCGNIGYPASSVAQTATA
                     EDTLVMELSSFQLMGTESFHPHIAVVTNLIASHIDYHGTFEDYVAAKWMIQRQMTAED
                     FVVINFNQKEAKELAGQTKATVVPFSTQEVVDGAYLADGKLYFKGEYIMDADQIGVPG
                     SHNVENALATIVVAKLLGVDQQAIQESLSAFGGVKHRLQFVGEINGVSFYNDSKSTNI
                     LATQKALSGFDNSKVILIAGGLDRGNEFDELVPDLVGLKKMVILGQSAPRVQRAADKA
                     EVETIEALDIADATRKAFAIAEKGDIVLLSPANASWDMYANFEVRGDVFLQTFEELK"
     gene            470825..471889
                     /locus_tag="SSUBM407_RS02335"
                     /old_locus_tag="SSUBM407_0418"
     CDS             470825..471889
                     /locus_tag="SSUBM407_RS02335"
                     /old_locus_tag="SSUBM407_0418"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011836646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine--N-acetylmuramyl-
                     (pentapeptide) pyrophosphoryl-undecaprenol
                     N-acetylglucosamine transferase"
                     /protein_id="WP_011922033.1"
                     /translation="MKKIVFTGGGTVGHVTLNLLLIPRFLEEGWEVHYIGDGNGIEHE
                     QVVKSGLDVHFHSIATGKLRRYFSFQNMLDVFKVGFGVLQSLTIIAKIRPQALFSKGG
                     FVSVPPVIAANLLRVPVFIHESDLTMGLANKIAYKFATTMYSTFEQPASLTKVKHVGA
                     VTKVGQTNDKVTPIQLPEILSHFDKSLPTLLFVGGSGGAKVFNDLISQNSAALTERFN
                     IINLTGDSSLNKLDKNLYRVDYVTELYQPLMDLADVVITRGGSNTLFELIAMQQLHLI
                     VPLGRQASRGDQIENALYAEKKGYSKQIDESQLTFASLLVEVDELLKHKEFYVQNMAN
                     SNEIQSVDSFYNLLREDMGR"
     gene            471895..472977
                     /locus_tag="SSUBM407_RS02340"
                     /old_locus_tag="SSUBM407_0419"
     CDS             471895..472977
                     /locus_tag="SSUBM407_RS02340"
                     /old_locus_tag="SSUBM407_0419"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002943031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FtsQ-type POTRA domain-containing protein"
                     /protein_id="WP_011922034.1"
                     /translation="MTEKDSNVEESVLEVEQASQVELDSEQISPAEKESVLAEEKEFS
                     TDVDIPEMTAPDDEKSAFFEQWKARHQAYLAHKDEADIQAVDEGQTEQEIPEAKKSKR
                     VLFQGIERKTESLKSKKETGEKVQTLKVDIPSKVVWKAIPVLVTSLLLAALALYFISP
                     TSKKKQIEVVGNERLTAEQVENYSLISPDDYNVTIALHADAYAKNIKKNSSSVETATI
                     KFQFPATFTIHIKEYAIIGYIQQQSQWYPVLSSGEIGGEPISQDSLPEDYTTINLSDK
                     ELIKELAIELGKIDAGIRSAIQTINLTPSKVTADLLTFNMRDGNTVLVPLSEISQKVS
                     YYTKIAAEVTVPTTIDMEVGIYRYAS"
     gene            473130..474509
                     /gene="ftsA"
                     /locus_tag="SSUBM407_RS02345"
                     /old_locus_tag="SSUBM407_0420"
     CDS             473130..474509
                     /gene="ftsA"
                     /locus_tag="SSUBM407_RS02345"
                     /old_locus_tag="SSUBM407_0420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018370882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="WP_012774997.1"
                     /translation="MARNGFFTGLDIGTSSVKVLVAEYIDNEMNVIGVSNVKSAGVKD
                     GIIVNIEVAAGAIKKAIEQAEEKSGIRIEKVNVGLPANLLQIEPTQGMIPVTTDSQEI
                     TDLDVENVVKSALTKSMTPEREVISFIPEEFTVDGFQGIKDPRGMMGIRLEMRGMLYT
                     GPRTILHNLRKTVERAGVQVENIVISPLALTRSVLNEGEREFGATVIDLGGGQTTVAV
                     MRGQELQYTNIYQEGGDYITNDISKVLTTSKSIAENLKYNYGIAYPQDASDKEKFTVE
                     VIGENAPVEVTERYLSEVIAARLRQIFDRVKQDLERTRALDLPGGIVLVGGGAILPGI
                     IELAQEVFGVNTKLFVPNQIGIRNPAFASVISFVEYVGELEDVENIAQHAVNGETTLR
                     HKPVEIPVARPRISQPIQREIVNELNTVDQVEEQVAPTYHDEEEEVRPAAKGNITDRI
                     RGLFGSMFE"
     gene            474535..475764
                     /gene="ftsZ"
                     /locus_tag="SSUBM407_RS02350"
                     /old_locus_tag="SSUBM407_0421"
     CDS             474535..475764
                     /gene="ftsZ"
                     /locus_tag="SSUBM407_RS02350"
                     /old_locus_tag="SSUBM407_0421"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002263818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="WP_011922037.1"
                     /translation="MAFSFEAAASHGAVIKVIGVGGGGGNAINRMIEEGVAGVEFIAA
                     NTDVQALSSSKAETVIQLGPKLTRGLGAGGQPEVGRKAAEESEEALTNVLTGADMVFI
                     TAGMGGGSGTGAAPVIARIAKNLGALTVAVVTRPFGFEGNKRGNFAIEGIEGLREQVD
                     TLLIISNNNLLEIVDKKTPLLEALSEADNVLRQGVQGITDLITNPGLINLDFADVKTV
                     MENKGNALMGIGIGTGEDRVIEAARKAIYSPLLETTIDGAEDVIVNVTGGYDMTLTEA
                     EDASEIVNQAAGQGVNIWLGTSIDETMKDEIRVTVVATGVRQDTADKPARHRTEAVSP
                     RPSHRFDHSVASAPTRGAAQQTEAPKASAFGEWDLRRENLIRPTDTEPTSTVSVEKFT
                     MDQDEDELDTPPFFRNR"
     gene            475771..476442
                     /locus_tag="SSUBM407_RS02355"
                     /old_locus_tag="SSUBM407_0422"
     CDS             475771..476442
                     /locus_tag="SSUBM407_RS02355"
                     /old_locus_tag="SSUBM407_0422"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015605500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YggS family pyridoxal phosphate-dependent
                     enzyme"
                     /protein_id="WP_011922038.1"
                     /translation="MNFQKNKDAIFSAVAKAAEKAGRPSESVKVIAVTKYVDSSIANQ
                     LVNTGITHIGENRVDQFLEKYNALADKQLTWHLIGTLQRRKVKDIIPFVDYFHALDSV
                     KLAQEIDKRATKIVKCFLQVNVSGEESKHGFAVSEIDAALAEISLLENIELVGLMTMA
                     PIDATDDELDEIFSKMQEIQEELATRNLPRMPFTELSMGMSGDFERAIAHGATYVRIG
                     SAFFE"
     gene            476459..477022
                     /gene="sepF"
                     /locus_tag="SSUBM407_RS02360"
                     /old_locus_tag="SSUBM407_0423"
     CDS             476459..477022
                     /gene="sepF"
                     /locus_tag="SSUBM407_RS02360"
                     /old_locus_tag="SSUBM407_0423"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012774998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein SepF"
                     /protein_id="WP_012774998.1"
                     /translation="MALKDTFKNLFNYFEVDEVNEVEEQADAYSMPNDRPKMRVANTT
                     VAPVREQQPKVETRREARSESQLQRLHERQQELMTNNNEKEIVKTTIDIKFPKRYEDA
                     PEMVNLLLDNASILIDFQYMSEQQARRCLDYLDGARSVLSGNLKKVSNTMWLLTPVNV
                     TVNIEELRNAGTTTGVADSNFEFDIKR"
     gene            477027..477290
                     /locus_tag="SSUBM407_RS02365"
                     /old_locus_tag="SSUBM407_0424"
     CDS             477027..477290
                     /locus_tag="SSUBM407_RS02365"
                     /old_locus_tag="SSUBM407_0424"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YggT family protein"
                     /protein_id="WP_011922041.1"
                     /translation="MQILIFLLLKIVEIYSYLLLAYALLSWFPSLYTSSIGRLIQWLV
                     APILKPFRRLNLQFMGLDWTVMAAMIALNMGTRFLVQLLLLLA"
     gene            477293..478084
                     /locus_tag="SSUBM407_RS02370"
                     /old_locus_tag="SSUBM407_0425"
     CDS             477293..478084
                     /locus_tag="SSUBM407_RS02370"
                     /old_locus_tag="SSUBM407_0425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002938812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_011922042.1"
                     /translation="MKNDKNLLQHFSREEREFVEKIMDMCQQVEDTYSYRLTHFLHPR
                     QDEIVCKIANYYQLQTFSSRDLVSTEHSRVIIAPTYYELDIKDFELTALHLSYARKFH
                     TLSHSQVLGTFLNQLGIKREYLGDILIDDERLIVFIDQKFGQIALQSITKVARVPVKG
                     KEEEWTTVRLPIGQEWRSKDVLVSSMRLDKLISVAFNLSRATANKLIEAGHVKLDYVL
                     TEQTSKLVEIGQLISVRRYGRVRLNEFLGFSKQGKIKLKLDIVKT"
     gene            478093..478782
                     /locus_tag="SSUBM407_RS02375"
                     /old_locus_tag="SSUBM407_0426"
     CDS             478093..478782
                     /locus_tag="SSUBM407_RS02375"
                     /old_locus_tag="SSUBM407_0426"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DivIVA domain-containing protein"
                     /protein_id="WP_011922043.1"
                     /translation="MALTALELKDKTFATKFRGYDADEVDDFLDIVTRDYEDLIRKNH
                     DQELELKNLRERLAYFDEMKESLSKSVLLAQDTAEKVKVAAEDQAANIIKQADYDAAT
                     LLHEAKDKANEILRNATDNAKKVVIETEELKNQTRIFHQRLKSTVESQLSLVNSSEWE
                     EILRPTASYIQTSDEAFRDVLHKALDEELPVEEESLDYTRQLTPEEIAELTRQAAAFE
                     SGESVVLSIEE"
     gene            479012..479455
                     /locus_tag="SSUBM407_RS02380"
                     /old_locus_tag="SSUBM407_0427"
     CDS             479012..479455
                     /locus_tag="SSUBM407_RS02380"
                     /old_locus_tag="SSUBM407_0427"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002938828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_012774999.1"
                     /translation="MIRLELVNKDNFEVVLQVQLASEDQRRVASVEYSLAQAWLYKDS
                     GMILPYAVVSGRKVVGFAMLSIEPKDNSYYLWRLLIDKDFQNRGCGKEAIQQIIGKAK
                     ADPLCHKISINYVIGNHKMRYILEKIGFQSVGLEGQEMKMELIIK"
     gene            479466..482255
                     /locus_tag="SSUBM407_RS02385"
                     /old_locus_tag="SSUBM407_0428"
     CDS             479466..482255
                     /locus_tag="SSUBM407_RS02385"
                     /old_locus_tag="SSUBM407_0428"
                     /EC_number="6.1.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002943049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucine--tRNA ligase"
                     /protein_id="WP_012775000.1"
                     /translation="MKLKETLNLGKTAFPMRAGLPTREPEWQKAWDEANLYARRQELN
                     EGKPAFHLHDGPPYANGNIHVGHALNKISKDIIVRSKSMSGFRAPFVPGWDTHGLPIE
                     QVLAKQGVKRKEMDLVEYLEMCRDYAFSQVDKQRDDFKRLGVSADWENPYITLTKDYE
                     AAQIRVFGAMADKGYIYRGAKPVYWSWSSESALAEAEIEYHDIDSTSLYYANKVKDGK
                     GLLDTDSYIVVWTTTPFTVTASRGLTMGADIDYVLVQPAGSDRKYVLAEALVDSLAAK
                     FGWESFEVISKHKGAEFEYIVTEHPWDREVDELVILGDHVTTDSGTGIVHTAPGFGED
                     DYNVGVKYDLEVAVTVNERGLMNEAAGPDFEGQFYDKVVPTVKEKLGDLLLASEVINH
                     SYPFDWRTKKPIIWRAVPQWFASVSKFRQEILDQIEATTFNPSWGKTRLYNMIRDRGD
                     WVISRQRAWGVPLPIFYAEDGTAIMTKEVTDHVAALFEEHGSIIWWKSDAKDLLPAGF
                     THPGSPNGEFTKETDIMDVWFDSGSSWNGVMNARENLAYPADLYLEGSDQYRGWFNSS
                     LITSVAVNGHAPYKAILSQGFVLDGNGMKMSKSLGNTILPSDVEKQFGAEILRLWVTS
                     VDTSNDVRVSMDILGQVSETYRKIRNTLRFLIANTSDFNPASDAVAYEELRSVDQYLL
                     VKFNKLVVQIREAYDNYDFMGIYKSVVNFVTLDLSAFYLDFAKDVVYIDGAKSLSRRQ
                     MQTVFYDILVKITKLLTPILPHTAEEIWSYLEHEAEEFVQLAEMPEVETFANEAQLLA
                     DWENFMVFRTQAQKALEEARNAKVIGKSLEAHLTAYVSAETKSFLESLNADLAQLLIV
                     SNLTVTTETAPSTALVVDEVAFAVERAAGEVCDRCRRIDTSVAERSYGATICDHCASV
                     VEENFAEAVAQGFEA"
     repeat_region   complement(482306..482412)
                     /note="Imperfect repeat RepSU1"
                     /rpt_family="RepSU1"
     gene            complement(482634..482942)
                     /locus_tag="SSUBM407_RS02390"
                     /old_locus_tag="SSUBM407_0429"
     CDS             complement(482634..482942)
                     /locus_tag="SSUBM407_RS02390"
                     /old_locus_tag="SSUBM407_0429"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002938710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1827 family protein"
                     /protein_id="WP_002938710.1"
                     /translation="MKIINTTNSHPNLVQSQLANTDAFLVETYSAGNTDVIFTQAPRH
                     YELLISNKYRAVQQNEIEQIRDFFLHRKIDERTINKAAIQTIHTDRLIEMSIPIIAEV
                     "
     gene            complement(482997..483458)
                     /locus_tag="SSUBM407_RS02395"
                     /old_locus_tag="SSUBM407_0430"
     CDS             complement(482997..483458)
                     /locus_tag="SSUBM407_RS02395"
                     /old_locus_tag="SSUBM407_0430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002938708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_002938708.1"
                     /translation="MEKIAVFGEKKAGVSYQSRFGVYAVIPDEKKEQIILVQAPNGAW
                     FLPGGEIEKGENHLIALERELMEELGFTAEIGKYFGQADEYFYSSHRDTHFYNPAYIY
                     EVTSYHQIGQPLEDFNHIAWFPVNEAIDKLKRGSHKWGIEQWKLQENSFNN"
     gene            complement(483644..485872)
                     /locus_tag="SSUBM407_RS02400"
                     /old_locus_tag="SSUBM407_0431"
     CDS             complement(483644..485872)
                     /locus_tag="SSUBM407_RS02400"
                     /old_locus_tag="SSUBM407_0431"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding subunit"
                     /protein_id="WP_012775506.1"
                     /translation="MLCKNCNINDATIHLYTNLNGKQQQVDLCHNCYQIMKTDPHNAI
                     LRGLGDLTNPNNMDPFSEFFNHLGGYPGNTPAGKNREQTPPTQAGGHNGRGGQTPPPQ
                     QPQQPNGLLEEFGINVTEIARRGDIDPVIGRDQEITRVIEILNRRTKNNPVLIGEPGV
                     GKTAVVEGLAQKIIDGDVPQKLRDKEVIRLDVVSLVQGTGIRGQFEERMQKLMEEIRN
                     RREIILFIDEIHEIVGAGSAGDGNMDAGNILKPALARGEMQLVGATTLNEYRIIEKDA
                     ALERRMQPVKVEEPSVEETITILKGIQNKYQDYHHVKYSDAAIEAAAVLSNRYIQDRF
                     LPDKAIDLLDEAGSKMNLTLNFIDPKEIDQRLIDSENRKAQATRDEDYEKAAYFRDQI
                     AKYKEMQKATISEEDIPLITEKEIEAIVEQKTNIPVGDLKEKEQSQLVSLASDLKAHV
                     IGQDEAVDKIAKAIRRNRVGLGAPNRPIGSFLFVGPTGVGKTELSKQLAIELFGSADS
                     MIRFDMSEYMEKHAVAKLVGAPPGYVGYEEAGQLTEKVRRNPYSLILLDEVEKAHPDV
                     MHMFLQVLDDGRLTDGQGRTVSFKDTIIIMTSNAGTGKVEASVGFGAAMEGRTQSVLG
                     QLSNFFTPEFMNRFDGIIEFQPLSKENLLEIVSLMLDDVNKRLSHNGISLHVTDKVKE
                     KLVDLGYNPKMGARPLRRTIQDQIEDAITDFYLEHPAEKDLRAVMSSKGTIQIKAQTK
                     TK"
     gene            486096..486326
                     /locus_tag="SSUBM407_RS02405"
                     /old_locus_tag="SSUBM407_0432"
     CDS             486096..486326
                     /locus_tag="SSUBM407_RS02405"
                     /old_locus_tag="SSUBM407_0432"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003105222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1797 family protein"
                     /protein_id="WP_002938704.1"
                     /translation="MESHLVRIINRLEAMANDGGTLKRNFERDGIVVAEVAYSYDEEN
                     GSVFTLRDVAARETYAFDSIDLIAMEIYELLY"
     gene            486452..487141
                     /locus_tag="SSUBM407_RS02410"
                     /old_locus_tag="SSUBM407_0433"
     CDS             486452..487141
                     /locus_tag="SSUBM407_RS02410"
                     /old_locus_tag="SSUBM407_0433"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002938702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_002938702.1"
                     /translation="MNFSFLPEYWAYFNYGAIVTLIIAFFSVFFGSILGVLLAFAQRS
                     KYKVLAWTANIYVWIFRGTPMIVQIMIAFAMTHFVAPTFQLGILTVDLTRLIPGIIVI
                     SMNSGAYVSETVRAGINAVPKGQLEAAYSLGIRPKQAMRYVIMPQAIKNILPALGNEF
                     VTIVKDSSLLSTIGVMELWNGAQTVQSTSYIPLTPLVFAASYYLIMTTVLTVIIQSFE
                     KKLNKGGQFHV"
     gene            487134..487868
                     /locus_tag="SSUBM407_RS02415"
                     /old_locus_tag="SSUBM407_0434"
     CDS             487134..487868
                     /locus_tag="SSUBM407_RS02415"
                     /old_locus_tag="SSUBM407_0434"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017769699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_002943067.1"
                     /translation="MSNAIISIKDLHKYFGKNEVLKGIDLDIQQGQVVVIIGPSGSGK
                     STFLRTMNLLEVPTKGTVTFEGVDITDKSNDIFKMREKMGMVFQQFNLFPNMTVLDNI
                     TLSPIKTKGIAKDEAEKKAKELLEKVGLPDKANAYPQSLSGGQQQRIAIARGLAMDPD
                     VLLFDEPTSALDPEMVGEVLAVMQDLAKSGMTMVIVTHEMGFAREVADRVIFMDGGVI
                     VEDGTPEEVFEHTKEERTKDFLSKVL"
     gene            487998..488846
                     /locus_tag="SSUBM407_RS02420"
                     /old_locus_tag="SSUBM407_0435"
     CDS             487998..488846
                     /locus_tag="SSUBM407_RS02420"
                     /old_locus_tag="SSUBM407_0435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009909467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional methylenetetrahydrofolate
                     dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
                     /protein_id="WP_011922050.1"
                     /translation="MTVIDGKALGVKLQAALAEKTARLKEEKGLVPGLVVILVGENPA
                     SQVYVRNKERSALAAGFKSEVVRVPDTISESDLLDLIERYNQDDEWHGILVQLPLPAH
                     ISEEKVLLAIDPDKDVDGFHPTNMGKFWSGHPVMIPSTPAGIMEMFKEYQIELEGKSA
                     LVIGRSNIVGKPMAQLLLDADATVTIAHSRTKNLPDLARQADILVVAIGRGHFVTKEF
                     VKLGAVVIDVGMNRDENGKLIGDVKYDEVSEVASYITPVPGGVGPMTITMLMEQTYEA
                     CVRSAK"
     gene            490295..490588
                     /locus_tag="SSUBM407_RS02425"
                     /old_locus_tag="SSUBM407_0436"
     CDS             490295..490588
                     /locus_tag="SSUBM407_RS02425"
                     /old_locus_tag="SSUBM407_0436"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002938694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002938694.1"
                     /translation="MQKTLEKLKRSELFELLVEQAKEIESYQAKLVDLEKRIEYREAV
                     LGEIGSIAEASLAVTRIFEEAQLAANIYLEQVQKVTHKQSDNCEIGRTDEDGD"
     gene            490578..491180
                     /gene="lepB"
                     /locus_tag="SSUBM407_RS02430"
                     /old_locus_tag="SSUBM407_0437"
     CDS             490578..491180
                     /gene="lepB"
                     /locus_tag="SSUBM407_RS02430"
                     /old_locus_tag="SSUBM407_0437"
                     /EC_number="3.4.21.89"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009909468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="WP_014917214.1"
                     /translation="MATNKNKDYVTISDLPSISIMSEELDKIRYKERYLETLKNTIFT
                     LVTVVALAVLIAMLWLPVLHIYGSSMSPTLKAGDMVATVKTNTLSTGDMVAFYYNNKV
                     LVKRVVATSGQWVNIDEQGNVYANGKTLDEPYVKDKAYGQTDIKLPYQVPEGQYFVMG
                     DHRSVSIDSRNTAIGSIGEEQLVGKLTFRIWPFHKMGVIK"
     gene            491199..491585
                     /locus_tag="SSUBM407_RS02435"
                     /old_locus_tag="SSUBM407_0438"
     CDS             491199..491585
                     /locus_tag="SSUBM407_RS02435"
                     /old_locus_tag="SSUBM407_0438"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011922052.1"
                     /translation="MKILWERLFKFVQQYFREKKTAKITMVLSIIMAFGISYLLILPA
                     ITLETDSQESVLQSVYNQPTTVEQPVQEEQAESQLAQVQSAGSLFAEHENITVQVNYE
                     EHTFEQPVRLQVLPSEDSTKYIGLVR"
     gene            complement(491586..>491975)
                     /locus_tag="SSUBM407_RS02440"
                     /old_locus_tag="SSUBM407_0439"
                     /pseudo
     CDS             complement(491586..>491975)
                     /locus_tag="SSUBM407_RS02440"
                     /old_locus_tag="SSUBM407_0439"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_086558050.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase family protein"
     gene            491943..492770
                     /locus_tag="SSUBM407_RS02445"
                     /old_locus_tag="SSUBM407_0440"
     CDS             491943..492770
                     /locus_tag="SSUBM407_RS02445"
                     /old_locus_tag="SSUBM407_0440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class C sortase"
                     /protein_id="WP_012775508.1"
                     /translation="MASQIRHDLSLLVFFLITGLLLLLYPTVSDYWNSHYQSEAVATY
                     SEKLLDISKEEKQKILENVSAYNNTLEKGTILNLNIDSVALKKYDSILNITDTGIMGY
                     VEIPKLQTTLPIYHGTDDAVLQVAVGHLAGTSLPIGGQGSHAAISGHRGLPSAKLFSD
                     LDQLVIGDTFMIQVLDNTLTYEIDKIITVTPDDVSPLMIDPNEDFVTLVTCTPYGVNS
                     HRLLVRGHRIENQLLARQVVSEGSIVKPILVSPFIALCLLGLLWSLFFIKKEVNLFM"
     gene            <492900..493064
                     /locus_tag="SSUBM407_RS02450"
                     /old_locus_tag="SSUBM407_0441"
                     /pseudo
     CDS             <492900..493064
                     /locus_tag="SSUBM407_RS02450"
                     /old_locus_tag="SSUBM407_0441"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007894915.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="phage tail protein"
     gene            493153..493563
                     /locus_tag="SSUBM407_RS02455"
                     /old_locus_tag="SSUBM407_0442"
     CDS             493153..493563
                     /locus_tag="SSUBM407_RS02455"
                     /old_locus_tag="SSUBM407_0442"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_012775509.1"
                     /translation="MNIKEVSDVTGLSADTIRYYERVGLIPKIARKSSGVRDFVENDV
                     AVLDFVRCFRSAGMSIERLIEYMGLVQAGDSTVEARIDLLKEEREVLQSRLSKIQQAL
                     ERLDYKIENYQTILRGAENQLFTDGSGSCKKDRE"
     gene            complement(493589..493900)
                     /locus_tag="SSUBM407_RS02460"
                     /old_locus_tag="SSUBM407_0443"
     CDS             complement(493589..493900)
                     /locus_tag="SSUBM407_RS02460"
                     /old_locus_tag="SSUBM407_0443"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3270 domain-containing protein"
                     /protein_id="WP_012775004.1"
                     /translation="MPLRHYQSHEYQYEEYIPKEKKANFQTYQAKNANKERLKELLFF
                     VNIAFFSLITVIASYVYLSVGIPVFIAIILASATGFLGLRLVQIGLKKKFKPKQVIRK
                     N"
     gene            494061..494990
                     /locus_tag="SSUBM407_RS02465"
                     /old_locus_tag="SSUBM407_0444"
     CDS             494061..494990
                     /locus_tag="SSUBM407_RS02465"
                     /old_locus_tag="SSUBM407_0444"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018376698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="U32 family peptidase"
                     /protein_id="WP_011922056.1"
                     /translation="MEKIIITATAESIEQVKELLVAGVDRIYVGEADHALRIPTNFTY
                     DELREIAELVHSAGKELTVAANALMHQDMMDNIKPFMELMREIKVDYLVVGDTGIFYI
                     NKRDGYNFKLIYDTSVFVTSSRQINFWKDHGAVEAVLAREIPSEELFDIAKNLEMPAE
                     ILVYGASVIHHSKRTLLQNYYNFTKADETDLSRGRGLFLAEPSDPDSHYSIFEDKHGT
                     HIFINNDIDMMTKLSELDEHGYHNWKLDGIYCPGQNFVEIVKLFVQARDLIEKGDFTY
                     DQAFLLDEQVRKLHPAERGLDTGFYEFDRNKVK"
     gene            495288..496574
                     /locus_tag="SSUBM407_RS02470"
                     /old_locus_tag="SSUBM407_0445"
     CDS             495288..496574
                     /locus_tag="SSUBM407_RS02470"
                     /old_locus_tag="SSUBM407_0445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018377161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="U32 family peptidase"
                     /protein_id="WP_014917216.1"
                     /translation="MSKTLKRPEVLSPAGTLEKLKVAIDYGADAVFVGGQAYGLRSRA
                     GNFTMDEMREGIEYAHARGAKVYVAANMVTHEGNEEGAGAWFRELRDMGLDAVIVSDP
                     ALIVICATEAPGLEIHLSTQASSTNYETFEFWKELGLTRVVLAREVTMEEVAEIRKRT
                     DVEIEAFVHGAMCISYSGRCVLSNHMSKRDANRGGCSQSCRWKYNLYDLPFGEERRSI
                     KGEIPEEFSMSAVDMCMIDHIPDMIENGVDSLKIEGRMKSVHYVSTVTNCYKAAVDAY
                     LESPERFEAIKQDLIDEMWKVAQRELATGFYYSPPSENEQLFGARRKIPEYKFIAEVV
                     AFDKETMTATIRQRNVINEGDQVEFYGPGFRHFETTIQDLHDSNGEKIDRANKPMELL
                     TIKLDREIYPGDMIRACKSGLINLYQEDGQSLTIRA"
     gene            complement(496990..497313)
                     /locus_tag="SSUBM407_RS02475"
                     /old_locus_tag="SSUBM407_0447"
     CDS             complement(496990..497313)
                     /locus_tag="SSUBM407_RS02475"
                     /old_locus_tag="SSUBM407_0447"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011922058.1"
                     /translation="MKRFLEVIFEQFTIFLEHGKAPKSIEPDSKEEIKNNLELALYKK
                     AAVHVIYGDRSFTGDIVKYDTDRQRIIMKNFKRQVTSIIKIEDIKKVTLVPDSIKTSQ
                     QQTKG"
     gene            497405..497620
                     /locus_tag="SSUBM407_RS02480"
                     /old_locus_tag="SSUBM407_0448"
     CDS             497405..497620
                     /locus_tag="SSUBM407_RS02480"
                     /old_locus_tag="SSUBM407_0448"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018167072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004194749.1"
                     /translation="MAEFTFEIEEKLLVLSENDKGWTKELNRVSFNGAPAKYDIRTWS
                     PDHTKMGKGITLSNEEFQVLLDAFANK"
     gene            complement(497632..498171)
                     /locus_tag="SSUBM407_RS02485"
                     /old_locus_tag="SSUBM407_0449"
     CDS             complement(497632..498171)
                     /locus_tag="SSUBM407_RS02485"
                     /old_locus_tag="SSUBM407_0449"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin transporter BioY"
                     /protein_id="WP_011922059.1"
                     /translation="MKTTSIKSLVYIAIGTALISTLSQISLSIGPVPFTLQTLAIGLV
                     ACLYKPKEAITSVSLYLVLGAIGLPVFAGFSGGFAALTGPTSGFLWGFLLYTIITSAL
                     TKSDSSPVTIFLACLLGTSICFLLGCCVFKLVSGASWTDTIGWTVLPFILPDLAKITL
                     VMICHRLLQPVIKKEAYFA"
     gene            498376..499113
                     /locus_tag="SSUBM407_RS02490"
                     /old_locus_tag="SSUBM407_0450"
     CDS             498376..499113
                     /locus_tag="SSUBM407_RS02490"
                     /old_locus_tag="SSUBM407_0450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014713635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclase family protein"
                     /protein_id="WP_012775006.1"
                     /translation="MTELLDIYRTLKSKTWVDLTHQINEKSPHFPALPALEKKALFTH
                     KDGFFVEQFTVVGQYGTHIDPPIHFVEGARYLDEIDLKDLLLPLYVIDKSAAVIENND
                     YEITKQDILDFEAEYGPIAPKSFVAFRSDLSKRWPSQDAIRNLDEDGVQRTPGWSHEA
                     LEYLIEERQVKAVGHETLDTDSGVSAAKHGGSLSEEYYLLSKDIYQLEVLANLDQVPP
                     TGALISIAFPHWEKASGSPVRAIAILP"
     gene            complement(499163..500512)
                     /gene="gorA"
                     /locus_tag="SSUBM407_RS02495"
                     /old_locus_tag="SSUBM407_0451"
     CDS             complement(499163..500512)
                     /gene="gorA"
                     /locus_tag="SSUBM407_RS02495"
                     /old_locus_tag="SSUBM407_0451"
                     /EC_number="1.8.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013903882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-disulfide reductase"
                     /protein_id="WP_012775510.1"
                     /translation="MKVFDIIAIGGGSGGIATMNRAAMYGAKAAVIEGSYLGGTCVNL
                     GCVPKKIMWYGSQVAEAIQHYGPEYGFTSQEVTFDFATLRKNREAYIERSRASYGNTF
                     NNNEVEVIQGFARFVDNQTVEVNGELIRAKHIVIATGAKPVVPAIPGSELGIVSDDVF
                     AWEELPSSVAVIGAGYIAVEMAGLLHGLGVQTDLFVRGNRPLRSFDTYIVDALMEEMQ
                     RTNLPLHTGKTPVSLEKTDDGQIQINFADGSNHIAQKVLWAIGRKPNIDKLNLKATSV
                     QLTSSGHISVNEYQETAVPGIYALGDVTGEKELTPVAIKAGRLLAERLFNNKPTAKMD
                     YTTIPTVVFSHPAIGTVGLTEDEAITQYGQDNVKVYTSAFTSMYTALENNRQMAKFKL
                     VTVGENEKVVGLHGIGYGVDEMIQGFSVAIKMGATKEEFDAVVAIHPTGSEEFVTMR"
     gene            500726..501883
                     /locus_tag="SSUBM407_RS02500"
                     /old_locus_tag="SSUBM407_0452"
     CDS             500726..501883
                     /locus_tag="SSUBM407_RS02500"
                     /old_locus_tag="SSUBM407_0452"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter periplasmic adaptor
                     subunit"
                     /protein_id="WP_012775008.1"
                     /translation="MLKTKKAKIALFGGLGVVAVALVGGALIFSNMLTSPSSSEDVAM
                     SMTYTVAKEGSIASSTLLTGTITAADEQYVYYDPSKGDLSEVLVAPGAKVEVGTPLIR
                     YDATELQSALDTAVRGRDKIGRQIADLRTNGQTVQTTGDAETDAAATATAQRSVDMQL
                     ADLNDSYADAQAAVDKAYTALTEATVTSTVAGTVVEVNKAVSKNSTSSQTVVHIVNQG
                     SLQVTGSLTEYDLANIAVDQEVKLTSKVYPDKTWTGKITYISNYPSSNQAGAATTGTS
                     GSGAKYPFKAALTSELGELKQGFSVNIEVVNTSKNILIPVSAVVPEEDKNYVWTLVDG
                     KAKKVEVTLGNADALNQEVTAGIAAGDKVITIPTPNLEDGKEVEANEEPAY"
     gene            501864..502559
                     /locus_tag="SSUBM407_RS02505"
                     /old_locus_tag="SSUBM407_0453"
     CDS             501864..502559
                     /locus_tag="SSUBM407_RS02505"
                     /old_locus_tag="SSUBM407_0453"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_004194759.1"
                     /translation="MKNQLIRLTSINKSYKNGDQELRVLKNIDLEVEEGEFLAIMGPS
                     GSGKSTLMNIIGLLDRFSSGNYWLEGEEVSQLSEKKLAQVRNDQIGFVFQQFFLLSKL
                     NALQNVELPLIYAGVPSSKRKELAKQYLEKVELAERMTHLPSELSGGQKQRVAIARAL
                     VNTPAIILADEPTGALDTKTGEQIMQLLTELNNEGKTIIMVTHEPEIAAYAKRKIVLR
                     DGVITEDSRREGV"
     gene            502560..503807
                     /locus_tag="SSUBM407_RS02510"
                     /old_locus_tag="SSUBM407_0454"
     CDS             502560..503807
                     /locus_tag="SSUBM407_RS02510"
                     /old_locus_tag="SSUBM407_0454"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004194760.1"
                     /translation="MENWKFALKSIMAHKMRSLLTMLGIIIGVAAVVIIVAMGTGVAK
                     SIEKSLAGDQNNVQVYFTAFSSSGTAFGPFGTASTEEPILEEEPDLTDSTLKGLLEID
                     GVSNYYSSISNIAEVRSGNKKAENVTITGVSQNFFAVKEYEILAGRQFTANDYSRFSR
                     MIMLDTALAEKLFGSIENSLNQTISVNSNAYLVIGVYKDPKAGTAIYGMNSGGNAVMT
                     NTQLAAETGMKENSQIFVHVEDVTRATEVGKAAADYLTKATGLKEARYEIYDMSAMLE
                     EFKSQMSGVTLFIGAVAGISLLVGGIGVMNIMLVSVTERTREIGLRKALGATRGNILI
                     QFLIEAMVLTTLGGAIGLAIAQTIVFLLNVSKALGERIAAEISIPVVLGSLAFSAVVG
                     IVFGVLPANKASKLDPIEALRYE"
     gene            503930..>504481
                     /locus_tag="SSUBM407_RS02515"
                     /pseudo
     CDS             503930..>504481
                     /locus_tag="SSUBM407_RS02515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003087421.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="LLM class flavin-dependent oxidoreductase"
     gene            504649..504822
                     /locus_tag="SSUBM407_RS10620"
                     /old_locus_tag="SSUBM407_0456"
     CDS             504649..504822
                     /locus_tag="SSUBM407_RS10620"
                     /old_locus_tag="SSUBM407_0456"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775511.1"
                     /translation="MKKKEQSSRQIVMCHLVAILGVDIEKATQLIDEMEQVGLIRFDE
                     FGNVGILVLEGQS"
     gene            504819..505637
                     /locus_tag="SSUBM407_RS02520"
                     /old_locus_tag="SSUBM407_0457"
     CDS             504819..505637
                     /locus_tag="SSUBM407_RS02520"
                     /old_locus_tag="SSUBM407_0457"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018165722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiator protein A"
                     /protein_id="WP_012775512.1"
                     /translation="MKRITANQYQTSERYYELPKVLFESERYKDMKLEVKVAYAVLKD
                     RLELSLSKGWIDEDGAIYLIYSNSNLMALLGCSKSKLLSIKKILREYGLIDEVQQSSS
                     ERGRMANKIYLGELEHEPTPVLHTDGASVKKTLGGSQRKTGPVLYSAPSETEGSETEY
                     SETEGSDFLIEDEEERQLVDEKQEENFTSKVDGVTKYDRDYIWGLVHDQLRQTGLSQS
                     ASDYAMLYFSDRYQYALEHMRFARSAEVIAEYVFNGVLSEWTKQLRRQEVKGGD"
     gene            505786..507141
                     /gene="dcm"
                     /locus_tag="SSUBM407_RS02525"
                     /old_locus_tag="SSUBM407_0458"
     CDS             505786..507141
                     /gene="dcm"
                     /locus_tag="SSUBM407_RS02525"
                     /old_locus_tag="SSUBM407_0458"
                     /EC_number="2.1.1.37"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000670024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA (cytosine-5-)-methyltransferase"
                     /protein_id="WP_012775513.1"
                     /translation="MKFLDLFAGIGGFRLGMESQGHKCLGFCEIDKFARTSYKAMFNT
                     EGEIEYHDIKEVTDHDFRQFRGQVDIICGGFPCQAFSLAGRRLGFEDTRGTLFFEIAR
                     AAKQIQPRFLFLENVKGLLNHDEGRTFATILSTMDELGYDVEWQVLNSKDFQVPQNRE
                     RVFIIGHSRRYRSRFIFPLRGENSPAHLERLGNINPSKRGLNGEVYLTSGLAPTLTRG
                     KGEGAKIAIPVLTPDRLEKRQHGRRFKDNQDPMFTLTSQDRHGVVVAGNLPTSFDQTG
                     RVFDISGLSPTLTTMQGGDKVPKILLREELPFLKIKEATKTGYAKATLGDSVNLAYPD
                     STKRRGRVGKGISNTLTTSDNMGVVVAAMEYRQAKWYEVTGIVLEGKLYRLRIRRLTP
                     RECFRLQGFPDWAYERAESVSSKSQLYKQAGNSVTVTVIEAIAREFRRTEEEEKHEPT
                     T"
     gene            507125..507553
                     /locus_tag="SSUBM407_RS02530"
                     /old_locus_tag="SSUBM407_0459"
     CDS             507125..507553
                     /locus_tag="SSUBM407_RS02530"
                     /old_locus_tag="SSUBM407_0459"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001050381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011922469.1"
                     /translation="MNLLHKKSILDCTELEEHIHQVETNQLLQKILSLPNFDCDFEVT
                     FEDDYHKEMNDPLFYESNLHRISDFMETRDIKNGVDTLLTKDNHLAFRAFGENYSARG
                     KDGILTTLVTVKCFGEGRMPIDMSRYFSTPEPTVENSLTL"
     gene            507564..507947
                     /locus_tag="SSUBM407_RS02535"
                     /old_locus_tag="SSUBM407_0460"
     CDS             507564..507947
                     /locus_tag="SSUBM407_RS02535"
                     /old_locus_tag="SSUBM407_0460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017770591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775514.1"
                     /translation="MLEVYLGNNANTNQDLLAILTTYGVTYRCIKACDVNREILLSLF
                     AKTTDCFELLSPRFLRFKRQYSISLNEMIQLILQKPDQNLRLPLIVCQNHVYPAIGLD
                     EVRTFLPRQVKEELFQTSLMKQVTG"
     gene            507956..508189
                     /locus_tag="SSUBM407_RS02540"
                     /old_locus_tag="SSUBM407_0461"
     CDS             507956..508189
                     /locus_tag="SSUBM407_RS02540"
                     /old_locus_tag="SSUBM407_0461"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006738851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_024390011.1"
                     /translation="MNERFWDNLEIILAEKDLTWAELARKVFKGQYVYPSEFNRLYQK
                     LRHYKSNRLMPQTRWVERIVLVLEIDYEDLFKR"
     gene            508192..508776
                     /locus_tag="SSUBM407_RS02545"
                     /old_locus_tag="SSUBM407_0462"
     CDS             508192..508776
                     /locus_tag="SSUBM407_RS02545"
                     /old_locus_tag="SSUBM407_0462"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000619435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CPBP family intramembrane metalloprotease"
                     /protein_id="WP_012775516.1"
                     /translation="MIRIVVFYLAIQLNGLLVSLYLKEYLTIEGIVLLQLVLLSVTCL
                     EIARHKTVQAKNITLRNRLRWFLLGFVAMVAFAVFISFLFPGQTRNQAVLVQVGKQVP
                     PIIFLLFLVNASILEEIVYRQLLWEKLTFPFVQIGVTSFLFVLSHGPNQLGSWLMYSC
                     LGLTLAAVRLKTDCMTAIILHLLWNSLAYVVTFL"
     gene            508854..509342
                     /locus_tag="SSUBM407_RS02550"
                     /old_locus_tag="SSUBM407_0463"
     CDS             508854..509342
                     /locus_tag="SSUBM407_RS02550"
                     /old_locus_tag="SSUBM407_0463"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017648298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002936460.1"
                     /translation="MSSEQQERQAMQYVERSSLLTVRTLLKLLEWSARQALAQDSAYK
                     IGVQKLEELLQSPYAIEAIDVSKDILDKPIDVEKFKELMESEKLPIAISWQKDYLYFY
                     AKDKTLLDHHLDELLKKLMSNPEKLEGLTFDKTLDQEIELAKEKIRVTEPSAVKTKEV
                     TL"
     gene            509342..511159
                     /locus_tag="SSUBM407_RS02555"
                     /old_locus_tag="SSUBM407_0464"
     CDS             509342..511159
                     /locus_tag="SSUBM407_RS02555"
                     /old_locus_tag="SSUBM407_0464"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003050830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretory system conjugative DNA
                     transfer family protein"
                     /protein_id="WP_012775517.1"
                     /translation="MYSRQKAFVFGLLGLAFGYFCHRLTLLYDSLTNAPPMERIAYLL
                     GEGLNQVFNPLWLFSFTQKSFLAFILGVLTMTLVYLYVSTGQKVYREGEEYGSARFGT
                     SKEKRNFYSKNPFNDTILARDVRLTLLEKKKPQFDRNKNLIVIGGSGAGKTFRFVKPN
                     LIQLNCSNIVVDPKDHLAEKTGKLFLENGYQVKVLDLVNMTNSDGFNPFRYVETENDL
                     NRMLTVYFNNTKGNGSRSDPFWDEASMTLVRAIASYLVDFYNPPGSSKQEQEARRKRG
                     RYPAFSEIGKLIKLLSKGDNQDKSVLEVLFEDYAKKYGHENFTMRNWADFQNYKDKTL
                     DSVIAVTTAKFALFNIQSVIDLTQRDTMDLKTWGTQKTMVYLVIPDNDTTFRFLSALF
                     FSTVFSTLTRQADVDFKGQLPIHVRSYLDEFANVGEIPDFAEQTSTVRSRNMSLVPIL
                     QNIAQLQGLYKEKEAWKTILGNCDSLLYLGGNDEETFKFMSGLLGKQTIDVRSTSRSF
                     GQTGSSSTSHQKIARDLMTADEVGNMKRDECLVRIAGVPVFRTKKYFPLKHKNWKWLA
                     DKESDERWWHYHINPLTAEEEVDLSGHKIRDLSTEKTLH"
     gene            511177..511419
                     /locus_tag="SSUBM407_RS02560"
                     /old_locus_tag="SSUBM407_0465"
     CDS             511177..511419
                     /locus_tag="SSUBM407_RS02560"
                     /old_locus_tag="SSUBM407_0465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012678629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001072182.1"
                     /translation="MNQKLTGFVYGVDASSMFSQAMSLLQKGLIAVGAFLVVMGIINL
                     STNIKDGGPGVRNAILEIVGGVMVGAAGAFVTQITI"
     gene            511444..512292
                     /locus_tag="SSUBM407_RS02565"
                     /old_locus_tag="SSUBM407_0466"
     CDS             511444..512292
                     /locus_tag="SSUBM407_RS02565"
                     /old_locus_tag="SSUBM407_0466"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017649781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbL"
                     /protein_id="WP_032500787.1"
                     /translation="MNFTSPFVFLASEKVSSDSLFEGFQVDLESTANLVKSLADFNPT
                     VWSYMTAITKGIMQPLGVAILAVVLVLEFSKMAKKIANSGGAMTFEAMAPMIVSYIMV
                     AVVITNTTVIVEAIIALASYVIEQVASLVTNGGANYDTISGIKGSGIVGKMIIGFFAI
                     LIWLVRMASIMVVNILITIRFIQLYLMIPFAPVTIPTFLSDDWRSVGIGYLKNIMVYA
                     VQGILIFLIVSLVPLFESAGKIAVSNGAGVMESLAIMFGGLVQAILLIIALVGSQRTA
                     RSILGM"
     gene            512354..512707
                     /locus_tag="SSUBM407_RS02570"
                     /old_locus_tag="SSUBM407_0467"
     CDS             512354..512707
                     /locus_tag="SSUBM407_RS02570"
                     /old_locus_tag="SSUBM407_0467"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PrgI family protein"
                     /protein_id="WP_012775519.1"
                     /translation="MNTRVFKDISKVQHRAWLGFTTRQVIFVFPAIVLTILVLGLNLF
                     YWQFGDWFVYGFVFIFTIPLMLFGVYRPNDLPFETYLRYRFHYELTVPDRTFTGRKGD
                     QREKIKTLNEIKDLF"
     gene            512664..515015
                     /locus_tag="SSUBM407_RS02575"
                     /old_locus_tag="SSUBM407_0468"
     CDS             512664..515015
                     /locus_tag="SSUBM407_RS02575"
                     /old_locus_tag="SSUBM407_0468"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000734154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_044682503.1"
                     /translation="MKKLKHSMKSKTSSNDKKQKTKTQKQEIRPSTVNTLAYQGLFQN
                     GLMQVSPSYFSQTYLLGDVNYQTVGLDDKGAIVEKYSDLINSLDDQTNFQLTIFNQKV
                     NLEKFRKSILYPLQEDGFDAYRDELNRMMDANLEAGENNFSAVKFLSFGKSDQTPKLA
                     FRSLSQIGEYFKSGFSEIDVSLGLLGGEERVNVLADMLRGENHSSFSYKDLTLSGQST
                     KHFIAPTYLSFKHKNHIELDERLLQIVYVRDYGMELGDKFIRDLMQSDLEVMISLHAK
                     GSTKSETMTKLRTKKTLMESQKIGEQQKMARTGIYLEKVGHVLENNIDEAEALLQTMT
                     QTGDKLFDTVFLIGVLADTEDQLKQSLDIIKQVAGSNDMIIDNLTYMQEAAFNSLLPF
                     GKNYLEGVSRSLLTSNIAVNAPWTSVDIQDKGGKFYGINQISSNIISIDRGKLNTPSG
                     LILGTSGAGKGMATKHEIISTKLKEADSDTEIIIVDPENEYSIIGQAFGGESIDIAPD
                     STTFLNVLDLSDENMDEDPVKVKSEFLLSWIGKLLDRKMDGREKSLIDRVTRLTYKHF
                     DTPSLVEWVFVLAQQPEQEAKDLALDMELYVEGSLDIFSHRTNIKTDSHFLIYNVKKL
                     GDELKQIALMVIFDQIWNRVVKNQKLGKKTWIYFDEMQLLLLDKYASDFFFKLWSRVR
                     KYGAIPTGITQNVETLLLDANGRRIIANSEFMILLKQAKSDREELVHMLGLSKELEKY
                     LVNPEKGAGLIKAGSTVVPFKNKIPQHTKLFDIMSTDPEKMRT"
     gene            515017..517818
                     /locus_tag="SSUBM407_RS02580"
                     /old_locus_tag="SSUBM407_0469"
     CDS             515017..517818
                     /locus_tag="SSUBM407_RS02580"
                     /old_locus_tag="SSUBM407_0469"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017649001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CHAP domain-containing protein"
                     /protein_id="WP_012775521.1"
                     /translation="MKEDKKLVKQARQNFRSNLKSARMHYRKEVSSLKQTVPKKGRFR
                     KSAKNSLFQEKKTELKGNLLSSQKEAEEKFLKEITYVSPRLLRGKEIKNYRLSQAQER
                     LRTARKHLSEVKLREKSKSVNPKFTFQKENSSLKSRFQFHQEKSFDRLSAEKDVSSAK
                     REVKQLKKVRKSKKSSTKVKAGLALAASESLDLIAQEDDLDGLRTMKDTSLKARRYGR
                     FTFQAGKVAVKSGQTGVRFTKTKFSHGKERFQNFKKGKGFTRQKPLKPRRRYQTFLKL
                     ARKQSVAGFKGIVQAIKGSMTFFSVLAGNPLTWIVSGILLILLLMMSFFMSVSGSSVI
                     QQDEIELSKSYTHMTLEDAEHTRNNEKGITFYTKIDEVMVYMNHQYQDYKLDDFMEAG
                     GVTYKAFLSQVWTDLNGGDSIKSMSDLYKEPTYKLSDEDQEELKELTEGGNYLALQEL
                     DNPFQGQTDEDSLSMTYRYGYEVIDEKPTLHHHIILEAKEGQVIVAPMDGKVSLDGEN
                     VVLTSGKGVNKTKLTLFGIHSGRVSENQQVLAGDIIGQTKDGTGLKVTYQKVDDDTDK
                     LVYVNPAFYFPKVIQVQTTILPTIGQFGGDEFERAKAIYDYLKSKGATNQAIAAILGN
                     WSVESSINPKRAEGDYLSPPIGATDGSWDDEGWLSLNGPTIYNGRYPNILKRGLGLGQ
                     WTDTADGSRRHTLLLEYAKGKHQKWYDLGLQLDFMLHGDSPYYTNWLKDFFKNSGSPA
                     SLAQLFLIYWEGNSGDKLLERQTRASEWYYQIEKGFSQPNGGTAQSDPKALEAVRGDL
                     FENSVPGGGDGMGYAYGQCTWGVAARINQLGLKLKGKNGEKIPIISTMGNGQDWVRTA
                     ASLGGETGTSPQAGAILSFAGGGHGTPTEYGHVAFVEKVYPDGSFLISETNYNGNPNY
                     TFRKLSGVDSSLSFAYTTK"
     gene            518157..518792
                     /locus_tag="SSUBM407_RS02585"
                     /old_locus_tag="SSUBM407_0470"
     CDS             518157..518792
                     /locus_tag="SSUBM407_RS02585"
                     /old_locus_tag="SSUBM407_0470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017649777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000222716.1"
                     /translation="MTYTLEWLETFDGEIDILNVDMSCLANTIEKYVSQYKYVYQTNM
                     ENYPEIVLSVPNSSIPHLLGLSRDHHVNLPTNNAGSIFEGLKDDWTLQRLNKADNGWF
                     NENKFKIVGTLLLYQMLHVMECKFYTTDGILNRKVGKRFRRDNIYFVVFKLSNGISYT
                     VELSHEQGNQYFPRSLKINDTLITNCREIELKLVDKKRFKTAKVRKVNWPS"
     gene            518952..523847
                     /locus_tag="SSUBM407_RS02590"
                     /old_locus_tag="SSUBM407_0471"
     CDS             518952..523847
                     /locus_tag="SSUBM407_RS02590"
                     /old_locus_tag="SSUBM407_0471"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000167702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPXTG cell wall anchor domain-containing
                     protein"
                     /protein_id="WP_012775522.1"
                     /translation="MTKTCNHHFLVNQEKGEKHVFRKSKKYRTLCSVALGTMVTAVVA
                     WGGTVAHADEVTSSVDTAIQRTENPATNLPEAQPTPVSEQTESLGSTGQSNGAIAVTV
                     PHDTVAQAVEQAKVEGVSTVEDSPMDLGNTTSAAETNQQISKAEEDAQNQVEAINEVT
                     KTYKADKAAYVDEKVRIEQENKVLSQAYEGANQTGKETNAWVDSKVNDLKTRYADADV
                     TVKEQVISSGNGTSVLDYTNYGKAVETIQSTNEQAVADYLTKKTKADDIVAKNQAIQK
                     ENEAGLAKAKADNEAIEKRNQAGQAAVDAENRAGQAAVDQANQEKQQFVSDRAAEIEA
                     ITKRNQEKEATARKENEAIDADNAKELERYQRDLAEISKGEEGYISEALAQALNLNNG
                     EPQAQHGAITRNPDQIISTGDALLGGYSRILDSTGFFVYDSFKTGETLSFNYQNLQNA
                     RFDGKKISRVTYEITNLVSPAGTDAVKLVVPNDPTEGFIAYRNDGNGDWRTDKMEFRV
                     VAKYFLEDGSQVTFSKEKPGVFTHSSLNHNDIGLEYVKDTSGKFVPINGSTVQVTNEG
                     LARSLGSNRASDLNLAEEWDTTSSRYAYKGAIVSTVTSGNTYTVTFGQGDMPQDVGLS
                     YWFALNTLPVARTVTPYSPKPHVTVELEPIPEPITVTPDVFTPKTFTPEKPVTFTPKP
                     LEEVVQPSLTLTKVTLPVKPIPKELPTPPQVPTVHYHAYRLTTTPEIMKEVVNSDQAN
                     LHEKTVAKDSTVIYPLTVDALSPNRAQTTSLIFEDYLPTGYLFDKETTQKENGNYVLS
                     FDETKNFVTLTAKENLLQEVNKDLTKVYQLNAPKLYGSVQNDGATYSNSYKLLLNKGT
                     TNTYTVTSNVVTVRTPGDGETTTLITPDKNNENADGVLINDTVVALGTTNHYRLIWDL
                     DQYKGDRSAKETIARGFFFVDDYPEEVLDVVENGTAVTTLDGQKVSGITVKNYTSLNE
                     APKDLQDKLARAKITPTGAFQVFLPDDNQAFYDQYVQTGTSLALLTKMTVKDSLYGQT
                     KTYTNKAYQVDFGNGYETKEVTNTLVSPEPKKQNLNKDKVDINGKPMLVGTQNHYTLS
                     WDLDQYRGIKADNSQIAQGFYFVDDYPEEALLPDEAAIQFVTSDGKTVSGITVKAYSQ
                     LSEAPKTLQEALSKQKIQPQGAFQVFMPEDPQAFFESYVTKGENITIVTPMTVLETML
                     NSGKSYENVAYQVDFGQAYETNTVTNFVPKVTPHKSNTNQEGISIDGKTVLPNTVNYY
                     KIVLDYSQYKDMVVTDDVLAKGFYMVDDYPEEALTLNPDGIQVLDKDGNRVSGISVST
                     YTSLSEAPKVVQDAMAKRQFTPKGAIQVLSSDDPKAFYDTYVKTGQTLVVTLPMTVKN
                     ELTKTGGQYENTAYQIDFGLAYVTETVVNNVPKLDPQKDVVIDLSHKDVSLDGKEVAL
                     NQTFNYRLVGAMIPSNRATDLFEYGFEDNYDEKHDEYNGVYRSYLMTDVTLKDGSVLK
                     EGTEVTKYTLQQVDTENGLVSISFDKSFLETISDDSAFQADVYLQMKRIATGQVENTY
                     LHTVNGYVISSNTVVTHTPQPEEPSPNQPSPPQPPIESLEPPVPASVLPNTGEQESIL
                     GLIGAGILLGTAYGLKKKEEK"
     gene            523848..524039
                     /locus_tag="SSUBM407_RS02595"
                     /old_locus_tag="SSUBM407_0471a"
     CDS             523848..524039
                     /locus_tag="SSUBM407_RS02595"
                     /old_locus_tag="SSUBM407_0471a"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017370833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calcium-binding protein"
                     /protein_id="WP_001068448.1"
                     /translation="MNPKTIYEKDSDQDGLTDAQELALGTNPQSVDTDGDGQADLEEL
                     QSGHSPLVPQKELCDGLEL"
     gene            524023..524574
                     /locus_tag="SSUBM407_RS02600"
                     /old_locus_tag="SSUBM407_0472"
     CDS             524023..524574
                     /locus_tag="SSUBM407_RS02600"
                     /old_locus_tag="SSUBM407_0472"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017370834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775523.1"
                     /translation="MAWNFDTMKEALSEMEKVDYQEFIKAFLSLELSISNRTILNQVY
                     QDYMDEDDLSLISDELRDKVDSYQDELQADMTDILEKLYRTGEGSSFIMDLMSSNSLS
                     DTLEQYEVLDSDDYSPLSLETLQAIIQQELAISSQDYFGDLVHLALQKDLLDQKSNFL
                     QHYVATVMEGIPQERDQRALVLD"
     gene            524624..531469
                     /locus_tag="SSUBM407_RS02605"
                     /old_locus_tag="SSUBM407_0473"
     CDS             524624..531469
                     /locus_tag="SSUBM407_RS02605"
                     /old_locus_tag="SSUBM407_0473"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001071192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="WP_012775524.1"
                     /translation="MNQEVLLQMMRATIPRDRALLEAFLYYQAEHFDEEWDSLIRQFL
                     TNRKEIKKSVQVLHFETDVSAFVQASPYDTAHDLLTYTQVFGQSGLQKLDKLSPTEKN
                     LVIEVALFNLATRFQLLDSNGHYQTISPDSLLQKSRGANLVNVYRVANNLADRISRDI
                     EQFLLTYESELETGVDETVLENEATVDEHKTSVHQAISFREDGSLIIASLDVDLSQLD
                     VQTGKTSHLPAYEELSLRRKFEILTYFDQIRNERSKVPSFKRGDFDTEMEMTPIFEGE
                     ELLTYLEADGSPYELKRTLTTVEEKELEKIGRAIRIENQEKLTQLGIELSQFESDQVG
                     ILLDAAGRFRLKNADLALLGGYPKASVTQLALATELLQMGLSHEKVEFFFGSQLSIEE
                     LRQVAYAFLHQELSREDAEQFEKDKGNQPDLTLRDWKNKLEKAEGKEVVDEAFEVNPL
                     VQMVLDNYPLGTLVSYKGQDFEVTSVSDARLNGLIRIELVNDFSDIIEQNPVLYLRTW
                     EEISQVIHIPKPEPKVELDEPDQELNLFSFLEEETSQSVNEAVQNIGVLDPDGSEKGH
                     NDTDLEDTDNQIPEEEVVEIIPDSPVTDFHFPEDLTVFYPKTARDKVETNIAAIRLVK
                     ILEAERRKASPSEQELLAKYVGWGGLANEFFDDYNPKFSKEREELKNLVSDKEYSDMK
                     QSSLTAYYTDPALIRQMWDKLERDGFTGGKILDPSMGTGNFFAAMPKHLREKSELYGV
                     ELDTITGAIAKHLHPTSHIEIKGFETVAFNDNSFDLVISNVPFANIRIADNRYNKPYM
                     IHDYFVKKSLDLVHDGGQVAIISSTGTMDKRTENILQDIRETTEFLGGVRLPDSAFKA
                     IAGTSVTTDMLFFQKHLDKGYVTDDLAFLGSVRYDKDSRIWLNPYFDGKYNSQVLGTY
                     EVRNFNGGTLSVKGTSDNLIASVQTALNHVKAPREIDRNDIIINPNVLTEQVMDTSIP
                     AEIRENLGQYSFGYQGSTVYYRDNKGIRVGTKTEEISYYVDEEGNFKAWDTKHSQKQI
                     DRFNALEVTDNTALDVYVTDDAAKRGQFKGYYKKTVFYEAPLSDKEVARIKGMVDIRN
                     AYQEVIAIQRHYDYDKKTFSHLLGKLNRTYDSFVKRYGYLNSAVNRNLFDSDDKYSLL
                     ASLEDESLDPSGKSVIYTKSLAFEKALVRPEKEVKKVHTALDALNSSLADGRGVDFAY
                     MMSIYQVESKMTLIEELGDLIMPDPEKYLNGELSYVSRQDFLSGDVVTKLEVVDLFVK
                     QDDQDFNWPHYAGLLETVKPARITLADIDYRIGSRWIPLSVYGKFAQETFMGKAFDLS
                     DQEVVTVLEVSPIDGVITYQSKFAYTYSNATDRSLGVPASRYDSGRKIFENLLNSNQP
                     TITKQVVEGDKKKNVTDVEKTTVLRAKETHLQELFQDFVAKYPEVQQIIEDTYNRLYN
                     RTVSKTYDGSHLTIDGLAQNISLRPHQKNAIQRIVEEKRALLAHEVGSGKTLTMLGAG
                     FKLKELGMVHKPLYVVPSSLTAQFGQEIMKFFPTKKVYVTTKKDFAKAKRKQFVSRII
                     TGDYDAIVIGDSQFEKIPMSREKQVTYINDKLEQLREIKLGSDSDYTVKEAERSIKGL
                     EHQLEELQKLERDTFIEFENLGIDFLFVDEAHHFKNIRPITGLGNVAGITNTTSKKNV
                     DMEMKVRQVQAEHGDRNVVFATGTPVSNSISELFTMMNYIQPDVLERYQVSNFDSWVG
                     AFGNIENSMELAPTGDKYQPKKRFKKFVNLPELMRIYKETADIQTSDMLDLPVPEAKI
                     IAVESELTQAQKYYLEELVERSDAIKSGSVDPSRDNMLKITGEARKLAIDMRLIDPAY
                     SLSDNQKILQVVDNVERIYREGAGDKATQMIFSDIGTPKSKEDGFDVYNELKDLLVDR
                     GIPKEEIAFVHDANTDEKKNSLSRKVNSGEVRILMASTEKGGTGLNVQSRMKAVHHLD
                     VPWRPSDIVQRNGRLIRQGNMHQEVDIYHYITKGSFDNYLWQTQENKLKYITQIMTSK
                     DPVRSAEDIDEQTMTASDFKALATGNPYLKLKMELENELTVLENQKRAFNRSKDEYRH
                     TISYSEKNLPIMEKRLSQYDKDIAQSLTTKSQDFVMRFDNQSMDNRSEAGDYLRKLIT
                     YNRSETKEVRTLASFRGFDLKMTTRGLSEPLPETISLMIVGDNQYTVALDLKSDVGTI
                     QRISNAIDHIIDDQEKTEGLVKDLKDKLRVAKVEVEKVFPKEEDYQLVKAKYDVLAPL
                     VEKEEEIEVIDAALAKFSEETTAQMKQQIALEI"
     gene            531540..531839
                     /locus_tag="SSUBM407_RS02610"
                     /old_locus_tag="SSUBM407_0474"
     CDS             531540..531839
                     /locus_tag="SSUBM407_RS02610"
                     /old_locus_tag="SSUBM407_0474"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000194854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775525.1"
                     /translation="MTQTLEEMRYQLEEWLAQGYTSPEDRANYQNLKEQYEDETLDYS
                     FSRREITGQLELIITSRENDFPNLDEVTKAEYLDLVAQLDDLDKRQADYYRKQLA"
     gene            531853..532152
                     /locus_tag="SSUBM407_RS02615"
                     /old_locus_tag="SSUBM407_0475"
     CDS             531853..532152
                     /locus_tag="SSUBM407_RS02615"
                     /old_locus_tag="SSUBM407_0475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775526.1"
                     /translation="MLEQILQSLLIIAAIGLMLLVLYQIVKVSGALFLIGLISGLVFI
                     EIYGIYLFFTERYLYSEDLATNGIWSFTGFFIIFNILLVLGLMTNLVKSRITEYK"
     gene            complement(532197..533084)
                     /locus_tag="SSUBM407_RS02620"
                     /old_locus_tag="SSUBM407_0476"
     CDS             complement(532197..533084)
                     /locus_tag="SSUBM407_RS02620"
                     /old_locus_tag="SSUBM407_0476"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018379642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_012775527.1"
                     /translation="MDYTIISNYLDYCKAHKRLSTHTLRAYKNDLMQFYNSNNECVIS
                     YIEGLTHSNLKTSTLRRKIASLKVFYGYLQLKNVITDNPFNQLRFQFRAEKTLPKTIS
                     HDSLKILYTYLQKKMISAKTIYQKQKAERNLLIVSLLLSTGIRISELCHIQIKDINLT
                     EQTLQILGKGKKERMIFIGDERTFQLLKAYITCYCNHTDDYLFPGKSLQKPLTEQSVR
                     LLLKTAKTQTRLTTTITPHMFRHSFATMLLDNDVDIRYIQQILGHSSISITQIYTHVS
                     QSRQKEILSSYNPISSIYT"
     gene            533176..534126
                     /locus_tag="SSUBM407_RS02625"
                     /old_locus_tag="SSUBM407_0477"
     CDS             533176..534126
                     /locus_tag="SSUBM407_RS02625"
                     /old_locus_tag="SSUBM407_0477"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001241758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-grasp domain-containing protein"
                     /protein_id="WP_012775528.1"
                     /translation="MKLVVILNVNPDPNVHEKISDNREYTRRELKNILKENFSKFVKE
                     VTFYDNFEHFKINVQKHHNDFVLNFDFGYKSRTRNMNVPAFCENYNIKYFNPDPYVQV
                     LCQDKFMTEKFAENFGVTVPNSLLVFKHSYQKNLLKDLNYPLIIKPNYESESIGITQD
                     SIVENPGDADTIIGKLFKEFDGILVEEYIEGKEVAITIWDNGEEIFFEEVELIFPRLE
                     EIKYQAYTSEIKQKIGIEIKKSCYLSDKDIINLKQLYKNLSPNKLIRIDGRIKNSKFY
                     LIEINANPGLYPKSVVPKTFLINGYDYETMLKKLFSVHLN"
     gene            complement(534107..535402)
                     /locus_tag="SSUBM407_RS02630"
                     /old_locus_tag="SSUBM407_0478"
     CDS             complement(534107..535402)
                     /locus_tag="SSUBM407_RS02630"
                     /old_locus_tag="SSUBM407_0478"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775529.1"
                     /translation="MFLIEKNLLEQVENFVFLPNSVSEIVRQESYFRTEKAFVGSSLI
                     RFLNLKISKTNKFEYLDTLVDYYIDSKNLLQIKPIIPQIRERLLNFDSQQGRREYFEK
                     FFLNRQRFIEKDNSFALSFTKIAYDANLYHEALEFINLSSKVTDDVIFAKSLILNRCE
                     LFIESIAYIQKNITSLSEQSSQFFKLSLIKLMNLIQLERRDEAKTIFESIKSQVDNPY
                     YPFLIRISNVFESSFSERLRMVEEISDRIYNQGNAEFSGLNAIYLSYLYAVNGKIMNA
                     EEHLDKARYFFGEKLIYNHMILHNEATIKFHNNDIDESIPELLNNAKLTAYDQYDLLA
                     IYNNLLVYYILSERVADINCQMLVLELEELLNETGFKRFVDKIYYNLYHYYNKMYNVD
                     KAEVYNNKLTHHQIKNFKEYNVRLMYETSWKLPLSLDGH"
     gene            complement(535571..536788)
                     /locus_tag="SSUBM407_RS02635"
                     /old_locus_tag="SSUBM407_0479"
     CDS             complement(535571..536788)
                     /locus_tag="SSUBM407_RS02635"
                     /old_locus_tag="SSUBM407_0479"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020220015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_001291561.1"
                     /translation="MSEKRRDNKGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKL
                     VATDRVPAGKRDCISLREKIAELQKDIHDGIDVVGKKMTLCQLYAKQNAQRPKVRKNT
                     ETGRKYLMDILKKDKLGVRSIDSIKPSDAKEWAIRMSENGYAYQTINNYKRSLKASFY
                     IAIQDDCVRKNPFDFQLKAVLDDDTVPKTVLTEEQEEKLLAFAKADKTYSKNYDEILI
                     LLKTGLRISEFGGLTLPDLDFENRLVNIDHQLLRDTEIGYYIETPKTKSGERQVPMVE
                     EAYQAFKRVLANRKNDKRVEIDGYSDFLFLNRKNYPKVASDYNGMMKGLVKKYNKYNE
                     DKLPHITPHSLRHTFCTNYANAGMNPKALQYIMGHANIAMTLNYYAHATFDSAMAEMK
                     RLNKEKQQERLVA"
     gene            complement(536870..537073)
                     /locus_tag="SSUBM407_RS02640"
                     /old_locus_tag="SSUBM407_0479a"
     CDS             complement(536870..537073)
                     /locus_tag="SSUBM407_RS02640"
                     /old_locus_tag="SSUBM407_0479a"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006730246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excisionase"
                     /protein_id="WP_000814511.1"
                     /translation="MKQTDIPIWERYTLTIEEASKYFRIGENKLRRLAEENKNANWLI
                     MNGNRIQIKRKQFEKIIDTLDAI"
     gene            complement(537534..537764)
                     /locus_tag="SSUBM407_RS02645"
                     /old_locus_tag="SSUBM407_0480"
     CDS             complement(537534..537764)
                     /locus_tag="SSUBM407_RS02645"
                     /old_locus_tag="SSUBM407_0480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002411750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_000857133.1"
                     /translation="MKTQYPMIPFPLIVKATDGDTEAINQILHHYRGYITKRSLRLMK
                     DEYGNQSMVVDEVLRGRMETRLITKILSFEIK"
     gene            complement(537761..538183)
                     /locus_tag="SSUBM407_RS02650"
                     /old_locus_tag="SSUBM407_0481"
     CDS             complement(537761..538183)
                     /locus_tag="SSUBM407_RS02650"
                     /old_locus_tag="SSUBM407_0481"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006733729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="WP_000804885.1"
                     /translation="MKPSSFQTTIENQFDYICKRAMEDERKNYMLYLSRIAKREVSFS
                     DVGDYLVSQFATTDNYSTDFQIFTLNGLSVGVENDLLSEALRELPDKKREILLLFYFM
                     DMSDSEIADLLKLNRSTVYRHRTSGLALIKKFMEEFEE"
     gene            538688..539041
                     /locus_tag="SSUBM407_RS02655"
                     /old_locus_tag="SSUBM407_0482"
     CDS             538688..539041
                     /locus_tag="SSUBM407_RS02655"
                     /old_locus_tag="SSUBM407_0482"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001227347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_001227347.1"
                     /translation="MRKKEDKYDFRAFGLAIKEARLKRGLTREQVGALIEIDPRYLTN
                     IENKGQHPSIQVLYDLVSLLHVSVDEFFLPANNLVKSTRRLQIEKYMDSFTDKELSLM
                     ESLASGINEARNIED"
     gene            complement(539101..539268)
                     /locus_tag="SSUBM407_RS02660"
     CDS             complement(539101..539268)
                     /locus_tag="SSUBM407_RS02660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002319681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine-rich KTR domain-containing protein"
                     /protein_id="WP_000336323.1"
                     /translation="MCPVCGNKTRLKIREDTELKKFPLYCPKCRQENLIEIKQFKVTV
                     ITEPDAKTQSR"
     gene            complement(539387..541306)
                     /gene="tet(M)"
                     /locus_tag="SSUBM407_RS02665"
                     /old_locus_tag="SSUBM407_0483"
     CDS             complement(539387..541306)
                     /gene="tet(M)"
                     /locus_tag="SSUBM407_RS02665"
                     /old_locus_tag="SSUBM407_0483"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019117172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetracycline resistance ribosomal protection
                     protein Tet(M)"
                     /protein_id="WP_002371500.1"
                     /translation="MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTD
                     NTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAK
                     DGVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVEL
                     YPNMCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLYH
                     GSAKSNIGIDNLIEVITNKFYSSTHRGQSELCGNVFKIEYTKKRQRLAYIRLYSGVLH
                     LRDSVRVSEKEKIKVTEMYTSINGELCKIDKAYSGEIVILQNEFLKLNSVLGDTKLLP
                     QRKKIENPHPLLQTTVEPSKPEQREMLLDALLEISDSDPLLRYYVDSTTHEIILSFLG
                     KVQMEVISALLQEKYHVEIELKEPTVIYMERPLKNAEYTIHIEVPPNPFWASIGLSVS
                     PLPLGSGMQYESSVSLGYLNQSFQNAVMEGIRYGCEQGLYGWNVTDCKICFKYGLYYS
                     PVSTPADFRMLAPIVLEQVLKKAGTELLEPYLSFKIYAPQEYLSRAYNDAPKYCANIV
                     DTQLKNNEVILSGEIPARCIQEYRSDLTFFTNGRSVCLTELKGYHVTTGEPVCQPRRP
                     NSRIDKVRYMFNKIT"
     gene            complement(541322..541438)
                     /locus_tag="SSUBM407_RS02670"
     CDS             complement(541322..541438)
                     /locus_tag="SSUBM407_RS02670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001814923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetracycline resistance determinant leader
                     peptide"
                     /protein_id="WP_001791010.1"
                     /translation="MILKYPENICMLCIPMVMHKNPSDKSIYHWDFYALLGF"
     gene            complement(541683..542615)
                     /locus_tag="SSUBM407_RS02675"
                     /old_locus_tag="SSUBM407_0484"
     CDS             complement(541683..542615)
                     /locus_tag="SSUBM407_RS02675"
                     /old_locus_tag="SSUBM407_0484"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein"
                     /protein_id="WP_001224318.1"
                     /translation="MRKEDLMMKFRKNQNKEKQIPKEKKPRVYKVNPHKKVVIALWVL
                     LGLSFSFAIFKHFTAIDTHTIHETTIIEKEYVDTHHVENFVENFAKVYYSWEQSDKSI
                     DNRMESLKGYLTDELQALNVDTVRKDIPVSSSVRGFQIWTVEPTGDNEFNVTYSVDQL
                     ITEGENTKTVHSAYIVSVYVDGSGNMVLVKNPTITNIPKKSSYKPKAIESEGTVDSIT
                     TNEINEFLTTFFKLYPTATASELSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTV
                     SLTVEYIDQQTKATQVSQFDLVLEKNGSNWKIIE"
     gene            complement(542612..543613)
                     /locus_tag="SSUBM407_RS02680"
                     /old_locus_tag="SSUBM407_0485"
     CDS             complement(542612..543613)
                     /locus_tag="SSUBM407_RS02680"
                     /old_locus_tag="SSUBM407_0485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018368130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional lysozyme/C40 family peptidase"
                     /protein_id="WP_000769868.1"
                     /translation="MKLKTLVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGV
                     NVSAEVLAHKPMVEKYAKEYGVEEYVNILLAIIQVESGGTAEDVMQSSESLGLPPNSL
                     STEESIKQGVKYFSELLASSERLSVDLESVIQSYNYGGGFLGYVANRGNKYTFELAQS
                     FSKEYSGGEKVSYPNPIAIPINGGWRYNYGNMFYVQLVTQYLVTTEFDDDTVQAIMDE
                     ALKYEGWRYVYGGASPTTSFDCSGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQA
                     GDLVFFHSTYNAGSYITHVGIYLGNNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ"
     gene            complement(543610..545787)
                     /locus_tag="SSUBM407_RS02685"
                     /old_locus_tag="SSUBM407_0486"
     CDS             complement(543610..545787)
                     /locus_tag="SSUBM407_RS02685"
                     /old_locus_tag="SSUBM407_0486"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017646277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000804748.1"
                     /translation="MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAIFLLAMLGTVVQ
                     AAGLVDDTVNVANEYSRYPLENYQLDFYVDNSWGWLPWNWSDGIGKQVMYGLYAITNF
                     IWTISLYVSNATGYLVQEAYSLDFISATADSIGKNMQTLAGVSANGFSTEGFYVGFLL
                     LLILVLGVYVAYTGLIKRETTKAIHAIMNFVLVFILSASFIAYAPDYIKKINDFSSDI
                     SNASLSLGTKIVMPHSDSQGKDSVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRV
                     ESLLSTSPDSNNGEDREKIVAEEIEDRSNTNLTITKTINRLGTVFFLFVFNIGISIFV
                     FLLTGIMIFSQVLFIIYAMFLPVSFILSMIPSFDGMSKRAITKLFNTILTRAGITLII
                     TTAFSISTMLYTLSAGYPFFLIAFLQIVTFAGIYFKLGDLMSMFSLQSNDSQSVGSRV
                     MRKPRMLMHAHMHRLQRKLGRSMTTLGAGSAIVTGKKGQSGSGSSARTQADHSRPDGK
                     EKSTLGKRIGQTIGTVADTKDRMVDTASGLKEQVKDLPTNARYAVYQGKSKVKENVRD
                     LTSSISQTKADRASGRKEQQEQRRKTIAKRRSEMEQVKQKKQPASSVHERPTTRQEQY
                     HDEQTSKQSNIQTSYKESQQAKQERPAVKSDFSSPKVERQGNTVQEKTVQKPATSTTT
                     ADRTSQRPITKERPSTVQRVPLQNTRSRPPIKTATIKKVGKKP"
     gene            complement(545790..548237)
                     /locus_tag="SSUBM407_RS02690"
                     /old_locus_tag="SSUBM407_0487"
     CDS             complement(545790..548237)
                     /locus_tag="SSUBM407_RS02690"
                     /old_locus_tag="SSUBM407_0487"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000331151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_000331160.1"
                     /translation="MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHD
                     SFRQLIAQNRDGKIHALQISTESSIRSAQERSKNEVTGKLKAVAYDKIDQQTDALISM
                     IGENQVNYRFFIGFKLLLNDQEFSMKSLTVEAKNALSDFVYDVNHKLMGDFVSMSNDE
                     ILRFQKMEKLLENKISRRFKIRRLDKDDFGYLIEHLYGQTGTAYEEYEYHLSKKKLDN
                     ETLIKYYDLIKPTRCLVEEKQRYLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQ
                     QQQFTFPIDTSMNVEIVANRKALSTVRNKKKELKDLDNHAWQSDNETSSNVAEALESV
                     NELETNLDQSKESMYKLSYVVRVSANDLDELKRRCNEVKDFYDDLSVKLVRPFGDMLG
                     LHEEFLPASKRYMNDYIQYVTSDFLAGLGFGATQMLGENEGIYVGYSLDTGRNVYLKP
                     ALASQGVKGSVTNALASAFVGSLGGGKSFANNLIVYYAVLYGAQAVIVDPKAERGRWK
                     ETLPEISHEINIVTLTSDEKNKGLLDPYVIMKNPKDSESLAIDILTFLTGISSRDGER
                     FPILRKAIRAVTNSEVRGLMKVIEELRVENTPLSTSIADHIESFTDYDFAHLLFSNGY
                     VEQSISLEKQLNIIQVADLVLPDKETSFEEYTTMELLSVAMLIVISTFALDFIHTDRS
                     IFKIVDLDEAWSFLQVAQGKTLSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKNNLGL
                     KFAFRSTDLNEIKKTLAFFGVDPEDENNQKRLRDLENGQCLISDLYGRVGVIQFHPVF
                     EELLHAFDTRPPVRKEV"
     gene            complement(548221..548727)
                     /locus_tag="SSUBM407_RS02695"
                     /old_locus_tag="SSUBM407_0488"
     CDS             complement(548221..548727)
                     /locus_tag="SSUBM407_RS02695"
                     /old_locus_tag="SSUBM407_0488"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016897981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein"
                     /protein_id="WP_000506270.1"
                     /translation="MGFLKSSIKSVGTLLLADFLFYGVAQSATPIFYERIDYMKKIRS
                     YTSIWSVEKVLYSINDFRLPFPITFTQMTWFVVSLFAVMILGNLPPLSMIEGAFLKYF
                     GIPVAFTWFMSTKTFDGKKPYGFLKSVIAYALRPKLTYAGKKVTLGRNQPQEAITAVR
                     SEFYGISN"
     gene            complement(548702..549199)
                     /locus_tag="SSUBM407_RS02700"
                     /old_locus_tag="SSUBM407_0489"
     CDS             complement(548702..549199)
                     /locus_tag="SSUBM407_RS02700"
                     /old_locus_tag="SSUBM407_0489"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000342537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antirestriction protein ArdA"
                     /protein_id="WP_000342539.1"
                     /translation="MDDMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYE
                     EYAIHDYELPFTVDEYTSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQE
                     DIIIHSDCDDMYDVARYYIEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGI
                     FEIVY"
     gene            complement(549316..549537)
                     /locus_tag="SSUBM407_RS02705"
                     /old_locus_tag="SSUBM407_0490"
     CDS             complement(549316..549537)
                     /locus_tag="SSUBM407_RS02705"
                     /old_locus_tag="SSUBM407_0490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002570387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001009056.1"
                     /translation="MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLI
                     IAIIAVGLVFNAAGVKDILLELFNRIIGA"
     gene            complement(549580..550785)
                     /locus_tag="SSUBM407_RS02710"
                     /old_locus_tag="SSUBM407_0491"
     CDS             complement(549580..550785)
                     /locus_tag="SSUBM407_RS02710"
                     /old_locus_tag="SSUBM407_0491"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000398284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation factor domain-containing
                     protein"
                     /protein_id="WP_000398284.1"
                     /translation="MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIE
                     TGKVKPSEDLQQSLWEALERFNPDAPLEMLFDYVRIRFPTTDVQQVVENILQLKLSYF
                     LHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGRGCRQFESYLLAQQRSWYEFF
                     MDVLVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRSGELVRKEE
                     KECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAV
                     RDLLVYDNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKP
                     EPYSFQRTLNWLSHQVAPTLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVK
                     EQDVITTKK"
     gene            complement(550808..550960)
                     /locus_tag="SSUBM407_RS02715"
     CDS             complement(550808..550960)
                     /locus_tag="SSUBM407_RS02715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000879507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000879507.1"
                     /translation="MLAGVAIATPALNPPYLTGGYKSTGNSQKNIRKSFGYKGFTKFQ
                     RMSNGL"
     gene            complement(550963..552348)
                     /locus_tag="SSUBM407_RS02720"
                     /old_locus_tag="SSUBM407_0492"
     CDS             complement(550963..552348)
                     /locus_tag="SSUBM407_RS02720"
                     /old_locus_tag="SSUBM407_0492"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000813487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA translocase FtsK"
                     /protein_id="WP_000813488.1"
                     /translation="MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQIN
                     WQDFNLSQADKIDIPYLIISFSVAILICLLVAFVFKRVRYDTVKQLYHRQKLAKMILE
                     NKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKNGLIQIRVEITLGKYQDQLLH
                     LEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRLMKNVWWEY
                     DKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRK
                     EDLLSCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTK
                     ENTAVMNKLKQIVMLGRQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYG
                     MMFGSDVQKDFFLKRIKGRGYVDVGTSVISEFYTPLVPKGYDFLEEIKKLSNSRQSTQ
                     ATCEAEVAGVD"
     gene            complement(552377..552763)
                     /locus_tag="SSUBM407_RS02725"
                     /old_locus_tag="SSUBM407_0493"
     CDS             complement(552377..552763)
                     /locus_tag="SSUBM407_RS02725"
                     /old_locus_tag="SSUBM407_0493"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000985015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YdcP family protein"
                     /protein_id="WP_000985015.1"
                     /translation="MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKER
                     TYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYIKA
                     DDIVLTKDSSSFKAQPQAKKEPTQDK"
     gene            complement(552779..553093)
                     /locus_tag="SSUBM407_RS02730"
                     /old_locus_tag="SSUBM407_0494"
     CDS             complement(552779..553093)
                     /locus_tag="SSUBM407_RS02730"
                     /old_locus_tag="SSUBM407_0494"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006148869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YdcP family protein"
                     /protein_id="WP_000420682.1"
                     /translation="MELKFVIPNMEKTFGNLEFAGEDKVVQRRINGRLTVLSRSYNLY
                     SDVQRADDIVVVLPAEAGEKHFGFEERVKLVNPRITAEGYKIGTRGFTNYLLHADDMI
                     KE"
     gene            complement(553409..554452)
                     /locus_tag="SSUBM407_RS02735"
                     /old_locus_tag="SSUBM407_0495"
     CDS             complement(553409..554452)
                     /locus_tag="SSUBM407_RS02735"
                     /old_locus_tag="SSUBM407_0495"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775530.1"
                     /translation="MEFINRKHLLQELKNEYKQHLKTGNSHIYIIRASSGIGKSEFIK
                     EITKGFSKIPIEILHLEDTEEFSTFRRFVIELDKLSYSNKYLDFKSFYQRKINSSKAM
                     QLLLKISSFFGQAVLVKKAQENGLEFLASEFNLPSLVVEHREYETFILKAQTENLFEY
                     AKYVLDHSNLYFNFPNASKIEQESLDLLNKLIIKSKGSIFIFECADEKIENSFKNSCN
                     ITLKTYQLEKLSEEHIKLYINLLSEQLGLQIEQVDFMVLQDSIRKGDLSEISIILKDF
                     SERLKEDNASQLQSIYQIIENISRTQLVFLILTLYTKGKLQLKELKEIMLETDKTFSS
                     DDVDFLFKNSIKI"
     gene            554587..555225
                     /locus_tag="SSUBM407_RS02740"
                     /old_locus_tag="SSUBM407_0496"
     CDS             554587..555225
                     /locus_tag="SSUBM407_RS02740"
                     /old_locus_tag="SSUBM407_0496"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017771980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775531.1"
                     /translation="MLNKVKARFLIGVGGLIAVSFMVMIGYTIGSQTISKQTENQIRA
                     EANKLVSKKKQEERATVLSDELVKEFLTQYFTKVQLGENNARIKPYMTDSAFSEEEAR
                     QNKAINQVYKDYMLDYRFESASIYVNTESHVALAEVSYQVTYVSDLSEQQQRTTQTET
                     KTVMLSYSKVSDKLLVNQLTIWNGKLEDMKEATDGANSSIPTIQGTTTSENN"
     gene            555264..556340
                     /locus_tag="SSUBM407_RS02745"
                     /old_locus_tag="SSUBM407_0497"
     CDS             555264..556340
                     /locus_tag="SSUBM407_RS02745"
                     /old_locus_tag="SSUBM407_0497"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018375339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toprim domain-containing protein"
                     /protein_id="WP_012775532.1"
                     /translation="MTRIKAVKQKAILDVAESLGYSFRRLSGQIYEHPDHDSFRIFAD
                     TNTFKWFSRDIQGDVIDFVQLVAGVTFKEAVSYLETGDFEQAKLVEETYQPFQYYLHE
                     EPFQQARIYLKDIRGLSDQTINTFGRQGLLAQATYQSEPVLVLKSYDHNGTLQAASLQ
                     GLVKNEEKHDRGYLKKIMKGSHGYVGISFDIGNPKRLIFCESVIDMMSYYQLYKKQLS
                     DVRLISMEGLKLSVIAYQTLRLAAEEQGKLAFLDTVKPSRLSHYLQAIQETTTFFQTH
                     SNVITMAVDNDEAGREFCQKLSDKGLPITKDLPPLQRLETKSDWNDIVKQQSELSLSD
                     FIQTAQAQVNKNHPPPKWKHALEL"
     gene            556394..556621
                     /locus_tag="SSUBM407_RS02750"
                     /old_locus_tag="SSUBM407_0498"
     CDS             556394..556621
                     /locus_tag="SSUBM407_RS02750"
                     /old_locus_tag="SSUBM407_0498"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002943342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775533.1"
                     /translation="MSVIERLAEKVARQEEKVSRETEKLEHYRDQLQTAMYSTFIKRQ
                     QSSQLSFHEALEQAFGKETTLHSNYRNEDTE"
     gene            556618..557007
                     /locus_tag="SSUBM407_RS02755"
                     /old_locus_tag="SSUBM407_0499"
     CDS             556618..557007
                     /locus_tag="SSUBM407_RS02755"
                     /old_locus_tag="SSUBM407_0499"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000048064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775534.1"
                     /translation="MSKTWNFDQPLDDVKSTSSHEERAKIAALFHKQDEKPIEEVDYV
                     AAFEQQQKESKYKDDQTLASTVKQSQPKKVNITSDYKQHLADTIAQNNKDISACQKQI
                     EELHQLIDEKKIQNKKLQAISVAIDDL"
     gene            557057..557353
                     /locus_tag="SSUBM407_RS02760"
                     /old_locus_tag="SSUBM407_0500"
     CDS             557057..557353
                     /locus_tag="SSUBM407_RS02760"
                     /old_locus_tag="SSUBM407_0500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002943338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044682494.1"
                     /translation="MKFFQKKKQNQDQFKRLIHRLSEMSDTELTKVEQLLDVVFDTNF
                     KPDRNVELSQSVINDEEQSLDKSIQEAKNKLNMEQFEKNIERFRQGRRESNNNK"
     gene            complement(557362..557670)
                     /locus_tag="SSUBM407_RS02765"
                     /old_locus_tag="SSUBM407_0501"
     CDS             complement(557362..557670)
                     /locus_tag="SSUBM407_RS02765"
                     /old_locus_tag="SSUBM407_0501"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775536.1"
                     /translation="MNQLDFNKNQLQMDYFSDSYRKFEADFYRYSALDTPLTFLTDDI
                     MLAMAKSQKSYFKLNKENAKDYQDHYFMFNVEPSRDNNLVRLYCYDSTMTHISKNRPK
                     "
     gene            complement(557657..558007)
                     /locus_tag="SSUBM407_RS02770"
                     /old_locus_tag="SSUBM407_0502"
     CDS             complement(557657..558007)
                     /locus_tag="SSUBM407_RS02770"
                     /old_locus_tag="SSUBM407_0502"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000567200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775537.1"
                     /translation="MIDRSYLPFKVAREYQDRKMAKWMGFFLSEHTSGLEQERNRIDY
                     SSELSLADKLLLLNQLYSHQLTGILTVPGRTYVGKVKNLTFQLISFETKEGYISIQIS
                     DILAIDLEVEYESA"
     gene            complement(558004..559419)
                     /locus_tag="SSUBM407_RS02775"
                     /old_locus_tag="SSUBM407_0503"
     CDS             complement(558004..559419)
                     /locus_tag="SSUBM407_RS02775"
                     /old_locus_tag="SSUBM407_0503"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004229560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Y-family DNA polymerase"
                     /protein_id="WP_012775538.1"
                     /translation="MGYVDYSKEPRSDIAFVDMKSFYASIECVERGLHPLHTSLCVMS
                     RADNSTGLILASSPMFKKIFGKGNVGRAYDLPFDVHTRKFNYYRASISGLPTDAKFVS
                     YIENWAKRTFIVPPRMDLYIQKNLEIQKVFQNYADPTDILPYSIDEGFIDLTSSLNYF
                     VGDKTLSRKYKLDLVSAKIQHDIWEKTGVYSTVGMSNANPLLAKLALDNEAKSTATMR
                     ANWSYEDVETKVWNIPKMTDFWGIGSRTEKRLNKLGIYSIKELANCDPTILKKEFGVI
                     GVQHWFHANGIDESNVHEPYRPKEVGIGNSQVLHKDYTRQSDIELVLREMAEQVAIRL
                     RRMHKKATVVAINVGYSNFENKKSINVQRKINPNNRTLVFQDEVVSLFRAKYDGGAVR
                     SIAVRYDGLVDENFAVISLFDDFEESEKEEKLETTIDSIRDRFGFLAVQKASSLLENS
                     RAIARSRLVGGHSAGGLEGLK"
     gene            complement(559562..560254)
                     /locus_tag="SSUBM407_RS02780"
                     /old_locus_tag="SSUBM407_0504"
     CDS             complement(559562..560254)
                     /locus_tag="SSUBM407_RS02780"
                     /old_locus_tag="SSUBM407_0504"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000490977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_012775539.1"
                     /translation="MFSGKRLKERRITLGYSQSELADKLHINRSSYFNWENEKTKPNQ
                     SNLKQLAILLDVPETYFESEYKIVNTYLQLSLQNQEKVEKYAEELLQEQGIHNKIIPL
                     FAVEVLSEIQLFAGPGEGLYDEFETETVYSEDEYTGFDIATWISGNSMEPVYKDGEVA
                     LIRSTGFDYDGAVYALNWNGSLYIKKLYREEDGFRMVSINPDVAERFIPFEDEIRIVG
                     KVVGHFMPVIGG"
     gene            560670..>560873
                     /locus_tag="SSUBM407_RS02785"
                     /pseudo
     CDS             560670..>560873
                     /locus_tag="SSUBM407_RS02785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001223589.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            561071..561250
                     /locus_tag="SSUBM407_RS02790"
                     /old_locus_tag="SSUBM407_0505"
     CDS             561071..561250
                     /locus_tag="SSUBM407_RS02790"
                     /old_locus_tag="SSUBM407_0505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011681570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Blp family class II bacteriocin"
                     /protein_id="WP_012775540.1"
                     /translation="MNTQTISQFELLDTELLATVEGGASGKCIAGVVVGALLGSVGGP
                     WGSAAGGAVGAGFFC"
     gene            561888..562247
                     /locus_tag="SSUBM407_RS02795"
                     /old_locus_tag="SSUBM407_0506"
     CDS             561888..562247
                     /locus_tag="SSUBM407_RS02795"
                     /old_locus_tag="SSUBM407_0506"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775541.1"
                     /translation="MGQEIKLIRKQFRITRQEEKQIKEMMREQKLDSFSEFLRQNLLK
                     KNYQDRIFESWFSLWQSQKFEQISRDVHEVLVVARENHQVTQEHVSILLTCVQELIAE
                     VNQVQLLSRGFREKYMR"
     gene            562257..562622
                     /locus_tag="SSUBM407_RS02800"
                     /old_locus_tag="SSUBM407_0507"
     CDS             562257..562622
                     /locus_tag="SSUBM407_RS02800"
                     /old_locus_tag="SSUBM407_0507"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000263054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MobC family plasmid mobilization relaxosome
                     protein"
                     /protein_id="WP_012775542.1"
                     /translation="MVYRYRTNLKKVFLTDSELHQLNERIDKSHCQNFSVYARKVLLN
                     PNMSFVTINTDTYDQLVFELRRIGNNINQIARAINQSHLISQEQLQELSKGVSELITG
                     VEKEFQVEVKRLREFHGSH"
     gene            562609..564474
                     /locus_tag="SSUBM407_RS02805"
                     /old_locus_tag="SSUBM407_0508"
     CDS             562609..564474
                     /locus_tag="SSUBM407_RS02805"
                     /old_locus_tag="SSUBM407_0508"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="relaxase/mobilization nuclease domain-containing
                     protein"
                     /protein_id="WP_012775543.1"
                     /translation="MVVTKHFATHGKKYRRRLIKYILNPDKTDNLKLVSDFGMSNYLD
                     FPSYEEMVEMYNVNFTNNDKLYESRNDRQEKHQQNIHSHHLIQSFSPEDNLTPEEINR
                     IGYDTMMELTGGRFKFIVATHTDKDHVHNHILINAIDSNSDKKLIWNYALERNLRMIS
                     DRISKIAGAKIIEKRFSYRDYQKYRQSSHKFELKQRLYFLMQHSKSFDDFLEKAVQLH
                     VHIDFSQKHSRFMMRDRAMTKPIRGRQLSKRDLYDEEFFRTHFAKHEIESRLEFLLNR
                     VNFLEELLTKAKELNLTIDLKQKNVIFILEENGKQFSLSHKKISDKKLYDVNFFQDYF
                     KNKEVGDSEGLENLQEQYHAFQEERDKEKVATEEIEEAFEEFKKKRDAVHEFEVELAG
                     HQIEKLVDEGVYIKVSFGVKQSGFIFIPNYQLDIIEEDNQKKYKVYIRETTSYFVYNK
                     EHSDKNQYIKGRTLIRQLTNDSRAIPYRRPTVERLQEKITEINLLIELTETDKRYQYV
                     KDELVAEIAELDVKLNQTNEKIAILNKMAEVLINLKSDDPNSRKLARYDFSKLNLTES
                     ITLEQVTEEIRVLQEDLGHYLDEYEGLARKLETFVKILNTNKQTEHEFHGDIALE"
     gene            complement(564518..565222)
                     /locus_tag="SSUBM407_RS02810"
                     /old_locus_tag="SSUBM407_0509"
     CDS             complement(564518..565222)
                     /locus_tag="SSUBM407_RS02810"
                     /old_locus_tag="SSUBM407_0509"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_012775544.1"
                     /translation="MTYKNIVFDLDDTLYDHLLPFKNSIIQCFPELDISEIELIYKRF
                     RYWSDIAFPKYTNKQISIEELRIFRCKQIISEFGSFSFSDDLALSFQKTYEKELSSIT
                     LFPELKEILEYCSAKRIPIGIITNGPVKHQLKKLSQLDVLKYFDKEKIIISQATGFQK
                     PQIEIFNLASKNFNFLPNQTLYIGDNFENDIEGSLNAGWKSIWFNHRKRKLPSDTKIH
                     EVQTAKDLKELIYRLL"
     gene            complement(565231..565992)
                     /locus_tag="SSUBM407_RS02815"
                     /old_locus_tag="SSUBM407_0510"
     CDS             complement(565231..565992)
                     /locus_tag="SSUBM407_RS02815"
                     /old_locus_tag="SSUBM407_0510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007209218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR/GlpR transcriptional regulator"
                     /protein_id="WP_012775545.1"
                     /translation="MIKKERHERILDMLNIEGVITVKDMMKELNISDMTARRDLDSLA
                     EAGFLTRIHGGAQRLYKDEEPHEKTHIEKKVLQTKEKKLIAQKANSIIKDGETVFIGP
                     GTTLEHLAVELKTRNIRVITNSLPVFLILNKSGTVDLLLIGGEYREITGAFVGSMATT
                     NLKTLRFSKAFVSANAVSDNAIATYSDVEGEIQQLALDNAVEKILLVDSTKFNRYDFF
                     NFYTLEQIDTIITDNQISQDQLNEFGRLTTIIQAD"
     gene            566172..567122
                     /locus_tag="SSUBM407_RS02820"
                     /old_locus_tag="SSUBM407_0511"
     CDS             566172..567122
                     /locus_tag="SSUBM407_RS02820"
                     /old_locus_tag="SSUBM407_0511"
                     /EC_number="2.7.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018371693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family glucokinase"
                     /protein_id="WP_012775546.1"
                     /translation="MTKKIIGVDLGGTSVKLAILDVLGNIEAQWSIPTDISDNGKNIV
                     SDIISSIQEYLLENSISLGDIKGIGMGSPGKIDFEKGTVTGAYNLGWSKEQNIKEQFE
                     EAFGRPFYIDNDANVAALGERWKGAGDNAPDVIFVTLGTGVGGGIIAQGQLLHGVNGS
                     AGEIGHMVVDEDGFPCTCGNIGCLETVASATGIVNIAKSFANQFDEPSELRRLILEHQ
                     VTAKDVFDYAKKNDSLGQKIVWQFANYLGKSLSQLANALNPNYIVIGGGVSAAGDFLL
                     DKVKEEFDRFAFPTVRNSTKLALATLGNDAGVIGAASLVL"
     gene            567358..567783
                     /gene="lacA"
                     /locus_tag="SSUBM407_RS02825"
                     /old_locus_tag="SSUBM407_0512"
     CDS             567358..567783
                     /gene="lacA"
                     /locus_tag="SSUBM407_RS02825"
                     /old_locus_tag="SSUBM407_0512"
                     /EC_number="5.3.1.26"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000215992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactose-6-phosphate isomerase subunit LacA"
                     /protein_id="WP_003084983.1"
                     /translation="MAVIIGADKAGTELKETVKSYLIELGKEVVDVSKDGQDFVDVTL
                     AVAKEVTSNDSNLGIVVDAYGVGPFMTATKIKGMIAAEVSDERSAYMTRGHNNSRIIT
                     IGSEIVGPGVAKNIAKGFVEGEYDGGRHQIRVDMLNKMC"
     gene            567817..568332
                     /gene="lacB"
                     /locus_tag="SSUBM407_RS02830"
                     /old_locus_tag="SSUBM407_0513"
     CDS             567817..568332
                     /gene="lacB"
                     /locus_tag="SSUBM407_RS02830"
                     /old_locus_tag="SSUBM407_0513"
                     /EC_number="5.3.1.26"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactose-6-phosphate isomerase subunit LacB"
                     /protein_id="WP_002936382.1"
                     /translation="MKIAVGCDHIVTNDKIAVVDYLKTQGYEVIDCGTYDNIRTHYPI
                     FGKKVGEAVASGEADLGVCICGTGVGINNAVNKVPGIRSALVRDMTSAIYAKEELNAN
                     VIGFGGKITGGLLMTDIIEAFIHAEYKPTEENKKLIEKIQHVETLNQGQADPHFFDEF
                     LEKWDRGEYHD"
     gene            568344..569276
                     /gene="lacC"
                     /locus_tag="SSUBM407_RS02835"
                     /old_locus_tag="SSUBM407_0514"
     CDS             568344..569276
                     /gene="lacC"
                     /locus_tag="SSUBM407_RS02835"
                     /old_locus_tag="SSUBM407_0514"
                     /EC_number="2.7.1.144"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015016933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tagatose-6-phosphate kinase"
                     /protein_id="WP_012775547.1"
                     /translation="MILTITMNPSVDISYPLEQFKLDTVNRVAKTHKTPGGKGLNVTR
                     VLSQLGDDVIASGLLGGKIGEFIESELDKSSVKHSFYKIAGETRNCIAILHDGNQTEI
                     LEQGPTISEEEATGFLNYFEKLVPDLGIVAISGSLPKGLDTNFYSRMVGICNKYNIPV
                     VLDCSGEALLNVLDGQEKPTVIKPNTEELSQLVGTEVTDDIDSLKSVLHNSLFDGIEW
                     VIVSLGSKGAFAKHHDVFYKVSIPKIEVVNPVGSGDSTVAGITSALVHNDSDENLLKK
                     ANVLGMLNAQEALTGHVNLNNYDNLFNQIEVTEV"
     gene            569279..570259
                     /gene="lacD"
                     /locus_tag="SSUBM407_RS02840"
                     /old_locus_tag="SSUBM407_0515"
     CDS             569279..570259
                     /gene="lacD"
                     /locus_tag="SSUBM407_RS02840"
                     /old_locus_tag="SSUBM407_0515"
                     /EC_number="4.1.2.40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018376130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tagatose-bisphosphate aldolase"
                     /protein_id="WP_003084249.1"
                     /translation="MVLTAQKRSLMEKVSDKNGVISALAFDQRGALKKMMAKHQTEEP
                     TVEQIETLKTIVSEELTKYASSILLDPEYGLPASKARADEAGLLLAYEKTGYDASTTS
                     RLPDCLDDWSVKRLKEQGADTLKFLLYYDVDGDEQVNRQKQAYIERIGSECKAEDIPF
                     FLEILSYDEGIADNTGVEFAKVKPRKVNEAMKVFSDERFGIDVLKVEVPVNMNFVEGF
                     GDGEVVYTKEEAAQHFRDQEASTHLPYIYLSAGVSAKLFQDTLVFAAESGAKFNGVLC
                     GRATWAGSVQVFIEQGEEAAREWLRTTGFQNIDELNKVLEKTASPWTEKV"
     gene            570287..570604
                     /locus_tag="SSUBM407_RS02845"
                     /old_locus_tag="SSUBM407_0516"
     CDS             570287..570604
                     /locus_tag="SSUBM407_RS02845"
                     /old_locus_tag="SSUBM407_0516"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006739201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS lactose/cellobiose transporter subunit IIA"
                     /protein_id="WP_003082802.1"
                     /translation="MNREEITLLGFEIVAYAGDARSKFLEALKAAQEGDYAKAEELIA
                     AGGECLNDAHNAQTSLLQKEAAGEDLAFSVTLMHGQDHLMTTILLQDLMKHMIELYKR
                     GAK"
     gene            570604..572298
                     /locus_tag="SSUBM407_RS02850"
                     /old_locus_tag="SSUBM407_0517"
     CDS             570604..572298
                     /locus_tag="SSUBM407_RS02850"
                     /old_locus_tag="SSUBM407_0517"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002938634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS transporter subunit EIIC"
                     /protein_id="WP_012775548.1"
                     /translation="MKGLIAQIEKGKPFFEKISRNIYLRAISDGFIAGMPVILFSSIF
                     ILIAYVPNAWGFKWSTDIETLLMTPYNYSMGILGLFVAGTTAKALTDSMNRSLPSTNQ
                     INFISTMLAAIVGFLLMAANPAKDGGFLTGFMGTKGLLTAFIAAFITVNVYKVCVKNN
                     VTIRMPDEVPPNISQVFKDLIPFTASVVLLYAIELLVHNALGVNVAESIGTLLAPLFQ
                     AADGYVGITIIFGAFAFFWFVGIHGPSIVEPAIAAITYANAEANLQLLQAGEHADKIL
                     TSGTQMFIVTMGGTGATLVVPFMFMWLTKSKRNKAIGRASVVPTFFGVNEPILFGAPL
                     VLNPIFFIPFILTPIVNVWIFKFFIETLGMNSFTANLPWVTPAPLGLVLGTNFQVLSF
                     ILAAVLIVVDVAIYYPFLKVYDEQMLEEERTGKSSDELKEKVAANFNTAKADAILEKA
                     GAVESKEITEQTNVLVLCAGGGTSGLLANALTKAAKEYGVPVTAAAGSYGAHREILPQ
                     YQLVILAPQVASNYEDMKAETDKLGIKLAKTEGAQYIKLTRDGQGALDFVKQQMLN"
     gene            572364..573770
                     /gene="lacG"
                     /locus_tag="SSUBM407_RS02855"
                     /old_locus_tag="SSUBM407_0518"
     CDS             572364..573770
                     /gene="lacG"
                     /locus_tag="SSUBM407_RS02855"
                     /old_locus_tag="SSUBM407_0518"
                     /EC_number="3.2.1.85"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002290548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-galactosidase"
                     /protein_id="WP_012775549.1"
                     /translation="MSKTLPKDFIFGGATAAYQAEGATKTDGKGPVAWDKYLEDNYWY
                     TAEPASDFYNRYPVDLKLAEEFGVNGIRISIAWSRIFPTGFGKVNEKGVEFYHNLFAE
                     CHKRGVEPFVTLHHFDTPEALHSNGDFLNRENIDHFVNYAEFCFKEFTEVNYWTTFNE
                     IGPIGDGQYLVGKFPPGIKYDLAKVFQSHHNMMVSHARAVKLFKDGGYKGEIGVVHAL
                     PTKYPFDKNNPDDVRAAELEDIIHNKFILDATYLGGYSEKTMEGVNHILSLNGGELDL
                     RDEDFQALEAAKDLNDFLGINYYMSDWMQAFDGPTEIIHNGKGEKGSSKYQIKGVGRR
                     EAPVDVPKTDWDWIIYPQGLYDQIMRVKRDYPNYKKIYITENGLGYKDEFVDNTVYDD
                     GRIDYVKKHLEVISDAIEDGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFETQERY
                     PKKSAYWYKQVAETQVIE"
     gene            573858..574754
                     /locus_tag="SSUBM407_RS02860"
                     /old_locus_tag="SSUBM407_0519"
     CDS             573858..574754
                     /locus_tag="SSUBM407_RS02860"
                     /old_locus_tag="SSUBM407_0519"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002889672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldose 1-epimerase family protein"
                     /protein_id="WP_012775550.1"
                     /translation="MVIELKNEQLTVQFSEFGGALSSIKDKDGVEYLWQGNPEYWSGQ
                     APVLFPICGSLRNDWAIYRPAERPHFTGIIPRHGLVRKENFDYCKIDDSTVCFSFKAN
                     EKTLKEYPYHFVLNIIYKLHGSTITTEYQVTSSEIERSIPYFIGGHPGFNCPLEDDEK
                     YEDYYLEFSEYETCSIPKSFPDTGLLDLQDRTPFLENQNKLDLDYSLFSHDAITLDQL
                     KSRSVSLKSKKSNKGIKVDFKDFPHLIIWSTTNQSPFIALEPWSGLSTSLEESDILEE
                     KQGVTFVEPSQTSIKSFDITIL"
     gene            575001..575231
                     /locus_tag="SSUBM407_RS02865"
                     /old_locus_tag="SSUBM407_0520"
     CDS             575001..575231
                     /locus_tag="SSUBM407_RS02865"
                     /old_locus_tag="SSUBM407_0520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000284847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_012775551.1"
                     /translation="MYQRIRDLREDHDLTQKFVANLLSFSHTNYAKIERGEIALTADV
                     LVQLSKLYNVSTDYLLGLTDCPDRIKHKIVSP"
     gene            575492..575632
                     /locus_tag="SSUBM407_RS10625"
                     /old_locus_tag="SSUBM407_0521"
     CDS             575492..575632
                     /locus_tag="SSUBM407_RS10625"
                     /old_locus_tag="SSUBM407_0521"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000416124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775552.1"
                     /translation="MEKTSTGAESPQIMIEGYKVIVKVTDKPLSLTDILDDLLGRQLE
                     KI"
     gene            575731..577305
                     /locus_tag="SSUBM407_RS02870"
                     /old_locus_tag="SSUBM407_0522"
     CDS             575731..577305
                     /locus_tag="SSUBM407_RS02870"
                     /old_locus_tag="SSUBM407_0522"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017768967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
                     /protein_id="WP_012775553.1"
                     /translation="MAQACIYLRLSRDDGDNVESNSIINQRSLLRDYARNHDITILEE
                     FVDDGISGLTFNRPDFNRMMENINNKTIDTIIVKDLSRFGRDYIETGKYIQRIFPAMG
                     VRFISVNDHYDSLTADANETHLVMPIKSLINDSYCRDISTKVRSTHKAKRLKGEFIGA
                     FAPYGYQKDPRQKNHLVVDESIRSIIEKIFTLKLEGYSSNQIAIYLNQCGIETPLQHK
                     KRNQEKLRGFCGHTNKWGTKMVNRILTNRVYTGALEQGKRTKLNYKAQHTIKVNQEDW
                     ICVEATHEGIISESTFKIANSLLLRDVKNSNNQPNEFAGLLFCNDCHAQLLQRKIRYK
                     NKETIQFICSTYNKGRGCSRHAIKYEELISIVSELIENHLDWKSHLIKKIPEYLSQEQ
                     LLEIDFTNLVSDRRKYEQLLQSLYMDLDDGLINEAEYQEFQRSYRQKLKDIEQTIVNK
                     KKLAQELVNKLQNKKTWLKKLTCQKEESSLNRLTLVTLLDRINISENQEISLVFHDLN
                     EIAILQELSLSEVGVI"
     gene            577305..578924
                     /locus_tag="SSUBM407_RS02875"
                     /old_locus_tag="SSUBM407_0523"
     CDS             577305..578924
                     /locus_tag="SSUBM407_RS02875"
                     /old_locus_tag="SSUBM407_0523"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003069249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
                     /protein_id="WP_012775554.1"
                     /translation="MARTKNRYRKSEVTDKTSELKRYSAGIYIRLSKERTEACRNKSQ
                     SLENQEKLARTFANQHGLTVVKCYTDYEYSGTNFMRPAFQEMMDDIKKGVINCILIRD
                     LSRLGRDYIEMGRLIDKVFPFLGVRFISINDNLDTLSGLKEKKSFEVEIKNLVNDMYS
                     KDISKKVTASHIQKASEGYFISGFAPYGYKLDKQKLGNKLKIDLTVKPILDKVFELFL
                     TGYSSYKVSDWLNENNIATPTSYRQTGELYRRIDDTKLWSNTNLRRMIRNQVYTGDLV
                     QRKSNKQLSPDDYIHFNNAHESYISRKDYETILELIANRKITKKYDYSRTPNRYRGLL
                     YLKGSYRQMSREYQKSKSKKNCEGHFYYRDYILNSNANRKSVCIRENVLDRIIITIIQ
                     AEMAKIGKVDELLSSLENMYEAYIQLLQSKIVKHKQHIVRLRMEISDLYASYSLLRDS
                     RDDYISQKLEKNRKIETLIQEIDQYEDRLKAVDEKYNRQVAWLNTLSKNHQSPVLSAD
                     LLNALIERIEIDENRQISVTFLCQIGSDGNA"
     gene            578917..580365
                     /locus_tag="SSUBM407_RS02880"
                     /old_locus_tag="SSUBM407_0524"
     CDS             578917..580365
                     /locus_tag="SSUBM407_RS02880"
                     /old_locus_tag="SSUBM407_0524"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007517216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
                     /protein_id="WP_012775555.1"
                     /translation="MPKIALYLRLSVDEATADESNSITNQRILLNQYLDRTPEFHPFK
                     RIEFIDDGFSGKNPNRPAFNRLMSDVRVGKIRYIIVKDFSRFMRDYLEFGNYIENIFP
                     FLGVRFIAVNDQFDSFTSENNGVEIDVPFRNLLNDFYARDVSEKVKSAMNTMKRSGKN
                     MSWLPPFGYLKDPNDRFKIIIDESVAPVVKRIFQLCIEGVGLSRIAIILNDENTITPA
                     ERKRQISQADYQYQIVVTEKQKRNIWTRSTVSRILKNEAYKGTYLFNAKTIFNGKQVK
                     RPKEEWERIENNHESIVTSEIFEQAQKALKSRNNRHSYQQSTKKYDVILTGFMICEHC
                     GHKLTAYTYKKKTHHYFYCRYCKVQGISLKGCRSDRVEQKILEYLKSKKEDVPSQKSN
                     KSLVYLMSQLKAQKFSYYQDYKDEKINRETYIYYKQEIDKKIDDIEEELNKLNNSQCM
                     IDSSLSKETLRESVKQIIVNHAGGYRIDYKNI"
     gene            <580445..580966
                     /locus_tag="SSUBM407_RS02885"
                     /pseudo
     CDS             <580445..580966
                     /locus_tag="SSUBM407_RS02885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636829.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="LLM class flavin-dependent oxidoreductase"
     gene            complement(581554..583044)
                     /gene="lysS"
                     /locus_tag="SSUBM407_RS02890"
                     /old_locus_tag="SSUBM407_0526"
     CDS             complement(581554..583044)
                     /gene="lysS"
                     /locus_tag="SSUBM407_RS02890"
                     /old_locus_tag="SSUBM407_0526"
                     /EC_number="6.1.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018165051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine--tRNA ligase"
                     /protein_id="WP_011922069.1"
                     /translation="MSTEHFEELNDQQIVRREKMTALAEQGIDPFGKRFERSANSAEL
                     KAQYEDKSKEDLEELGQTAIIAGRIMTKRGKGKAGFAHIQDREGQIQIYVRKDDVSEE
                     NYEIFKKADLGDFIGVEGDVFKTNVGELSIHARKLTHLSKALRPLPEKFHGLTDIETR
                     YRKRYLDLITNRESFDRFVTRSKIISEIRRYLDGLGFLEVETPVLHNEAGGAAARPFI
                     THHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQ
                     AYADYQDIMDLTEGIIQHTAKAVVGDGPVTYQGTEIAIHEPFKRIHMVDAIKEQTGVD
                     FWQEMSFEEAKALAAEHKVPVEKHHTEVGQIINSFFEEYVEATLIQPTFVYGHPVAVS
                     PLAKKNDEDPRFTDRFELFIMTKEYGNAFTELNDPIDQLERFEAQAKAKELGDDEATG
                     VDYDYIEALEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK"
     gene            complement(583147..583773)
                     /locus_tag="SSUBM407_RS02895"
                     /old_locus_tag="SSUBM407_0527"
     CDS             complement(583147..583773)
                     /locus_tag="SSUBM407_RS02895"
                     /old_locus_tag="SSUBM407_0527"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013730229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine phosphatase family protein"
                     /protein_id="WP_002938482.1"
                     /translation="MKIYFVRHGKTEWNLEGRFQGYSGDSALLPESYQDLEKLGKYLA
                     EIPFDAIYSSDLQRAHSTAVEIAKANHHCQTVLTTQQLREWNFGTLEGSKMAIFRAIY
                     PKQAWALKHNLALFNNDLFEAESVRQVTQRMVDFVQSLKGQDMETVLIVSHGAFLTAS
                     IHRLLGFPPAQLRHRGGLDNASVTILETSDFENFTELAWNDTSYKAKQ"
     gene            complement(583776..584258)
                     /locus_tag="SSUBM407_RS02900"
                     /old_locus_tag="SSUBM407_0528"
     CDS             complement(583776..584258)
                     /locus_tag="SSUBM407_RS02900"
                     /old_locus_tag="SSUBM407_0528"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cys-tRNA(pro)/cys-tRNA(cys) deacylase"
                     /protein_id="WP_011922070.1"
                     /translation="MAKKVKIKKTLVDQILDKAKINHDSLVLNAFEGQLPPGIEEHEI
                     YKTLALTGDKTGPIIGIIPITEHLSEKKLAKISGNKKVSMIPQKDLEKTTGYIHGANN
                     PVGIRQKHNFPIYIDQSALELGHLIVSAGEIGRSIRIDSQVLADFVKADFADLIEGRD
                     "
     gene            complement(584258..585100)
                     /locus_tag="SSUBM407_RS02905"
                     /old_locus_tag="SSUBM407_0529"
     CDS             complement(584258..585100)
                     /locus_tag="SSUBM407_RS02905"
                     /old_locus_tag="SSUBM407_0529"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003100489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF368 domain-containing protein"
                     /protein_id="WP_009909486.1"
                     /translation="MASWISRIIKGMIIALGFILPGVSGGVLAAILGIYERLIGFLAN
                     IRKDFKENFLYFVPVGIGGILGIALFSFPVEFLLQHFQVPVLWAFAGAIVGTIPSLLK
                     ESTQKSKRDSIDLAWLIGTFIISGLLLYNLSDLVGTLPATFASFVLAGALIALGVLVP
                     GLSPSNLLLILGIYTPMLNGFKSLDLFGTFLPIAIGGVLAMVAFSKAMDHALKVYHSR
                     VYHFIIGIVSSSTLLILIPQASNKESISYAGANFVTWIAAIVLFILGAWLGLWMSKLE
                     EKYK"
     gene            complement(585203..585751)
                     /gene="thiT"
                     /locus_tag="SSUBM407_RS02910"
                     /old_locus_tag="SSUBM407_0530"
     CDS             complement(585203..585751)
                     /gene="thiT"
                     /locus_tag="SSUBM407_RS02910"
                     /old_locus_tag="SSUBM407_0530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011922072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy-coupled thiamine transporter ThiT"
                     /protein_id="WP_011922072.1"
                     /translation="MPTSKLPILAEVAIFSAIALVFDKIPLFTMPQGGSVSLVMLPIL
                     LLALRHGLGVGVLTGGIVGTIQLFYGGYFLNVFQVFLDYAFSYAGIGLAGLVAPTLSK
                     QNNLKNATLIITLASFLGGSIRLLATFLSGIIFYADYAPDGMPVWFYSFTYNISYILP
                     STAIASILLILLYRARPGFYNL"
     regulatory      complement(585810..585905)
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00059"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="TPP riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="thiamine pyrophosphate"
                     /db_xref="RFAM:RF00059"
     gene            complement(585929..586783)
                     /locus_tag="SSUBM407_RS02915"
                     /old_locus_tag="SSUBM407_0531"
     CDS             complement(585929..586783)
                     /locus_tag="SSUBM407_RS02915"
                     /old_locus_tag="SSUBM407_0531"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002924015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_011922073.1"
                     /translation="MRKKLNPMIVVGFFLSFFALIFITGVTGNTVNKTEVANEPAVTQ
                     SNTSTSSKTTNSSSSYYIANALEMKPIIDVSAWQRPSEIDYDTLSKNISGAIVRIQSG
                     SHTKNENTATDKNGLDKSFDTHIKEFQARNIPVAVYAYVTGNSIENMREEARSFYKAA
                     NKYKPTFYWLDVEEYTMDDMNAGVEAFRKELETLGAKNIGIYVGTYFMEDHSINVDKF
                     DAIWIPTYGDDSGYYNAAPNTDLNYDLHQYTSRGYVNGFEHHLDLNIITTLKDPNEVY
                     QKLFTTPE"
     gene            586896..587315
                     /locus_tag="SSUBM407_RS02920"
                     /old_locus_tag="SSUBM407_0532"
     CDS             586896..587315
                     /locus_tag="SSUBM407_RS02920"
                     /old_locus_tag="SSUBM407_0532"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014917219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011922708.1"
                     /translation="MHDKSEKVRRVSQLVVLSYFSLLESWILMILVMVGSGLLFGFGT
                     VVLWQVLSFAFIQFIWWLAIGPFIKKENIPLWLQSLLAGILVFLYGLTISFLSATQFG
                     TSPIVFWLNGLVFDSLHATSTVLFYPIIDYIFRRFYK"
     gene            587312..587677
                     /locus_tag="SSUBM407_RS02925"
                     /old_locus_tag="SSUBM407_0533"
     CDS             587312..587677
                     /locus_tag="SSUBM407_RS02925"
                     /old_locus_tag="SSUBM407_0533"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4430 domain-containing protein"
                     /protein_id="WP_011922709.1"
                     /translation="MKKISIMLMVVFSLFLAACTNTTEKQNNSAIEVTLQITTKDKEN
                     RQEVTAEEGDSVMDVLKEHHDIVEDNGLITEIDGVSQDTSTNTYWMYKVNGQMADKGA
                     KDLTVANGDEIEFYLETFE"
     gene            587814..589028
                     /locus_tag="SSUBM407_RS02930"
                     /old_locus_tag="SSUBM407_0534"
     CDS             587814..589028
                     /locus_tag="SSUBM407_RS02930"
                     /old_locus_tag="SSUBM407_0534"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002940200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FtsW/RodA/SpoVE family cell cycle protein"
                     /protein_id="WP_011922075.1"
                     /translation="MKIDKRQLLNYSILIPYLILSVIGLVMVYSTTSATQIINGGNPF
                     RTVINQAGFWIVSLVAIYTIYRMKLSFLRKKAVIYSVILVEVFLLAISRLFPPINGAH
                     GWIPLPIAGTLQPAEYLKLIIIWYLAHEFAKQQADIRTYDYVSLIKGSWIPKEFTDWR
                     VVSLLLLGLVATLPDLGNATIIVLIMVVMISVSGIAYRWFSTAVLGIVAASTVILGTI
                     RILGVETVEKIPLFGYIARRFAAYFDPFGNATNSGLQLTHSYYAMSNGGWLGRGLGNS
                     IEKKGYLPEAHTDFAFSIVIEELGFVGASLILALLFFLIIRIIIVGVRARSPFNAMMA
                     LGMAGMLLIQTFVNIGGISGIIPATGVTFPFLSQGGSSLLIISIGIGFVLNIDASEKR
                     RLIEEEIERTLI"
     gene            589049..591745
                     /gene="ppc"
                     /locus_tag="SSUBM407_RS02935"
                     /old_locus_tag="SSUBM407_0535"
     CDS             589049..591745
                     /gene="ppc"
                     /locus_tag="SSUBM407_RS02935"
                     /old_locus_tag="SSUBM407_0535"
                     /EC_number="4.1.1.31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018163727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxylase"
                     /protein_id="WP_012775556.1"
                     /translation="MAIQKLENYNNKEAIREEVTILTSILEEVAAQMMPAETFAKIVE
                     LSQLSRQDDYQALIAIISQLNNDELAVISRYFAVLPLLINISEDVDLAYEINHQNNID
                     QDYLGKISTTIDMVSKQENAAEILEKLNVVPVLTAHPTQVQRQSMLDLTKHIHELLRR
                     YRDVKLGLLNKNKWEDELRYYIEIIMQTDMIREKKLKVTNEITNVMEYYNSSFIKAVT
                     KLQREYKRLAAEKGIVLNNPRPITMGMWIGGDRDGNPFVTAETLKLSALTQCEVIMNY
                     YDEQLYKLYRNFSLSTSIVNVSTAVKMLADLSEDSSVYRENEPYRRAFHYIQMKLANT
                     RDYLVHNKPSDVRYSNVAEFKADLLAIKQSLVENKSMALLKGDFTELLEAVEAFGFYL
                     ASIDMRQDSSIHEASVAELLASARIVEDYSSLSEEAKCHVLLKQLETDPRILSATHMP
                     KSEQLEKELAIFAAARELKDKLGEEIIKQHIISHSESVSDLLELAVLLKEVGLVDVDK
                     ARVQIVPLFETIEDLDNAPDTMRQYLQLDLAKRWIAGNKYYQEIMLGYSDSNKDGGYL
                     SSGWTLYKAQNELTQIGQDYGVNITFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRLR
                     LTEQGEVIGNKYGNKDAAYYNLEMLVSATLDRMVTQMITDPNEIDGYRETMDEIVSDS
                     YRIYRDLVFNNPHFYDYFFAASPIREVSSLNIGSRPAARKTITEIGGLRAIPWVFSWS
                     QNRVMLPGWYGVGSSFKRFIDKHPDNLSKLQKMYESWPFFRSLLSNVDMVLSKSNMNI
                     AFEYAKMCESEEVRNIFHVILDEWQLTKEIILSIEQNDELLAELPFLKASLDYRMPYF
                     NVLNYIQIELIHRLRRGELSKEQENLIHITINGVATGLRNSG"
     gene            591860..592363
                     /locus_tag="SSUBM407_RS02940"
                     /old_locus_tag="SSUBM407_0536"
     CDS             591860..592363
                     /locus_tag="SSUBM407_RS02940"
                     /old_locus_tag="SSUBM407_0536"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_011922077.1"
                     /translation="MSIKLDQYEKEVIGIAEEISYYLQKSGANYADSQDIAQDILVKI
                     LEAELVLPFEKLRAWLYRSAVRAYIDKYRRDKRYHEILQKEFFTPENFLVYDQEDYEE
                     LYQAVADLPEKYQQVIDLYYFQDMSIKEIAHILGAGQSWVKISLHRGRKQLRKILEER
                     GYDYEDF"
     gene            592344..593315
                     /locus_tag="SSUBM407_RS02945"
                     /old_locus_tag="SSUBM407_0537"
     CDS             592344..593315
                     /locus_tag="SSUBM407_RS02945"
                     /old_locus_tag="SSUBM407_0537"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009909491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma factor"
                     /protein_id="WP_011922078.1"
                     /translation="MTMKTFEEVTKKSKRKNLWKTVGLSSFIGFILLLIGIQTVKIIV
                     GAREGSENWKQIILMEISYPNIKHDGIKIQSTSYVSGKLYCNLYKDLAGVPMAFGQHE
                     IYYDLFDRHYDFAQHIPGNTFKYLYDFTTNTKIPVFYNRKKSVWSVQDIANELHYLKD
                     MSGQLVEVAISFDKKYSLAEIKQMIPSNLKQNWYWIGTEGKQNTHYYRPEQLLGLDPE
                     DIQLVFSDMPGDYMTGMDFMKEFLESGDQKRAQYLDIPVDDLQAFVDKFGDTDFTKQE
                     EIDKLEFAGIILTGKAEDFAQLEGKDWIYSSSIGASIPIQPYYQLHH"
     gene            593671..594867
                     /gene="tuf"
                     /locus_tag="SSUBM407_RS02950"
                     /old_locus_tag="SSUBM407_0538"
     CDS             593671..594867
                     /gene="tuf"
                     /locus_tag="SSUBM407_RS02950"
                     /old_locus_tag="SSUBM407_0538"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014335040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_012775011.1"
                     /translation="MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSV
                     NQPKDYASIDAAPEERERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQM
                     DGAILVVASTDGPMPQTREHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDL
                     LSEYDFPGDDLPVIQGSALKALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPV
                     EDVFSITGRGTVASGRIDRGTVRVNDEIEIVGLQEEKSKAVVTGVEMFRKQLDEGLAG
                     DNVGVLLRGVQRDEIERGQVISKPGSINPHTKFKGEVYILTKEEGGRHTPFFDNYRPQ
                     FYFRTTDVTGSIKLPEGTEMVMPGDNVTIDVELIHPIAVEQGTTFSIREGGRTVGSGM
                     VTEIEA"
     gene            595042..595794
                     /locus_tag="SSUBM407_RS02955"
                     /old_locus_tag="SSUBM407_0539"
     CDS             595042..595794
                     /locus_tag="SSUBM407_RS02955"
                     /old_locus_tag="SSUBM407_0539"
                     /EC_number="5.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003087526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triose-phosphate isomerase"
                     /protein_id="WP_011922080.1"
                     /translation="MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAP
                     AVDLNALLWFAKDSELKVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDY
                     FHETDEDINKKAHAIFRNGLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTADQV
                     ASLVIAYEPIWAIGTGKSATKDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPS
                     NVAEYMACPDVDGALVGGASLEAESFLALLNF"
     gene            complement(595847..596655)
                     /gene="yidA"
                     /locus_tag="SSUBM407_RS02960"
                     /old_locus_tag="SSUBM407_0540"
                     /pseudo
     CDS             complement(595847..596655)
                     /gene="yidA"
                     /locus_tag="SSUBM407_RS02960"
                     /old_locus_tag="SSUBM407_0540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015604638.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="sugar-phosphatase"
     gene            complement(596645..597958)
                     /locus_tag="SSUBM407_RS02965"
                     /old_locus_tag="SSUBM407_0541"
     CDS             complement(596645..597958)
                     /locus_tag="SSUBM407_RS02965"
                     /old_locus_tag="SSUBM407_0541"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HD domain-containing protein"
                     /protein_id="WP_011922082.1"
                     /translation="MIEKVFRDPVHNYVHVDHELIYKLINTKEFQRLRRIKQLGTTSY
                     TFHGGEHSRFSHCLGAYEIARRITQKFEDKYPQIWDTNESLLTMVAALLHDVGHGAYS
                     HTFERLFDTDHEEMTCAIITSPETEINALLKQVSPEFPDKVASVIKHTYPNKQVVQLI
                     SSQIDVDRMDYLLRDSYFTGANYGEFDLTRILRVIRPTENGIAFKESGMHAVEDYVLS
                     RYQMYMQVYFHPASRSMEVLLQNLLNRAKLLYTGEQEFFARTSPRLLPFFEHRIRLTD
                     YLSLDDGVMNTYFQSWIDGPDRILSDLAQRYINRKVLKSITFKAEEEEALDRLRSLVA
                     DVGFDPEYYTAIHHNFDLPYDIYRPNAEKKRTQIEIYRKDETLVELSSLSPIVHSLSG
                     TIHGDSRFYFPKEMLEETGIFAPQIADFNSHIHNDHFIIGESNEH"
     gene            598057..598944
                     /locus_tag="SSUBM407_RS02970"
                     /old_locus_tag="SSUBM407_0542"
     CDS             598057..598944
                     /locus_tag="SSUBM407_RS02970"
                     /old_locus_tag="SSUBM407_0542"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anion permease"
                     /protein_id="WP_002936180.1"
                     /translation="MNNQIILLTIQVFIVALILWMLYTILSYAKKHDISLKEKFWTGF
                     GIGYVTDLLDTLGIGTFATTTTMFKLTKLVEDDRKIPATMTTAHIIPVLVEALLFITI
                     VEVDMVTLIAMAAAAFTGAFVGAKVTQKWDTKKVQRILGILLIIAACFMVYRMITNPG
                     ADLTNEVKGLTGWKLAVGIAFDFMVGMLMSMGLGNYAPELIFFSLMGISPAVALPVMM
                     LNAAMIMTAGAKQFIQSGRVNWPGVPGIVVGGVLGVLTAAFFLSNLDINNLKILVVFI
                     AAYTGFTLLRSSFVTRIKK"
     gene            598956..599342
                     /locus_tag="SSUBM407_RS02975"
                     /old_locus_tag="SSUBM407_0543"
     CDS             598956..599342
                     /locus_tag="SSUBM407_RS02975"
                     /old_locus_tag="SSUBM407_0543"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1934 domain-containing protein"
                     /protein_id="WP_011922083.1"
                     /translation="MDIHLRNEIDLDGQIEVVDQQFQVEVKEKDGNLYLIYSNDEAEK
                     VVIKCDEEELVMTRFSTPKSIMRFISGKEAIVTIPTPLGIQHFVTDTKRYQLNRSDQS
                     VQLQYELKGLENQQLFASYDLEISWK"
     repeat_region   complement(599344..600880)
                     /note="IS element, novel IS"
     gene            complement(599614..600777)
                     /locus_tag="SSUBM407_RS02980"
                     /old_locus_tag="SSUBM407_0544"
     CDS             complement(599614..600777)
                     /locus_tag="SSUBM407_RS02980"
                     /old_locus_tag="SSUBM407_0544"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012677391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS30 family transposase"
                     /protein_id="WP_011922710.1"
                     /translation="MKNKHLTLSDRNDIQIGIEQLKPFSAIAAKLGKDPSTISKEVRR
                     NRVIKENSSTSNCEACPLLKKTPYVCNACPKKRSNCGYQKQFYYAKRAQLDYEVKLSD
                     SRTGVALNKEEFYRMDEIVSAAIQKGQHLNHIIASNEMSASRASIYRYLEKGYLSTKP
                     IDFPRVVKFRKRRIRNLQPIPKIAKEGRSYEDFQRFLTEKGISYWLEMDTVTGRIGGK
                     VLLTFNLSFCNFIFAQLLDNKTANEVAKHLYAIKNDLHQKEMDFCEIFPVILTDNGGE
                     FARVDDIEMDVRGESKLFFCDPNRSDQKGRIEKNHTLIRDILPKRSSFDNLTQEDINL
                     VCSHINSVKRASFNGKSAYELFTFTYGEELATLLGISKIDPENVIQSPRLLDK"
     gene            601102..603789
                     /locus_tag="SSUBM407_RS02985"
                     /old_locus_tag="SSUBM407_0545"
     CDS             601102..603789
                     /locus_tag="SSUBM407_RS02985"
                     /old_locus_tag="SSUBM407_0545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012658135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation-translocating P-type ATPase"
                     /protein_id="WP_012775235.1"
                     /translation="MSKEQKRDLFYTQSEEQVLSSMGSSLDGLSSDEASKRLADYGRN
                     ELDEGEKRTLLAKFLDQFKDLMIIILIAAAILTVITEGSHGLTDAIIILAVVILNAAF
                     GVYQEGQAEAAIEALKNMSSPVARALRDNHVVEVDSKDLVPGDIVLLEAGDVVPADMR
                     LLEANSLKIEEAALTGESVPVDKDLSAVLAEDAPIGDRVNMAYQNSNVTYGRGLGVVT
                     NTGMYTEVGHIAGMLANADETDTPLKQNLHQLSKVLTYAVLVIAAVTMAVSVFVRGEG
                     ILPALMTSVALAVAAIPEGLPAIVTVVLSLGTQVLAKRNSIIRKLPAVETLGSTEIIA
                     SDKTGTLTMNQMTVEKVYTNGQLVDAKEALDASNTTLRVMNFANDTKVDPTGKLIGDP
                     TETALVQFGLDQNFDVREVLVSEPRVAELPFDSTRKLMSTVHQQAAGNFFVAVKGAPD
                     QLLKRVTQIEENGTIRPITDADKQAILATNKDLAKQALRVLMMAYKYVDAIPELESDV
                     VENDLVFSGLVGMIDPERPEAAEAVRVAKEAGIRPIMITGDHQDTAEAIAKRLGIIDP
                     NDTEDHVFTGAELNELTDEEFQKVFKQYSVYARVSPEHKVRIVKAWQNDGKVVAMTGD
                     GVNDAPSLKTADIGIGMGITGTEVSKGASDMVLADDNFATIIVAVEEGRKVFSNIQKT
                     IQYLLSANTAEVLCIFLATLFGWDVLEPVHLLWINLVTDTLPAIALGVEPAEPGVMQH
                     KPRGRNSSFFSGGVLSSIIYQGILQTALVLGVYGFALLYPEHAGDNHAIHADALTMAY
                     VTLGLIQLVHAFNVKSVYQSIFTVGPFKNKLFNWSIVAAFLLLMATVVIPGFNTFFKV
                     SILTPTQWMVTVIGSGLMVVVVEIVKFVQRKLGLDEKAI"
     gene            complement(603900..604100)
                     /locus_tag="SSUBM407_RS02990"
                     /old_locus_tag="SSUBM407_0546"
     CDS             complement(603900..604100)
                     /locus_tag="SSUBM407_RS02990"
                     /old_locus_tag="SSUBM407_0546"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014636456.1"
                     /translation="MRVIIHYPKPIKQLSSQKLPLLVDGKIAGTVTQGKILSLPITQP
                     SVTLSIRGDKKSSIQVKEGDRV"
     gene            604234..604650
                     /locus_tag="SSUBM407_RS02995"
                     /old_locus_tag="SSUBM407_0547"
     CDS             604234..604650
                     /locus_tag="SSUBM407_RS02995"
                     /old_locus_tag="SSUBM407_0547"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004298733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TM2 domain-containing protein"
                     /protein_id="WP_004298733.1"
                     /translation="MNYLQNYILSKSSYLPSDKLFILQKELEDLDDEALNVLMMVEMR
                     QPLVALILAIFFGEFGVDRFYVGNKELGFAKLIAFAVSFVTLFILIGFLLFLGLYLWK
                     FIDCFLIMRACKEANFERLMLQIHQYKAFQHSNQTF"
     gene            604820..605308
                     /locus_tag="SSUBM407_RS03000"
                     /old_locus_tag="SSUBM407_0548"
     CDS             604820..605308
                     /locus_tag="SSUBM407_RS03000"
                     /old_locus_tag="SSUBM407_0548"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VanZ family protein"
                     /protein_id="WP_009910340.1"
                     /translation="MQTKKMSMFLFFAYLLLLTWMIIFKMDLSIVYGRYGYASINLIP
                     FAGTAVYDGVLDFPEILFNIVSFIPFGIYMEMLFRKASWVTNLCLIMLVSLCFEVLQY
                     LLLLGVADITDLLANGLGGAIGINIMYVLTSIWREKAYVRMNIFCFVLTFFVILITYL
                     AM"
     gene            605349..606476
                     /gene="queG"
                     /locus_tag="SSUBM407_RS03005"
                     /old_locus_tag="SSUBM407_0549"
     CDS             605349..606476
                     /gene="queG"
                     /locus_tag="SSUBM407_RS03005"
                     /old_locus_tag="SSUBM407_0549"
                     /EC_number="1.17.99.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA epoxyqueuosine(34) reductase QueG"
                     /protein_id="WP_012775233.1"
                     /translation="MNIKEEIIKLSQEIGISKIGFTTADDFAYLEKSLRASQEEGRSS
                     GFEHKNIEERIRPKLSLESAKTIISIAVAYPRHLPVKPQKTQYKRGKITPSSWGLDYH
                     YILQDKMERLARGIEKLTDGLEYKAMVDTGALVDTAVARRAGIGFIGKNGLVISKEFG
                     SYMFLGELVTNLDIEPDQPVDYDCGDCNRCVAACPTSCLLGDTTMNARRCLSFQTQDK
                     GMMDLEFRKKIKTVIYGCDICQICCPYNKGISSPPVVEIDPDLAEPELIPFLDLSNGQ
                     FKEKFGMIAGSWRGKNILQRNAIIALANSNDRSAIPKLLEIIDKKQNPVHMATAIWAL
                     GQLVKQPNDEMVSFIAGISSDNDDVIAEQAAFLNMVKDLQM"
     gene            606511..607606
                     /gene="prfB"
                     /locus_tag="SSUBM407_RS03010"
                     /old_locus_tag="SSUBM407_0550"
     CDS             join(606511..606582,606584..607606)
                     /gene="prfB"
                     /locus_tag="SSUBM407_RS03010"
                     /old_locus_tag="SSUBM407_0550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775232.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 2"
                     /protein_id="WP_012775232.1"
                     /translation="MDTAEIRQKIEELGKKLTSFRGSLDLEGLEEEIAILENKMTEPD
                     FWNDNLAAQKTSQELNELKNTYGNFHQMLDLYDESEILLDFLAEDESVRDELVEKLVE
                     LDKTMTAYEMTLLLSEPYDHNNAILEIHPGSGGTEAQDWGEMLLRMYQRYGNAKGFIV
                     ETLDYQAGDEAGIKSVTLSFTGPNAYGLLKSEMGVHRLVRISPFDSAKRRHTSFTSVE
                     VMPELDDTIEIEIRDDEVKMDTFRSGGAGGQNVNKVSTGVRLTHIPTGIVTQSTVDRT
                     QYGNRDRAMKLLQAKLYQLEQEKKAAEVDSLKGDKKEITWGSQIRSYVFTPYTMVKDH
                     RTGYEVAQVDKVMDGDLDGFIDAYLKWRIS"
     gene            607749..608441
                     /gene="ftsE"
                     /locus_tag="SSUBM407_RS03015"
                     /old_locus_tag="SSUBM407_0551"
     CDS             607749..608441
                     /gene="ftsE"
                     /locus_tag="SSUBM407_RS03015"
                     /old_locus_tag="SSUBM407_0551"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012130521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division ATP-binding protein FtsE"
                     /protein_id="WP_002936190.1"
                     /translation="MGIIEMKDVSKKYGNGTTALRGVSVNVEAGEFAYIVGPSGAGKS
                     TFIKLLYREEKLDKGSLKVGKFDLAKIKKRDVPLLRRSVGVVFQDYKLLPKKTVFENI
                     AYAMEVIGEKPRNIKKRVMEVLDLVGLKHKIRSFPNELSGGEQQRIAIARAIVNNPKV
                     LIADEPTGNLDPENSWEIMNLLERINLQGTTILMATHNSQIVNTLRHRVIAIEDGRVV
                     RDEAEGEYGYDE"
     gene            608434..609363
                     /locus_tag="SSUBM407_RS03020"
                     /old_locus_tag="SSUBM407_0552"
     CDS             608434..609363
                     /locus_tag="SSUBM407_RS03020"
                     /old_locus_tag="SSUBM407_0552"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004298742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002936191.1"
                     /translation="MSNRFFRHFIESLKSLKRNGWMTIAAISSVAITLTLVGLFASVI
                     LNTAKLASDLEQNVRINVYLRANSTDQAETIVNEAGETVANPDYKKVYNQITALENVQ
                     SVTYSSKDEQLQKLTATLGDTWNLFQGDANPLYDAYIIDTTEPQYVKTVAAEIAKIDG
                     VTEVRDGEVETERIFKLANLVRTWGLAATGLLLFTAVFLISNTIRITIISRSREIQIM
                     RLVGAKNSYIRGPFLWEGAWVGLLGAILPSALVYSFYKMIYTSVNASLASQDLSLISM
                     DVFVPGMIGALFVIGIIIGSLGSVISMNRYLKI"
     gene            complement(609416..609568)
                     /locus_tag="SSUBM407_RS03025"
     CDS             complement(609416..609568)
                     /locus_tag="SSUBM407_RS03025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004298744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FeoB-associated Cys-rich membrane protein"
                     /protein_id="WP_085461704.1"
                     /translation="MPTLILFLIIVILFSLAIRSLIKGKGSCGDCSCDCTIKQEMNES
                     SHHRHP"
     gene            complement(609568..611712)
                     /gene="feoB"
                     /locus_tag="SSUBM407_RS03030"
                     /old_locus_tag="SSUBM407_0553"
     CDS             complement(609568..611712)
                     /gene="feoB"
                     /locus_tag="SSUBM407_RS03030"
                     /old_locus_tag="SSUBM407_0553"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrous iron transport protein B"
                     /protein_id="WP_012027350.1"
                     /translation="MTKHIALAGNPNSGKTTLFNLLTGTNQRVGNWPGVTVERKSGTI
                     KKRKHLLIQDLPGIYSLSPYTPEERVARDYLIADQPAAILNVLDATNLERNLYLTLQL
                     LEMGLPIVIALNMTDALKSQGRSINSDQLSYQLGVPVQPISALKKLGISQLLHEVEKI
                     TNQQAEPIYPQYDKQFEAGLAQVIDLLSDSIPNRQKRFYAIKLLEQDQVILDQLQLNA
                     QDMLDLTEIIAILEKIYADDMEAIIVNQRYQFIEKITELVTKDSDKAFNLSDNIDRLV
                     TNRFLALPIFAAVMWLTYFLSIQTVGTMGTDWVNDVLFGELVPGLIQANLDRFEIAGW
                     LQSLVLDGIIAGCGAILGFVPQIFVLFVCLGILEDIGYMSRVAFVMDRIFRRFGLSGK
                     SFIPMLISTGCGVPGVMASRTIENEQDRKITIMTATFMPCSAKLPIISLVAGAFFPDN
                     PWIAPSAYFVGMAAIVLSGMALKKTKQLGGVASPFIMELPSYHLPKLSTVLRYAFDKA
                     LSFIKRAGTIIFVTNIIIWFSSSYNWSLQMVETDESILASIGHSFSLLFAPLGFGNWR
                     ATVAAITGLLAKETVIATFGILYKLGETTEENPELWGLLQQDYTALSAYSFLVFNLLC
                     APCFAAIGAIHREMGEAKWTWIAIGFQTGLAYASSLVIYQIGLVLIHGQLPTVWTFIA
                     IFLIITAIYSLVKKPTNTLPIVTLKTLEKGEY"
     gene            complement(611709..612179)
                     /locus_tag="SSUBM407_RS03035"
                     /old_locus_tag="SSUBM407_0554"
     CDS             complement(611709..612179)
                     /locus_tag="SSUBM407_RS03035"
                     /old_locus_tag="SSUBM407_0554"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrous iron transport protein A"
                     /protein_id="WP_012775230.1"
                     /translation="MKLQNLQVGQSYLVKDCLTQDDIRKHLAHLGLKVGEEIRIISKT
                     KTNAIFQVKASRLALDREIIESLVLTEKSATEIINLSEAPIGSSAKVMDIYATGALRR
                     RLMDMGLTKNTQLFLKKVAPLGDPIETTLRGYELTLRKSEAQMIGVQITSEVRK"
     gene            612336..612408
                     /locus_tag="SSUBM407_RS03040"
                     /old_locus_tag="SSUBM407_t0045"
     tRNA            612336..612408
                     /locus_tag="SSUBM407_RS03040"
                     /old_locus_tag="SSUBM407_t0045"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:612369..612371,aa:Thr,seq:ggt)
     gene            612878..614605
                     /locus_tag="SSUBM407_RS03045"
                     /old_locus_tag="SSUBM407_0555"
     CDS             612878..614605
                     /locus_tag="SSUBM407_RS03045"
                     /old_locus_tag="SSUBM407_0555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012028347.1"
                     /translation="MFRLIFDYIKRHKWLYLLVAVTLIIYDATLLLPTQIIQRMVDIL
                     TKNELTQAILVQEMTLLLLVTVLNYATAFIWHLKLFQASVNFKFDMQQRAFKKLVTMR
                     TPFYEKFRSGDVMTRFSTDVDGLMEMVGYGLMIVVYAGGMLAFIIPTMFFIDWKISLV
                     ALLPMLFMTLCIFFIGRKQDKAIDANREAVAQLNNEVLEVIEGIRVTRAYSKKANQKA
                     QFQARTKQLAQGGDRITSLQSLYNPLATVCLGLSTIFVLLMGAQAVKAGQLTLGQVIA
                     LQLYVGSLLEPFWTLADFILVYQTGKTSFEKLQELIETGDDLEADGSKEIAELSSISF
                     KNYSFSYPQAERASLQDINWTLKAGQTVGIVGKTGSGKTTLVRQFLRQYPIGQGNFFI
                     NHQSILDFKRSSIEEKIGYVPQEHILFSRSVGENIALGKVASSSEEIEQAIATAAFSQ
                     DLKRMSDGLDTMIGERGVSISGGQKQRISIARAFLREPDLLILDDSLSAVDARTERQI
                     IQNIQKERAGKTNVIVTHRLSAVNHADWVLVLDEGRIVEEGRPADLLAQRGWYYEQYQ
                     RQQSQEGGE"
     gene            614605..616344
                     /locus_tag="SSUBM407_RS03050"
                     /old_locus_tag="SSUBM407_0556"
     CDS             614605..616344
                     /locus_tag="SSUBM407_RS03050"
                     /old_locus_tag="SSUBM407_0556"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012027346.1"
                     /translation="MTILGFLLKQIRRVKCLFIVAVGFYLLASTMVRLAPLLIQQAID
                     GPITDLSKGLPFDEAVFLNQSVQYMGMIILGAIGFYLSMRLLMHCANRIAENLRNQAY
                     DVMQRLPISYFDDKPAGKIATRIVNDTETLRTQFYGTLVNAFNNIVRLLFTYGVLFYM
                     NRSLGWLMLLLIPLYIGIQFAYKKMTDKPMKDFYDARSDVNTQVNETMNGASLIQLFG
                     QEERIMKEFEVTADKMRRADNKIIWAQSLATWNLSGFLQNLVIAAILTVVGYQFLAGQ
                     DGVTAGKLFVYVNYIEGVFIALGALVQQFPNMLRSFETGKRLMALLEEELEDDCDRIL
                     EVEQGQVVFEHVNFSYEENRPVLKDITIRAEKGETVALVGHTGSGKSSIMNLLYRFYD
                     PQEGCVLIDGKNIRDYSRESLRSHMGIVLQDPYLFTGTIASNVSMNEEEADRTRIMQA
                     LEKVGAGPMLSRLEKGIDEPVVEKGAAFSSGERQLIAFARTLYSDPKILILDEATSHI
                     DTETEEIIQHAMEVVKEGRTTFIIAHRLSTIQNADQILVLDQGRIIEHGKHEELVARG
                     GVYAQMHEIQAKV"
     gene            616398..617108
                     /locus_tag="SSUBM407_RS03055"
                     /old_locus_tag="SSUBM407_0557"
     CDS             616398..617108
                     /locus_tag="SSUBM407_RS03055"
                     /old_locus_tag="SSUBM407_0557"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_012027345.1"
                     /translation="MKALIFDVDDTLYDQIQPFERALERHIEVAREQIEPLYLSFRRY
                     ADEVFEATAIGKMSLKDSHIYRMKHALADFGYQVSDATALAIQIDYDYFQGQIELSPV
                     FPEIFSWCQVQGIAMGIITNGPYRHQLRKIRTMGLVNWFELEHVLISGQVGITKPNPA
                     IFQLMEERLGMSGEDICYLGDSFENDIIGAKTAGWQAVWFNHRKRSEPESSFQADYMI
                     DEWFNLDSLIKNIIKPIG"
     gene            617698..619191
                     /gene="sly"
                     /locus_tag="SSUBM407_RS03060"
                     /old_locus_tag="SSUBM407_0558"
     CDS             617698..619191
                     /gene="sly"
                     /locus_tag="SSUBM407_RS03060"
                     /old_locus_tag="SSUBM407_0558"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_095889394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cholesterol-dependent cytolysin suilysin"
                     /protein_id="WP_012775557.1"
                     /translation="MRKSSHLILSSIVSLALVGVTPLSVLADSKQDINQYFQSLTYEP
                     QEILTNEGEYIDNPPATTGMLENGRFVVLRREKKNITNNSADIAVIDAKAANIYPGAL
                     LRADQNLLDNNPTLISIERGDLTLSLNLPGLANGDSHTVVNSPTRSTVRTGVNNLLSK
                     WNNTYAGEYGNTQAELQYDETMAYSMSQLKTKFGTSFEKIAVPLDINFDAVNSGEKQV
                     QIVNFKQIYYTVSVDEPESPSKLFAEGTTVEDLKRNGITDEVPPVYVSSVSYGRSMFI
                     KLETSSRSTQVQAAFKAAIKGVDISGNAEYQDILKNTSFSAYIFGGDAGSAATVVSGN
                     IETLKKIIEEGARYGKLNPGVPISYSTNFVKDNRPAQILSNSEYIETTSTVHNSSALT
                     LDHSGAYVAKYNITWEEVSYNEAGEEVWEPKAWDKNGVNLTSHWSETIQIPGNARNLH
                     VNIQECTGLAWEWWRTVYDKDLPLVGQRKITIWGTTLYPQYADEVIE"
     gene            619502..620203
                     /locus_tag="SSUBM407_RS03065"
                     /old_locus_tag="SSUBM407_0559"
     CDS             619502..620203
                     /locus_tag="SSUBM407_RS03065"
                     /old_locus_tag="SSUBM407_0559"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009567792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmannosamine-6-phosphate 2-epimerase"
                     /protein_id="WP_012027343.1"
                     /translation="MGTISKTDLKQQIKDGIIVSCQALPGEPLYREEGGIMPLLVKAA
                     QEAGAVGIRANSVRDIKEIKEVTTLPIIGIIKRDYPPQEPFITATMREVDELAALDIE
                     VIALDCTKRERYDGLDIVDFIKQIKEKYPEQLFMADISTFEEGLTAYEAGIDFIGTTL
                     SGYTSYSRQEEGPDIELVDRLCRAGIDVIAEGKIHYPDQVKIIHDLGVAGIVVGGAIT
                     RPKEIAERFISALHK"
     gene            620231..621739
                     /locus_tag="SSUBM407_RS03070"
                     /old_locus_tag="SSUBM407_0560"
     CDS             620231..621739
                     /locus_tag="SSUBM407_RS03070"
                     /old_locus_tag="SSUBM407_0560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012678573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS transporter subunit EIIC"
                     /protein_id="WP_012027342.1"
                     /translation="MNFKKFSQLGQAFMLPISILPVAGLLLGIGGALSNSNAVAQFPV
                     LDQAWLQAVFTIMSTAGSAVFANLALIFAIGVAVGLADADKGTAGLSAGVAYLVYTAT
                     ISGFLTLFADKGASIDTGVLGALAIGITVATLHNKYRKIELPAFLGFFGGSRFIPIIS
                     SFAAIAIGSIFYIIWPPIQNLLVDFGKAIAEMGSFGTFLYGFGLRLTGAFGLHHTIYP
                     MFWYTSLGGSEVVAGETIQGAQNIFFAQLADANHTGLFTYGTRFFAGRFATMIFGLPA
                     SCLAMYHAIPKENRKKVGSFYSSSALTSLLTGITEPIEFSFLFVAPWLYVVHAFLDGL
                     SFLVADLLQIRIGNSFSGGLIDYLIFGVFQGNDKTNWIYVIPVGLLWAAVYYLVFKFL
                     VTKFHVLVPGMESSDQASHSEKVLSNGSSLRDNAIAIIDALGGADNIENVTACATRLR
                     VSLRNSGLVDKGVIQSIGATAVLDVKGGIQAIFGGKAILYSQEINQILGLEE"
     gene            complement(621843..622655)
                     /locus_tag="SSUBM407_RS03075"
                     /old_locus_tag="SSUBM407_0561"
     CDS             complement(621843..622655)
                     /locus_tag="SSUBM407_RS03075"
                     /old_locus_tag="SSUBM407_0561"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MurR/RpiR family transcriptional regulator"
                     /protein_id="WP_012028344.1"
                     /translation="MLQTPKHITAIIESHLDQMTRLEKQIASYFTQLDPSSADLSQEN
                     TIQQLHISPSALTRFAKKCGFSGYREFVFAFQNNQQYLDKHFEKLQRSLTKKVLVDYE
                     EILTATNKLVDEEKLEEIAKLIDSSKRVYFYGIGSSGLVAMEIKSRFMRLGVVCDAIT
                     DENNLIWTTNILDDSCLVIGLSLSGQTEEVMEHLQLAAQKGIPTALLTTRSFPHPTFD
                     QIIPVASVRHLNYGNRISPQIPLLIMLDIIYAYFLAIDKEKKENIFKQTIRE"
     gene            622755..623252
                     /gene="ybeY"
                     /locus_tag="SSUBM407_RS03080"
                     /old_locus_tag="SSUBM407_0562"
     CDS             622755..623252
                     /gene="ybeY"
                     /locus_tag="SSUBM407_RS03080"
                     /old_locus_tag="SSUBM407_0562"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018380869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA maturation RNase YbeY"
                     /protein_id="WP_002935749.1"
                     /translation="MYIEMIDETGQVSAQMQEQITELLQFAAEKIGKQNKEMAVTFVD
                     NKRVHEVNLEYRGIDRPTDVVSLEYKPESEIVFDEEDLLDNPELAEMMEDFDAYIGEL
                     YISIDKAREQAEDYGHSYEREMGFLAVHGFLHINGYDHYTPEEEAEMFGLQEEILTAY
                     GLTRE"
     gene            623233..623634
                     /locus_tag="SSUBM407_RS03085"
                     /old_locus_tag="SSUBM407_0563"
     CDS             623233..623634
                     /locus_tag="SSUBM407_RS03085"
                     /old_locus_tag="SSUBM407_0563"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018372465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase family protein"
                     /protein_id="WP_012027339.1"
                     /translation="MDLQENNSKNRWKNRELIASLEFAVTGLLTAFKEERNMKKHLAS
                     AVLVVLAGLIFQVSVTEWLFLLLSISLVIAFEIVNSAIENVVDLASDYHFSMLAKNAK
                     DMAAGAVLFVSGFALLTGLIIFVPKIWDFIF"
     gene            623651..624550
                     /locus_tag="SSUBM407_RS03090"
                     /old_locus_tag="SSUBM407_0564"
     CDS             623651..624550
                     /locus_tag="SSUBM407_RS03090"
                     /old_locus_tag="SSUBM407_0564"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase Era"
                     /protein_id="WP_002935752.1"
                     /translation="MTFKSGFVAILGRPNVGKSTFLNYVMGQKIAIMSDKAQTTRNKI
                     MGIYTTEEEQIVFIDTPGIHKPKTALGDFMVESAYSTLREVDTVLFMVPADEKRGKGD
                     DMIMERLKQAKVPVILVVNKIDKVHPDQLLEQIDDFRQQMDFKEIVPISATQGNNVNR
                     LMEILKENLDEGFQYFPADQITDHPERFLVSEMIREKVLHLTREEIPHSVAVVIESMK
                     RDEFTDKVHIRATIMVERDSQKGIIIGKQGAMLKKIGSMARRDIELMLGDKVFLETWV
                     KVKKNWRDKKLDLADFGYNEKEY"
     gene            625163..625990
                     /gene="mutM"
                     /locus_tag="SSUBM407_RS03095"
                     /old_locus_tag="SSUBM407_0565"
     CDS             625163..625990
                     /gene="mutM"
                     /locus_tag="SSUBM407_RS03095"
                     /old_locus_tag="SSUBM407_0565"
                     /EC_number="3.2.2.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009910298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-formamidopyrimidine glycosylase"
                     /protein_id="WP_012775229.1"
                     /translation="MPELPEVETVRRGLNRLVKGKVISKVEVTYAPMIKTGVDAFCQD
                     LIGQEILDVDRRGKYLLIYLTDHVLISHLRMEGKYNFFADQVPANKHFHAFFTFIDGS
                     TLVYQDVRKFGTMELLGKADVDAYFISRKIGPEPTEEDFDLEEFAKKLAKSKKPIKSH
                     LLDQSLVAGLGNIYVDEVLFKAKVHPAQTSNQLSTDQVADLRQATIEVLQLGIEKGGS
                     TIRTYKNALGMDGTMQDYLQVYGKTGQACPRCQTEIVKIQLGGRGTHFCPKCQVKHG"
     gene            625983..626585
                     /locus_tag="SSUBM407_RS03100"
                     /old_locus_tag="SSUBM407_0566"
     CDS             625983..626585
                     /locus_tag="SSUBM407_RS03100"
                     /old_locus_tag="SSUBM407_0566"
                     /EC_number="2.7.1.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002918651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="WP_012027337.1"
                     /translation="MAKIIGLTGGIASGKSTVTAFLREQGYPVIDADAVVHELQAKGG
                     KLYQILLKEFGPDILSADGHLDRVKLGQAVFADSKLRARLSDLQDQIIRQELLDRRDA
                     LKQTEQVLFMDIPLLYEADYSGEVNEIWLVYVDRAQQLERLMKRNGLAVQDAENRLAA
                     QLSLEEKRSQAQVVIDNSGAVEATLAQVAQLLEELKDGRR"
     gene            626572..627777
                     /locus_tag="SSUBM407_RS03105"
                     /old_locus_tag="SSUBM407_0567"
     CDS             626572..627777
                     /locus_tag="SSUBM407_RS03105"
                     /old_locus_tag="SSUBM407_0567"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012028343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux MFS transporter"
                     /protein_id="WP_012028343.1"
                     /translation="MDDGSSYWKQNLKVAWLGNFLTGTSFTLVMPFISVFVEELGVGP
                     GQVEYYAGLAVSVNALAAALMAPIWGSLADRYGRKPMMVRAAFAMIFTMGGMAFVPNV
                     FWLLTLRVLNGVFTGYIPNATALIASQVPKDKTGYALGTLSTGAVAGNLIGPTLGGIL
                     AEMFGVHMVFLLVGLLYAIVVLLTVFYIREDFVPVKKGEEMSVKEVFEQVKDRQMLVG
                     LFVTSMIIIAAAQAVVPILTLYVRHLGQTDNLLFVAGFIISLPGMASLVTSGYLGKIG
                     DRIGNHRLLLIALTYSLLINVFCVFAENPFQLGLLRFMYGFGTGALLPSVNSLLTKLT
                     PKEGISRIFSYNQLFNNLGSVVGPMMGSAVAAHMGYDWVFYLSSGLVLFNLIWSLTNF
                     RNYLKVRDV"
     gene            627777..627926
                     /gene="rpmG"
                     /locus_tag="SSUBM407_RS03110"
                     /old_locus_tag="SSUBM407_0568"
     CDS             627777..627926
                     /gene="rpmG"
                     /locus_tag="SSUBM407_RS03110"
                     /old_locus_tag="SSUBM407_0568"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008809064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_012775228.1"
                     /translation="MRVKINLQCSECGSKNYLTSKNAKTHPDKIEVLKYCPKERKVTL
                     HLETK"
     gene            627973..628206
                     /gene="secG"
                     /locus_tag="SSUBM407_RS03115"
                     /old_locus_tag="SSUBM407_0569"
     CDS             627973..628206
                     /gene="secG"
                     /locus_tag="SSUBM407_RS03115"
                     /old_locus_tag="SSUBM407_0569"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019777395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="WP_012027334.1"
                     /translation="MYQALLAILLILSVILIVVIFIQPAKNQSSNVFDSSSGALFERT
                     KARGFEAVMQRITAILIFLWMLDALALVIISSK"
     gene            628638..631007
                     /gene="rnr"
                     /locus_tag="SSUBM407_RS03120"
                     /old_locus_tag="SSUBM407_0570"
     CDS             628638..631007
                     /gene="rnr"
                     /locus_tag="SSUBM407_RS03120"
                     /old_locus_tag="SSUBM407_0570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004298775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease R"
                     /protein_id="WP_012027333.1"
                     /translation="MKNEIINYIKEVGPVTMDQLADQFGASSAKSFTDLVKLVSSMEG
                     SRQLVFDNAGRITLPAPKISKNKVTLQGIFRAHKSGFGFVTIDEEEDDLFVSRDDVNF
                     AIEGDRVEVAIKKVADRFKGTAAEAEVIDILEHSLKTAVGLIVFDEDKPEYAGYIKSK
                     NQKIAQKIYIKKSPLVLTGTEILKVDIEAYPNKKRDHFVATIRDVVGHKDDVGIDVLE
                     VLESMDIVSEFPDEVLAEANRVPESPSEKDFEGRLDLRDEIIFTIDGADAKDLDDAVH
                     IKQLKNGNLELGVHIADVSYYVTEGSALDQEAVKRGTSVYVTDRVVPMLPERLSNGIC
                     SLNPNVDRLTQSAIMEIDCKGKVVKHWIGQTVIKTTFRMTYSDVNDMIAGNKEKLDKY
                     KTIVPSVELMVKLHETLETMRYKRGALNFDTAEAKIIVNKDGLPVDIQLRQRGIAERM
                     IESFMLAANECVAEHFAKLDLPFIYRIHEEPKSDKLQKFIDYATSFGLTVYGTASSIS
                     QDALQDLMERVKDEPYADVLNMMLLRSMQQARYSEHNHGHYGLGAEFYTHFTSPIRRY
                     PDLLVHRMVREYGHNPSEKAEHFEQVIPELAKSSSSLERRAIDAEREVEAMKKAEFMQ
                     EFVGQEFDGVVSSVVKFGLFVELPNTVEGLIHVTNLNEYYQFHERTLTLQGEKSGRVF
                     RVGQPIRIKLTRADKMTGEIDFAHMPSELDIVEKALKAKRRTASHSNRDRDDRSGRGR
                     GKHYKQEAAGRDSGRHKSGKDHKSKSGKKDKKKKPFYKEVAKKNKKKRR"
     gene            631010..631477
                     /gene="smpB"
                     /locus_tag="SSUBM407_RS03125"
                     /old_locus_tag="SSUBM407_0571"
     CDS             631010..631477
                     /gene="smpB"
                     /locus_tag="SSUBM407_RS03125"
                     /old_locus_tag="SSUBM407_0571"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002894882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SsrA-binding protein SmpB"
                     /protein_id="WP_012027332.1"
                     /translation="MAKGEGNVIAQNKKARHDYTIVDTVEAGMVLTGTEIKSIRAGRI
                     NLKDGFAQIKQGEAWLVNVHIAPYDEGNIWNQEPTRTRKLLLRKKQIESLDNEVKGTG
                     MTLVPLKVYIKDGFAKVLIGLAKGKHDYDKRESIKRREQDRDIKRTMKAINSR"
     gene            complement(631564..632607)
                     /locus_tag="SSUBM407_RS03130"
                     /old_locus_tag="SSUBM407_0572"
     CDS             complement(631564..632607)
                     /locus_tag="SSUBM407_RS03130"
                     /old_locus_tag="SSUBM407_0572"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004233216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase catalytic
                     domain-containing protein"
                     /protein_id="WP_012775558.1"
                     /translation="MKAAIYEKAGKMTVAEIEKPSLQAKDDVIIKVVRACVCGSDLWG
                     YGEDIHHDHGDTNSGHEAIGIVEEVGEDITTLVPGDFVIVPFTHGCGHCDACRAGFDG
                     TCDNHPGYTNWGNNYQSQYIRFHYGNWALVKIPGQPSDYSEGMIKSLLTLADVMPTGY
                     HATRVADVKPGDKVVVIGDGAVGQCAVIAAKMRGASQIIMMSRHADRQQMALESGATA
                     VVAERGEEGIAKVREILGGGADAALECVGTEASIDQALGVLHNGGRIGFVGVPHYNNH
                     ALGSTFAQNIIIDGGSASVTTYDKEILLDAVLKGDINPGRVFTQTYSLDNIDQAYKDM
                     ANRKTIKAMITVD"
     gene            632776..633636
                     /gene="tehB"
                     /locus_tag="SSUBM407_RS03135"
                     /old_locus_tag="SSUBM407_0573"
     CDS             632776..633636
                     /gene="tehB"
                     /locus_tag="SSUBM407_RS03135"
                     /old_locus_tag="SSUBM407_0573"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase TehB"
                     /protein_id="WP_012775226.1"
                     /translation="MTVLVPYKRMPIWNQDTVPQHFLTKHNTKVGTWAKIKVLRGQLK
                     FEPISDDNEILGEFVYGPTDDVPFVEPQAWHRVTLLTEDTEFFLEFFCQPEDYFAKKY
                     DYTRTHSEVLEALKRIEPCKVLDLGCGHGRNSLYLAQQGFEVTAVDKDVPSIRTLLQV
                     KEVEDLDLQAGTYDINSASLEQDYDWIISTVVFMFLERERVPAIIRNMQEQTRPGGYN
                     LIVAAMDTEDAPCPMNFSFTFGVGELKEYYRDWELVKYNEDFGQLHKRDENGHFLKMR
                     FATMLARKKG"
     gene            633830..635653
                     /locus_tag="SSUBM407_RS03140"
                     /old_locus_tag="SSUBM407_0574"
     CDS             633830..635653
                     /locus_tag="SSUBM407_RS03140"
                     /old_locus_tag="SSUBM407_0574"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C69 family dipeptidase"
                     /protein_id="WP_012028341.1"
                     /translation="MKKTFVRIATFLMLVCLFPVQLVQACSGFIIGKGLTTDGSILYG
                     RTEDYPYPPNNGAHNKNYIVVPATAYAKGDMLVDESFGFTAPHLANEFKYTSTPDAAR
                     GDGSNGNFGAHGFNEKGVSMTATVTAIPNKKVLAVDPLVTAGGLGEAILIDYVLPRVT
                     SAREGIELIAKTIDEKGSAEGNIIVIADKNEVWYMEILSGHQYVAIKFPEDKYAIFAN
                     TYYLGHVDFTDTENVIASAKVEEVAKQAENYMMVDGKFHIAKSYGPENYADGDRSRTY
                     AGIKLLDPASSVTYEDAVYDLLRQPTDPSRRFSLQDTFALQRNRFEHLPEFRPDDEAG
                     KVKQGDNGANDQAADATYKYALGNENVIDAHVYQINSSLPSAFGGTVWLGLAQTRNTP
                     YVPFYGIVTDTYEAFKNRSASYDTNSWYWTVQNIDKMAISHPELFGTSIQEKWIALEK
                     EWIASQAALDAQYAGLSEDAAVALAPTVTEATLARSAEIFAQLKAVEAEMMAKIEAAT
                     TPSSSSTEPSTSTEPSSSGTETSTSTSQSTSDSNTGGATDTSSSSRTVVPSDKKVTPT
                     NKKGKSSLPSTGEQVSLLLVALGVAGILTAIFLHRKKSSKE"
     gene            635984..638473
                     /locus_tag="SSUBM407_RS03145"
                     /old_locus_tag="SSUBM407_0575"
     CDS             635984..638473
                     /locus_tag="SSUBM407_RS03145"
                     /old_locus_tag="SSUBM407_0575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-translocating P-type ATPase"
                     /protein_id="WP_012775225.1"
                     /translation="MKQASYPIQGMTCASCALTVEKAVGKLAGMEEVSVNLATEKLSV
                     SYDEKLLGLEDIRQAVEKAGYQLVDNLVTESYDISGMTCASCALTVEKALGKLEGVEE
                     VSVNLATEKATIRYSRHRQNPASLERAVEQAGYQLIRPEKVEGAADKGPSTEEKLRHR
                     FVWSAAFTFPLLYIAMGPMLPWGGLPLPALLHQPLVYAISQVILLIPILYIGRSFFQK
                     GFKTLLQGHPNMDSLIAVGTGAALVQGLLMIVFLQMGKEVAMHGHHPELYFESAAVIL
                     TLITLGKYFEARAKGQTSEAIKKLMDLAPKAAQVLRNGQEMQVPIEEVVVGDQVIVRP
                     GQQIPVDGQVLEGQTRVDESMLTGESLPVKKALGNNVFGGTLNQQGAITMQATKVGRD
                     TTLAQIIRLVEEAQGSKAPIAKLADQVSAIFVPVVMGLALLSGLAWYFLGQESWIFSL
                     SIIIAVLVIACPCALGLATPTAIMVGTGKGAENGLLFKSGQAIETLQGVNTIVFDKTG
                     TITEGKPQVTDIHLLSTKNREQVLQLAASSEQFSEHPLAQALLQAAQTEKIELLPATD
                     FQALSGRGLSVIIAEQTIYLGNERLMREQGIDVSKGRAVAEAFAQQAKTPVFLASQQE
                     VLAVIAIADKIKETSRQAVQALQTIGLEVVMLTGDNEKTAKAIAKEVGIEQVISQVLP
                     DDKANQVKFLQEQGKTVAMVGDGINDAPALAQAHVGLAIGSGTDIAIESADIVLMHSD
                     ILDVVKAVKLSQATMRTIKQNLFWAFAYNVIGIPIAMGLLHAFGGPLLNPMFAGAAMA
                     LSSVSVVLNALRLKTYKLYQKYQSKNWYFFT"
     gene            638513..638998
                     /gene="tpx"
                     /locus_tag="SSUBM407_RS03150"
                     /old_locus_tag="SSUBM407_0576"
     CDS             638513..638998
                     /gene="tpx"
                     /locus_tag="SSUBM407_RS03150"
                     /old_locus_tag="SSUBM407_0576"
                     /EC_number="1.11.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003088071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol peroxidase"
                     /protein_id="WP_012775224.1"
                     /translation="MTTFIGKPVTLVGPQLRVGDVAPDFVLMANDLSLKSLKDFGKQT
                     KVISVVPSIDTGICDTQTRRFNQELADRDNTVVITVSADLPFAQKRWCGAAGLEDAIT
                     LSDYYDHAFGKSYGVLMREWNLLARAVFVLNADNEITYVEYLDNVNEHPDYDAALEAV
                     K"
     gene            639093..639428
                     /locus_tag="SSUBM407_RS03155"
                     /old_locus_tag="SSUBM407_0577"
     CDS             639093..639428
                     /locus_tag="SSUBM407_RS03155"
                     /old_locus_tag="SSUBM407_0577"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775223.1"
                     /translation="MEKTQIIQDVLALIQDLNRAFQADKVGTADEQRFQHNLTETTRI
                     LSEAKSVTNTELIAIEKFYRSTSFLVGLGDLRLSETSRQAWRAFDRYYYETIREELKL
                     YGGSAIAQV"
     gene            639517..640218
                     /locus_tag="SSUBM407_RS03160"
                     /old_locus_tag="SSUBM407_0578"
     CDS             639517..640218
                     /locus_tag="SSUBM407_RS03160"
                     /old_locus_tag="SSUBM407_0578"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018167723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012027323.1"
                     /translation="MSYIQVKNSSKYYQMGDATIVANDGVSFEIEQGELVIILGSSGA
                     GKSTLLNILGGMDSNDEGEVWIDGVDIAKLSSHELTNYRRDDVGFVFQFYNLVANLTA
                     KENVELAAEIVKDALDAEEVLEQVGLGHRINNFPAQLSGGEQQRVAIARAVAKKPKIL
                     LCDEPTGALDYQTGKQVLQILQDMSRKQGATVIIVTHNSSLAPIADRVIRMRDARVHS
                     VELHAEPQDIASLEY"
     gene            640218..643595
                     /locus_tag="SSUBM407_RS03165"
                     /old_locus_tag="SSUBM407_0579"
     CDS             640218..643595
                     /locus_tag="SSUBM407_RS03165"
                     /old_locus_tag="SSUBM407_0579"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009910278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FtsX-like permease family protein"
                     /protein_id="WP_012027322.1"
                     /translation="MGETMKKKIYWKDMRQSLLSSKGRFLSIFSLMMLGALALTGLKV
                     TAPNMEKTAQAYIASHRTMDLAVISGLGLSQADLDELETIEGATLEAGYFKDVVTNEG
                     QTAIRLFSAPKTLSTYKLVEGEVPSQKGQIALSASFKNRYKLDDTVQVTESDKDGKIL
                     TQTSFTLVGFVASAEIWDNETMGMAVSGDGQLGGYGLVSQDTFKSEVYTIARIRYDDL
                     VDLPYYSQAYQDRLDQHQEDLEKLLANNDEQRLATIQSDGQTDISKGEEEIAQAQSQL
                     EQAESELETGEEQLATGRSEFARGRAKVVQTEAELRAAQAQLLKNKFELEESKKELDG
                     RKAQLEQTASFLDGYQMELEMSAQQLEEAKQELDSQNAQLSQTASQISTGRASWFQAQ
                     QELDLEIANHLQEGQTLSDYPDLLARQEGLDVEKSRLDQMESAHEQANQAYLQGYDYY
                     QTKQNEYNSNLAQYQTWNQEYQAGLARYQAGLSQYEQGIAAYNKGVEDYEWGLSQLES
                     SNQLLRQEELRLEEADKELSQAQSQFSDKKAVADQEISQAQTEIAQAKSDLSKLAKAP
                     YQVYTRSSLPGGDGYTTYSNATRSIAAVGNVFPVVLYLVAALVTFTTMARFVDEERTQ
                     SGILKALGYTNRQIMAKFILYGLAAGLVGTIVGIIAGNLLLSPLISDIITQTTVIGPA
                     KLHFYPLWTGLALLLSLVSSVLPAYLVARRELTEKPAQLLLPKPPVTGSSIWLEKWPA
                     IWSRLSFTHKVTARNIFRYKLRMLMTIFGVAGTVALLFGGLGIRSSISGVVQRQFGEL
                     IHYDMLVVENSRATEEELDKLTHFLQSDQVRQSLPVAFEQLNQTVEENGQRKNLSISL
                     YISDRRDFGNQVSLESSTGQPIKLSDRGIVLTEKLAQIYGVSVGDKLSLTLEDKEVSV
                     RVEAVADMYAGHFIYMTDSYYEQVTGKQKTANAYLVQLKDSQLGHIQTLASQLLAMPA
                     VRSLVQNTSLIDMLTTIAGSLQTIMTILVILSILLGLVILYNLTIINMSERIRELSTI
                     KVLGFHNREVTMYIYRETIALSLIGMLVGLVGGIYLHKLLLAMIGSDSIRFNPSVGLE
                     VYLIPILAISGILSVLGWYVNHHLRKVDMLVALKSVD"
     gene            643747..645072
                     /locus_tag="SSUBM407_RS03170"
                     /old_locus_tag="SSUBM407_0580"
     CDS             643747..645072
                     /locus_tag="SSUBM407_RS03170"
                     /old_locus_tag="SSUBM407_0580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012027321.1"
                     /translation="MCYNHLMKKISDLGLTGRKLVGEGLILVFIGIGFLIAGWQFPGL
                     ILRFVHAGLFFLALYELSMTFFRKKKSSESVIALVGKAVLFGILASLDLAVQIPLYFA
                     AIFVGIYQLFTALINFITFYLYRKDGVQPRIRYLIDGIWLFLLGSASLFVSGTQLVVQ
                     TIVIGGYLILYGLTNLRDGFLFEEAIEQQNLKRHVRLPLPLFLAALIPRMTLQKVNDY
                     LADNEGQTAQSIYNRHKEIAELPALEVFVHVGEEGFGAVGHVDLSYKGRVYGYGSYDV
                     LSERLGGAIGDGVLFKAERQAYIDFCNQEGMTMLGYQLSLRPEQEEAIETRLAEIDNL
                     LLPWNPSPEKVSKTVDGQPIEMYAYRMKEAIHAELFKFRKSKFKTYFVLSTNCVLLAD
                     SVIGQAGTDILGMHGFIAPGTYQSYLDQEFEKPHSLVVAKNIYYRKEKS"
     gene            645148..647784
                     /gene="polA"
                     /locus_tag="SSUBM407_RS03175"
                     /old_locus_tag="SSUBM407_0581"
     CDS             645148..647784
                     /gene="polA"
                     /locus_tag="SSUBM407_RS03175"
                     /old_locus_tag="SSUBM407_0581"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="WP_012027320.1"
                     /translation="MKKNKLLLIDGSSVAFRAFFALYNQIDRFKNANGLHTNAIYGFN
                     LMLDHMMKRIEPTHILVAFDAGKTTFRTEMYADYKAGRAKTPDEFREQFPFIRQMLDA
                     MGVKHYELDQYEADDIIGTLDKMAERTDIPFDVTIVSGDKDLIQLTDENTVVEISKKG
                     VAEFEEFTPAYLMEKMGISPTQFIDLKALMGDKSDNIPGVTKIGEKTGLKLLTEFGSL
                     DGIYENIDSMKASKMKENLIADKEKAFLSRTLATIDTQAPIEIGLDDIVYQGPKVDEL
                     GQFYDDMGFKQLRAQLGTTSSQEEAVLDFQIVTEISPAMLKQDQFFYFEILGENYHRE
                     DLVGLAWGDKEKIYVGGPELLDSPVLRDFLESQTIKTYDFKRGKVLLDRKEIKLPPAT
                     FDSRLAKYLLSTVEDNSLTTIANLYGQTSLVPDEAVYGKGAKLDLPEREIFFPHLARK
                     VQVLIETEEPMLTKLEENQQLDLLFDMELPLANVLAKMEIAGIKVEAETLKAMQSENE
                     VLIDQLTKEIYELAGQEFNINSPKQLGTILFEDMGLPLEYTKKTKTGYSTAVDVLERL
                     APIAPVVSKILEYRQITKLQSTYVVGLQDAILEDGKIHTRYVQDLTQTGRLSSTDPNL
                     QNIPVRLEQGRLIRKAFVPSLENSVLLASDYSQIELRVLAHISQDQHLIEAFQQGADI
                     HTSTAMRVFGIEKAEYVTPNDRRNAKAVNFGVVYGISDFGLSNNLGITRKEAKAYIDT
                     YFERFPGIKNYMETIVREARDKGYVETIYKRRRELPDINSRNFNVRNFAERTAINSPI
                     QGSAADILKVAMINLDKALTEAGLATRMLLQVHDEIVLEVPVAELETVKAMVKETMES
                     AISLSVPLIADENEGSTWYEAK"
     gene            647771..648553
                     /locus_tag="SSUBM407_RS03180"
                     /old_locus_tag="SSUBM407_0582"
     CDS             647771..648553
                     /locus_tag="SSUBM407_RS03180"
                     /old_locus_tag="SSUBM407_0582"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009910268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_012775221.1"
                     /translation="MKQSKKGKSMKKLILCIGLCSLLLAGCGKASQKTEKTPASSGEE
                     FSTTLPILQEKQDTTNEQFNVLANAEVVAVNSTPPADETQKGHKIYAANNGVAEKDEN
                     GNIKEYFRYYDVPSTWTINAENTKDETVAAVYDVKEGGSNYMVQIYNINAFNQSPLED
                     GRNMTPEELEARMVETNHSFSEKTVVTINGQEWQVGRQLLTDQKLARLTFYRMESTAA
                     YDDSVVVGSIYYSLDPGDDKKRTNLKKVIGQVKDVVYQIAKK"
     gene            648673..649110
                     /locus_tag="SSUBM407_RS03185"
                     /old_locus_tag="SSUBM407_0583"
     CDS             648673..649110
                     /locus_tag="SSUBM407_RS03185"
                     /old_locus_tag="SSUBM407_0583"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004298822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA-binding protein"
                     /protein_id="WP_012027318.1"
                     /translation="MSYSFQNPSQDIIFDYLKNAKTIAVVGLSSREETAAYRVSKLMQ
                     EAGYKIIPVNPKAAGGTILGELVYSSLAEIDQPIDIVDVFRRSEFLPEVAQEFIQSNA
                     KVFWAQLGLESQEAEKQLRQAGRNDIVMNKCIKIEYLEMKEQY"
     gene            complement(649406..650248)
                     /locus_tag="SSUBM407_RS03190"
                     /old_locus_tag="SSUBM407_0584"
     CDS             complement(649406..650248)
                     /locus_tag="SSUBM407_RS03190"
                     /old_locus_tag="SSUBM407_0584"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF975 family protein"
                     /protein_id="WP_012027317.1"
                     /translation="MFTISNIRERARQTLNETPGIYQVAVIPVTISVIVQLISFSRNS
                     LAGVSAEELASPSYFISTSLFPVFYGLLLGMLSLSVIWTIFNIIKGGKTTTSFKDSLS
                     IFNHKDFWKIFRTYILKSFLLFLWGLLFYLGIGLLIGAGTMITIIAASSQSLDPDALP
                     MEILAILGLMAMGGILLMVLGIALYIPQIYAYSQVEYILFEQLEREEYTGAFSIIKSS
                     RKLMKGYKFKRFTLDLSFIGWFLLVIITFGLAGLYVWPYHYAAQMHFHEEILDDQAKK
                     MSYV"
     gene            650568..651710
                     /gene="tgt"
                     /locus_tag="SSUBM407_RS03195"
                     /old_locus_tag="SSUBM407_0585"
     CDS             650568..651710
                     /gene="tgt"
                     /locus_tag="SSUBM407_RS03195"
                     /old_locus_tag="SSUBM407_0585"
                     /EC_number="2.4.2.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004298827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA guanosine(34) transglycosylase Tgt"
                     /protein_id="WP_012027316.1"
                     /translation="MTDVPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQAT
                     VKTMSPEELKAMGSGIILSNTYHLWLRPGDELVARAGGLHKFMNWDQPILTDSGGFQV
                     YSLADSRNISEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYD
                     YVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFPGYSI
                     GGLAVGETHDEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTR
                     IARNGTCMTNRGRLVVKNAQFAEDFTPLDPECDCYTCKNYTRAYLRHLLKADETFGIR
                     LTSYHNLYFLINLMKNVRQAIMDDNLLEFRQDFMEKYGYGKNGRNF"
     gene            complement(651749..652834)
                     /locus_tag="SSUBM407_RS03200"
                     /old_locus_tag="SSUBM407_0586"
     CDS             complement(651749..652834)
                     /locus_tag="SSUBM407_RS03200"
                     /old_locus_tag="SSUBM407_0586"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000040814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase P family protein"
                     /protein_id="WP_012027315.1"
                     /translation="MSKLHHVKSYLEANKMDLAIFSDPVSIYYLTGYHSDPHERHMML
                     FVMPDHDSLLFLPALDVERAVATVDFPVAGYMDSENPWQIIKSKLPQKSFSAICAEFD
                     NLNLTRYHGLQSIFSQPFSDITPLINTMKLIKSRDEIEKMLVAGEFADKAMQVGFNNI
                     SLDVTETDIIAQIEFEMKKQGISKMSFETMVLTGDNAANPHGIPSTNKIENNALLLFD
                     LGVEALGYTSDMTRTVAVGKPDQFKKDIYNLTLEAHMAAVNMIKPGVTAGEIDYAARS
                     VIEKAGYGEYFNHRLGHGLGMSVHEFPSIMEGNDLVIEEGMCFSVEPGIYIPGKVGVR
                     IEDCGYVTKNGFEVFTKTPKELLYFEG"
     gene            653044..654048
                     /gene="ccpA"
                     /locus_tag="SSUBM407_RS03205"
                     /old_locus_tag="SSUBM407_0587"
     CDS             653044..654048
                     /gene="ccpA"
                     /locus_tag="SSUBM407_RS03205"
                     /old_locus_tag="SSUBM407_0587"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catabolite control protein A"
                     /protein_id="WP_004298830.1"
                     /translation="MLNTDDTVTIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLE
                     VIDRLDYRPNAVARGLASKKTTTVGVVIPNIANAYFATLAKGIDDIADMYKYNIVLAN
                     SDENDEKEINVVNTLFSKQVDGIIFMGYHLTDKIRAEFSRSRTPIVLAGTVDLEHQLP
                     SVNIDYAAASVDAVNLLAKNNKKIAFVSGPLVDDINGKVRFAGYKQGLKDNGIEFNEG
                     LVFESKYKYEEGYALAERILNAGATAAYVAEDEIAAGLLNGVSDMGIKVPEDFEIITS
                     DDSLVTKFTRPNLTSINQPLYDIGAIAMRMLTKIMHKEELENREVVLNHGIKVRKSTK
                     "
     gene            complement(654482..656404)
                     /locus_tag="SSUBM407_RS03210"
                     /old_locus_tag="SSUBM407_0588"
     CDS             complement(654482..656404)
                     /locus_tag="SSUBM407_RS03210"
                     /old_locus_tag="SSUBM407_0588"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPXTG cell wall anchor domain-containing
                     protein"
                     /protein_id="WP_012775559.1"
                     /translation="MNTKKWRTSLLIPGIVLFGTVALVNNVSAQEVKNTIISAKQPDG
                     GQATSKAVNVKIPAVVRLFGRELLENEFKFELREANGEELPVLDTAQNTKEGQVRFKN
                     LSFDKPGKYWYTISEVKDELGGIEYDSKYIVAKITVEDRNGQLQAMIEFIDNDNVFNN
                     FYTPAPAAASLSIKKVLEGRTLNTGEFEFVLKNEKGDEIEKVSNQADGSVNFSALTFT
                     KEGTYTYTVSEVDGGLGDIIYDKSDIKATVTVKDNNHGQLVSTVTYENSDQIFENILN
                     PGKLIAPTTDSVITDNEVSKEAMTGKEKGNIEPPKEQIANEEKDNIEASEKQMPSIVN
                     DMVVTPEKQMTNKENDKVVISEKQMPSVVNENAVTPEKQMTNKENDNIETSEKQMPSV
                     VNENAVTPEKQMTNKEKDNIETSEKQMPSIVNDMVVTPQEQMANKENDKVVISEKQMP
                     SIVNDMVVTPQEQMANKENDKVVISEKQMPSIVNDMVVTPQEQMANKENDKVVISEKQ
                     MPSIVNDMVVTPQEQMANKENDKVETSEKQMPVNEKDNAVTPEKQMANKEKENIETSK
                     KQIPVNENNQNGTVEENSNTKPTTEKTDKQETSTFKTETAKQILPVTGEKGSLWLLTS
                     GIIGLAIALFTRKRKL"
     gene            656714..657712
                     /locus_tag="SSUBM407_RS03215"
                     /old_locus_tag="SSUBM407_0589"
     CDS             656714..657712
                     /locus_tag="SSUBM407_RS03215"
                     /old_locus_tag="SSUBM407_0589"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004182965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_012027312.1"
                     /translation="MKVLLYLEGKTVLEKSGIGRALQHQMEALDMAGIPYTTDLLGDY
                     DVIHINTYGPRSWLLLHAAKRSGKKVIMHGHSTKEDFQNSFIGSNTLAPFVGKYLASM
                     YQKADFVITPSEYSKKLIQSYGVTTPIIAVSNGIDLDKYKKDERKEAIFREHFKIEEG
                     QPVVVCAGLYFRRKGIEDFVKVAEKMPHVRFIWLGSINKWLIPSYIRKIVEGDHPANV
                     EFPGYFKGAVFQGAMSGANAFFFPSYEETEGIVVLEALASHQHVVLRDIPVYDGWIDE
                     NVAELGHTVDDFVDSIQKILDKQVDKREAGYQVAVSRSIDNVSHQLVDAYRQVLEM"
     gene            657713..659026
                     /locus_tag="SSUBM407_RS03220"
                     /old_locus_tag="SSUBM407_0590"
     CDS             657713..659026
                     /locus_tag="SSUBM407_RS03220"
                     /old_locus_tag="SSUBM407_0590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005590651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="WP_012027311.1"
                     /translation="MRIGLFTDTYFPQVSGVATSIRTLKTELEKLGHTVFIFTTTDED
                     VNRYEDWDIIRIPSVPFFAFKDRRVAYAGFTDALKIASRYKLDIIHTHTEFSLGILGK
                     MIAKELDIPVVHTYHTQYEDYVHYIAKGRIIRPGMVKYLVRAFLKDLDGVICPSEIVE
                     DLLMSYNVPISKRVIPTGIDLAKFDRPEIGKDETDELREQLGIASDETMLLSLSRISH
                     EKNIQAIVQAMPKILLENPKVKLVIVGGGPYTDDLQEMIAELNLDEHVQLTGMIAPSD
                     TALYYKAADFFISASTSETQGLTFLESLASGTPILAHSNPYLKNVITDKMFGTLFIRE
                     QELADAVVEAIVATPPMNPYVLDKKLYEISSTNFGRKVFEYYLDLKISYDFRKEHTNQ
                     DSVAEALIKEAIYLPQKVVVKSTDTTAKILKKSVEQVKSIRNFFE"
     gene            659041..659415
                     /locus_tag="SSUBM407_RS03225"
                     /old_locus_tag="SSUBM407_0591"
     CDS             659041..659415
                     /locus_tag="SSUBM407_RS03225"
                     /old_locus_tag="SSUBM407_0591"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012027310.1"
                     /translation="MEKLRKESWKNLVLATLIILSMYAGIYLIAFHLISDTMLSKELV
                     VGNILLYTPIVLFLTGLLYGFFHGFSPSLLVLVLLLYPVTIFFFKEWIILYQIVYTLC
                     ALIGNGIGALLFSLRKKMRKNP"
     gene            659674..659994
                     /locus_tag="SSUBM407_RS03230"
                     /old_locus_tag="SSUBM407_0592"
     CDS             659674..659994
                     /locus_tag="SSUBM407_RS03230"
                     /old_locus_tag="SSUBM407_0592"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000422773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MazG-like protein"
                     /protein_id="WP_012775219.1"
                     /translation="MLPDDLLRRCQDVRRAYRELEIKHHDKEWSIDEDLLALTNDIGN
                     MNRLIMTKQGRYYDETPYTLEHKMAENIWWLIELADRLDIDIQKEMETFLAQKEELLG
                     IKNK"
     gene            660008..661960
                     /gene="thrS"
                     /locus_tag="SSUBM407_RS03235"
                     /old_locus_tag="SSUBM407_0593"
     CDS             660008..661960
                     /gene="thrS"
                     /locus_tag="SSUBM407_RS03235"
                     /old_locus_tag="SSUBM407_0593"
                     /EC_number="6.1.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine--tRNA ligase"
                     /protein_id="WP_012775560.1"
                     /translation="MIKITFPDGAVREYQAGVTTFEIAESISKSLAKKALAGKFNGKL
                     IDTTRAIDEDGTLEIVMPDHDDALDILRHSAAHLFAQAARRLFSDIKLGVGPAIQDGF
                     YYDTDNAAGQISNEDLPRIQEEMMKIVKENFPSERREVTKEEALEIFKNDPYKLELIH
                     EHSDDEGGLTIYTQGEYVDLCRGPHVPSTGRIQIFELLNVAGAYWRGKSENPMMQRVY
                     GTAWFDKKDLKAYLQMREEAKERDHRKLGKELDLFMISQEVGQGLPFWLPNGATIRRT
                     LERYITDKELASGYQHVYTPPLASVELYKTSGHWEHYSEDMFPTMDMGDGEEFVLRPM
                     NCPHHIQVYKNHVRSYRELPVRIAELGMMHRYEKSGALTGLQRVREMTLNDGHIFVTP
                     EQIQEEFKKALQLIIDVYADFNLNDYRFRLSYRDPEDKEKYYDNDEMWENAQRMLKGA
                     MDEMGVDYFEAEGEAAFYGPKLDIQVKTALGNEETLSTIQLDFLLPERFGLTYIGADG
                     EEHRPVMIHRGVISTMERFTAILIETYKGAFPTWLAPTQVTMIPISVEAHLDYAWKVA
                     KELQDRGVRVHVDERNEKMQYKIRQSQTSKIPYQLIVGDKEMEDNAVNVRRYGSKATQ
                     TQSVSEFVDHILADIARKSRPAEAAE"
     gene            complement(662032..662691)
                     /locus_tag="SSUBM407_RS03240"
                     /old_locus_tag="SSUBM407_0594"
     CDS             complement(662032..662691)
                     /locus_tag="SSUBM407_RS03240"
                     /old_locus_tag="SSUBM407_0594"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009659320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_002935828.1"
                     /translation="MNYVLELLKPSTFQLLWSGLKLTLYISSISVILSILFGMILAIM
                     RNGKNPIFKWIATIYIEFVRNVPNLLWIFTVFLVFQMKSTPAGITAFTIFTTAAMAEI
                     IRGGLNAIGPGQTEAGLSQGFTPVQIMVYIIMPQAIRKMLPAIISQIVTVIKDTSFLY
                     SVIALQELFGSSQILMGRYFEAEQVFALYIMVALIYFSINFAISSLSRYVAKSWASSI
                     E"
     gene            complement(662706..663404)
                     /locus_tag="SSUBM407_RS03245"
                     /old_locus_tag="SSUBM407_0595"
     CDS             complement(662706..663404)
                     /locus_tag="SSUBM407_RS03245"
                     /old_locus_tag="SSUBM407_0595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_012028333.1"
                     /translation="MTVLTTSPYAWENWVSYFKDFPIFFQGFLFTLAISVGAFIMAMF
                     LGIVFGSLSSSKNKVLKIIARVYVEYYQNTPLLVQFMIVYYGLPLISNYVLMPSIYWT
                     AVICVGLYHGAYIAEVIRAGIEAVPTGQTEAALSQGFTQSETMRIIILPQAIPTILPP
                     LTNQVVNLIKNTATVAIISGADIMFMTKSWSAMNANYIPAFAGAAFLYFIMCFPVASW
                     GRRIEEKNKSAFSH"
     gene            complement(663419..664258)
                     /locus_tag="SSUBM407_RS03250"
                     /old_locus_tag="SSUBM407_0596"
     CDS             complement(663419..664258)
                     /locus_tag="SSUBM407_RS03250"
                     /old_locus_tag="SSUBM407_0596"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002916990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="WP_012027305.1"
                     /translation="MDKKKINIFFAIRLLVFGLILLVFAKQPVAQTETPASITNSDQV
                     QAIIDRGVLRVGVKQDVPNFGYKNPDTGEFEGMEIDIARKIADELGVDIEFTPVTAQT
                     RGPLLDNSQVDMVIATFTITEERKLLYNFTTPYYTDAVGFLVNKDSGIKTFTDLDGKT
                     IGVAQGSITRTLISELADKYGITVNFAELGSYPELSVSLRAHRTDAFSVDQSILAGYI
                     SSKSELMDFSFSASDYGIVTKLSNKDLNNYLNSLVEKWTADGSLQSIYDANGLKPVTE
                     TDE"
     gene            complement(664269..665030)
                     /locus_tag="SSUBM407_RS03255"
                     /old_locus_tag="SSUBM407_0597"
     CDS             complement(664269..665030)
                     /locus_tag="SSUBM407_RS03255"
                     /old_locus_tag="SSUBM407_0597"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_012027304.1"
                     /translation="MALVEFKDVNKYYGDYHALRNINLEFEPGQVVVLLGPSGSGKST
                     LIRTINGLEAIDEGTLIVNGHDISSTSIKELVSLRKEVGMVFQHFNLYPHKTVLENVT
                     LAPIKVLGINKATAEKTAQKYLEFVNLWDRKDSYPAMLSGGQKQRVAIARGLAMKPEL
                     LLFDEPTSALDPETIGDVLAVMQKLARDGMNMIVVTHEMGFAREVADRIIFMAEGEVL
                     VDTTDVNGFFDNPTEPRAQQFLSKIINHESDKVKL"
     gene            665224..665928
                     /locus_tag="SSUBM407_RS03260"
                     /old_locus_tag="SSUBM407_0598"
     CDS             665224..665928
                     /locus_tag="SSUBM407_RS03260"
                     /old_locus_tag="SSUBM407_0598"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005589489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_004298854.1"
                     /translation="MKKILIVDDEKPISDIIKFNMTREGYEVVTAFDGREALEVFEAE
                     FPDIVILDLMLPELDGLEVARTIRKTSNVPILMLSAKDSEFDKVIGLEIGADDYVTKP
                     FSNRELQARVKALLRRSELAETQTNIESTGTPELVIGDLVILPDAFVAKKHGKELELT
                     HREFELLHHLAKHLGQVMTREHLLETVWGYDYFGDVRTVDVTIRRLREKIEDTPSRPE
                     YILTRRGVGYFIKGND"
     gene            665921..667270
                     /gene="vicK"
                     /locus_tag="SSUBM407_RS03265"
                     /old_locus_tag="SSUBM407_0599"
     CDS             665921..667270
                     /gene="vicK"
                     /locus_tag="SSUBM407_RS03265"
                     /old_locus_tag="SSUBM407_0599"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018372260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall metabolism sensor histidine kinase
                     VicK"
                     /protein_id="WP_012027301.1"
                     /translation="MINQLRYLMTTAEFWFVVILIGFLIALTVLLIENYWDNKQIKQL
                     NQKVNALIEGNYADLLDMRGSPEITDMANSLNDLSEVIRLTHDNLEQEKTRLTSILSY
                     MSDGVIATDRIGRIIMINDMAQKQLGLSNPKQEQYHLLEVLDLSDRYTLRDLLAQTPE
                     IVIDHTNENEEFLTLRANFATIRSESGLISGLVVVLHDMTEQAKEERERRLFVSNVSH
                     ELRTPLTSVKSYLEALDEGALTESVAPSFVKVSLDETNRMMRMITDLLSLSRIDNQVG
                     QIDVELINFTAFVTFILNRFDQMKNADSDKVYTIVRDYQISPIWVEIDTDKMTQVLDN
                     ILNNAIKYSPDGGTITFSMKTTDSQLIVSVSDEGLGIPKADLPRIFDRFYRVDKARSR
                     AQGGTGLGLAIAKEIVKQHKGFIWAKSEYGHGSTFTIVLPYSKDIALDEWDDSDEEE"
     gene            667277..668080
                     /locus_tag="SSUBM407_RS03270"
                     /old_locus_tag="SSUBM407_0600"
     CDS             667277..668080
                     /locus_tag="SSUBM407_RS03270"
                     /old_locus_tag="SSUBM407_0600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018372259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_012027300.1"
                     /translation="MIGKGFNYSILASGSSGNCFYLETDKKKILVDAGLSGKKITSLL
                     AEIDRKPEDIDAILVTHEHSDHIHGIGVLARKYGMDIYANELTWQAMESKLGKIDVAQ
                     KHIFELGAMKTFGDLDIESFGVSHDAACPQFYRFMKDDKSFVMLTDTGYVSDRMVGIV
                     ENADAYLIESNHDIEILRAGSYSWNLKQRILSDKGHLCNEDGADAMIRSLGNRTKKIY
                     LGHLSKENNIKELAHMTMVNQLAQADLGVGVDFQVYDTSPDTATPLTKI"
     gene            668336..668608
                     /locus_tag="SSUBM407_RS03275"
     CDS             668336..668608
                     /locus_tag="SSUBM407_RS03275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014735627.1"
                     /translation="MEVIKCIRLEKEFAGRRGWAKSLTSLLRVRVNISAQWLIGRFVR
                     ASHSKSDLINCAGAGRRTLFILVEFFPAPKQLSLQASWSKGWFGWK"
     gene            668595..669137
                     /locus_tag="SSUBM407_RS03280"
                     /old_locus_tag="SSUBM407_0601"
     CDS             668595..669137
                     /locus_tag="SSUBM407_RS03280"
                     /old_locus_tag="SSUBM407_0601"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_012027299.1"
                     /translation="MVGNNGVGKSTFLKILLGLDRDFAGQIEVKADWAYVPQLQERSS
                     LSGGEQVWKSIQEAFAQRPQLLIMDEPTANLDQEHQEKLIKQIKRYRGSLLVVSHDRH
                     FLNQIASHIWHLEEEKVQVYLGNYEAFVESRRARREGQQESYEAYQKKVAQMKKAQHE
                     RQAKAQKMGKRGSGIEVNQL"
     gene            669300..670049
                     /locus_tag="SSUBM407_RS03285"
                     /old_locus_tag="SSUBM407_0602"
     CDS             669300..670049
                     /locus_tag="SSUBM407_RS03285"
                     /old_locus_tag="SSUBM407_0602"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-F family ATP-binding cassette
                     domain-containing protein"
                     /protein_id="WP_012027298.1"
                     /translation="MMGSYDSQAKSMAKTAKHLEKRIERLDKVEQPRKETWVKMEAKG
                     ALDTGLHSLFRLQAGQVLMDEVYLFDVPQIGMTFGEKLALVGANGSGKTSFVRKLFRK
                     ELAGYYNPKLKIAYFAQDLINLDEEKTAFENVSCTSLQDRMMILNLLGMLGLSCDKAQ
                     QKVANLSGGERVRLSLAKVLLADANLLILDEPTNFLDMAAIEVLETFLKEYEGSVPLI
                     SHDQQFVETSVHSQWEIVQACLVKKSQENIF"
     gene            670126..672201
                     /locus_tag="SSUBM407_RS03290"
                     /old_locus_tag="SSUBM407_0603"
     CDS             670126..672201
                     /locus_tag="SSUBM407_RS03290"
                     /old_locus_tag="SSUBM407_0603"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 2"
                     /protein_id="WP_012775443.1"
                     /translation="MKKRKNKPLEHDGNFISLRLNILFSIVIFLFLVLILRLADMQII
                     NHDFYSNKLSTASQKIISNGSIRGQIYDAQGKPLVENEIQQVVSFTRPNKMSAQEMKE
                     VANKLLQWVNVSDVTITQRDKADYYLADEEVYRQVVEALPKDKKYDSDGNYLSESTIY
                     SNAVDSIPAEALQYSEQDNKAIELFKQMNGATYFSTVNLVTDTLTSEQVAHIVANESQ
                     LPGISTTNNWQRTILPTSLSSIIGTVTSEQAGLPAEDAEYYLSKGYSSNDRVGTAYLE
                     KQYEEVLQGQREKKQINLDRNGNIESIETIQEGQQGNNIKLTIDLAFQDGVNAILRKY
                     FESELATGSALYSEGVYAVALNPSTGAVLAMSGYSHEKGSSTITEDALGTITSVFTPG
                     SIVKGATISSGWENGVISGNQIQLDEPIYFAGSAPITSWYGAYGSFNIDATEALEYSS
                     NIYMVKIALGLLGQTYSANMYLNDGDTLKNAMTKLRSTFAEYGLGASTGIDLPLESTG
                     FLPDKYTTANFITNAFGQFDNYTPMQMAQYAATIANNGTRISPHLVEGIYGNNAQGGL
                     GELIETVSGKEMNQVNISAEDMSLLRQGFYQVVNGSGRFNTGSAIGRGAAVTISAKTG
                     TAETYTTTASGDVVTAVNTNVVAYAPSDNPQIAVAVVLPNLTNQSSTTTKTITQEIIN
                     LYQSLHPMN"
     gene            672210..672806
                     /gene="recR"
                     /locus_tag="SSUBM407_RS03295"
                     /old_locus_tag="SSUBM407_0604"
     CDS             672210..672806
                     /gene="recR"
                     /locus_tag="SSUBM407_RS03295"
                     /old_locus_tag="SSUBM407_0604"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002896112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein RecR"
                     /protein_id="WP_012027296.1"
                     /translation="MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMEDDVVNEFA
                     KNLLAAKRDLSYCSICGNLTDQDPCAICQDSTRDQSTILIVEDSRDVTALENIQEYHG
                     LYHVLHGLISPMNGIGPDDINLKTLLTRLMENEVTEVIVATNATADGEATSMYISRVL
                     KPAGIKVTRLARGLAVGSDIEYADEVTLLRAIENRTEL"
     gene            672911..673957
                     /locus_tag="SSUBM407_RS03300"
                     /old_locus_tag="SSUBM407_0605"
     CDS             672911..673957
                     /locus_tag="SSUBM407_RS03300"
                     /old_locus_tag="SSUBM407_0605"
                     /EC_number="6.3.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015604540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--D-alanine ligase"
                     /protein_id="WP_012775216.1"
                     /translation="MSKETLILLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYFIS
                     QTGDFIKTQEFSQTPSADEKLMTNATIVEEQKIRPSDIYEEKAVVFPVLHGPMGEDGS
                     IQGFLEVLRMPYVGTNILSSSVAMDKITTKRVLESAGISQVPYVAVIEGENIDDKIAE
                     IEGKLTYPVFVKPANMGSSVGISKAEDLAGLRKALDLAFKYDSRVLVEQGVNAREIEV
                     GLLGNADVKTTLPGEVVKDVAFYDYDAKYIDNKITMEIPAKIDESIMDIMRDNAAKAF
                     RAIGGCGLSRCDFFLTEDGDIFLNELNTMPGFTQWSMYPLLWDNMGLAYPDLIEELVR
                     LAKEMFEKRESHLI"
     gene            674045..674425
                     /locus_tag="SSUBM407_RS03305"
                     /old_locus_tag="SSUBM407_0606"
     CDS             674045..674425
                     /locus_tag="SSUBM407_RS03305"
                     /old_locus_tag="SSUBM407_0606"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC family protein"
                     /protein_id="WP_012775215.1"
                     /translation="MYQTTVKGEGLFQALSQGYGESVRTFGVTEKGETPVSLVNIGLA
                     ACITMCVQGYYASQEGNKTMPVQVESRLDNQRFEVLIGIGESVSAQKQKEILAYVEKK
                     CKVKALLREDLQFETSFYVLESVE"
     gene            674554..675915
                     /locus_tag="SSUBM407_RS03310"
                     /old_locus_tag="SSUBM407_0607"
     CDS             674554..675915
                     /locus_tag="SSUBM407_RS03310"
                     /old_locus_tag="SSUBM407_0607"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-
                     alanine ligase"
                     /protein_id="WP_012775214.1"
                     /translation="MKLTLHEVAQVLGAKNDISLYTDTAFNKVEFDSRLVTTGDLFVP
                     LKGARDGHDFIPVAFENGCVVTLSEVSLDVPHILVEDCLAALQQLAAYYLEKTGVEVI
                     AVTGSNGKTTTKDMIHDVLATTYKTYKTQGNYNNEIGLPYTVLHMPDDTEKLVLEMGQ
                     DHLGDIHLLSEIAKPSLSVITLFGEAHLEFFGSREEIAKGKLQIADGMEPGSKLLIPA
                     DPIADKLLPSHVDLIRFGEQADLQVTSLVESKDSLTFTVNFMDGDIFLPVTGKYNATN
                     AMVASYVGKTLGVPDEAIKSALASLNLTRNRTEWKKAANGADILSDVYNANPTAMRLI
                     LETFTSIPANEGGKKIAVLADMKELGSQSVDLHNQMILSLSPDVLDTVIFYGQDIEGL
                     AQLASQMFPIGKVYFFRKNAEQDQFEDLVKQVRESLGKEDQILFKGSNSMNLGKVVEA
                     IEK"
     gene            676006..676704
                     /locus_tag="SSUBM407_RS03315"
                     /old_locus_tag="SSUBM407_0608"
     CDS             676006..676704
                     /locus_tag="SSUBM407_RS03315"
                     /old_locus_tag="SSUBM407_0608"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004298877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR02206 family membrane protein"
                     /protein_id="WP_012775213.1"
                     /translation="MSDFFSNQISEAPNLNVLEHLFLMIIWFFMLHLCFRCYQKRWFH
                     IVFWWLQFIQIVSLYTWYIVADSPLSESLPFYHCRLAMLFILWAKPGPLKRYFAYLGL
                     FGSLAAFIHPVFDPFAFPHLTFFTFVIGHYALTVNCMLYLLSDLEGEMLKGKEVVKYT
                     LIMNMLILGVALLTGGNYGFLRQAPLVNTNNLPLNFFLVTCLLCFSILSIQAMLIAYL
                     KKESKQMNSHILKK"
     gene            complement(676735..679071)
                     /locus_tag="SSUBM407_RS03320"
                     /old_locus_tag="SSUBM407_0609"
     CDS             complement(676735..679071)
                     /locus_tag="SSUBM407_RS03320"
                     /old_locus_tag="SSUBM407_0609"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004298878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation-translocating P-type ATPase"
                     /protein_id="WP_012775561.1"
                     /translation="MNKQIKGLSTKEVQERIQNQQTNHFKTKTSASNWEIFRRNVFTS
                     FNALNFAIFLALLAVQAWSNLFFFGVIVLNAVSGMLTEWRARRMIDKLNLMNKDFIRV
                     VRDSETISIAPEDIVLDDVLLLSAGEQVPSDAIVLEGIAETNEAMLTGESDLIVKNTG
                     AELLSGSYLVSGQIYAKVIHVGAENYANKLMLEAKTHKPIVSRILYNMDKIAKFTGKI
                     IIPFGLALFLEAFFIKILPLKDSVITSSTALLGMLPKGIALLTITSLLTAVIKLGMKN
                     VLVQEMYSVETLARVDVLCLDKTGTITQGKMTVENLLPLTNHYSLDTIQQILATYIQT
                     SEDTNSTAQAIRKEYGDLEHHYKASHIIPFSSDRKWGAMTIENIGHIFLGAPEMLLTQ
                     NPPSVSEAQARGSRVLILALSQQSLLSSQNQLPENIEPLALLEIADPIREDAAETLAY
                     LRSQEVTLKIISGDNPVTVSHIAREAGFADYDSYIDCSKVDDEELIARAETTAIFGRV
                     SPHQKKLLIQTLKAQGHTTAMTGDGVNDILALREADCSIVMAEGDPATRQIANLVLLD
                     SEFRDIPEILFEGRRVVNNISHIAPIFLIKTIYSFLLGLICSASIALGKAEYLLVFPF
                     IQVQMTLIGQFVEGFPPFILTFERNIRPVEKHFLRKSLLLALPNALMVVLSVLIFHLM
                     QVFGYLNLHDMQTLSYYVLGSTGLLAVIRACLPLTKARLALIIYSVFGFFISSHFLHG
                     LIEIHPLNSHTLPIYSGLMLIFIPVFFWISYKQGAFKN"
     gene            679308..680852
                     /locus_tag="SSUBM407_RS03325"
                     /old_locus_tag="SSUBM407_0610"
     CDS             679308..680852
                     /locus_tag="SSUBM407_RS03325"
                     /old_locus_tag="SSUBM407_0610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011681503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="WP_012028326.1"
                     /translation="MSLQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVK
                     GKKTGNFAKSDWMDIEKQRGISVTSSVMQFDYAGKRVNILDTPGHEDFSEDTYRTLMA
                     VDAAVMVVDSAKGIEAQTKKLFEVVKHRNIPVFTFINKLDRDGREPLDLLQELEEVLG
                     IASYPMNWPIGMGKSFEGLYDLHNKRLELYRGDERFASLDEGDKLFGSNPFYAQVLDD
                     IELLAEAGNEFSEQAILDGDLTPVFFGSALTNFGVQTFLDTFLEFAPEPHGHKTTTGD
                     VIDPLNKDFSGFVFKIQANMDPRHRDRIAFVRVVSGEFERGMAVNLPRTGKGAKLSNV
                     TQFMAESRENVENAVAGDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVS
                     AKNVMKQKSFHKGIEQLVQEGAIQLYKNYQTGEYMLGAVGQLQFEVFKHRMEGEYNAE
                     VVMAPMGKKTVRWIKPEDLDERMSSSRNILAKDRFDQPVFLFENDFALRWFADKYPDV
                     ELEEKM"
     repeat_region   complement(681129..682516)
                     /note="IS element, novel IS"
     gene            complement(681150..682406)
                     /locus_tag="SSUBM407_RS03330"
                     /old_locus_tag="SSUBM407_0611"
     CDS             complement(681150..682406)
                     /locus_tag="SSUBM407_RS03330"
                     /old_locus_tag="SSUBM407_0611"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012677188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ISL3 family transposase"
                     /protein_id="WP_012775212.1"
                     /translation="MEQLNLITNFLRIKDKNITITDEYDMGTHLELHGYLDYMAPKCP
                     ECKGQMAKYDYQKASKIPYLETAGYPLLIRLKKRRFKCKECGKMAGAETPLVKKNHQI
                     SVAVSQKIAQLLIENQAMTHIAHRLSISTSSVMRKLNEFKFETDWNTLPEVMSWDEYA
                     FKKGKMSFIAQDFDSLNVIAILDGRTQATIRNHFLRYPRKVRNQVKVITMDMFSPYYQ
                     LAKQLFPNAKIVLDRFHIVQHLGRAMNRVRIQIMNQFDRTSQEYRALKRYWKLIQQDS
                     RKLSDKRFYPPMFRMHLTNKEILEKLLSFSEELRQHYELYQLLLFHFQEKNSDHFFDI
                     VELEIATVNPIFQTVFKTFLKDKDKVLNALELPYSNAKLEATNNLIKVIKRNAFGFRN
                     FENFKKRILIALNIKKERTKFVLSRC"
     gene            complement(682535..683338)
                     /locus_tag="SSUBM407_RS03335"
                     /old_locus_tag="SSUBM407_0612"
     CDS             complement(682535..683338)
                     /locus_tag="SSUBM407_RS03335"
                     /old_locus_tag="SSUBM407_0612"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018372352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_012027287.1"
                     /translation="MKKILVLALASSILLTACTNNSTANSSSSTASSSSPSSTTTADT
                     TASSQYAKDLAYAINNPKATFPQLSNEIGENEAAIKIKTTEGDITIKLFPEQAPLTVE
                     NFLTHAKEGYYNGTIFHRVIKDFMIQGGDPLGNGTGGESIWAGKDTTIDAGNGFKDEI
                     SAFLYNIRGSLSMANAGAGTNGSQFFINQNTTDMSSQLSSSSYPGKIIDAYKNGGNPN
                     LDGKHTVFGQVIEGMDIVDKIASVETDNSDKPKTDVKIESIEILKDYTF"
     gene            683481..683834
                     /locus_tag="SSUBM407_RS03340"
                     /old_locus_tag="SSUBM407_0613"
     CDS             683481..683834
                     /locus_tag="SSUBM407_RS03340"
                     /old_locus_tag="SSUBM407_0613"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002935873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2500 domain-containing protein"
                     /protein_id="WP_012775211.1"
                     /translation="MFENLFDPDGSLVWHTALFYSFSAIILATVCFHIIKNFMEWHHN
                     NRAPKESCKAKLVSKRTHVFGNEVARTNYYVTFEWEGKRQEFRLRSDEYALLAERDVG
                     TLHFQGTRFLGFERL"
     gene            683919..684295
                     /locus_tag="SSUBM407_RS03345"
                     /old_locus_tag="SSUBM407_0614"
                     /pseudo
     CDS             683919..684295
                     /locus_tag="SSUBM407_RS03345"
                     /old_locus_tag="SSUBM407_0614"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000625774.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
     gene            684296..684841
                     /locus_tag="SSUBM407_RS03350"
                     /old_locus_tag="SSUBM407_0615"
     CDS             684296..684841
                     /locus_tag="SSUBM407_RS03350"
                     /old_locus_tag="SSUBM407_0615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013730254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012028325.1"
                     /translation="MSLQNRVEEMYKDHEVKPYISPERDLAAWLLEAKPVPKRNMVRL
                     EEGILPGDIILLWRISLGSFESTTPYSKYFEYMYGINGPAHMEQLIADGYAYVESAFD
                     SLDHITSTAKKNILKAEGVTGLSKMKAADLDTALKDNLTEEKLAPYFTVRGYALTEKG
                     RAALDNHPEVLAKHPMKKMYK"
     gene            684998..685987
                     /locus_tag="SSUBM407_RS03355"
                     /old_locus_tag="SSUBM407_0616"
     CDS             684998..685987
                     /locus_tag="SSUBM407_RS03355"
                     /old_locus_tag="SSUBM407_0616"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_012027284.1"
                     /translation="MEEQKSITMKDVARVAGVSVGTVSRVINNEPGIKESTLEKVNAA
                     IKELNYIPDVYARGMKKNKTETIALIIPTVWHPFFGEFAYHVEVELSKKNYKLLLCNI
                     SGPKRELDYLTMLQQNKVDGIIAITYSPIEDYLSSNIPFVSIDRTYENKAIPCVSSDN
                     RAGAELAANTLIAKGGRHFAFIGGHNKTINETKKRRLYFEKRILEAGFPCHVLDLEEP
                     YDDFVGQVEEFLINNPQVDAIFTINDFTALDTLAVLEKLRRRVPEDVQVIGYDGIQLA
                     SEKSLALSTIRQPLESMAQEAVACLIDIIEKRERPLQVTLPISYLEGKTTKNF"
     gene            686092..687012
                     /locus_tag="SSUBM407_RS03360"
                     /old_locus_tag="SSUBM407_0617"
     CDS             686092..687012
                     /locus_tag="SSUBM407_RS03360"
                     /old_locus_tag="SSUBM407_0617"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_012775210.1"
                     /translation="MKTSKLQQASLFDRIKQQKLLLLMLLPGLVLTFIFRYIPMYGVL
                     IAFKDYNPLKGVLGSEWIGFEEFTKFLSSPNFGTLLANTLKLSVYGLLLGFLLPIILA
                     IMLNQLLSDKAKKRIQLVLYAPNFISVVVIVGMIFLFFSVGGPVNSILGMFGIEANFL
                     TDPDFFRPLYILSGIWQGMGWASTLYTATLINVDPALIEAAKLDGANIFQRIWHIDLP
                     ALKPVMVIQFILAAGGIMNVGYEKAFLMQTSLNLTSSEIISTYVYKIGLVSGDYSYST
                     AVGLFNALINIILLIAVNKIVKRINDGQGL"
     gene            687022..687909
                     /locus_tag="SSUBM407_RS03365"
                     /old_locus_tag="SSUBM407_0618"
     CDS             687022..687909
                     /locus_tag="SSUBM407_RS03365"
                     /old_locus_tag="SSUBM407_0618"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018165023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="WP_012027282.1"
                     /translation="MNTQMYTKFDKRMLVVNKILLAFLVLITVVPMVYILVASFMDPQ
                     ALLSKGISFDPKDWTVEGYQRVFSDKSILRGFFNSLFYSFSFAFVTVAISVMTAYPLS
                     KKDLVGKKWINAFLVFTMFFGGGLVPTYLLVKDLGMLNTVWAIIIPGAVNVWNIILAR
                     TYFQGLPDELVEAAVMDGANEFQIFWKIMIPLAKPIMFVLFLYAFVGQWNSYFDAMIY
                     IKDPDLEPLQLVLRKILIQSEPAKDMIGAQAAMNEMKRIAEMIKYATIVISSLPLIVM
                     YPFFQKYFDKGIMAGSLKG"
     gene            687956..689566
                     /locus_tag="SSUBM407_RS03370"
                     /old_locus_tag="SSUBM407_0619"
     CDS             687956..689566
                     /locus_tag="SSUBM407_RS03370"
                     /old_locus_tag="SSUBM407_0619"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012775562.1"
                     /translation="MKHTFGKTVVTLLASTVLLAACGSKNTASSPDYELKDVQFPLEK
                     SVTLKFMTASSPLAPADSNEKLIFKRLEEETGVHIDWTNYQSDFGEKRNLDIASGDLP
                     DAIHNDGASDVELMNWAKQGVIVPVEDLIDKHMPNLKKILDENPEYRSMITAPDGHIY
                     SFPWIEELGEGKESIHTVNDIAWINKEWLDKLGLDMPKTTDDLIKVLEAFKTQDPNGN
                     GKADEIPMGFINGGGNEDFKILFGAFGVGDNDDHLVVNNDGTVDFTADNEDYKEGVEF
                     MRTLQEKGLLDSEAFEQDWNTYIAKGSENLYGVYFTWDKANITGMNDTYDILPVLAGP
                     DGTKHITRTNGMGFQRDRMVITSANKNLELTAKWIDAQYKPIQSVQNNWGTYGDETQQ
                     NIFELDTATNSLKHLPLEGTAPGELRQKTEVGGPLAILDEYYGTVTTMPDDAKWRLDL
                     MHATYLDYVTNDDIYPRVFMEQEDLDKIAQVEADMNDFIYRKRAEWIVNGGIEEEWDS
                     YLKELESYGLSDWLAIKQKYYDQYKENQ"
     gene            689584..690942
                     /locus_tag="SSUBM407_RS03375"
                     /old_locus_tag="SSUBM407_0620"
     CDS             689584..690942
                     /locus_tag="SSUBM407_RS03375"
                     /old_locus_tag="SSUBM407_0620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012028321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 32 protein"
                     /protein_id="WP_012028321.1"
                     /translation="MKTVVEANQFIQKEKGNVNPIFKPQAHLTPETGWMNDPNGFIYF
                     RGEYHLFYQFNPYESVWGPMHWGHAKSKDLVNWEQLPVDLAPDKAYDKDGCFSGSAIV
                     KDDVLWLMYTGHIVNEDGTVSQVQNMAFSTDGIHFEKIEQNPVATADGLPEEVIANDF
                     RDPKIFEKDGHYYSVVATKHKDNVGCIVLLSSPNLTDWKFESIFLKGEANQGFVWECP
                     DYFEVDGQEYLIISPMRYQKDGNDFININSNIFVTGHVDWDKKVFVAESFKEIDHGHD
                     FYAAQTTEGPEGERVMIAWMHTWGRPLVTNDLGHKWYGQMTLPRLLKQGENGLRQVLP
                     AGILNSFDDIEIGQVIQGPSKLSLKLDDSLDLKLGTDRDYLQFGYDKAKQEVYIDRSH
                     LKIQQVGEEEWSTVRRAVTVQATELEVLVDTNCLEIFINDGQETLTSTFYVEGQIILN
                     AL"
     gene            691068..693437
                     /locus_tag="SSUBM407_RS03380"
                     /old_locus_tag="SSUBM407_0621"
     CDS             691068..693437
                     /locus_tag="SSUBM407_RS03380"
                     /old_locus_tag="SSUBM407_0621"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA translocase FtsK"
                     /protein_id="WP_012027278.1"
                     /translation="MRKTSKKGKATRRPTKAELAQQERVKNITLRVLGLLFIAFAASR
                     LGVFGVTSYNIFRLLFGSLAYLLLVGAFIYLLIPKVLREREGTISGFWLIVIGLLIEF
                     QAYLDWTYQGSDLFGHTLKLALSDLAKFQVTAFLGGGMIGSIFYLPVSFLFANVGSFF
                     IGLLVIAFGIFFVSPWSVYDVADGLAVAKDKLVETQVKRAELRTQKKAEREEKRQQEL
                     ARLEEERLRLEEEEESARALALVDRHVNLETGEILEEEPVQVPIISEYDHLDIEDEFP
                     IMLAEDDQPAQSNSASQDSETNEFEKDETDVQIDFKPKQRLAYKLPSIDLFAPIKAKS
                     QSNEKRIVRQNIKVLEDTFASFGIKVVVERAEIGPSVTKYEVKPAVGVRVNRISNLAD
                     DLALALAAKDVRIEAPIPGKSLVGIEVPNSEVATVPFRELWEQSKTDPDKLLEIPLGK
                     AVNGSVRSFNLARMPHLLVAGSTGSGKSVAVNGIISSILMKAGPDQVKFMMIDPKMVE
                     LSVYNDIPHLLIPVVTNPRKAARALQKVVDEMEKRYELFSQIGVRNLEGYNAKVEEFN
                     SRSEEKQIPLPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMILATQRPSV
                     DVISGLIKANVPSRIAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENHPVRLQG
                     SFISDDDVEAIVGFIKDQADADYDESFDPGEVAEGDGDAGFGDAGGDPLFNEARALVV
                     ETQKASASMIQRRLSVGFNRATRLMEELEAAGVIGPAEGTKPRKVLETQ"
     gene            693437..693823
                     /locus_tag="SSUBM407_RS03385"
                     /old_locus_tag="SSUBM407_0622"
     CDS             693437..693823
                     /locus_tag="SSUBM407_RS03385"
                     /old_locus_tag="SSUBM407_0622"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002931159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_012027277.1"
                     /translation="MKFDAVHHIAIIGSDYGKTREFYVEKLGFEQVDEHIRPEKNDIL
                     FNVKKGNLILEIFIKPDAPMRPAMPNPEHTGLRHLAFQVADVEACLEEFDRLDIRHEV
                     LRTDDFDGKKMAFFFDPDGLPLEIHE"
     gene            complement(694191..694547)
                     /locus_tag="SSUBM407_RS03390"
                     /old_locus_tag="SSUBM407_0623"
     CDS             complement(694191..694547)
                     /locus_tag="SSUBM407_RS03390"
                     /old_locus_tag="SSUBM407_0623"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008809396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3397 family protein"
                     /protein_id="WP_162838045.1"
                     /translation="MIFLKIVAFLFIFLTLAISIIAVKFFRLQNRGWNFADIAFPLYA
                     IEFYLISDKAYYNSLLPQLVLALSLLAIGLCGFFLLKKKNFLYRRFFKVFWRASFILT
                     FLMYLALVIAVFTLKS"
     gene            694714..695139
                     /gene="rplK"
                     /locus_tag="SSUBM407_RS03395"
                     /old_locus_tag="SSUBM407_0624"
     CDS             694714..695139
                     /gene="rplK"
                     /locus_tag="SSUBM407_RS03395"
                     /old_locus_tag="SSUBM407_0624"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004226069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_002935890.1"
                     /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNA
                     RTADQAGMIIPVVISVYEDKSFTFITKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTR
                     AQVQEIAETKMPDLNAASLEAAMRMIEGTARSMGFTVTD"
     gene            695180..695869
                     /gene="rplA"
                     /locus_tag="SSUBM407_RS03400"
                     /old_locus_tag="SSUBM407_0625"
     CDS             695180..695869
                     /gene="rplA"
                     /locus_tag="SSUBM407_RS03400"
                     /old_locus_tag="SSUBM407_0625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_004194879.1"
                     /translation="MAKKSKNLRAALEKIDSTKLYSVEEAVALAKETNFAKFDASVEV
                     AYNLNIDVRKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVA
                     KINGGWLDFDVVIATPDMMAVVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGK
                     ITYRADKAGIVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMTSVSITTTQ
                     GVGIKVDPNSL"
     gene            695976..696266
                     /locus_tag="SSUBM407_RS03405"
                     /old_locus_tag="SSUBM407_0626"
     CDS             695976..696266
                     /locus_tag="SSUBM407_RS03405"
                     /old_locus_tag="SSUBM407_0626"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775208.1"
                     /translation="MKVAEKEELYKYLSAAYNLPQEAFSEALREKILEVAGQLDKEEN
                     LYILAGHLSRFINAELTALTCRAPKELVQLAHYLQEVQNHYRYASLFPGKVK"
     gene            696275..697063
                     /gene="yghU"
                     /locus_tag="SSUBM407_RS03410"
                     /old_locus_tag="SSUBM407_0627"
     CDS             696275..697063
                     /gene="yghU"
                     /locus_tag="SSUBM407_RS03410"
                     /old_locus_tag="SSUBM407_0627"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012028317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-dependent disulfide-bond
                     oxidoreductase"
                     /protein_id="WP_012028317.1"
                     /translation="MTEYTKPLVWKWEDENDNRSGNRPTAGSRFEQDLPRGEKSFQVY
                     SLGTPNGIKVAIMLEELKELGISEADYDLFLINIGQGDQFGSDFVAINPNSKIPAMVD
                     YSEQEPISVFESANILLYLAEKFEAFLPKAWAERTEVLNWLFWQTGAAPFVGGGFGHF
                     FHYAPTAQEYPINRYTMETKRQLDLLDQLLATREYIAGNTYTIADIAIWSWYGRLVQG
                     ELYPGSAEFLDVDSYKHLKTWVDKIAQLPAVQRGLTVKYHSIDN"
     gene            697213..698853
                     /locus_tag="SSUBM407_RS03415"
                     /old_locus_tag="SSUBM407_0628"
     CDS             697213..698853
                     /locus_tag="SSUBM407_RS03415"
                     /old_locus_tag="SSUBM407_0628"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="WP_012027272.1"
                     /translation="MSEKVEMQQSKEQATMARGLAWLTAGNILSRLLGVAYVIPWYIW
                     LGEYRAEANALFSMGYQIYANFLLISTAGLPTAIAKQVAKYNVLGKEEVSLYLVREFF
                     KLMLVFGAVFAGVMYLSAPWLADASGSKEKLLPVMYSLVPPLFIFPAMSILRGFFQGR
                     HDMKPYAISQLAEQLVRVIWILAATFMIMKLGSGDYLEAVVQSTFAAFVGMIASVGIL
                     VYTLWKQGYLGKLLHAKKQKISLDTGQLIKETVRDAIPIIILGLTIQLLQFIDQVTFI
                     RVMERITDYSNSELLELYSYMAANPSKITMMIIGISLSLGSVAIPLITEKFVKKDLKA
                     ASHLVADNLQLLFIFTIPAIVGTVLLAGPLYTIFYGPSEPIAITLFIWNLFLILPLGL
                     YSVISVVIQAIFENRRAIYYFLIGMLVKIVLQVPMIYVFKVYGSFISTIFGLGIMLYL
                     FYRRIDKVLHIDERLVIKDIATISWISIVMGLVVWGIEFVLNLILPANGYVSSFIHLA
                     VAGGAGMLVFVILTLKTRQLDRLIGSRAQSLRRKLRLG"
     gene            699020..699754
                     /locus_tag="SSUBM407_RS03420"
                     /old_locus_tag="SSUBM407_0629"
     CDS             699020..699754
                     /locus_tag="SSUBM407_RS03420"
                     /old_locus_tag="SSUBM407_0629"
                     /EC_number="2.7.4.22"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015445263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UMP kinase"
                     /protein_id="WP_044475455.1"
                     /translation="MMKPKYERILIKLSGEALAGERGVGIDLKTVQEMAKEIQEVAES
                     GIQIALVIGGGNLWRGAPAAEAGMDRVQADYTGMLGTVMNALVMADSLKQLGVDTRVQ
                     TAIAMQSVAEPYIRGRALRHLEKGRIVIFGAGIGSPYFSTDTTAALRAAEIEADAILM
                     AKNGVDGVYNADPKKDANAVKFNELTHREVISRGLKIMDATASTLSMDNDIDLVVFNM
                     NEPGNIKRVVFGEPIGTTVSNSSEEK"
     gene            699889..700446
                     /gene="frr"
                     /locus_tag="SSUBM407_RS03425"
                     /old_locus_tag="SSUBM407_0630"
     CDS             699889..700446
                     /gene="frr"
                     /locus_tag="SSUBM407_RS03425"
                     /old_locus_tag="SSUBM407_0630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006148672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome recycling factor"
                     /protein_id="WP_009910199.1"
                     /translation="MSKEIIAKAQERMNQSHQSLAREFSHIRAGRANASLLDRISVEY
                     YGSPTPLNQLAGITVPEARVLLITPFDKSILKDIERALNASDLGLTPQSDGTVIRLVI
                     PALTEETRKNLAKDVKKVGENSKVAIRNIRRDAMDEAKKAEKAKEITEDELKTLEKDI
                     QKVTDDAIKTIDKMTADKEKELLEV"
     gene            700578..701432
                     /gene="cvfB"
                     /locus_tag="SSUBM407_RS03430"
                     /old_locus_tag="SSUBM407_0631"
     CDS             700578..701432
                     /gene="cvfB"
                     /locus_tag="SSUBM407_RS03430"
                     /old_locus_tag="SSUBM407_0631"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002897151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding virulence regulatory protein CvfB"
                     /protein_id="WP_012775207.1"
                     /translation="MNDLLAQYIVGLVTDENDQFYFVQKEGRTFALSKDEGEHSLGQS
                     VKGFAYTDMKQKLRLTTKEVGASRTSFGWGTVTEVRKDLGVFVDTGLPDKQVVVSLDI
                     LPEIKELWPKKGDRLYVKLDVDKKDRIWALPAFQEDFQKMAGPAYDNMQNQNLRAIVY
                     RLKMNGTFVYLPDNNMLGFIHPSERFAEPRLGQVLEARVIGYRAVDRTLNLSLKPRSF
                     EMLENDAQMILTYLESNGGFMTLNDKSAPEDIKATFGISKGQFKKALGGLMKAGKIKQ
                     DSFGTELV"
     gene            701442..702362
                     /locus_tag="SSUBM407_RS03435"
                     /old_locus_tag="SSUBM407_0632"
     CDS             701442..702362
                     /locus_tag="SSUBM407_RS03435"
                     /old_locus_tag="SSUBM407_0632"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003083322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="WP_012027269.1"
                     /translation="MLVYIAGSGAMGCRFGYQLSKTNHEVILLDNWEEHIEAIRENGL
                     KVTGDVEETVYLPIMKPTEATREADFIILLTKADQLPKMLRDIKPIIGPTTKVLSLLN
                     GLGHATTMRRYVPDESIMVGVTMWLAGLKGPGHAHLEGPGSMSVQHILGDEQSVADII
                     EMLNEAGLNVTYDNHVVSAIWQKACVNGVMNPTCTILDCTIGELFGTEAGLNLVQGIF
                     KEFIAVAKSEADGIDEEAIWKYVIDASKKASNHYPSMHQDLVQHGRKTEIDYLNGAVV
                     FKGKRAGISTPYCQMITDMIHAKESMLGLR"
     gene            702372..702827
                     /locus_tag="SSUBM407_RS03440"
                     /old_locus_tag="SSUBM407_0633"
     CDS             702372..702827
                     /locus_tag="SSUBM407_RS03440"
                     /old_locus_tag="SSUBM407_0633"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1801 domain-containing protein"
                     /protein_id="WP_012027268.1"
                     /translation="MLIEVETIEEYLAALPENRKEVVERLHQVIVEQLPAGFEVGILG
                     GMINYYVPLAAYPDGYHCTPGEPLPFLALASQKAHIALYHMGIYMDQELNDWFVAAYQ
                     AQVPTKLDMGKSCVRMKNPKNIPYELIGELVSKMSMERYIELYEKNHRK"
     gene            702833..703048
                     /locus_tag="SSUBM407_RS03445"
                     /old_locus_tag="SSUBM407_0634"
     CDS             702833..703048
                     /locus_tag="SSUBM407_RS03445"
                     /old_locus_tag="SSUBM407_0634"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018364270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YozE family protein"
                     /protein_id="WP_009910192.1"
                     /translation="MRRSFYSWLMTQRNPKSNEPVAILADYAFDESDFPKQSDNFDEV
                     SRFLEESASFAFSMSDFDAIWEDYLGH"
     gene            703127..704149
                     /gene="phoH"
                     /locus_tag="SSUBM407_RS03450"
                     /old_locus_tag="SSUBM407_0635"
     CDS             703127..704149
                     /gene="phoH"
                     /locus_tag="SSUBM407_RS03450"
                     /old_locus_tag="SSUBM407_0635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoH family protein"
                     /protein_id="WP_009910187.1"
                     /translation="MLEHSIDIQLKHPDDSFSLFGSNERHLRLMEQELGVVIHARTEK
                     VQVIGQEEHVEQARLVIQSLLVLVSRGLVINTPDVVTAISMAKNDEIEKFVALYEEEI
                     IKDNYGKPIRVKTLGQKLYVDSVKRHDIVFGIGPAGTGKTFLAVTLAVTALKRGQVKR
                     IVLTRPAVEAGESLGFLPGDLKEKVDPYLRPVYDALYQILGKEQTTRLMEREIIEIAP
                     LAYMRGRTLEDAFVILDEAQNTTIMQMKMFLTRLGFNSKMIVNGDISQIDLPRKVKSG
                     LIDATEKLSKIPQIDFVHFSAKDVVRHPVVAQIINAYEQEALAADGRASFETIGEPSR
                     KYNGEE"
     gene            complement(704819..705967)
                     /locus_tag="SSUBM407_RS03455"
                     /old_locus_tag="SSUBM407_0638"
     CDS             complement(704819..705967)
                     /locus_tag="SSUBM407_RS03455"
                     /old_locus_tag="SSUBM407_0638"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin-independent methionine synthase II
                     family protein"
                     /protein_id="WP_012027267.1"
                     /translation="MTTSRFQLVGSLLRPANLGEFKRQIEAREDIKYPFYDDFDGYKE
                     TEASLIQKIVAEQKENGLDIVTDGEFGRSMWHLDFLWGFDGIERYIAEHGYPFKDHDG
                     QIFETRKDIGLRITAPLSAKNHHFIDIFKQVKELAGETVTKQTIFGPAHAFNELTIFN
                     GQVGPNQVYKTRDELKVGLIAAYKEFLDQYKEAGGQIVQFDDCLWELFDPANPVPFLP
                     QDDSEALAALADEFVAINNAVIDYGHEIGLTVWTHNCRGNYESRSAAGGTYEAIAEKF
                     LRDQKYDRFFLEWDDERAGDLKALESLRDKNVEVVLGLLSSKTSDLDDEERVYKLLEE
                     ASKIIPKERLYLSHQCGFASCDSGNELAIPQQWAKIKQGQEIAEKFWS"
     gene            706166..707332
                     /locus_tag="SSUBM407_RS03460"
                     /old_locus_tag="SSUBM407_0639"
     CDS             706166..707332
                     /locus_tag="SSUBM407_RS03460"
                     /old_locus_tag="SSUBM407_0639"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013730261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012775206.1"
                     /translation="MKKQSPFIIAGIVMLGVVMRAPFTALPAILIDVAAGLRVEVSSL
                     GILTSIPLIMFALCSSLAPRLAAKFGMEKLMALVLLVMVLGSGMRVLNLPALYIGTML
                     VGATIAFINVLLPSLVAANFPKKIGLYTTIYITLMGVAATVASMIAVPIVSSSSWEFF
                     ILLITGLVFMAFLIWLPNVKNNHRFASENQGNQKSSIWKNKAAIAFLIFGGLQSVLYY
                     TEITWLPTISQSVGFSKAEAGLMAGFFNMTAIPMSMIIPAVLSRQTKEMRRNIMLAIS
                     SVTLLGLFMMSLIPTNLILWSALHIILSFSNAALFPYMMLSFTLKTSNSQATAQLSGM
                     VQTGGYLIAAFGPGLLGYSYPIFGNWMPLILALAIVTLAMMWTIVLIEREDIIL"
     gene            complement(707432..707602)
                     /locus_tag="SSUBM407_RS03465"
                     /old_locus_tag="SSUBM407_0640"
     CDS             complement(707432..707602)
                     /locus_tag="SSUBM407_RS03465"
                     /old_locus_tag="SSUBM407_0640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003002781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3042 family protein"
                     /protein_id="WP_012775205.1"
                     /translation="MAKGFGKGFLTGVLSTVALAAGAVFTVHKTIIEPEEKKEAFIEE
                     NRKKAARKRVAH"
     gene            707671..708555
                     /gene="miaA"
                     /locus_tag="SSUBM407_RS03470"
                     /old_locus_tag="SSUBM407_0641"
     CDS             707671..708555
                     /gene="miaA"
                     /locus_tag="SSUBM407_RS03470"
                     /old_locus_tag="SSUBM407_0641"
                     /EC_number="2.5.1.75"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012028315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (adenosine(37)-N6)-dimethylallyltransferase
                     MiaA"
                     /protein_id="WP_012027263.1"
                     /translation="MKTKVIVVIGPTAVGKTALGIDLAQRYNGEIISGDSQQVYRKLD
                     IGTAKASPEEQAAAVHHLIDVRDVTEGYSAYEFVAEAKALIADIKSRGKLPIIVGGTG
                     LYIQSLLEGYHLGGLVDQEQVLAYRAELDCLSDEDLETMAEQAGLMVEGNSRRRIIRG
                     LELKKFGENLENTESGYEPLYICLTDDRQVLYDRINQRVDKMMAAGLLDEVSWLYQEH
                     PEAQAAMGIGYKEFFPYLEGQISLEEAIDNVKQNSRRFAKRQLTWFRNRMAVDFYQVS
                     EEAVKDRIYTAVEEFLDD"
     gene            708548..709798
                     /gene="hflX"
                     /locus_tag="SSUBM407_RS03475"
                     /old_locus_tag="SSUBM407_0642"
     CDS             708548..709798
                     /gene="hflX"
                     /locus_tag="SSUBM407_RS03475"
                     /old_locus_tag="SSUBM407_0642"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006596519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase HflX"
                     /protein_id="WP_012027262.1"
                     /translation="MIETQKEQERALLVGVELQQTDNFDVSMEELASLAKTAGALVKG
                     VYTQKREKYDSKTFVGSGKLDEIAQMVEADEIDTVIVNNRLTPRQNVNLEEILGVKVI
                     DRMQLILDIFAMRARSHEGKLQVHLAQLKYMLPRLVGQGIMLSRQAGGIGSRGPGESQ
                     LELNRRSIRNQIHDIERQLKTVEKNRATVRERRLQSGVFKIGLIGYTNAGKSTIMNAM
                     TDKRQYEADELFATLDATTKQINLADKFNVTLTDTVGFIQDLPTELISAFKSTLEESM
                     NVDLLLHIIDASDPNHSEQEQVVLDILKDLDMLDIPRLALYNKLDKTDDSFTPSQFPH
                     VMLSTKDENAKGHIQMMVLAKIKTMFERFEVRVPLAESYKLHDLATLALIENRTYEED
                     VEVVSGYIASSNKWKLEEFYDGLS"
     gene            709782..710411
                     /locus_tag="SSUBM407_RS03480"
                     /old_locus_tag="SSUBM407_0643"
     CDS             709782..710411
                     /locus_tag="SSUBM407_RS03480"
                     /old_locus_tag="SSUBM407_0643"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-lyase"
                     /protein_id="WP_012027261.1"
                     /translation="MTDYLDLAIKYGGFTSLDKVYLARKLADMTDQQKLDFITPPPSV
                     INAYFAEIYQKQGAEEATDYYLTLSQQLCLFPKEPSFAESKPFVRLNLSGKSFGFTYV
                     SADGLAQVFSEVGEEVTDSLLFEIAQVFPHYVVFVEEGKIFMKVNPFEDAELEEVETD
                     YLLTQVATGEGLVKISGFNQEEVLEVADGYAGQHYYVWSGRSAILYIKH"
     gene            710422..711351
                     /locus_tag="SSUBM407_RS03485"
                     /old_locus_tag="SSUBM407_0644"
     CDS             710422..711351
                     /locus_tag="SSUBM407_RS03485"
                     /old_locus_tag="SSUBM407_0644"
                     /EC_number="3.1.26.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018377974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease Z"
                     /protein_id="WP_012027260.1"
                     /translation="MQIQFLGTGAGQPSKARNVSSLALKLLDEINQVWLFDCGEGTQN
                     RILETTIRPRKVAKIFITHLHGDHIFGLPGFLSSRSFQSSEEQTDIDIYGPVGIRSFV
                     LASLKVSGTRLPYRIHFHEFDVDTVGQVLETDKFTVFAEKLDHTIPCVGYRVIQKDLE
                     GTLDAEALRAAGVPFGPLFGKIKNGQNVTLEDGTEIIASDYISPPRPGKVVTILGDTR
                     KCHASVRLAVNADVLVHEATYGKGDEKIARKHGHSTNMEAAQVAKDAGVKQLLLNHIS
                     PRFLSKDISQLRKDASTIFEQVHIVKDLEEIEL"
     gene            711348..712103
                     /locus_tag="SSUBM407_RS03490"
                     /old_locus_tag="SSUBM407_0645"
     CDS             711348..712103
                     /locus_tag="SSUBM407_RS03490"
                     /old_locus_tag="SSUBM407_0645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002895169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_012027259.1"
                     /translation="MRTILITGASGGLVQEMVPLLKDDFLILLGRDVAKIEQLYAYHE
                     KKAVFDVDIRDEIALTAFFDELDSQFGQIDILVNNAGYAIYDDFENFSSQQVQAMFDI
                     NTFALMTMCRLVGKRMKARRSGQIINIISMSGLIASAKSSVYSATKFAAMGFSNTIRL
                     ELAQYGVTVTTVNPGPIATSFFDQADPDGSYQESVKAFLLQPDYVAKKIVSAMGTKKR
                     DINLPWSLAAAHKLYTLFPRIADYLASTVFNLK"
     gene            complement(712147..715332)
                     /locus_tag="SSUBM407_RS03495"
                     /old_locus_tag="SSUBM407_0646"
     CDS             complement(712147..715332)
                     /locus_tag="SSUBM407_RS03495"
                     /old_locus_tag="SSUBM407_0646"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPXTG cell wall anchor domain-containing
                     protein"
                     /protein_id="WP_012775564.1"
                     /translation="MKLSYKKRLLNQVLLASTVLLAASLAQGTVFANTEEIPPTTNET
                     VTPLPEETPITKTSTSEATDNLVEGKETEKQTEEIADTSPASVSTEEETTSSEPNAEE
                     TTLRTANNDNQNTTEEKPAVPTIDTITLETKTVYLSEAVTITESVTLPDTTEKIEWIL
                     DGKPISEWKTWNLKEGDFTGDTFITVEESRQDNQLHLNIQLAALFGEDLSKRTPSNIR
                     RTYRHFIKDMLLEGTSADGNLIISKTLHFRPYEAYRTHEEMLTEIEETKNNAATDRLV
                     RIESIGQSAEGRDIKMAVVAKNQASIDKYLTETTPLMLTQPDQMLKQLQAGTFDYRLP
                     ILINNTHADEQPGIDVVTSLFKEFAQKDTITFPSTDADGNPVTLHLKVTDLLDKFIFL
                     FNFTENPDGDVKNLRSLVNGLDPNRDTGFQVNPETQAIVRQIHKWNPISVLDIHGFVS
                     GFLIEPATPPHDPNFEYDLLADIMLEKAHEMGRAGIANSKYERYTIPKVHWGDGWDDS
                     FSGYTAVYAMYHGILGHTIEIPEGNQESFKAGFFAVLGGVHNMATKPDSLMEMRLKYY
                     SRGVNKVEDPKAESELVGPDGAVVGRVKKDQPKFFPDYYVIPMTLDKHNDMQEAFKMI
                     EYFNRNGVVVKELTEDVGNFRKGDLVVDMAQAKRGFANHVLYAGSDESAWGAMYAELV
                     VNFPDMKGFSAKAVFEENTFSGKLGSITWTKAPRTTEIDFKAPYYVVANTSESAVQAI
                     NQAIKSGAKVYLTDDGYIMETNQFSHLLDTYALYGEPLYKKPLGQELKAMKVYAPSHS
                     YSWAGDFAILANAALAVERMGFEIVNSADEADAIILESDQFDASVFGKKPIIIVGGVA
                     MQKLEELGILAGFNAEQFTDGGDYEGLMQAIIDDKDPLTSGYAMNGLFYSNSGNWIEG
                     IPEGFKTLVKIADKDYYIAGWWPGHDKLANKIVAIAGNYQDQPVFIYAGNPTNKVHPV
                     HFFRWVSNALFGSQLASLEDLPAVEILVPQPEMPKNILDEAPKTTTVVHTTKSTEAKQ
                     LPQTGEKTNYIAIALGSLLLGSIALRRKERS"
     gene            715548..717095
                     /gene="cls"
                     /locus_tag="SSUBM407_RS03500"
                     /old_locus_tag="SSUBM407_0647"
     CDS             715548..717095
                     /gene="cls"
                     /locus_tag="SSUBM407_RS03500"
                     /old_locus_tag="SSUBM407_0647"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cardiolipin synthase"
                     /protein_id="WP_012775565.1"
                     /translation="MEKLWKIIYSRTFIVISLIILTIFLILWLVGSAATYMPALLIIL
                     QIFSIFVAISIINRPMNTSFKLTWIIFVIGIPIFGALFYFILQSNIETKRYRKNFHKQ
                     AQRLREYSKTSEKVMKALEQEDKEQLKLAHFMSEYVGYPIHTNTDAVYFSTGQEKFEA
                     LLEELKKAEQYIFMEYFIVDMGYMWDSILDILKEKAAQGVEVRFMYDGMNSLTNLPYN
                     YYKTLRKYGIKAKVFSQIIPALSTVQNNRDHRKIAIIDGKVAFTGGINIADEYINKKV
                     RFGYWKDAAIMIRGEAVANFTLMFLQMWNYNEKTETDDLKYLKTHKDLETETVDAEGF
                     FLPYGENPFDGDEVAKRVCLDMIQSATDYIYIMTPYLVLDDEMIDNLTYAAKRGVEVR
                     ILLPHIYDKKSAYLAARTDFPTYLEAGIEIFEFQPGFVHSKVVLVDDKKATVGTVNMD
                     FRSFYLNFECGLYIYNHSEVLAAIKDDFTHSFKKSQQINLLTFHKTYSWYKRLGGALL
                     RIISPLL"
     gene            717251..719464
                     /gene="recJ"
                     /locus_tag="SSUBM407_RS03505"
                     /old_locus_tag="SSUBM407_0648"
     CDS             717251..719464
                     /gene="recJ"
                     /locus_tag="SSUBM407_RS03505"
                     /old_locus_tag="SSUBM407_0648"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded-DNA-specific exonuclease RecJ"
                     /protein_id="WP_012027256.1"
                     /translation="MIKPNYDWQLLTGFSDEQFIKIAKKEGVDPVAAKLLYERGIHSA
                     EELHTFLQPSLEDLHDPYLLHDMDKAVERIRRAIENYEHILIYGDYDADGMTSASILK
                     ETLEEMGAEVQVYLPNRFTDGYGPNQSVYKYFIEQQGISLIVTVDNGVAGHEAIAYAQ
                     EMGVDVVVTDHHSMQETLPNAYAIVHPEHPEGNYPFKHLAGCGVAFKLACALLETVHA
                     DLLDLVAIGTIADMVSLTDENRVMVKYGLSLLKQTERAGLQELIKIAGIDIDSIDEET
                     VGFQLAPRLNALGRLDDPNPAIELLTGFDDEEAHQIALMIDSKNVERKDVVQAIYDEA
                     KTMLRHDRPVQVLAKEGWNPGVLGIVAGRLLEELQQPVIVLSIEDGKAKGSARSVEAV
                     DIFKALKDHQDLFIAFGGHAGAAGMTLEVDKLEELALTLTDYIIENKLDLSSKSSLVL
                     DEELDLEELTLDTLKSFEKLAPYGMDNKKPVFYIRDFQVESARTMGQNNAHLKLRITK
                     GAAGFDVLAFGKGNLALEFSQAKGLELAVTLSVNQWNGNTSLQLMLVDARVNGVQLYN
                     IRGKQHPIPAGVPILDIENPVADNKAIVLANLPEDLSSLRSYFQEREFEAIYFKNEIA
                     KPYYLDGYGSREQFAKLYKTIYQFEEFDVRYKLKDLAVYLKIKDSLLVKMIQIFQELE
                     FVTIADGVMRVNKEAQKREISESQIYQELKETVIQQELMALGTVQEIYEWLCGRV"
     gene            719443..720339
                     /locus_tag="SSUBM407_RS03510"
                     /old_locus_tag="SSUBM407_0649"
     CDS             719443..720339
                     /locus_tag="SSUBM407_RS03510"
                     /old_locus_tag="SSUBM407_0649"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014917262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3114 domain-containing protein"
                     /protein_id="WP_012027255.1"
                     /translation="MAMWSRLMTVEALVVGVIGTLLYTYWFIRQKGLLKNLEQITEIK
                     HALIELRRVGWSERAIKKVFLKQLLPLKQEDIPAFVQNFIKEATIFASTSFYQLIRVD
                     SRSLSQEKATALLEQCMNMLDFPEELSHGILPELLQKMDVNCPPHHPFWRYFAKLVDK
                     AFPVRELEVKRPLNRQVHQLRYLISYQQTFWVRQQFGKGKTDWQALIAYVRSLPRWSY
                     RLRESARLHNKQLFGKKNQKTLPVNMKILIHFHSEFILNQDGQFALILEERPHVNGVV
                     NGASFNYARANNKREWERTRLV"
     gene            720772..721284
                     /locus_tag="SSUBM407_RS03515"
                     /old_locus_tag="SSUBM407_0650"
     CDS             720772..721284
                     /locus_tag="SSUBM407_RS03515"
                     /old_locus_tag="SSUBM407_0650"
                     /EC_number="2.4.2.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001049318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="WP_002937136.1"
                     /translation="MNLKDYIATIPNYPKEGIEFRDISPLMADGNAYSYAVREIVQYA
                     TDKQIDMIVGPEARGFIVGCPVAFELGIGFAPVRKPGKLPREVISADYEKEYGVDTLT
                     MHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELDDLKGREAIG
                     DYDYKVLMHY"
     gene            721388..722329
                     /locus_tag="SSUBM407_RS03520"
                     /old_locus_tag="SSUBM407_0651"
     CDS             721388..722329
                     /locus_tag="SSUBM407_RS03520"
                     /old_locus_tag="SSUBM407_0651"
                     /EC_number="2.3.1.46"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-succinyltransferase"
                     /protein_id="WP_012775204.1"
                     /translation="MPIKIEKSLPAVEILRKENIFVMDSDRASHQDIRPIKILILNLM
                     PQKIVTETQLLRLLANTPLQLEVEFLYMASHESKNTHSGHLKQFYKTFEQVRDSYFDG
                     LIVTGAPVENLPFEEVDYWHELTQVFDWSKTHVYSTLHICWGAQAGLYARYGVPKHSM
                     SRKLSGVYCQEVTNPTSPLMRGFDDEFRSPHSRYTEVREADIAHLSGLTILSQGPEVG
                     LSILASKDLRGIYSFGHLEYDRDTLAKEYQRDCIAGKNPHLPENYFKGDDPTSKPSLS
                     WNLPAAQFFTNWVNYAVYQETPYDWHIFEQSAQSASL"
     gene            722339..723013
                     /locus_tag="SSUBM407_RS03525"
                     /old_locus_tag="SSUBM407_0652"
     CDS             722339..723013
                     /locus_tag="SSUBM407_RS03525"
                     /old_locus_tag="SSUBM407_0652"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002941367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DnaD domain-containing protein"
                     /protein_id="WP_012027253.1"
                     /translation="MNYSQQFRQGHLVLPAAILFHYQELFPSADDFLIWQFFLYQNSS
                     AIESLAPSEIAQATGKTVAQVNQAIENLQDAGLLEFKTISIAGEIEMIFDALPAFEKL
                     DVLLTPKQAVEIVQPENDLKTLVGDFERELGRFLSPFEIEDLQKTIEDDKTSIDLVRA
                     ALKEAVFNNKTNWKYIQAILRNWRREGITTVVQVEAKNAEREIQTPKNVTVSSDFLDA
                     MDLWKD"
     gene            723015..723698
                     /locus_tag="SSUBM407_RS03530"
                     /old_locus_tag="SSUBM407_0653"
     CDS             723015..723698
                     /locus_tag="SSUBM407_RS03530"
                     /old_locus_tag="SSUBM407_0653"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012767134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (adenine-N(1))-methyltransferase"
                     /protein_id="WP_012775203.1"
                     /translation="METKLSKRLETVASFVPQGARLVDVGSDHAYLPLFLVEQGRIDF
                     AIAGEVVQGPYQSALQNVEQAGQTEKILVRLANGLGAFEKSDQMTAVTIAGMGGRLIA
                     EILEAGKEKLATIERLILQPNNREDDVRRWLEKNGFRLVAEKILEENGKLYEVLVAES
                     GQMRLSEVERRFGPYLLEETSPVFVKKWRRELEKLSFALEQVPSERQGDRFAISQKIQ
                     QIQEVVHVS"
     gene            723688..724482
                     /locus_tag="SSUBM407_RS03535"
                     /old_locus_tag="SSUBM407_0654"
     CDS             723688..724482
                     /locus_tag="SSUBM407_RS03535"
                     /old_locus_tag="SSUBM407_0654"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014634275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Nif3-like dinuclear metal center hexameric
                     protein"
                     /protein_id="WP_012775566.1"
                     /translation="MLASQVIERYQAFCPHSLAMEGDVKGLQIGTLNKEIQRVMVALD
                     IRETTVAEAIDKKVDLIIVKHAPIFRPINDLVADNPQTKMYLDLIKHDIAVYVSHTDI
                     DVVEGGLNDWFCELLEIQDTTYLIETAEGQGLGRVGTIAEQTLEELALKVKSVFDLDA
                     VRLVTYGHQAKQYVSRVAICGGSGGSYYHEALAKGADVYITGDIYYHTGQDMLTQGLL
                     AIDPGHHIEALFIKKIAELLEIWKAKEGWDVEILPSTVSTNPFRHL"
     gene            724658..725482
                     /locus_tag="SSUBM407_RS03540"
                     /old_locus_tag="SSUBM407_0655"
     CDS             724658..725482
                     /locus_tag="SSUBM407_RS03540"
                     /old_locus_tag="SSUBM407_0655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018166479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ZIP family metal transporter"
                     /protein_id="WP_012775202.1"
                     /translation="MTWVTNQSVVLQALLGGLFTWFCTIVGSAVVFFFKTVSRRLLDT
                     MLGFAAGVMIAASFWSLLAPSIEYAESSYGNLAWIPAAVGFAAGGIFLRLVDAWVPHL
                     HLGNDKDKAEGGGEKDRKNLSKTALLFLAITIHNIPEGLAVGVIFGALASNYSPAAFI
                     GAIGLAIGIGIQNIPEGAALAIPIRTDGASRWKAFYWGSMSAIVEPIAAVIGAFAVTF
                     MTPILPYALSFAAGAMIFVVVEELIPESQTNGNTDIATLGLMAGFIIMMILDVALG"
     gene            725580..726449
                     /gene="rfbA"
                     /locus_tag="SSUBM407_RS03545"
                     /old_locus_tag="SSUBM407_0656"
     CDS             725580..726449
                     /gene="rfbA"
                     /locus_tag="SSUBM407_RS03545"
                     /old_locus_tag="SSUBM407_0656"
                     /EC_number="2.7.7.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002276675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase RfbA"
                     /protein_id="WP_012027249.1"
                     /translation="MKGIILAGGSGTRLYPLTRAASKQLMPIYDKPMIYYPLSTLMLA
                     GIKDILIISTPQDLPRFKDMLGDGSELGISLSYAEQPSPDGLAQAFIIGEEFIGDDNV
                     ALILGDNIYHGNGLTKMLQRAASKEKGATVFGYQVKDPERFGVVEFDADMNAISIEEK
                     PEEPKSNFAVTGLYFYDNDVVEIAKNIKPSPRGELEITDVNKAYLERGDLSVELMGRG
                     FAWLDTGTHESLLEAAQYIETVQRLQNVQVANLEEIAYRMGYITKEQVYKLAQPLKKN
                     EYGQYLLRLIGEA"
     gene            726449..727042
                     /locus_tag="SSUBM407_RS03550"
                     /old_locus_tag="SSUBM407_0657"
     CDS             726449..727042
                     /locus_tag="SSUBM407_RS03550"
                     /old_locus_tag="SSUBM407_0657"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018029578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase family
                     protein"
                     /protein_id="WP_012027248.1"
                     /translation="MTENFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEK
                     MLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGTWVDLREG
                     ETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYA
                     DPSLDIKWENLEEAEVSEADENHPFLKDVKPLRKEDL"
     gene            727042..727527
                     /locus_tag="SSUBM407_RS03555"
                     /old_locus_tag="SSUBM407_0658"
     CDS             727042..727527
                     /locus_tag="SSUBM407_RS03555"
                     /old_locus_tag="SSUBM407_0658"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002937118.1"
                     /translation="MFQAFLEIAEQLNKLGITPLLMGSVGLERRTGRDWQARDLDIHV
                     PSDPRGWEAPDEERIYRADELIVLMNQLGYVLVDRHEHEFHKDGLSVEFGGLHSLPEF
                     AGVELEDLEELETVGVRYYLPTLEQYLKIYQASSKDSYRAENNNQKDFAKIAYLKEIL
                     R"
     gene            727716..728762
                     /gene="rfbB"
                     /locus_tag="SSUBM407_RS03560"
                     /old_locus_tag="SSUBM407_0659"
     CDS             727716..728762
                     /gene="rfbB"
                     /locus_tag="SSUBM407_RS03560"
                     /old_locus_tag="SSUBM407_0659"
                     /EC_number="4.2.1.46"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002884100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="WP_002937117.1"
                     /translation="MSQFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGN
                     KANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTN
                     FIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSP
                     YSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLY
                     GEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKD
                     AYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSQGLEETIQWYTDNQDWWKAEKE
                     AVEANYAKTQEVIK"
     gene            728817..729668
                     /gene="rfbD"
                     /locus_tag="SSUBM407_RS03565"
                     /old_locus_tag="SSUBM407_0660"
     CDS             728817..729668
                     /gene="rfbD"
                     /locus_tag="SSUBM407_RS03565"
                     /old_locus_tag="SSUBM407_0660"
                     /EC_number="1.1.1.133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018364624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose reductase"
                     /protein_id="WP_012027245.1"
                     /translation="MILITGANGQLGTELRYLLDERGVDYVAADVAEMDITDADKVDA
                     FFAEVKPSVVYHCAAYTAVDMAEDEGKELNYKINVTGSENVAKATAKYCATLVYISTD
                     YVFNGDLPVGKEWQVDDQPDPQSEYGRTKRKGEEAVEKFADKFYTVRTAWVFGNYGKN
                     FVFTMQNLAETRDTLTVVNDQHGRPTWTRTLAEFMVHLVDTKQAFGYYHLSNDAAEDT
                     TWFDFATEVLKDTNTKVLPVDSSQFPAKAKRPFNSTMSLDKAKATGFVIPTWQEALEA
                     FYKQEKK"
     gene            729685..730728
                     /locus_tag="SSUBM407_RS03570"
                     /old_locus_tag="SSUBM407_0661"
     CDS             729685..730728
                     /locus_tag="SSUBM407_RS03570"
                     /old_locus_tag="SSUBM407_0661"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPXTG cell wall anchor domain-containing
                     protein"
                     /protein_id="WP_012775201.1"
                     /translation="MKKKAIVKPLLMSGIFLALLGGATLPSGAVPVVAAETSQSTTYH
                     LTDDEKVAVREYIQAKMTIDMQEYRLAFLEGMMEEMASGSAEAAWDEEIADLKANLTA
                     EQVVVLDELEANLIGSIAQHYHYLFETLTVAGKSGREEAAAIVSKYESEDDASTPEAE
                     LAALKYAREVIVELLNKESAAIDNYIAYAEATGQELAGLLESGNSNLESITSATIGYG
                     QALATASQPKFPYDFSEMDRQIAELTASLQSKVEDKSTAKTENTGVQTSQSATNGSND
                     LQTVPDQGGGQISDVATGKGNISEAGQKKVIPNDNAKVLPKTSGKSSLPLTVLGLITI
                     FAGWLLTNKQEEK"
     gene            730766..733573
                     /locus_tag="SSUBM407_RS03575"
                     /old_locus_tag="SSUBM407_0662"
     CDS             730766..733573
                     /locus_tag="SSUBM407_RS03575"
                     /old_locus_tag="SSUBM407_0662"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GBS Bsp-like repeat-containing protein"
                     /protein_id="WP_012775567.1"
                     /translation="MFLHVKYIKEMFVKKRTLLFLSLCASALNAQLVQADMVNAPSSQ
                     VSSSQVAETGGQLSVVDEAGQIKAILSNIQGEIIGVTAQFSSETNSGITVTFSMDEQG
                     RYVAVLDRSAFAEEDQVFSLKLTAQLTDGSFQTLSDYSFEWKKDVVSAAEKPTALDNS
                     DATPSKIEEEATSTTTSSTVNSSLTAGATSSTSNSLTRSSSNTIAGSSNGSTSVPSAR
                     VSTASSSVNVTQPTGTITIENRNDAQGTFDVRVTNVSSPKDIASVLLPTWSQSDDIRW
                     YEATRQSDGSYKLTVNKKDHKYRTGTYTVHLYYKDSNGGLTGAGGTTTHLSEAKPTGT
                     ITIENRNDAQGTFDVRVTNVSSPKDIASVLLPTWSQSDDIRWYEATRQSDGSYKLTVN
                     KKDHKYRTGTYTVHLYYKDSNGGLTGAGGTTTHLSEAKPTGTITIENRNDAQGTFDVR
                     VTNVSSPKDIASIILPTWSQTDDLRWYEATRQSDGSYKLTVNKKDHKYRTGTYTVHLY
                     YKDSNGGLTGAGGTTTHLSEAKPTGTITIENRNDAQGTFDVRVTNVSSPKDIASIILP
                     TWSQTDDLRWYEATRQSDGSYKLTVNKKDHKYRTGTYTVHLYYKDSNGGLTGAGGTTT
                     HLSEAKPTGTITIENRNDAQGTFDVRVTNVSSPKDIASVLLPTWSQSDDIRWYEATRQ
                     SDGSYKLTVNKKDHKYRTGTYTVHLYYKDSNGGLTGAGGTTTHLSNPSAQRSYTVYID
                     PGHGGRDSGASYGGIHEKNLALSVSNKLRENLLQYGINVLMTRTGDYDVDFKTERSRM
                     TNASNADLFISIHFNATGAGVSNATGIETYWYQYNPEYQPKINKEMHNNPTRLAESEI
                     LANKVQESLIKETGAVNRGVRRETFAVLRETAIPAILVELGFMDNPSELQVIKQDSYH
                     TRLAKALAQGVMNWYGAVEGK"
     gene            733651..734079
                     /locus_tag="SSUBM407_RS03580"
                     /old_locus_tag="SSUBM407_0663"
     CDS             733651..734079
                     /locus_tag="SSUBM407_RS03580"
                     /old_locus_tag="SSUBM407_0663"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosaminidase domain-containing protein"
                     /protein_id="WP_074390297.1"
                     /translation="MEQSSKANSILSSVMLSQAILESAWGTSYLATHGNNLFGIKADA
                     AWTGATIEIITNEYRDGEKKQEKHLFRKYNSWNESVADYAKFFTSTPWRIKNYQSFRE
                     ATDYQQAILALRQSGYATDPKYGEKLRSIIENYKLYLLDN"
     gene            complement(734139..736688)
                     /locus_tag="SSUBM407_RS03585"
                     /old_locus_tag="SSUBM407_0664"
     CDS             complement(734139..736688)
                     /locus_tag="SSUBM407_RS03585"
                     /old_locus_tag="SSUBM407_0664"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase family protein"
                     /protein_id="WP_014636419.1"
                     /translation="MKLIKQLIHILISIGLIGSFFLYAHLIQNELGSTKNDGTIEIIA
                     EQPNQVIDSIQINGRYIHSSEIIENQWGINDADLIPNFSSLGEENSLVIKSSSSVRTL
                     SFEYFVSENPTIVKIKVGGQLVESIDTSTGDKYKNLAFIELPYTLRITKDNQFWYLHL
                     IVLALGLTCFILNGATWRIKRRDIRILTILLIVQYIFTTFTFPRLYRNELVLFNSNFN
                     KMETQQLLVALTYLIFFSLLGYKQLRGHISKAFKTISLSVIYLLVPIFSLFIIENSYS
                     QFSTLSSNSLWNNLIIIGVLYLILVFTTNLRFASLLILSASVFIGISNQLLIDSRGAP
                     LLFYNLFQITDGLNVASSVAININNRMLQSMVFSYILLTFFFFIPKLYLPKLLPSRTF
                     YSSYDFKWPKRFSRILLGYITLITIVPMINKTVVSNANISLNYWRMYVTYGQFGLPLS
                     LASFYEDSKITKPEGYSVPKLNEVLEKYPPETEKQTIRPNIIFIQNESQSDFSNLQGL
                     NMEPNPLSNQHALTDNTIHGTLNVSVFGGGTANTEYEVLTSNPISLLSSNLFPYQQII
                     TQDRPSFATYLKNKNYDTVALHPQSGNNYNRNAVYPLLGFNKSYFLDSEPAISSLAPL
                     TIDRGWPSDQFLFNGIKELYTQKGDQPLFSFVVTMQGHGGYPSTEEIYPREVSINGST
                     SEYLAETEFLTSMKRTDEAFADLITFFSTYKEPTVIVMYGDHQPSLTQEFYAQFMDEN
                     NPAAKYSTPLVIWSNFDIRERESTTISPNYLVPYLMDILSESDYALPRSPYQQFLSDM
                     QIEAPIITSWGNIDNNGQQIEDLSTLPLYQTYLQLEYNSAIDKQPLTDLYE"
     gene            736902..738050
                     /locus_tag="SSUBM407_RS03590"
                     /old_locus_tag="SSUBM407_0665"
     CDS             736902..738050
                     /locus_tag="SSUBM407_RS03590"
                     /old_locus_tag="SSUBM407_0665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1972 domain-containing protein"
                     /protein_id="WP_012028306.1"
                     /translation="MKHVFIIGSRGLPAKYGGFETFVQQLVSHQQSEKICYHVACLSD
                     TSHHQHSTYLGADCFTINPPKLGPARVIAYDMMAITYALKIIKEQQIERPIFYILGNT
                     IGGFIVPFAKQIHSVGGTLFVNPDGLEWKRAKWAKPVQRYLKFSEKMMVKYADLIIAD
                     NEGIEDYIQSEYSATNTRFIAYGTDLSPTKLTKESEQVRQYFTNWNIKEKEFYLIIGR
                     FVPENNYVTAIREFMASNTRRDLVIVANHEGSAYFQKLKDETGFISDKRIKFVGTVYD
                     QELLKYLRQECRAYIHGHEVGGTNPSLLEALAQTNENLVLGVDFNRKVALEGARYWSK
                     ESGSLSQLINQIDENAEAMELGEIAKKHMKDEYTWEKIVQEYEELFLQ"
     gene            738047..738976
                     /locus_tag="SSUBM407_RS03595"
                     /old_locus_tag="SSUBM407_0666"
     CDS             738047..738976
                     /locus_tag="SSUBM407_RS03595"
                     /old_locus_tag="SSUBM407_0666"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015604479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_012027238.1"
                     /translation="MKVNILMSTYNGQQFLAEQIRSIQEQSYIDWTLFIRDDGSSDRT
                     REIIKDFVEQDQRIHFIDVETDENLGVIKSFHRLVHYDTADFYFFSDQDDVWLPNKLE
                     VSLKKAQAYPTNLPLMVYMDLKVVNQNLEVMAESMVKSQSHHANTELVQELTENTVTG
                     GVAMINHHLAEMWQVTEDILMHDWYLALLASALGKLVFIDKPGELYRQHSDNVLGART
                     LSKRFKKWIRPHILFAVYWDLIKNSQKQARHLLQMPLSQSNRELIEAFVTIMDKPMLE
                     RFRILRKYGLRKNKTFHTLVFTTLIVTKFAYKE"
     gene            738979..739785
                     /locus_tag="SSUBM407_RS03600"
                     /old_locus_tag="SSUBM407_0667"
     CDS             738979..739785
                     /locus_tag="SSUBM407_RS03600"
                     /old_locus_tag="SSUBM407_0667"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019770493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012027237.1"
                     /translation="MNLLNKENQILLREMIKTDFKLRYQGSLIGHLWSILKPMLLFTI
                     MYLVFVRFLRFDDGTPHYAVGLLLGMVTWNFFTEATNMGMMSIVSRGDLLRKLNFSKE
                     IIVFSSVAGAAINYAINLMVVFVFAAINGVPFTWSVLVIIPLFFELALLATGIAFILS
                     SLFVRFRDIGPIWEVFLQAGLYATPIIYSLTFILQRGQVTFAKLMMLNPVAQIIQDLR
                     HFIVYSGNTTVSELIENPVIVAIPYILPVVVYLLGITVFRKNAKKFAEIL"
     gene            739785..740999
                     /locus_tag="SSUBM407_RS03605"
                     /old_locus_tag="SSUBM407_0668"
     CDS             739785..740999
                     /locus_tag="SSUBM407_RS03605"
                     /old_locus_tag="SSUBM407_0668"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_002937100.1"
                     /translation="MVKNNNIAVKVEHVSKSFKLPTESSQSLRTTLVNLFKGIKGYVE
                     YNVLQDISFEVEKGDFFGIVGRNGSGKSTLLKILSQIYVPERGTVAVDGKLVSFIELG
                     VGFNPELTGKENVYLNGAMLGFTAEEIDAMYDDIVEFAELSEFMNQKLKNYSSGMQVR
                     LAFSVAIKAQGDILILDEVLAVGDEAFQRKCNDYFLERKKSGKTTILVTHDMGAVKKY
                     CNKALLIEKGYVKALGEPDDVANQYSFDNVLASISEVTENEEPLHQSDIVKDLQINLV
                     SKNQIEPDESIEIEFRYTVLEDIETHVAFTFLDLERHFDVYNDNSMDLKTFGKGEKFF
                     RVKCKLPSINQAKLKMAVSVRNSNKQPLLFAKTSDTPAIFISRKFSTDNIAEEDAATG
                     FIQRNSQWELLD"
     gene            741020..742744
                     /locus_tag="SSUBM407_RS03610"
                     /old_locus_tag="SSUBM407_0669"
     CDS             741020..742744
                     /locus_tag="SSUBM407_RS03610"
                     /old_locus_tag="SSUBM407_0669"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnan synthesis protein F"
                     /protein_id="WP_012775568.1"
                     /translation="MSRLLVYVHYNKYNVVSEYIYYQLKSIRSIYSDIVFVSNSHVSK
                     DIVQYLQSERLIDFFIQRDNIGYDFAAWKEGLNQVTFYQYDSVTLMNDTCFGPLWDLE
                     DYYSQFDSDVDVDFWGMTNHLETKIDSVVVPEHLQSYFMVFKKRILQSQAFVGFWSSV
                     SELTDIQDVIKLYESQLTKILLSEGYSYKCALDTSICCKTLENSNITLEYPEVILKNN
                     VPFIKIKSFTEYPDRIYSLLHLIRMKTKYPVELIERHLRQIIIPGTSFIPPIRVSQTT
                     ETVRSSTSVLLHIHIESVSIFEEYIEELCKISDRCQLLITLPETDFSNNFSIVERYLS
                     TYKLRAQIVKLTDELHFFEIVNNYMGDAKYLAHITVKQTNKTKYSVEDIIDRYQLRKM
                     FFTSFDAVISNFESQSNLAVVIPDLTTNQRYDRKSLREGNPELIRQLNILYESLVRTK
                     KVDFYKVPYIIGEEVSWYWIKTEHYKKIEEKFRNIDFSKEDRLLLVPILFIYSAWDLS
                     NDYAVVENTENVSPILEKISFSSERELRLIIEEKEFLQIGLRRTLKIISVGIVSVFKM
                     IKKSLLKN"
     gene            742777..744036
                     /locus_tag="SSUBM407_RS03615"
                     /old_locus_tag="SSUBM407_0670"
     CDS             742777..744036
                     /locus_tag="SSUBM407_RS03615"
                     /old_locus_tag="SSUBM407_0670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
                     /protein_id="WP_012775569.1"
                     /translation="MKSRIVSPKTIFIWNLLGSISSAAISIFLLLLVTRLLTELEADI
                     FSFAYAVANLFVIIATFQVRDYQATDVSKKFSFSQYLATRLITITIMLLLALSYIFLS
                     KYEFQKSVCIFLICLYRGSDALSDVFQGLFQQNARLDIAGKSLFLRNSIVILTFGLGL
                     FITNNLLLSLIYLVISSYLFVFFFDVTNLFQFTRVIKEEINLKAIKNILLECLPLFIN
                     AFLLVTIYNQPKYALNTFFERGVIGTGVQRDFNILFMPVFSMNILLILFRPMITQLAI
                     YRRAGDYNQFKQYQKRIVKMVVGLAVLVLVGGIVLGIPALNILYGTNLNKYWLSFIIT
                     MLGGIASTFATICDNMLTVLRKQKYLVISFAISCLLSILISNPLVEYYGILGAAIAFV
                     SSMWTWFLISLVIYLKLQKHLNWEVQE"
     gene            744033..745340
                     /locus_tag="SSUBM407_RS03620"
                     /old_locus_tag="SSUBM407_0671"
     CDS             744033..745340
                     /locus_tag="SSUBM407_RS03620"
                     /old_locus_tag="SSUBM407_0671"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2142 domain-containing protein"
                     /protein_id="WP_012775199.1"
                     /translation="MKIEKLFLRLAIPFLLISIFVMPVTKVPDEATHAFMSWNILFDS
                     PTSRDTEAMNELRAADFTYSEPEIHAVDSTEYSSLFTKIRDFSKDKLSIDFSLKSLMS
                     TPQLIGLVVGKLLYPSYGMMVTIGRLFNTIVYIIGIYYLIKKIKYGKMTLFFVSLLPM
                     MIQQAGSLSYDVVNYLAVVAFFVFYVNLLVDKVLTTRKFINLILLSLLLYLTKANNIL
                     LLALLFFVDFEFEGVLSKFNSILKWIQKRRLPILILGFGLVLLVSYLFLHNRGGVVHF
                     VKVMINSLFINNRNDHLNGILTVGIFGYFGWFVTQLPLWLIFIDIFIFTLLLFNDGNL
                     KISKTEGLASLFVLPVQVAIIVAGMYFAWTPTAIGPNAMISQGAQGRYFTPFLVYLFP
                     ACLMLKEQVSVSVKQKYLIRLLTGTVVINFIMYLFLIVDYYWV"
     gene            745363..746352
                     /locus_tag="SSUBM407_RS03625"
                     /old_locus_tag="SSUBM407_0672"
     CDS             745363..746352
                     /locus_tag="SSUBM407_RS03625"
                     /old_locus_tag="SSUBM407_0672"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 8 protein"
                     /protein_id="WP_012775198.1"
                     /translation="MNILFTLNDAFVPQVAACMGSIMRTLDEDDTCHFYLFSDGISQQ
                     NKENLHQFVTDGGNKLTIVELENLESYFDFEVDTNGWASVVLARLLVDKLLPEEVDRI
                     IYLDGDTLVLENIRELWEVDLEGKVLGMCPEPTASSERREGLNLGTYTYHNAGVLLID
                     LKRWRSKSIGTIIFDYYKEKNGELFANDQDALNGALKEEIKTLSITYNYFNIFDVYPY
                     RTLEKLSRPSTFISKEEFVKIRKQPRIVHFLGEERPWRIGNKHRFREDYVSALNQTPW
                     RGTQFESGWQFYFFCFNLFNMVMKPFPMLRYKIITVLIPVFMKYRKIRLQKGV"
     gene            746355..747335
                     /locus_tag="SSUBM407_RS03630"
                     /old_locus_tag="SSUBM407_0673"
     CDS             746355..747335
                     /locus_tag="SSUBM407_RS03630"
                     /old_locus_tag="SSUBM407_0673"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_012027231.1"
                     /translation="MKFSVIIPAYNVADYLEECVYSVLNQTYEEFEILLVDDGSTDGK
                     TSNICDKLAAKDDRVKVFHQTNGGLSAARNTGIKNASGDYILFLDGDDFWTDICFLDE
                     VNREIISHDEVIDAVIYPFSYFYGKDDVAVRNFSKKLPFHQVITDTRLLVETGALITP
                     AWNKCVRRDKFTSALNFLSGYLYEDGIWCANLLKELNVFIVVDNTQCMYRQNRQGSIT
                     NNVTLRHVEHAFRGIEENLKNFKQLSNEKQEALLIYLSNSYISILPFVFPYLNNFDIK
                     MFVKKFRYLLKYSQKVELVSFRISGLMTRVLGIYVSTFIQNKLLKIYKSR"
     gene            747345..749405
                     /locus_tag="SSUBM407_RS03635"
                     /old_locus_tag="SSUBM407_0674"
     CDS             747345..749405
                     /locus_tag="SSUBM407_RS03635"
                     /old_locus_tag="SSUBM407_0674"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_012027230.1"
                     /translation="MIGNTVKRWIRNFTTRLFILSGKYKLLFYILELTKNIAKFFWRI
                     PKYIKRTLLALQRDKQRRNNYSDIKNRYLIYTIYEHQSSLQDYKVIFLEALAKISRDV
                     LIVVNGKLPQADINRLAQFGKVLERDNEGYDVAAFRHGIIHTGKEALQQYNQLILVND
                     TNIGPFRDLEEVFSEFNSDQLDFWGISMGEEQLDFTGYNPYGKIPKHLQSYFVVIENS
                     LLRYEGFYDYWEKLSDTDSRNKAIGKHETVFAKYFYDRGFKYDALIKDTKDSALYIHP
                     FKLLKQGCPLVKYSAFRNYDREQYFWHGLERESEIPDLMEYIAKETDYPIEVVSSILE
                     DFKTRENQSYILIIDGVENIIPQCTRYRVLNKAEQLRELGYTVRVINNSLVQLQDAQF
                     ASHIIIYRAPFNDMLKEICRAAHIKNRPVYFDIDDLVFDTKFTDELEFTQGLSKREKK
                     GYDTSVLAYKKMLSLCDYAITSTSKLKDELEQYKNKVILNRNVMSKELVERSLQVKKN
                     SNDNKVKIGYFSGSITHNENFDLISQALLNLLQKYPQVELHIVGYLDIPKPFQKFKKQ
                     IVSHEYVDWRKLPILISQVDINLAPLVTTTFNEAKSEIKWIEAAAVKVVTVASNLGAF
                     EEMIQDGVTGVLADDNEWESKLERLILEQDLRAQIAENAFEFVMNHCTTANRINDFLK
                     EELV"
     gene            749405..750658
                     /locus_tag="SSUBM407_RS03640"
                     /old_locus_tag="SSUBM407_0675"
     CDS             749405..750658
                     /locus_tag="SSUBM407_RS03640"
                     /old_locus_tag="SSUBM407_0675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="WP_012027229.1"
                     /translation="MKRILFISPTTSMDNGAEKSIYYLMKYLIQLGHTVINVTHAIGG
                     EPQDKHEQLYKMIGVKNYYLPTIKWWWPDAPGGEILNREEATSYYRQNVQDIAEIIEQ
                     NEIDLVISNTVNVFQGAIAASCQKVPHFWLIHEFPKNEFAYYADKIDFIEEYSSELFS
                     VTGELNNFLTPLFNKKVHSFISYTEQETKVLKKGNQVRIVSVGRLTEGKNQLELIKAY
                     KTLNRLDIELVFIGGWDSKYKAICDEYIHENKLQKNVKFLGNLDNPWEEVTDRDICVF
                     PSSMETFGLVYVEAILRGLPVILSNNLGHLTAFEIFSAGQIYKLGDIEELVTKLEQVI
                     ESFRNFSDRARLDVERLRTLYTPEVAYKEILDGINHLEYTGHQNTNLSHIKELLTLNM
                     RPTRLERYARLISNMATKIRHKLRL"
     gene            750762..751478
                     /locus_tag="SSUBM407_RS03645"
                     /old_locus_tag="SSUBM407_0676"
     CDS             750762..751478
                     /locus_tag="SSUBM407_RS03645"
                     /old_locus_tag="SSUBM407_0676"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015604473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_012027228.1"
                     /translation="MKVLMIIPAYNEEESILQTVQGIIDYKNSVNFQLDYVVINDGST
                     DSTKEILIQNKLNAVHLVQNLGIGGAVQTGYKYALDNDYDVAVQFDGDGQHDIRSLNG
                     LIQPILVGQADMVIGSRFVGDTLSEFQTSFMRRFGIGVISNMIKLTTGNRIWDTTSGY
                     RLGNRKVIAQFAKRYPIKYPEPESTVHLLKQNFQVVEAPANMFERAGGVSSITPFKSI
                     RYMVEVCSSILIASLMKEGE"
     gene            751478..751834
                     /locus_tag="SSUBM407_RS03650"
                     /old_locus_tag="SSUBM407_0677"
     CDS             751478..751834
                     /locus_tag="SSUBM407_RS03650"
                     /old_locus_tag="SSUBM407_0677"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002937073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2304 domain-containing protein"
                     /protein_id="WP_002937073.1"
                     /translation="MTIQALAMFLASLGFLYFIFRNINKNKILFEHAFMWIVIGFGLI
                     VFALFDVIPIKLAYLFGFGLTSNFLLSVAIFVLLVIGFLHSMALSQQKQQIKNLIQEV
                     SMAKKRISELEEHHAE"
     gene            751824..752594
                     /locus_tag="SSUBM407_RS03655"
                     /old_locus_tag="SSUBM407_0678"
     CDS             751824..752594
                     /locus_tag="SSUBM407_RS03655"
                     /old_locus_tag="SSUBM407_0678"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_012027227.1"
                     /translation="MQNNHTFVICAYGDSKYLEECIHSLKQQTLQSQLILYTSTPSEY
                     IEQICQKNAIVMHTAQGGGIGKDWNLALSFVTTPYATIAHQDDIYLPDYCEKIMSQMT
                     EETLIAYSDYQEVKEGVAIPLTSNLKIKQLMLRTMAMFPKWKFWRNRVLAFGNPISCP
                     AVTYNLKKLNDFKFNEEMKVSLDWFAWYQIAQKNGSFTFVDESLMYHRIHEESETTNS
                     IENNIRTQEDYEMYLLFWPKFIAKFLLSYYVKSQETNN"
     gene            752777..753265
                     /locus_tag="SSUBM407_RS03660"
                     /old_locus_tag="SSUBM407_0679"
     CDS             752777..753265
                     /locus_tag="SSUBM407_RS03660"
                     /old_locus_tag="SSUBM407_0679"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EbsA family protein"
                     /protein_id="WP_012027226.1"
                     /translation="MIKIFGKIRYHWQPDLSWAIIYWSLTFTPIFIGMALLLEKLQVS
                     RLFILLVSLFAVLVVLGLHRYFEIKDEHLRIASANPFAVQKIEIATIEKIEVSYLAIR
                     IFAKEFPNGRMYYMRKWTKKYFINHLAIHSCFKGKIELIDHLIKQDYFEEYYTKKAKS
                     IR"
     gene            complement(753254..753448)
                     /locus_tag="SSUBM407_RS03665"
                     /old_locus_tag="SSUBM407_0680"
     CDS             complement(753254..753448)
                     /locus_tag="SSUBM407_RS03665"
                     /old_locus_tag="SSUBM407_0680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009910133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_012775197.1"
                     /translation="MKVKLIPERCIACGLCQTYSSLFDYDDDGIVVFSDDSQFEKTIE
                     PNPDILKAIKSCPTKAISAD"
     gene            753499..753975
                     /locus_tag="SSUBM407_RS03670"
                     /old_locus_tag="SSUBM407_0681"
     CDS             753499..753975
                     /locus_tag="SSUBM407_RS03670"
                     /old_locus_tag="SSUBM407_0681"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysM peptidoglycan-binding domain-containing
                     protein"
                     /protein_id="WP_012027224.1"
                     /translation="MSQEPWNEEVYHTETTSRKERLSKGVANTTVFTVLAIIFFVIVL
                     IIGIMAVYLSIGGGSKTDSTKEFYTPSTTTVVAESSSSAAETQESTSTDTTETETSSS
                     PAEATDGSTLTVQAGEGVGQLAARGGISIAELERLNPEKMTTGSWIAHPGDVVRIR"
     gene            753985..754662
                     /locus_tag="SSUBM407_RS03675"
                     /old_locus_tag="SSUBM407_0682"
     CDS             753985..754662
                     /locus_tag="SSUBM407_RS03675"
                     /old_locus_tag="SSUBM407_0682"
                     /EC_number="2.7.4.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003087727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(d)CMP kinase"
                     /protein_id="WP_012775570.1"
                     /translation="MKSIQIAIDGPASSGKSTVAKIIAKNLGYTYLDTGAMYRSATYL
                     ALTNGIEITDQNRIVDLLAQYPIRFGRDENGQQLVFVGDEDVTLPIRDNQVTNNVSAV
                     AALPLVREELVRLQQDIAQAGGIVMDGRDIGTVVLPQAELKIFLVASVEERALRRFKE
                     NTERGIETDLESLKEEIAARDYKDSNREVSPLKAADDAITFDTTGVSIEGVVKFISEK
                     AKEILDR"
     misc_feature    754689..754817
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00558"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="ribosomal protein L20 leader region; Derived by
                     automated computational analysis using gene prediction
                     method: cmsearch."
                     /db_xref="RFAM:RF00558"
     gene            754843..755364
                     /gene="infC"
                     /locus_tag="SSUBM407_RS03680"
                     /old_locus_tag="SSUBM407_0683"
     CDS             754843..755364
                     /gene="infC"
                     /locus_tag="SSUBM407_RS03680"
                     /old_locus_tag="SSUBM407_0683"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008808772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="WP_032497583.1"
                     /translation="MAKQDLFINDEIRVREVRLIGLEGEQLGIKPLNEAQAIADSANV
                     DLVLIQPQAKPPVAKIMDYGKFKFEYQKKQKEQRKKQSVVTVKEVRLSPVIDKGDFET
                     KLRHARKFLEKGNKVKVSIRFKGRMITHKEVGAKVLAEFAEATQDIAIIEQRAKMDGR
                     QMFMQLAPASDKK"
     gene            755391..755591
                     /gene="rpmI"
                     /locus_tag="SSUBM407_RS03685"
                     /old_locus_tag="SSUBM407_0684"
     CDS             755391..755591
                     /gene="rpmI"
                     /locus_tag="SSUBM407_RS03685"
                     /old_locus_tag="SSUBM407_0684"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002895038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="WP_012027223.1"
                     /translation="MPKQKTHRASAKRFKRTGSGGLKRFRAYTSHRFHGKTKKQRRHL
                     RKAGMVHAGDFKRIKSMLTGLK"
     gene            755635..755994
                     /gene="rplT"
                     /locus_tag="SSUBM407_RS03690"
                     /old_locus_tag="SSUBM407_0685"
     CDS             755635..755994
                     /gene="rplT"
                     /locus_tag="SSUBM407_RS03690"
                     /old_locus_tag="SSUBM407_0685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019786714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="WP_012028296.1"
                     /translation="MARVKGGVVSRKRRKRILKLAKGYYGAKHLLFRTAKEQVMNSYY
                     YAYRDRRQKKRDFRKLWITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVND
                     AAAFTALADAAKAKLAK"
     gene            756320..758824
                     /locus_tag="SSUBM407_RS03695"
                     /old_locus_tag="SSUBM407_0686"
     CDS             756320..758824
                     /locus_tag="SSUBM407_RS03695"
                     /old_locus_tag="SSUBM407_0686"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pneumococcal-type histidine triad protein"
                     /protein_id="WP_012775196.1"
                     /translation="MKQGKTLLYVAGASLICAVALVTYQASNYREQSNHQKTTSIETS
                     QSKQSKEIPSDSKKEVPGIDKATDDGFLLTDESQIEEKTDLGIIVNHGDHKHFFFYSD
                     LKNTKWAYLIPENYQEKNHSSQPKRSQLSSGSKQIEDEYVFDPKDIVAEDANGYTVRH
                     GDHYHYILKSSLGGTTHRQLTSDSRQSPTLPIVHQQEGIPGIDFQTSDGFLFDGQNIS
                     GVTETGILVRHGKHLHLIHFETLKRSKWSYLVNQYKPNVESDKKAQPEVENTEYQTKL
                     DYLAKELNLEPSRFKKVIVDGQIGLEYPHGDHTHIVLLKEIDTTKPFESPEDRILKQK
                     DGETLEQRKERLIKQYMERFKVKREDITIDGNYMSVRHGDHAHVYKIDPSLPDDPERD
                     VKTETVNLAIEKQLVYGPFYTEGSTENLTRNGVHQKYRPEGLQDIKNFILVTFSTNSD
                     FGNFVVNGKKTKRVYYLVRKDLNWEDLNIAYPQTLQQKGRVFNGWNATLPKSGKMARE
                     HQSFYADFDNVYRKPTKNIYTPSDDVSNIDLSDYVPVKYSAIANGRLKLNGEIRAGFI
                     YFVKSDLTWKQAKEQGLVVPEPVSSKDYEFIEFRTVITGGEKDTDYVSATTSLAAFGT
                     TAPRIGPYIANNTENPTDINDPSRHPNYYWHDPKNYVALAFRAGEGGQLQTHLGTSKT
                     VVYLVRKGLTLNQAGIFPPSLKSDTGYKRDYTKPVIPNVAWDTPILEDTVYDIHFDKV
                     ESDSKDGTVEPGDTWLPGNPLANTPDVPNGEEDADSWLDDLLTPSPEATDIETVTEAE
                     TTTEDTKATESSTAAPIDIPKKSSTEEEPSEDFIFP"
     repeat_region   complement(758859..758966)
                     /note="Imperfect repeat RepSU1"
                     /rpt_family="RepSU1"
     gene            complement(759020..761200)
                     /locus_tag="SSUBM407_RS03700"
                     /old_locus_tag="SSUBM407_0687"
     CDS             complement(759020..761200)
                     /locus_tag="SSUBM407_RS03700"
                     /old_locus_tag="SSUBM407_0687"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LTA synthase family protein"
                     /protein_id="WP_012775195.1"
                     /translation="MKKLIDYVKKSGQTRLGFVLILLIIYWLKTLWAYYVDFNLDTQG
                     FFQNFIAIMNPLPVGILLLGLSLYIKNTKVFYSVAMIIYIILSVWLFSNAVYYREFSD
                     YISISTIMATSSVSAGLGEAALKLFRLWDIVYFLDFIIFGILVYRKLLRWDKKTFHKK
                     SSFAITALSVMLFSINLFLAEIDRPELLTRGFSNTYIVRALGLPAFLGYNANQTYNAH
                     KNRSGASATDLEPVKQYITEHYAQPNDNYFGIAKGRNVIYLHLESLQQFVIDYKLNVN
                     GVEHEVTPFLNSLYHSSSTLAFSNFFNQVKAGKTSDAETMIETSLFGLNQGSFMVQYG
                     GSNTQQAAPYILSQNGGYTSAVFHGNAASFWNRNNTYKQWGYNYFFDQSYFSKATAEN
                     SFQYGLNDKIMFADSIQYLEHLQQPFYTKFITVSNHYPYTTSLIGDEIGFPLANTDDE
                     TINGYFATANYLDASIKAFFDYLKATGLYENSIIVLYGDHYGISNSRNPDLAPLIGKD
                     SQTWSDFDNAMMQRVPYMIVVPGMTNGGIFDTYGGEIDALPTLEHLLGIKSDNYLQVG
                     QDLLSSQHSQIVALRTAGSFITPKYTSYEGKIYYTETGLEITNPDETTQKEIDAIKEA
                     TAAQLATSDAIQTGDLIRFFDNGLPALDPSQYNYIDSLAAEIALENKLGKQSTSLYST
                     NGNKSTIELFKAPSYLELHGSTTATSTPNTGTSTSSTSTSSNSR"
     gene            761316..762479
                     /locus_tag="SSUBM407_RS03705"
                     /old_locus_tag="SSUBM407_0688"
     CDS             761316..762479
                     /locus_tag="SSUBM407_RS03705"
                     /old_locus_tag="SSUBM407_0688"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent rRNA methyltransferase"
                     /protein_id="WP_004194720.1"
                     /translation="MKIKVNRIAEQKINRGIQLLDSADFSGVSFDEDRLAVLYSESGS
                     YLGQAYLSKQNKGIGWLFSRSNQDLTMDFFVKLFVDAKQKRQHFYQSEMTNAFRLFNQ
                     DGDSFGGMTVDLYDEYAVFSWYNTFIYSVKEMIVAAFQQVFPEVRGAYEKIRFKGLAF
                     ESAHLYGEEAPEYFTVLENGVHYQVFMNDGLMTGIFLDQHEVRGSLVDGLAAGKSLLN
                     MFSYTAAFSIAAAMGGAEETTSVDLAKRSRELSKAHFKVNSLDLDNHHFVVMDVFEYF
                     KYAKRKGLTYDVIVLDPPSFARNKKQTFSVAKDYHKLISQSLEILNTGGTIIASTNAA
                     NVSVEKFKRQIEKGFDVRKHRYEATYRLPADFVINKNDESSNYLKVFTIQVDK"
     gene            762476..763150
                     /locus_tag="SSUBM407_RS03710"
                     /old_locus_tag="SSUBM407_0689"
     CDS             762476..763150
                     /locus_tag="SSUBM407_RS03710"
                     /old_locus_tag="SSUBM407_0689"
                     /EC_number="4.2.1.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002940621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I 3-dehydroquinate dehydratase"
                     /protein_id="WP_012027218.1"
                     /translation="MKIVVPIMPRNLEEVEAIDVERLAEADIVEWRADYLLKDDILRV
                     APAIFEKCSGKEVVFTIRTTREGGHLDLDDQEYVNVIKEVATLYQPDYIDFEYYSYKS
                     VFEQMLEFPNLVLSYHNFEETPSNYMEIMSELTSLSPAVVKMAVMAKTEQDVLDVMNY
                     TRGFKSLNTEQIFATIAMGELGKLTRIAGVITGSCWTFASLDETSAPGQMSLSNTRKF
                     LEILEN"
     gene            763154..764320
                     /gene="aroC"
                     /locus_tag="SSUBM407_RS03715"
                     /old_locus_tag="SSUBM407_0690"
     CDS             763154..764320
                     /gene="aroC"
                     /locus_tag="SSUBM407_RS03715"
                     /old_locus_tag="SSUBM407_0690"
                     /EC_number="4.2.3.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002997861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate synthase"
                     /protein_id="WP_004194717.1"
                     /translation="MRYLTAGESHGPRLTAIIEGVPAGLPLTAEDINEELKRRQGGYG
                     RGSRMQIETDRVEITAGVRHGKTTGAPITLNVTNKDHQKWLDIMAVEDIEEKLKSKRR
                     IKHPRPGHADLVGGMKYRFDDLRNSLERSSARETTMRVAVGAVAKRILAELDIEIANH
                     VVVFGGKEIDVPDGLSVAEIKERAAQSEVSIVNQEREEEIKAYIDQIKRDGDTIGGVI
                     ETVVGGVPAGLGSYVQWDKKLDAKLAQAVVSINAFKGVEFGVGFQAGYLKGSQVMDEI
                     LWSQEKGYTRRTNNLGGFEGGMTNGEALIIRGVMKPIPTLYKPLMSVDIDTHEPYKAT
                     VERSDPTALPAAGVVMESVVATTLATEILEKFSSDNMEELKAAVASHRDYVKNF"
     gene            764328..765431
                     /locus_tag="SSUBM407_RS03720"
                     /old_locus_tag="SSUBM407_0691"
     CDS             764328..765431
                     /locus_tag="SSUBM407_RS03720"
                     /old_locus_tag="SSUBM407_0691"
                     /EC_number="1.3.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydrogenase"
                     /protein_id="WP_012027217.1"
                     /translation="MKKTILIVGLGLIGSSLALCIRKDHPDYHLIGFDPNEQSCQIAL
                     GKGMVDEVSTELEGVAKQADVILLCVPIQVSLRLIEEFSALELKDTVLITDAGSTKSA
                     IVAAAEEHLAPRQINFIGGHPMAGSHKSGASAADLHLFENAYYIMTPCQATKQDAVPR
                     LTDLLSGTGARFVQIDAAEHDRVTSQISHFPHVLASSLMHQAGEYAQDHPFTNNFAAG
                     GFRDMTRIAESEPSMWTSILLTNADSILNRIEEFQARLSEISDVLRSGDQKAIWDFFD
                     KGRQTRKAMEIHKRAGVDSFYDLFLSVPDEEDTILKVLEVLRGISIVNIRINEENRED
                     IHGILQITLKNKGNLEDAAKRLREQTTYKIHLD"
     gene            765441..765779
                     /locus_tag="SSUBM407_RS03725"
                     /old_locus_tag="SSUBM407_0692"
     CDS             765441..765779
                     /locus_tag="SSUBM407_RS03725"
                     /old_locus_tag="SSUBM407_0692"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002938966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YlbF/YmcA family competence regulator"
                     /protein_id="WP_002938966.1"
                     /translation="MSTNIYDIANELERAIRNLPEYKAVEAVKVSVEGNSEAKEILES
                     YISFQKEIQSKLQAGEIPTEADQKKMLDFNKKVQGNPLLTEYFSKQQQLGTYVADLER
                     IIFKPLNELL"
     gene            766042..767187
                     /gene="nagA"
                     /locus_tag="SSUBM407_RS03730"
                     /old_locus_tag="SSUBM407_0693"
     CDS             766042..767187
                     /gene="nagA"
                     /locus_tag="SSUBM407_RS03730"
                     /old_locus_tag="SSUBM407_0693"
                     /EC_number="3.5.1.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-6-phosphate deacetylase"
                     /protein_id="WP_012775571.1"
                     /translation="MTVFIKAKSIILPESEVESAYLEITDKGQFGRIVIEKPEGEIVD
                     YSDFHLAPGLVDTHIHGYASHDVMDNDFEGIKVISEGLLSCGVTSWLPTTLTDTTENL
                     DAVCETIGTYAGQETGAKIQGIFLEGPFFTEKYKGAQNPKCMSDPSIEKLDNWHSLSK
                     GLVNKIAIAPEREGVKEFIEFANSKAIHTALAHSDATYAQAEAAVEAGANIFVHVYNG
                     MSGLHHREPGMVGAALNLKNVYAEMICDGHHVHPAAAEIVVKARGAEETVLITDCMRA
                     GGMGEGESRLGEFEVVVKDGTARLKESGSLAGSILELIEAVQNVVKWGLVSLPDALRM
                     ASLAPARSVNIDHICGRIAEGRAADFIVVDDAGRLQATYLDGVKRFG"
     gene            767210..768211
                     /gene="lacD"
                     /locus_tag="SSUBM407_RS03735"
                     /old_locus_tag="SSUBM407_0694"
     CDS             767210..768211
                     /gene="lacD"
                     /locus_tag="SSUBM407_RS03735"
                     /old_locus_tag="SSUBM407_0694"
                     /EC_number="4.1.2.40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tagatose-bisphosphate aldolase"
                     /protein_id="WP_012775193.1"
                     /translation="MTKLQLSQAKFNHMTRLSNSDQVIAALAIDQRGALKRLLAAAAG
                     GGEFGDDILIDFKKVISSDLTPYASSILLDAEYGVPASELRHADCGFIAAYEKTGYDA
                     STPGRLPDLLPNWSAKRIKELGADAVKILLYYDVDDKPEINDIKHAWVERIGSECIAE
                     DIPYFVEILTYDASDMDVTSREYAALKPHKVNGAMREFSKSRYNADVLKVEVPVNMNF
                     VEGYTDEEPVYTVEEAKAFFKEQTDSTHLPFIYLSAGVSAKLFQETLVFAKEAGSSFN
                     GVLCGRATWKDAVAIFASEGEEAAKAWLADQGRRNVEELNEVLAITARPWTEKVEVK"
     gene            768926..769885
                     /locus_tag="SSUBM407_RS03740"
                     /old_locus_tag="SSUBM407_0696"
     CDS             768926..769885
                     /locus_tag="SSUBM407_RS03740"
                     /old_locus_tag="SSUBM407_0696"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012028292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012028292.1"
                     /translation="MGFKKIILSSVALLSAVTLAACSSNSSDSSSVNVGIIQYAEHEA
                     LSSAREGFVEALEEAGYKEGENLTIDLQNAQGDQANLQTMVEKLAGKNDLNFAIATPA
                     AQTMLNADSETSSVFTAVTDPVEAGLVESLEKPGGTMTGSIDATDVEGQIEMLLKVVP
                     TAKTVGIFYNSSEVNSEVQAEQAKKALEAKGVKVEVTTVTTTNDVQQAITSLAGKVDA
                     IYLPTDNTVASTASTIGDILKEAKVPAMGSDAAVIDAALFTYGVDYHAIGVQAGELAV
                     KILKGEKPADLAVEKPNTAAITVNEEMAKAVGIDAATIKALEE"
     gene            769909..770883
                     /locus_tag="SSUBM407_RS03745"
                     /old_locus_tag="SSUBM407_0697"
     CDS             769909..770883
                     /locus_tag="SSUBM407_RS03745"
                     /old_locus_tag="SSUBM407_0697"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012028291.1"
                     /translation="MYYKLVKKLATISVASMGLLTLAACSSSSEQASSDVVKVGVLQY
                     MEHESLTAAREGFVAELEANGYKEGEKLVLDYQNAQGDQANLQTISEQLIDGNDIVLA
                     IATPSAQSLATVSTETPIVFTAVTDPLSADLVESIEKPGGLLTGTSDQAPIDKQVELL
                     GQAVPDAKTVGILYTTSERNSEVQVEQAKELLEKAGYKVVVKGITSSNEVQDATTSLM
                     KDVDALFIPTDNTVASTMTMIGELSVEHKVPVIGGSTDMVDEGGLLTYGTNYEALGRQ
                     TAKMAIKIIEGANVSETAVEYPETVSLHVNEEMAQKLGIDTSKLAVSE"
     gene            770938..771831
                     /locus_tag="SSUBM407_RS03750"
                     /old_locus_tag="SSUBM407_0698"
     CDS             770938..771831
                     /locus_tag="SSUBM407_RS03750"
                     /old_locus_tag="SSUBM407_0698"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002940642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_002940642.1"
                     /translation="MDIILSSISQGLLWSVMAIGVYLTFRILDIADMTAEGSYPLGAA
                     VCATGIVNGVNPLLATFMAMVAGMGAGLISGLLHTKLKIPALLTGIVTLTGLYSINLK
                     ILGKANVALLKQETLVTQLQDFGLTKTNAVLVIGLVFVLAVVGLLTLLLNTQIGLAIR
                     STGDNIPMSEANGINVDNMKIYGYMLSNGLIALCGALLTQNNGYADLNSGTGTIVIGL
                     ASVIIAEVILRNLRLGWRLLSVVLGAVVYRLIILAILEIPGMDADLVKLFSAILLATV
                     LYVPELQKKLNIRRPKLNGNA"
     gene            771841..772641
                     /locus_tag="SSUBM407_RS03755"
                     /old_locus_tag="SSUBM407_0699"
     CDS             771841..772641
                     /locus_tag="SSUBM407_RS03755"
                     /old_locus_tag="SSUBM407_0699"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003005034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_012027210.1"
                     /translation="MSTILSIQNIHKTFEAGTVNENHVLRGLNLDVKEGDFISIIGGN
                     GAGKSTFMNSLAGALTVDSGDILLEGKSIKYVSAAKRSKDISRVFQDPKMGTASRLTI
                     EENMAIAYRRGLSRGLGWGVKDSERAIFKEALKELGLGLENRMKVDTQFLSGGQRQAL
                     TLMMASLVKPKVLLLDEHTAALDPKTSDMVMELTKKIVESHQLTALMITHNMENAIEY
                     GNRLVMLHRGQIVVDVEGEEKKNLTVQNLMDLFYKNSGEKLTDDEMIL"
     gene            complement(772846..773913)
                     /locus_tag="SSUBM407_RS03760"
                     /old_locus_tag="SSUBM407_0700"
     CDS             complement(772846..773913)
                     /locus_tag="SSUBM407_RS03760"
                     /old_locus_tag="SSUBM407_0700"
                     /EC_number="4.2.3.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002938125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="WP_012775572.1"
                     /translation="MKLTINLPNTPYDILIQRGSLAQTGAWVKELWKPQKIAIITDDH
                     VGSLYRETVQSSLEQAGFETIVFEFPEGEASKNLDTVNQAYEFLVKNGMTRSDGIIAL
                     GGGVVGDLAGFVASTYMRGIHFLQIPTSLTAQVDSSIGGKTGVNTPFAKNMVGTFCQP
                     DGVLIDPDTLKTLGKRELIEGMGEVVKYGLIDDVELWETLDQLDGSVESILEHADYII
                     YHSCEVKRKVVVEDELDNGVRLYLNFGHTIGHAIEATAGYGQVMHGEAVAIGMVQISR
                     AAEKKGLMPAGMTAKIIAMCEKFGLPTTHQPWNVDELYASLTHDKKTRGKTIKLVIVP
                     QLGQAAIHQIPMEEMLEFLQV"
     gene            complement(773926..774795)
                     /locus_tag="SSUBM407_RS03765"
                     /old_locus_tag="SSUBM407_0701"
     CDS             complement(773926..774795)
                     /locus_tag="SSUBM407_RS03765"
                     /old_locus_tag="SSUBM407_0701"
                     /EC_number="1.1.1.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013643218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase"
                     /protein_id="WP_012027208.1"
                     /translation="MNIDGYTRLAAVVAKPIKHSISPFIHNLAFKETGVNGVYVAWEI
                     PEEDLAVTLENIKRYDMFGINLSMPYKQAVIPYLDSLTDSARLIGAVNTVIHQDGLLI
                     GHNTDGIGFFKSLEKLRGFQVRNKRLTILGGGGASTAIIAQATLDGAKEITIFCRQQS
                     LERTQASLTPIARATGVPMQILALDDSQLLQEHITNSDLLVNGTSVGMDGYSQPVPST
                     IRFPENLLVADVIYQPFETPLLKLAQSQGNPTINGLGMLLFQAAEAFQSWTGQEMPTD
                     LIWDQLVQKYDIK"
     gene            complement(774841..775866)
                     /locus_tag="SSUBM407_RS03770"
                     /old_locus_tag="SSUBM407_0702"
     CDS             complement(774841..775866)
                     /locus_tag="SSUBM407_RS03770"
                     /old_locus_tag="SSUBM407_0702"
                     /EC_number="2.5.1.54"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018364383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /protein_id="WP_012027207.1"
                     /translation="MGIHKRSTSLDIDKVKELSKLEGEFLAAKNQRDEELKRIIRGED
                     DRLLLVIGPCSSDNEEAVLEYARRLSKLQEEVKDKIFMVMRVYTAKPRTNGEGYKGLV
                     HQPDTSKLPDLINGIAAVRNLHYRVITETGLTTADEMLYSANYPLVEDLVSYHAIGAR
                     SVEDQEHRFVASGVDMPTGMKNPTSGNLTVMFNGIYAAQNKQNFIYRDAEVDTDGNPL
                     AHAILRGANTEKGGYEPNYYYDILLKTIKQYEQFGLKNPFIVIDTNHDNSGKNYLEQI
                     RIVRQTLINRDWNEAIRKYVRGFMIESYLEDGRQDSPEVFGKSITDPCLGWEKTEALI
                     REIHQTV"
     gene            complement(775876..776913)
                     /locus_tag="SSUBM407_RS03775"
                     /old_locus_tag="SSUBM407_0703"
     CDS             complement(775876..776913)
                     /locus_tag="SSUBM407_RS03775"
                     /old_locus_tag="SSUBM407_0703"
                     /EC_number="2.5.1.54"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /protein_id="WP_012027206.1"
                     /translation="MKEGDLLFTPISEKIDINQVREHSKLSPETLAKKQARDRELEAI
                     LKGEDNRLLLVIGPCSSDNEEAVLDYAHRLAKLQEEVKDKIFMVMRVYTAKPRTNGDG
                     YKGLMHQPDTDAAPSLINGIKAVRNLHYRVITETGLTTADEMLYPENLPLVDDLVSYI
                     AIGARSVENQQHRFVASGIDVPTGLKNPTSGNLKVMFNGLFAAQKKQSFLFNNTEVET
                     SGNPLAHVILRGAVNENGKYLPNYYYDNLLETIELYDQFGLKNPFIIIDTNHDNSGKN
                     YLEQIRIVRQTLINRDWNESIRNYVRGFMIESYIEDGRQDNPDVYGKSITDPCLGWEK
                     TQELIREIYNR"
     gene            complement(777214..777807)
                     /locus_tag="SSUBM407_RS03780"
                     /old_locus_tag="SSUBM407_0704"
     CDS             complement(777214..777807)
                     /locus_tag="SSUBM407_RS03780"
                     /old_locus_tag="SSUBM407_0704"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1361 domain-containing protein"
                     /protein_id="WP_012027204.1"
                     /translation="MFTKKNILTHLFFLIIAVGLKRYGVTAPDLTWNMFLALVALDFA
                     ILTNHTKSHILKVIAGLLWLFFYPNTFYMVTDIVHMHFANTVLWQRESMILFMLYVPS
                     IFFGVMAGVESVRLIFSAFSIKSYWLKLFMISGLSLLSSFAIHIGRYARLNSWDIFTR
                     PTVVIDEMLAVISWDSLPFILGFTFIQIMVLVFSINE"
     gene            777963..779966
                     /gene="metG"
                     /locus_tag="SSUBM407_RS03785"
                     /old_locus_tag="SSUBM407_0705"
     CDS             777963..779966
                     /gene="metG"
                     /locus_tag="SSUBM407_RS03785"
                     /old_locus_tag="SSUBM407_0705"
                     /EC_number="6.1.1.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019313364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine--tRNA ligase"
                     /protein_id="WP_012775573.1"
                     /translation="MTKTPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEV
                     FYLTGLDEHGQKIEEKAKEAGLTPQAYVDGMAVGVKELWNLLDISYDKFIRTTDDYHE
                     EVVAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLEEVFRDENGKVTSGIAPSGH
                     EVAWVSEESYFLRLSKYQDKLVEFFNAHPDFIQPDGRLNEIMKNFIEPGLEDLAVSRT
                     SFTWGVPVPSNPKHVVYVWIDALLNYATALGYGQEETVNYDKFWNGTVYHMVGKDILR
                     FHSIYWPIMLMMLDMKLPDRLVAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRY
                     YLMRSLPVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFGGQVPTFVANVT
                     DFDADLAAVVADNLASYHKYMEAVDYPRALEAVWNIISRTNKYIDETAPWVLAKDEAD
                     RDKLAAVMAHLTAGLRVVAHLIQPFMMTTSNAIMEQLGLGTAFDLENLDFAGLPAGLT
                     VVAKGTPIFPRLDMEEEIAYIQAQMGGSSAISQEEEKEWNPADVELKNEKAAIKFEDF
                     DKVEIRVAEVKEVAKVKGSDKLLKFRLDAGDGQDRQILSGIAKYYPNEQELVGKKVQI
                     VANLKPRKMMGLLSQGMILSAEHGDNLTLLTVDPSVPNGSQIG"
     gene            780030..780971
                     /locus_tag="SSUBM407_RS03790"
                     /old_locus_tag="SSUBM407_0706"
     CDS             780030..780971
                     /locus_tag="SSUBM407_RS03790"
                     /old_locus_tag="SSUBM407_0706"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein CoiA"
                     /protein_id="WP_012027201.1"
                     /translation="MLVALDEDGQVFNVLENPAPQGSFSCPGCGGLVRYKSGKVLRSH
                     FAHVTLRDCHYFSENESAQHLSLKSCLYRWLVNAEQVELEKCLTSIGQVADLFVNNSL
                     ALEVQCSGLPISRLQLRTQAYSEAGYQVLWLLGKDLWLKERLTNLHKQFLSFSMNMGF
                     HLWELDDEKKELRLRYLIHEDLRGKVHCLTKVFPFGEGNLLDILRLPFAKQALSHLTC
                     PLDRDLPRYIAQQLYYKSPNWLALQAESYSRGENLLTKTAEEWYPHIRLPRSAIGFAQ
                     IQKDLTLVYQDFDQYYGNIEDKQKQVLYPPIIYRKPM"
     gene            781202..783004
                     /gene="pepF"
                     /locus_tag="SSUBM407_RS03795"
                     /old_locus_tag="SSUBM407_0707"
     CDS             781202..783004
                     /gene="pepF"
                     /locus_tag="SSUBM407_RS03795"
                     /old_locus_tag="SSUBM407_0707"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004299006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoendopeptidase F"
                     /protein_id="WP_012027200.1"
                     /translation="MSKQRYEIEEKYQWDLTTIFPTDEAWEAELADLQAETEKTKEFA
                     GHLLDSAKSLLEISETQLSLMRRIEKLYVYASMKNDQDTREGKYQEFQAKAMGLYAVF
                     SQAFAFYEPEFMGITEEKLEAFKVEEPALVQYSHQFEKLLAAKDHVLSQEVEEVLAAT
                     SEIFESPAETFSVLDNASLRFPEITDEDGHLVPLSHGNYIHFMESKNRDVRQEAYEAM
                     YGTYEQFQHTYAKTLQSNVKVNNLKARLRKYDSARHASLAANFIPESVYDTLVAAVNK
                     HLPLLHRYINLRKKLLGIDDLKMYDMYTPLSDFSTKISYEDALKKCQETLEIFGEDYS
                     AIVKEAFENRWIDVHVNEGKRSGAYSGGAYDTNAFMLLNWQDNLDNMYTLIHETGHSL
                     HSMLTRKTQPYVYGHYSLFLAEIASTTNENLLTEKLLAEVEDDKERFAILNHYLDGFR
                     GTVFRQTQFAEFEQAIYKADQEGQVLTADFLNELYGQTNEKYYGLSAEENPEIQFEWA
                     RIPHFYYNFYVYQYATGFAAASALANKIVNGSPEDKENYLNYLKAGSSDYSLNVIAKA
                     GVDMTKEDYLNDAFKVFEARLEELEALVEKGVHL"
     gene            783006..783446
                     /locus_tag="SSUBM407_RS03800"
                     /old_locus_tag="SSUBM407_0708"
     CDS             783006..783446
                     /locus_tag="SSUBM407_RS03800"
                     /old_locus_tag="SSUBM407_0708"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775191.1"
                     /translation="MISYKRSIVIPSVISLVLILLGLGGLTKQEPSMGSVVYLIFLQA
                     LLVYLYILRKQKAVFILTKQYLEFQEHFWSERQRHSLEEIAEIRYMVSPVYRGYQSKR
                     LRIVGNKGGLLAVVSLNRLDGADFNDIYHFVEQVAPHIRWDFSN"
     gene            783462..784010
                     /locus_tag="SSUBM407_RS03805"
                     /old_locus_tag="SSUBM407_0709"
     CDS             783462..784010
                     /locus_tag="SSUBM407_RS03805"
                     /old_locus_tag="SSUBM407_0709"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004299013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002938103.1"
                     /translation="MLTEEQLQDIFELADLMSNGDRELFLQLREVVFASDPHEILNFM
                     ERILDSESFDDFLDRVGESEKENLWLILIKLLEHLNYICVRDYKDNLEDFIYFFDCLQ
                     QVRNAGISLKLDSGGLSPIASISEWARVIDNKYLDENFCLGAVDMDTDSYYLFFSKQA
                     TFIRLQELAGNLGYRIDYAKNM"
     gene            784085..784804
                     /locus_tag="SSUBM407_RS03810"
                     /old_locus_tag="SSUBM407_0710"
     CDS             784085..784804
                     /locus_tag="SSUBM407_RS03810"
                     /old_locus_tag="SSUBM407_0710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009910106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-methyltransferase"
                     /protein_id="WP_009910106.1"
                     /translation="MVESYSKNANHNMRRPVVKEEIVDFMRTRQAQNTGFLKELEEFA
                     HQENIPVIPHETVAYFRLLMQTLQPKRILEVGTAIGFSALLMADNSPHSKITTIDRNE
                     EMIGFAKENFAKYDYRQQIELLEGEAMDILPTLPDNTYDFIFMDSAKSKYIVFLPEVL
                     KKVKVGGLIILDDIFQGGDVAKDIKDIRRGQRTIYKGLQRLFDATLDNPDVTASLVSM
                     SDGLLMLRKNVENVDLKHIEI"
     gene            784865..785866
                     /gene="prsA"
                     /locus_tag="SSUBM407_RS03815"
                     /old_locus_tag="SSUBM407_0711"
     CDS             784865..785866
                     /gene="prsA"
                     /locus_tag="SSUBM407_RS03815"
                     /old_locus_tag="SSUBM407_0711"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase PrsA"
                     /protein_id="WP_002938100.1"
                     /translation="MKQTKKILAGAVTLFAAVTLAACSNAADKDIITMKGNTITVSEF
                     YEKVKTNSQAQQVLLSMVISNVFENQYGDKVSAEEVNKEYDKKAEQLGASFNAALSSA
                     GLTEESYKEQIRTNKLVEYAVKQAAEKELTDENYKAAYDAYTPEVTARVIKLADEAKA
                     KEVLAAAQAEGADFAQLAKDNSTDTTTKDNGGEVKFDSTSTTVPAEVQKAVFALDAGQ
                     VGASVISSVDMKTYTTSYYVVKLDAKSEKSAKWEDYKDKLKEIILAQKQRDSSFVATV
                     LKEALQKANVKVKDSAFQNLLSQYVTTEESSSSSTKSSSSSTESSSSTTESSSSSGQ"
     gene            786134..786619
                     /locus_tag="SSUBM407_RS03820"
                     /old_locus_tag="SSUBM407_0712"
     CDS             786134..786619
                     /locus_tag="SSUBM407_RS03820"
                     /old_locus_tag="SSUBM407_0712"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003055592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LURP-one-related family protein"
                     /protein_id="WP_012775190.1"
                     /translation="MKQFQVKQRFTFGGEKFDIRDSFGNLAYQVEGSFLEIPKRFIVT
                     NSRGGEVCQITKKFLTFLPQFTIDMVEGHSFYLQKEFTFFKDRYTVENLGLILDGNIW
                     DLDFRLKRPDGMLVAEISKELFHLTSHYSVTVLEDSCADLVISLVVAIDYIEMMEDAS
                     T"
     gene            786899..789517
                     /gene="alaS"
                     /locus_tag="SSUBM407_RS03825"
                     /old_locus_tag="SSUBM407_0713"
     CDS             786899..789517
                     /gene="alaS"
                     /locus_tag="SSUBM407_RS03825"
                     /old_locus_tag="SSUBM407_0713"
                     /EC_number="6.1.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000661542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine--tRNA ligase"
                     /protein_id="WP_012027193.1"
                     /translation="MKNLSSAQIRQMWLDFWKSKGHSVEPSANLVPVNDPTLLWINSG
                     VATLKKYFDGSVIPDNPRITNAQKSIRTNDIENVGKTARHHTMFEMLGNFSIGDYFRD
                     EAIEWGFELLTSPEWFAFPKDKLYMTYYPDDMDSYNRWIALGVEPSHLIPLEDNFWEI
                     GAGPSGPDTEIFFDRGTDFDPENIGIRLLEEDIENDRYIEIWNIVLSQFNADPAVPRS
                     EYKELPNKNIDTGAGLERLAAIFQGAKTNFETDLFLPIIREVEKISGKTYDQDGDNMS
                     FKVIADHIRALSFAIGDGALPGNEGRGYVLRRLLRRASMHGQRLGITEPFLYKLVETV
                     GNIMESYYPEVLEKRAFIEKIVKSEEESFARTIHTGSQFAEQLMDKLAAEGKSEIDGR
                     DIFKLYDTYGFQVELTEELAEHRGMTLDIAGFEAAMKEQQDRARASVVKGGSMGMQNE
                     TLAAITEESTFVYGQTALEASLSVIVADNARTEAVSEGQALLVFDQTPFYAEMGGQVA
                     DHGFVKNATGDIVATVIDVQKAPNGQPLHTVELSASISVGQTYTLEIETKRRKGVEKN
                     HTATHLLHAALHNIIGEHATQAGSLNEQDFLRFDFTHFEAVTAEELRRIEEEVNEQIW
                     NAIPVVTVETDIDTAKEMGAMALFGEKYGKEVRVVTIGDYSVELCGGTHVGNTAEIGI
                     FKILKEEGIGSGTRRIIAVTGREAFLAYRDQEDALKEVAATIKSPQIKEVPNKVESLA
                     QQVRDLQKENAALKEKAAAAAAGDVFKNVKDANGIRYIASQVQVSDAGALRTFADNWK
                     QKDYSDVLVLVAAIGDKVNVLVASKSSDVHAGNLIKVLAPIVAGRGGGKPDMAMAGGS
                     DASAIQTLLNSVADNL"
     gene            789726..789926
                     /locus_tag="SSUBM407_RS03830"
                     /old_locus_tag="SSUBM407_0714"
     CDS             789726..789926
                     /locus_tag="SSUBM407_RS03830"
                     /old_locus_tag="SSUBM407_0714"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775189.1"
                     /translation="MKKINNSDMAGFVQLIAIIYLVFVLLADIMKWQQLDQTHVTLAI
                     CAIAVTTGSLKKLGGRKESKVK"
     gene            789960..790184
                     /locus_tag="SSUBM407_RS03835"
                     /old_locus_tag="SSUBM407_0715"
     CDS             789960..790184
                     /locus_tag="SSUBM407_RS03835"
                     /old_locus_tag="SSUBM407_0715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012775188.1"
                     /translation="MKTSSNKKGILITGTSVVRGLEVIIALFLIYAFVQILGFGQPID
                     MVPLLMMVSSLFILKTTLGREKEKKNEQDS"
     gene            790370..790936
                     /locus_tag="SSUBM407_RS03840"
                     /old_locus_tag="SSUBM407_0717"
     CDS             790370..790936
                     /locus_tag="SSUBM407_RS03840"
                     /old_locus_tag="SSUBM407_0717"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012028280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3267 domain-containing protein"
                     /protein_id="WP_012028280.1"
                     /translation="MEAKKKLYEVNIMENKKFVWGLNILAVVLIFPFAFVFGMIVSWL
                     IANGSQYSELSVSEVWLLIPLYILLIVVHEAIHGIFFKVFCPENPVKYGFKWKSGMAY
                     ATSPGSLYNRMQMLVISLAPFVVISLVLTMVAGFGMMNITLYFMLATMHAASCAGDFY
                     YTYLLLVKFAKGNIAVEDTETGLIIYQA"
     gene            790949..791164
                     /locus_tag="SSUBM407_RS03845"
                     /old_locus_tag="SSUBM407_0718"
     CDS             790949..791164
                     /locus_tag="SSUBM407_RS03845"
                     /old_locus_tag="SSUBM407_0718"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003051509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_012028279.1"
                     /translation="MEYVLKNRLKELRARDGLNQTELAKLAEVSRQTISLIERGEYTP
                     SVVIAMRIAQIFNENVENVFQLVEVEE"
     gene            791161..791919
                     /locus_tag="SSUBM407_RS03850"
                     /old_locus_tag="SSUBM407_0719"
     CDS             791161..791919
                     /locus_tag="SSUBM407_RS03850"
                     /old_locus_tag="SSUBM407_0719"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3169 family protein"
                     /protein_id="WP_012028278.1"
                     /translation="MKQGKQISTKQRWMRYSAYMLISAILGGFIGFFGILIFKFSLPS
                     YLNLDNFLICLRIITFLIFAGTVYFGVKANQNYKLYHSISDEDEEHVDELYKKMYRNL
                     EYATISFNVAVSLTLLNLVLGFGVTFFEDGAIMYGSIFDVVFYVILLISQIFIMKLTQ
                     KIRDYKLSAFATVKEMKDFAEAMDEGEKQANYEMSFQIVFTLNQIVLPGLYLFLFVLS
                     MLLQERQITAFLVVAFLHIYINVMQVRMIRRYFK"
     gene            791941..792147
                     /locus_tag="SSUBM407_RS03855"
                     /old_locus_tag="SSUBM407_0720"
     CDS             791941..792147
                     /locus_tag="SSUBM407_RS03855"
                     /old_locus_tag="SSUBM407_0720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009910094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_009910094.1"
                     /translation="MKENKKFISVLKIVYFVGLIGLGLYAVGYIFGEWLATGQIDLSN
                     LNILLPMVLGLPALLLFKKESDKN"
     gene            792173..792862
                     /locus_tag="SSUBM407_RS03860"
                     /old_locus_tag="SSUBM407_0721"
     CDS             792173..792862
                     /locus_tag="SSUBM407_RS03860"
                     /old_locus_tag="SSUBM407_0721"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CPBP family intramembrane metalloprotease"
                     /protein_id="WP_012775187.1"
                     /translation="MNRLGNVKDWNVVKNWKFLLVGLAVVALNVLTQLAMFALPNFDG
                     NNLLIAAVLLLLAVVLGLILTGKLGLWKGEQKWGMVANVGFVVLAFIVMFGLKIIGGQ
                     LIMLEEGYGQTTANQEIINNSGLPTLVLFLFAVFFAPVLEELLFRGILMGRVFGKDSI
                     VGLLLSSFLFGLIHNPTNIGSWVVYGGMGLVLGLAYRISGKYTNALILHSLNNLLGFL
                     LMLLMQSLGLI"
     gene            792872..793189
                     /locus_tag="SSUBM407_RS03865"
                     /old_locus_tag="SSUBM407_0722"
     CDS             792872..793189
                     /locus_tag="SSUBM407_RS03865"
                     /old_locus_tag="SSUBM407_0722"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012028275.1"
                     /translation="MKLFLWILVGFLFFNSLSDRKKVKQLQARVKKLQKTTKGENQMS
                     VLLKELIGSKAKIRFDEEFSIAYEYTILAVDEEWVKISRELANGEIETKLVRVDNIID
                     LSF"
     gene            793199..793873
                     /locus_tag="SSUBM407_RS03870"
                     /old_locus_tag="SSUBM407_0723"
     CDS             793199..793873
                     /locus_tag="SSUBM407_RS03870"
                     /old_locus_tag="SSUBM407_0723"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CPBP family intramembrane metalloprotease"
                     /protein_id="WP_012775574.1"
                     /translation="MLKFIKHVALLFLYFVAYQIASGFLMVGPTLQSIPDIPAQLIDS
                     TIWICAIIGLVLSIALIILLWKYIYPRHSVDYRVTASWFHKIQWPILLYIAFFIIQFI
                     VPVPESENQKLVIEFVSAYPLIAFSSVVIFAPILEELIFRGFFATYFFPKMADMKAVG
                     IYLFVTGALFSLVHMPATLPQFLIYFTMGLNLGWLYLIRRDIRYPIALHMLNNGISYL
                     MILFLV"
     repeat_region   793901..795373
                     /note="IS element, novel IS"
     gene            793981..795102
                     /locus_tag="SSUBM407_RS03875"
                     /old_locus_tag="SSUBM407_0724"
     CDS             793981..795102
                     /locus_tag="SSUBM407_RS03875"
                     /old_locus_tag="SSUBM407_0724"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
                     /protein_id="WP_012775575.1"
                     /translation="MFHFTTLFIGMDVHKESFSLCYYDMMANQFKHSTKVGPNVSYIV
                     NYVNELRRLYGQDVEVLCGYEAGCLGFTLYHQLQAHGIPCIVMAPTTVMKEGSKRVKT
                     DKKDAAQLTKALAFHSYRPVHISTVEDEQVKEYICMRTDHKVALKKIKQQILAFCLRH
                     DFRYTEGSSNWTQKHVRWLCPLNIDGLYAEILTEYLLTYEKLVDQIERYDARIEQLGQ
                     SDSYQEKVSQLFCFIGIKTLTALSIVTEIGGFNRFATAQHFASYLGLTPSENSSGDRE
                     RRGAITKTGNSHVRRLLIEAAQSLAKGTIGYKSKELKRRQSGNRVEVIAYADKANERL
                     RRRYRTLVLGKNKKQNVAKTAIARELSGFIWGMMTGRIA"
     gene            796180..796995
                     /locus_tag="SSUBM407_RS03880"
                     /old_locus_tag="SSUBM407_0725"
     CDS             796180..796995
                     /locus_tag="SSUBM407_RS03880"
                     /old_locus_tag="SSUBM407_0725"
                     /EC_number="1.1.1.69"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate 5-dehydrogenase"
                     /protein_id="WP_012027182.1"
                     /translation="MNQQFSLDQFSLKGKIALVTGASYGIGFAIASAYAKAGATIVFN
                     DINQELVDRGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGIIDILVNNAGII
                     RRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETV
                     SAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELQKDGSRHPFDQ
                     FIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQPEA"
     gene            797046..797687
                     /locus_tag="SSUBM407_RS03885"
                     /old_locus_tag="SSUBM407_0726"
     CDS             797046..797687
                     /locus_tag="SSUBM407_RS03885"
                     /old_locus_tag="SSUBM407_0726"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009569354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiB/LacA/LacB family sugar-phosphate isomerase"
                     /protein_id="WP_012028272.1"
                     /translation="MKIALINENSQAAKNSLIFETLKSVTDAKGYHVFNYGMYGKEGE
                     SQLTYVQNGLLASILLVSKAADFVITGCGTGVGAMLAANSFPGVVCGFAVDPTDAYLF
                     SQINGGNALSLPFAKGFGWGAELNLKLLFERLFAEEMGGGYPRERVIPEQRNARILNE
                     MKAVTYKDLLTVLQEIDQDFLKETISGEHFQEYFFANCQDESIATYLKTVLES"
     gene            797704..798705
                     /locus_tag="SSUBM407_RS03890"
                     /old_locus_tag="SSUBM407_0727"
     CDS             797704..798705
                     /locus_tag="SSUBM407_RS03890"
                     /old_locus_tag="SSUBM407_0727"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar kinase"
                     /protein_id="WP_012775576.1"
                     /translation="MKKVLLIGEPLIRITPTNYQELTDGVESRVFFGGSEINVACNLQ
                     GFGCETKLLTALPQGSLGDRFLDFLDGKGIDTSSVQRKGERVGVYYMEAGFGCRSSQV
                     YYDRGQSSLEAIQVDHFDMEQLFLEVGLVHFSGITVAIGSAVRAWLVQVLKEAKRRKI
                     PISMDLNWRSKMIGLRDAKKVFSQFATYADYCFGLEPIMANEKDWELFERDTATVHTI
                     RERMQTLKEAYKFQAIFHTIRQTDELGRNLYKAYGLADEFCCSQELKTQVLQRVGSGD
                     AFVAGALYKLLEGTSLKAILDFAVASGTYKCSIEGDHMRQSLRKVESLLEGKNDIIR"
     gene            798716..799357
                     /locus_tag="SSUBM407_RS03895"
                     /old_locus_tag="SSUBM407_0728"
     CDS             798716..799357
                     /locus_tag="SSUBM407_RS03895"
                     /old_locus_tag="SSUBM407_0728"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 4-hydroxy-2-oxoglutarate
                     aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase"
                     /protein_id="WP_012775185.1"
                     /translation="MSPSQIISKLKEQGLVVVVRGDDKEVGFKTAQACIAGGITAIEV
                     AYTNPDANMIITELSRCHKDDVSVLIGAGTVLDSVTARQAIMAGASYIVSPSFNIEVA
                     KICHLYAVPYLPGCMTLTEITNALEAGCEMVKLFPGSVLGANYITAIKGPLPHVSIMV
                     TGGVKLNNVSEWFNAGATVLGIGGEFNQLATKGEFGTIQELASSYTSVRDKMK"
     gene            799644..800078
                     /locus_tag="SSUBM407_RS03900"
                     /old_locus_tag="SSUBM407_0730"
     CDS             799644..800078
                     /locus_tag="SSUBM407_RS03900"
                     /old_locus_tag="SSUBM407_0730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIA"
                     /protein_id="WP_012027178.1"
                     /translation="MIKVIVVAHGQFASGILTSLKLIAGEVENIEAIDFSEGMSAQEL
                     KARIKSAILGEREVLILTDLLGGTPFKVSVELATEQKEQNVVVLSGLNLAMILEANFS
                     RLTDDLEQLVGKLITTSKDGIVDSVSLLAEDNHDEELFEDGI"
     gene            800090..801280
                     /locus_tag="SSUBM407_RS03905"
                     /old_locus_tag="SSUBM407_0731"
     CDS             800090..801280
                     /locus_tag="SSUBM407_RS03905"
                     /old_locus_tag="SSUBM407_0731"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 88 protein"
                     /protein_id="WP_012775184.1"
                     /translation="MIKDVLIESIAKKREFRNSTLLSKKEVVAAIELAIQQLVINCEY
                     FGESFPTPATFDNHYPKMDNTEWTNGFWTGALWLGHEYSLNNEMKALAKKNTTSFLER
                     VKQRIELDHHDLGFLYSPSTVADYKLTGSKEALEASLLAADKLMERYQEKGGFIQAWG
                     QLGKAEDYRLIIDCLLNLQLLFFAYEETGEQKYYDVALSHFYASVNTVIRDDASTFHT
                     YYFDPETGKPLKGVTRQGFSDDSSWARGQSWGIYGIPLAYRKIKDPACLNLFKGVTNY
                     FLNRLPEDNVSYWDLIFNDGSGHARDSSATAIAVCGIHEMLKYLPEVDEDKETYKYAM
                     HTMLRSLIDNYANRELAPGRPLLLHGVYSWHSGKGVNEGNTWGDYYYLEALLRFYKDW
                     ELYW"
     gene            801290..801781
                     /locus_tag="SSUBM407_RS03910"
                     /old_locus_tag="SSUBM407_0732"
     CDS             801290..801781
                     /locus_tag="SSUBM407_RS03910"
                     /old_locus_tag="SSUBM407_0732"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016251424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system
                     mannose/fructose/N-acetylgalactosamine-transporter subunit
                     IIB"
                     /protein_id="WP_012027176.1"
                     /translation="MATPNIVMARIDERLIHGQGQLWVKSLGCNTVIVANDKVSEDKI
                     QQTLMKTVIPDSVAMRFFSLQKVIDVIHKANPAQTIFLVIKDLQDALALVKGGVPITE
                     LNIGNIHNAPGKMQVTRSIFFGSEDKAIVRELNDVYKIRFNTKTTPSGNDGAVEVNIL
                     DYI"
     gene            801800..802576
                     /locus_tag="SSUBM407_RS03915"
                     /old_locus_tag="SSUBM407_0733"
     CDS             801800..802576
                     /locus_tag="SSUBM407_RS03915"
                     /old_locus_tag="SSUBM407_0733"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000026606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS
                     mannose/fructose/sorbose/N-acetylgalactosamine transporter
                     subunit IIC"
                     /protein_id="WP_002936077.1"
                     /translation="MTISLIQAALIGLWTAFCFSGLLLGLYTNRCIVLSFGVGIILGD
                     LPTALAMGAISELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVTPEAALALST
                     PIAVGIQFLQTSAYTLHAGAPESAIKHLRAGNLSKFKRVANGTVITFAFLGFALGFLG
                     AYSMDTLLKLVEMIPPVLLTGLSVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAA
                     YLQLPVIGIAIVGSIFALKEFFNKPEQVAVKQEEAHDDWI"
     gene            802563..803378
                     /locus_tag="SSUBM407_RS03920"
                     /old_locus_tag="SSUBM407_0734"
     CDS             802563..803378
                     /locus_tag="SSUBM407_RS03920"
                     /old_locus_tag="SSUBM407_0734"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011889050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS mannose/fructose/sorbose transporter family
                     subunit IID"
                     /protein_id="WP_002936073.1"
                     /translation="MTGSKLTKKDYLNTSLRAFFLQNGFNYSNYQGIGYANVMYPAFK
                     KHFGDDKEGLTKALEENCEFYNTNPHFLPFITSLHLVMLENDLPEEETRGIKMALMGP
                     LAGIGDSLSQFVLAPLLSTIAASLAGQGLVMGPILFFLGMNIILTSIKLLTGLYGYKF
                     GTSVIDKLSDQMATISKVANIIGVTVISGLAVTFVKISVPITFAAGELTEGADQKIVT
                     IQGMLDKIAPALLPALFTILVYYLIKNKKWTTYKLVILTVIIGILGSWLGILA"
     gene            803385..803693
                     /locus_tag="SSUBM407_RS03925"
                     /old_locus_tag="SSUBM407_0735"
     CDS             803385..803693
                     /locus_tag="SSUBM407_RS03925"
                     /old_locus_tag="SSUBM407_0735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit YajC"
                     /protein_id="WP_012027175.1"
                     /translation="MEQQTLYYVLIILVALSTILPVLTSYVNRKRQQKALEEQLEKRQ
                     RYLSTLQAGDEVILFSGLHGKIIKLTDSLVELQIAEGVLVYVEKESIMGKAKELLFTK
                     "
     gene            803790..805358
                     /locus_tag="SSUBM407_RS03930"
     CDS             803790..805358
                     /locus_tag="SSUBM407_RS03930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027174.1"
                     /note="The YSIRK form of extended signal peptide directs
                     nascent proteins to the cross-wall site, while signal
                     peptides lacking YSIRK direct proteins instead to the cell
                     pole. A large fraction of YSIRK proteins are surface
                     proteins anchored by sortase-mediated processing of a
                     C-terminal LPXTG motif; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YSIRK-type signal peptide-containing protein"
                     /protein_id="WP_043032332.1"
                     /translation="MGFFISQSKQHYGIRKYKVGVCSALIALSILGTRVAANQLPSTE
                     TASPQSSQLVETTPETTEAVNLTTEAVMTSEVSSEVSPVTSTETQPSSTAAETLASPQ
                     AVQATKEEEKNLVANGEFASTTAASGNWADPAATNWETWIPANVKKENGQVRIDEGRL
                     HISSTASYRVAVHQTVDVDPNKRYLFSYNVETKDLKGSGVRVRLHSLTAEGKDLSPQE
                     FAYTPYKNGSQAEHIEQILTVSPETRKLKVELFFENSVGQAWLDNISLVEYVEKTPET
                     PEPSLELVQPETGQISLASNKVYLPVRPDLTYRIADAAVAIVEKNMIRPLAAGKTQVD
                     VYDKDTKLSSFELTVTEHQATVFDTLRNNWEDISLANKRYQSNDTQMKAFLGRLDAGV
                     ASSLKKWVEPTNQGKTIFNDIDFSKSSHLTTVYRRLEQMAQVVENPDSAYYHDRSLID
                     LVRKGMNWLYTNVYNENKSIDGNWWDYEIGTPRAVVNTLIYMHPYFSQEEILTYTKPI
                     SKFVPDPTTISVKH"
     gene            805355..806614
                     /locus_tag="SSUBM407_RS03935"
     CDS             805355..806614
                     /locus_tag="SSUBM407_RS03935"
                     /inference="COORDINATES: protein motif:HMM:NF019735.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide lyase 8 family protein"
                     /protein_id="WP_079394405.1"
                     /translation="MTNPVPAVGGNQTDLSKVAILEGALREDADRVRAGAQGLTTIMK
                     FVDKGEGFYKDGSFIDHTNVAYTGAYGNVLIEGFSQLLPVIQPTEFALKEEQTNILYE
                     WIEKAFMPILVRGELMDMTRGRSISRATGESHVQAMEILRSLVRIAESAQPEQKNKLL
                     SFVKAQLTSDTFYDSYRSLKSYKDIDLVNKLLADNQIPAEVDKDYIAAFNNMDKFVYR
                     SAQEGFTFALSMYSSKTQNYEDMNNENRKGWYTADGMVYLYNDDLSHYSNHYWATVDP
                     YRLPGTTTTKDKREDGSGEVTLASDFVGASQLGNRLATIAMNFNNWNNSLTARKAWIV
                     LGNKIVFLGTDIQHQSAQGAVTTIENRKLLTGEKYSYYINGQPVDLSKEVVTDKTQSF
                     YMTNGKDNQSIGYVFLNQLPTYAKLDQ"
     gene            806660..807310
                     /locus_tag="SSUBM407_RS03940"
     CDS             806660..807310
                     /locus_tag="SSUBM407_RS03940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPXTG cell wall anchor domain-containing
                     protein"
                     /protein_id="WP_012027171.1"
                     /translation="MSNSFVSLWHEHAQTSSNYAYVLVPNQSMEKVNQVAASVKLLHQ
                     DRDLQVVYDQEQNVWGVVKYTDTAYKLTDDITLTDSGLYTIQKVEGGYRIAFYNPSTR
                     TVKNGIELTKAGSSLTVEMEPTAAYPSTVWKVTMPEGSDKQTGSVEKTEKEEKQLKEN
                     QPSPEVKQVVHHAAEKTKSSKPRLPQTGEEASLGLGFLGLLTLGAVVDFKCRRSHS"
     gene            807570..809546
                     /locus_tag="SSUBM407_RS03945"
                     /old_locus_tag="SSUBM407_0738"
     CDS             807570..809546
                     /locus_tag="SSUBM407_RS03945"
                     /old_locus_tag="SSUBM407_0738"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009910066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alginate lyase family protein"
                     /protein_id="WP_012027170.1"
                     /translation="MNFEEWIWALPSLSSFGEAIEKGLVMQTIFGKIVANQSAESVKT
                     YILNQQDAAYKELLLSCQNLLNDIFIFEDNWDMEPCSVGYHLAPLDWTADCHGDEEWT
                     FMLNRQEYLWKLVLAYLVEKDSRYMEQVKRFIFSWIEQVTDWYPKRTSSRTLDTAIRC
                     LSWLNILPFLIDWGGLSEAERSQLLVSIQKQLSYLHSHYRAKDTLSNWGIFQTGAMLL
                     AHAYIGDQVDLVELHHFARQEIEEQIQTQILEDGTQFEQSFLYHVEVYKLLLGLAFSL
                     PDYRKQWTSILKKMADYVLQMTGPDGKSVALGDSDVHCTSDILQMTAIFFEDGTYLVD
                     NSKLDLGVLFLVGENGLRIFEHLTAQSSSSGGQHFSESGHSIVKEVDSYLCFKAGPMG
                     SAHSHSDQNSLCFYHKGQPIVIDSGRFSYRECEERYLLKSAWAHSTCILDDNAPGQIK
                     GSWEYDTYPQFISHSYKGFEHCHWMQGIYQAQTSQGLPYWHKRQLLMVGGDLLLIVDS
                     VDCSGQHELISQLILDERVKIGEERLNDLRLYSQKDFEIQKTVRSPRYNQLVETNKLV
                     KKESFQDRLVTFTLLADEAIRVKQLPVYQTDYHLIESGLAFSCQGKGLNILLVVSDND
                     ICKGEKLLQVAGYKLRGKCLVVDRDKRQVVRLKN"
     gene            809643..810644
                     /locus_tag="SSUBM407_RS03950"
                     /old_locus_tag="SSUBM407_0739"
     CDS             809643..810644
                     /locus_tag="SSUBM407_RS03950"
                     /old_locus_tag="SSUBM407_0739"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000412458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_012027169.1"
                     /translation="MSEKFTIKDIAELAQTSKTTVSFYLNGKYEKMSKETRERIERVI
                     RETDYKPSVVARSLNSKNTKLIGVLIGDITNTFSNQIVKGIEEEAHKSGYQVIIGNSN
                     YNQESEDKYIESMLMLGVDGFIIQPTSHFRKYSRIIEDKKKHMVFFDSQLYEHRTSWI
                     KTNNYDAVYDATQLCVENGYQKFILITADISRLSTRIERATGFMDALLDCKQSYQDLT
                     IADENTDIEEIKCFLQGVVNPQEKTLVFVPNCWALPLVFNAMKELKYDFPQVGLLGFD
                     NTEWTNFSSPTISTIVQPAFEEGCQATRMLINQIEGGNQVGRQQVLDCTVHWKDSTF"
     gene            complement(811080..812039)
                     /gene="nrdF"
                     /locus_tag="SSUBM407_RS03955"
                     /old_locus_tag="SSUBM407_0740"
     CDS             complement(811080..812039)
                     /gene="nrdF"
                     /locus_tag="SSUBM407_RS03955"
                     /old_locus_tag="SSUBM407_0740"
                     /EC_number="1.17.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004253599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class 1b ribonucleoside-diphosphate reductase
                     subunit beta"
                     /protein_id="WP_002936057.1"
                     /translation="METYYKAINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDW
                     RKLTAEEKDLVGKVFGGLTLLDTLQSETGVQALRNDIRTPHEEAVYNNIQFMESVHAK
                     SYSSIFSTLNTKSEIEDIFEWTNSNEYLQRKAKIINEIYETGTPLEKKVASVFLETFL
                     FYSGFFTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELSEEEQDKLR
                     DWMYDLLYQLYENEEGYTRSLYDAVGWTEEVLTFLRYNANKALMNLGQDPLFPDSADD
                     VNPIIMNGISTGTSNHDFFSQVGNGYLLGEVEAMTDDDYLYGL"
     gene            complement(812066..812260)
                     /locus_tag="SSUBM407_RS03960"
                     /old_locus_tag="SSUBM407_0741"
     CDS             complement(812066..812260)
                     /locus_tag="SSUBM407_RS03960"
                     /old_locus_tag="SSUBM407_0741"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012027168.1"
                     /translation="MFGFGKTKQENKKLKRENNVLKKAYSQTKKENNKLKKTSDRLAA
                     DGLRHGSPEAGKYLVGKRKK"
     gene            complement(812306..814465)
                     /gene="nrdE"
                     /locus_tag="SSUBM407_RS03965"
                     /old_locus_tag="SSUBM407_0742"
     CDS             complement(812306..814465)
                     /gene="nrdE"
                     /locus_tag="SSUBM407_RS03965"
                     /old_locus_tag="SSUBM407_0742"
                     /EC_number="1.17.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000053857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class 1b ribonucleoside-diphosphate reductase
                     subunit alpha"
                     /protein_id="WP_012027167.1"
                     /translation="MSLKELGDVSYFRLNNEINRPVNGQIPLHKDQEAVKAFFTENVL
                     PNTKQFDSILDKIAYLLEENYLEKEFLDQYSPEFIIKIDQFLKDQNFRFKSFMAAYKF
                     YNQYALKTNDGAYYLESMEDRVLFNALYFAEGDEELALNLANEMIHLRYQPATPSFLN
                     AGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGISLSNLREAGAPIKGY
                     EGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLDVFHPDIISFLSTKKENADEKVR
                     VKTLSLGITVPDKFYELARKNEDMYLFSPYSVELEYGVPYSYLDITEKYDELVANPRI
                     RKTKIKARDLETEISKLQQESGYPYVINIDTANRSNPVDGKIIMSNLCSEILQVQTPS
                     ILNDSQEYLSMGTDVSCNLGSTNIVNLMKSPDFGRSVRTMTRALTYVTDHSHISAVPS
                     IEAGNSQAHSIGLGAMGLHSYLAQNLIDYGSKTAVEFTNIYFMLLNYWTLVESNNIAR
                     ERKATFHNFDKSKYADGTYFDKYVTGDYQPQSDRVKELFEGIFIPSGQDWAELREKVM
                     ADGLYHQNRLAVAPNGSISYINDVSASIHPITQRIEERQEKKIGKIYYPAAGLTTETI
                     PFYKSAYDMDMRKVIDVYAAATEHVDQGLSLTLFLRSELPKELYEWKKENKQTTRDLS
                     ILRNYAFNKGIKSIYYIRTFTDDGEEVGANQCESCVI"
     gene            complement(814498..814716)
                     /gene="nrdH"
                     /locus_tag="SSUBM407_RS03970"
                     /old_locus_tag="SSUBM407_0743"
     CDS             complement(814498..814716)
                     /gene="nrdH"
                     /locus_tag="SSUBM407_RS03970"
                     /old_locus_tag="SSUBM407_0743"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin-like protein NrdH"
                     /protein_id="WP_012027166.1"
                     /translation="MVTIYSKNDCVQCKMTKKFLDQHSVDYKEINLDEQPEFIDHVQG
                     LGFSAAPVIETENDVFSGFQPGKLKALV"
     gene            815103..817772
                     /gene="acnA"
                     /locus_tag="SSUBM407_RS03975"
                     /old_locus_tag="SSUBM407_0744"
     CDS             815103..817772
                     /gene="acnA"
                     /locus_tag="SSUBM407_RS03975"
                     /old_locus_tag="SSUBM407_0744"
                     /EC_number="4.2.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase AcnA"
                     /protein_id="WP_012027165.1"
                     /translation="MEKTQRKRLFYKGEEYSYYALESISMEEKVDIHSLPYTIRILLE
                     SLLRKEDGVDVTKNHIMELLHYQAASPKGEIPFKPSRVILQDFTGVPVVVDLASMRDA
                     VVKAGGNPELINPEIPVDLVIDHSVQVDFFGTEDALEKNIALEFERNNERYEFLKWAE
                     NSFENYRAVPPATGIIHQVNIEFLSDVIINKDGLLYPDSMFGTDSHTTMINGIGVLGW
                     GVGGIEAEAAMLGEASYFPVPEVIGVRLDGQLPKVATATDLALKVTQLLRQENVVGKF
                     VEFFGPGLSSLTLADRATVSNMAPEYGATCGYFPIDGETLHYMRLTNRSEEHVELTEA
                     YAKANYLFYDAERFPSYSKVLELDLSTVVPSISGPKRPQDLIELTDAKAEFQASLIRE
                     VGVRGFGLEEAELDKTASVKYVEGDEQIQTGHVAIAAITSCTNTSNPYVLLAAGLLAK
                     NAVEKGLAVSKTVKTSLAPGSKVVTGYLKKSGLQTYLDTLGFNLVGYGCTTCIGNSGD
                     LCPEVAEAIKEEDLLVSAVLSGNRNFEGRINPLVKANFLASPPIVVAYAIAGNMNVDL
                     TRDPLGYDEKQQAVYLADIMPSREEVDDYIERYVTRDLYKEEYQQVFTDSQAWNAIET
                     KINKNYNWNSSSTYIQNPPYFDNMQADLSIKPLENLSVLAKFGDSVTTDHISPAGNIA
                     RLSPAARYLEENGIVYKDFNSYGSRRGNHEVMIRGTFANIRIKNELADGKIGGWTRVG
                     EEILPIYDAAMRYKEVGVGSIVIAGKDYGMGSSRDWAAKGSSLLGVKAVLAESFERIH
                     RSNLVMMGVLPLQFLEGQSAESLGLTGHESYTIDLPEDVGVGQIVTVHAQTDDVTKEF
                     QALVRFDAEADIRYYRHGGILPMVVRKKLGGKV"
     gene            817769..818887
                     /locus_tag="SSUBM407_RS03980"
                     /old_locus_tag="SSUBM407_0745"
     CDS             817769..818887
                     /locus_tag="SSUBM407_RS03980"
                     /old_locus_tag="SSUBM407_0745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019790817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate synthase"
                     /protein_id="WP_012028268.1"
                     /translation="MTETNGLKDAIACDTRISAIENDRLSYAGYDIAELMENNASFEE
                     VIYLLWNLHLPTQIELNYFEKSLRKEYAISDAVEQCILIQSRRHLHPMSVLRSTVSLL
                     GVYNVHAEENSLEALYEQSIQIMAKVPTIIATFARLRRGLVPIEPRSDLGFAANFLYM
                     LNGEEPSDLQIKAFNKALVLHADHELNASTFAARVTASTLTDLYSCVTTAIGTLKGSL
                     HGGANERVFDMLLAIRESGDTERYLQKKLDSKEKIMGFGHRVYKTVDPRQEYLKEMAR
                     DLTFGTDDEAFYRLSEEVESFIKTKKGLIPNVDFYSATVYHVLGIDSDIFTLIFAMSR
                     MAGWIAHVQEQRKNNKLIRPRSSYLGGRNLVYIPIGKR"
     gene            818890..820071
                     /gene="icd"
                     /locus_tag="SSUBM407_RS03985"
                     /old_locus_tag="SSUBM407_0746"
     CDS             818890..820071
                     /gene="icd"
                     /locus_tag="SSUBM407_RS03985"
                     /old_locus_tag="SSUBM407_0746"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019804703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent isocitrate dehydrogenase"
                     /protein_id="WP_012027162.1"
                     /translation="MAEKILMREGRLIVPDCPVIPYIEGDGIGRDIWSVSQKVIDAAV
                     KKAYAGQRSIQWREVFAGEKAYELMGTSLPNETLEIIREHLVAIKGPLGTPIGKGHRS
                     LNVALRQELDLYACVRPIRYFKGVPSPLKEPEKTDITIFRENTEDIYAGIEWEAGSDE
                     VAKVISFLQEEMGVVNIRFPESSSIGIKPISEEGSKRLIRSAIEYALEHQLKMVTLVH
                     KGNIQKFTEGGFRKWGYELAKEEFATELAEGTLVVNDIIADNFLQQILLAPENFQVVA
                     LTNLNGDYASDALAAQVGGIGISPGANINYQTGHAIFEATHGTAPDIAGKDLANPCSL
                     LLSACMMLEYIGWKEAAVLIIQALEDAFINKNVTLDFAKILDVAHQSTSQFSEVLIDS
                     I"
     gene            820227..820490
                     /locus_tag="SSUBM407_RS03990"
                     /old_locus_tag="SSUBM407_0747"
     CDS             820227..820490
                     /locus_tag="SSUBM407_RS03990"
                     /old_locus_tag="SSUBM407_0747"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019775469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphocarrier protein HPr"
                     /protein_id="WP_002936050.1"
                     /translation="MASKDFHIVAETGIHARPATLLVQTASKFASDITLNYKEKSVNL
                     KSIMGVMSLGVGQGADVTISAEGADADDAIAAITETMEKEGLA"
     gene            820495..822228
                     /gene="ptsP"
                     /locus_tag="SSUBM407_RS03995"
                     /old_locus_tag="SSUBM407_0748"
     CDS             820495..822228
                     /gene="ptsP"
                     /locus_tag="SSUBM407_RS03995"
                     /old_locus_tag="SSUBM407_0748"
                     /EC_number="2.7.3.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014634263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate--protein phosphotransferase"
                     /protein_id="WP_012027161.1"
                     /translation="MTEMLKGIAASDGVAVAKAYLLVQPDLSFETVTVEDTNAEEARL
                     DAALEASQNELSVIRENAVASLGEEAAAVFDAHLMVLADPEMIGQIKETIRAKKTNAE
                     TGLKEVTDMFIAIFEGMEDNPYMQERAADIRDVAKRVLAHLLGVRLPNPATIDEESIV
                     IAHDLTPSDTAQLNKQLVKAFVTNIGGRTSHSAIMARTLEIAAVLGTNNITEIVKDGD
                     VLAVNGITGDVVINPSEEVIAEFKAAGEAYAKQKAEWALLKDAQTVTADGKHFELAAN
                     IGTPKDVEGVNDNGAEAVGLYRTEFLYMDSQDFPTEDEQYEAYKAVLEGMNGKPVVVR
                     TMDIGGDKELPYFDLPHEMNPFLGFRALRISISETGNQMFRTQLRALLRSSVHGKLRI
                     MFPMVALLTEFRAAKAILDEEKANLLAEGVAVADDIQVGIMIEIPAAAMLADQFAKEV
                     DFFSIGTNDLIQYTMAADRMNEQVSYLYQPYNPSILRLINNVIKAAHAEGKWAGMCGE
                     MAGDQQAVPLLVGMGLDEFSMSATSVLRTRSLMKKLDTAKMEEYAHRALTECATAEEV
                     LELQKEYVDFD"
     gene            complement(822310..823797)
                     /locus_tag="SSUBM407_RS04000"
                     /old_locus_tag="SSUBM407_0749"
     CDS             complement(822310..823797)
                     /locus_tag="SSUBM407_RS04000"
                     /old_locus_tag="SSUBM407_0749"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1846 domain-containing protein"
                     /protein_id="WP_002936048.1"
                     /translation="MKKIAFDSTKYLNLQRDHILERIAQFEGKLYMEFGGKMLEDFHA
                     ARVLPGYEPDNKIKLLQELKDQVEIVIAINASNIEHSKARGDLGISYDQEVFRLIDTF
                     NDIDIYVGSVVITQYRNQPAADAFRKQLEKHGIKSYLHYPIKGYPSDIDHIISPEGMG
                     KNDYIETSRNLVVVTAPGPGSGKLATCISQLYHDQLHGVTSGYAKFETFPVWNLPLHH
                     PVNLAYEAATADLDDLNMIDPFHLQTYGKTAVNYNRDIEVFPVLNRTFERILNKSPYA
                     SPTDMGVNMVGYSIVDEEAAIEASKQEIIRRYYQTLVDFKAERVSEQAVKKIELLMNE
                     VGVTPADRKVVIAAREKAELTTSPALAIQLPTGEIVTGKTSDLLKPTATVLLNAIKQI
                     ANIDDETLLIEPNYIRPIQELKADYLDKTNTRLDASEILNALAITAQDSPLAARAMKE
                     LGQLNGSEAHSTVILSDEDKSVLRKLGINLTFDPIYQHNKFYQKN"
     repeat_region   823977..825513
                     /note="IS element"
     gene            824080..825243
                     /locus_tag="SSUBM407_RS04005"
                     /old_locus_tag="SSUBM407_0750"
     CDS             824080..825243
                     /locus_tag="SSUBM407_RS04005"
                     /old_locus_tag="SSUBM407_0750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012677391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS30 family transposase"
                     /protein_id="WP_011922710.1"
                     /translation="MKNKHLTLSDRNDIQIGIEQLKPFSAIAAKLGKDPSTISKEVRR
                     NRVIKENSSTSNCEACPLLKKTPYVCNACPKKRSNCGYQKQFYYAKRAQLDYEVKLSD
                     SRTGVALNKEEFYRMDEIVSAAIQKGQHLNHIIASNEMSASRASIYRYLEKGYLSTKP
                     IDFPRVVKFRKRRIRNLQPIPKIAKEGRSYEDFQRFLTEKGISYWLEMDTVTGRIGGK
                     VLLTFNLSFCNFIFAQLLDNKTANEVAKHLYAIKNDLHQKEMDFCEIFPVILTDNGGE
                     FARVDDIEMDVRGESKLFFCDPNRSDQKGRIEKNHTLIRDILPKRSSFDNLTQEDINL
                     VCSHINSVKRASFNGKSAYELFTFTYGEELATLLGISKIDPENVIQSPRLLDK"
     gene            825616..826887
                     /locus_tag="SSUBM407_RS04010"
                     /old_locus_tag="SSUBM407_0751"
     CDS             825616..826887
                     /locus_tag="SSUBM407_RS04010"
                     /old_locus_tag="SSUBM407_0751"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012775182.1"
                     /translation="MKRLIHNKLFLSSFVADLISNFGDTLYYLALMNYVLLLPDTKFA
                     LAMITASETLPILAGLFIGIWADKTKNKLDTILATLVVRVGLYAFVGFLMGFAPALWV
                     VAVVCVINFLSDLAGQYENGLYMPVSLRVVAAEDRETAMAFKMTVKSLLQIAFQASGA
                     ILIGFMSYQNLAFFNAGTFLVSLAIMATLRPALAKLLKENPIQEAEQTETEAGIIKGM
                     RNSLKESYQAVQNIPVLKASIVTIASLNAIFTALSPLVILNMKEFSDFVIVNAGTTVA
                     LISIFFSVGSILGSSIGMALFKNVSLINLLKFSTLMPVLIFSGFFLHNIYVVLTIIFV
                     TAMTLGVFNPKMNALVLNELPEDKLATVGGGIDAFCQIGMVAGQALVALMVTVLSATS
                     ISLIFLLLSVGLVSYTILVGRKSKNEVVVKA"
     gene            826899..827939
                     /locus_tag="SSUBM407_RS04015"
                     /old_locus_tag="SSUBM407_0752"
     CDS             826899..827939
                     /locus_tag="SSUBM407_RS04015"
                     /old_locus_tag="SSUBM407_0752"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009910042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_012775181.1"
                     /translation="MKLDYRDYRSEIVEKFFIPLIVKEREEPIEADFSQKEKGILKDT
                     LDIRDEIEEKLADFRQEVNQVFVWGYIFNILHSLYFYILNDGQDPKTVEEACQLILKL
                     SQEEVEDAMRTMLASENDGHREKTLSLMELLEKTDKKPADKWYWSLAIRNPLETVERS
                     VHLLDKMLPIYQPYFEQARVEREAFARDFDIEKLYRDSKQLSMTGLDALSVENAQFFV
                     LSPWNYWFAYYGNEEFDYMKVALLASCRIDQIMLSNDELDLDDLTTALKVISDSTRYQ
                     VLVELTKPHAKSKDIAERLAITGAAVSFHTQKLINGDLLLFNTKNSDVKYSVNRELLQ
                     EVIAKLTEDFDL"
     gene            complement(828185..829174)
                     /locus_tag="SSUBM407_RS04020"
                     /old_locus_tag="SSUBM407_0753"
     CDS             complement(828185..829174)
                     /locus_tag="SSUBM407_RS04020"
                     /old_locus_tag="SSUBM407_0753"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012775577.1"
                     /translation="MQNKTKPLNTSLLSLIQFIGAILVIALHCRRLFETDQLHFIQKS
                     IFSRMVVPYFMVTASFFLRRNYPSLSKQYLIRYSKQYLTWSVLYLPFYLFYLNLQEIP
                     LLHYPLALLVGLTYTGTSYQLWYMPAFLLGLVLVHYSLRKWGWRITACLACLLYLLGS
                     VETYSSYLAESIFLTAFDSYKTFFFTSRNGLFYAPIFVLTGFYLADKLNHPIFQYRQK
                     NKLLVCTALLAFEATVIYLKQGYDKNFLFSLIPFTAYLVAWTLTTDLFRQKKFQFLKE
                     YASYYYFIHVIPVEISFFFLENHSLTIIQQGWLVFFITIITCQLLSWLIINTQ"
     gene            829363..830049
                     /locus_tag="SSUBM407_RS04025"
                     /old_locus_tag="SSUBM407_0754"
     CDS             829363..830049
                     /locus_tag="SSUBM407_RS04025"
                     /old_locus_tag="SSUBM407_0754"
                     /EC_number="3.1.26.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014636411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease III"
                     /protein_id="WP_012028264.1"
                     /translation="MKDLHAKLLADFGIDFSDLNLLETAFTHTSYANEHRLLKISHNE
                     RLEFLGDAVLQLMISKYLYQKYPDRPEGEMSKLRSTFVREESLAGFSRACGFDRFLRL
                     GKGEEKSGGRNRDTILGDAFEAFLGALLLDKGEKTVEEFIHKVMIPRLEKGNFERVTD
                     YKTALQEILQVNGEIAISYQVIAESGPAHDKTFEVEVSADQRVIGRGRGRSKKLAEQA
                     AAKNAVEARG"
     gene            830052..833585
                     /gene="smc"
                     /locus_tag="SSUBM407_RS04030"
                     /old_locus_tag="SSUBM407_0755"
     CDS             830052..833585
                     /gene="smc"
                     /locus_tag="SSUBM407_RS04030"
                     /old_locus_tag="SSUBM407_0755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005589495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation protein SMC"
                     /protein_id="WP_012775578.1"
                     /translation="MYLKSIEMQGFKSFADKTKVVFDRGVTAVVGPNGSGKSNITESL
                     RWALGESSAKSLRGGKMPDVIFSGTESRKALNYASVVVTLDNSTGFIANKQKEIKVER
                     HIYRSGDSEYLIDGQKVRLRDIHDLFMDTGLGRDSFSIISQGRVEAIFNSKPEERRAI
                     FEEAAGVLKYKTRKKETESKLAQAQDNLDRLDDIIYELDNQVKPLEKQAQTAKKFLEL
                     DGQRKELYLNVLVAQLSLGKEKLSEKEAELESVKTELTSYYKQRSELEQENLNLKEKR
                     HRLSEQLEREQAVLLDLTKLISDLERKIEVHKLESSQNESSRQEAQARLENLLTRREQ
                     LAEQIEQKQETLAQLDSSLSSLKDDIAAVDKEISYFSEDPDQVLDHLREQYVALMQEE
                     AEASNSLTKIQQDIANQISLSESKSEDLARLQTEKQTAQEVLDKSRKSLEEADHVLRQ
                     LLESYQTKKTELDQVQTAYQAEQGRLFDLLDQLKGKQARQSSLEAILKNHSNFYAGVK
                     AVLQAAPSLGGIIGAVSEQLTFDTRYQTALEIALGGASQNVIVEDEATAKRAIAFLKE
                     KRQGRATFLPLTTIKPRQLSGQQVSLLESSEGFLGLASDLVTYQPNLDAIFQNLLGTI
                     AIFDSIDHANQAARATKFQVRMVTMDGAEIRPGGAFAGGSNRNNSTTFIKPELDALLG
                     EIAELSSQLQEQESLVAAKKTSLDQTREALETIKAEGEEARLNQQSARIHQEQAENRL
                     AQLSAQYDLQMSQVSPTILTELEEAAAKEEVNVQALNEKKLALDQQINQVRDNRDSIQ
                     ESLQKLQTQKGQLTLEQAELTSQLRFEQTDLRRLQEEKVVADKEISLLEDMIDQKLEA
                     LEDTSIEILEEQLQAASDKQNQTNQILIRLKFELEDIDGQFEDLEERLQQARTKNDDL
                     IRKQAKLEADCEQAGDKLRTLLGNLTEHFKLSFEAAQSQAKEVENLAVAEQSLKDLER
                     AIRALGPVNLDAIEQYDEVNNRLTFLNEQRTDILSARDLLLDTIHEMDDEVKERFKVT
                     FEAIRESFKQTFKQMFGGGSADLILTEGDLLTAGVEISVQPPGKKIQSLNLMSGGEKA
                     LSALALLFSIIRVKTIPFVILDEVEAALDEANVKRFGDYLNRFDKESQFIVVTHRKGT
                     MAAADAMYGVTMQESGVSKIVSVKLKDVEKL"
     gene            833582..834391
                     /locus_tag="SSUBM407_RS04035"
                     /old_locus_tag="SSUBM407_0756"
     CDS             833582..834391
                     /locus_tag="SSUBM407_RS04035"
                     /old_locus_tag="SSUBM407_0756"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_012027151.1"
                     /translation="MINKIYASDMDGTFLREDHSFDKERFRRILNQFKEKGYLFVAAS
                     GRSMQSLKLVFEDFVDEIGFVAENGSIVEYQGQTIFMDDPISPEIYLPIIAGIDAGPF
                     GSSRSMVLSGLENFYLLKNAEPQFLEAMTNYYAHFRLVDTFEEVREEIIKINAKFSPE
                     EMDDARRWLNDTFEGVTAMTTGFDNIDIIPNGSNKSVGLSHLCAHFGITRQDVVAFGD
                     NQNDLDMFDFAGLALATENAREEVKAQADWMIGHCNDGAVLAYLEEEVNGN"
     gene            834381..835193
                     /locus_tag="SSUBM407_RS04040"
                     /old_locus_tag="SSUBM407_0757"
     CDS             834381..835193
                     /locus_tag="SSUBM407_RS04040"
                     /old_locus_tag="SSUBM407_0757"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011837207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cof-type HAD-IIB family hydrolase"
                     /protein_id="WP_002936036.1"
                     /translation="MAIKLIALDLDGTLLTSDKRISEANKKALQAARERGVYVVLTTG
                     RPLQAIGTFLEELDLLGENQYSITFNGGLVQENTGRVLDKVGFTIEDVRTIRRVTNDL
                     DLPLDVLYGGDVYSLPSAHESLYLTCNPLLNKIVASDEEMPEDFVYNKAVSAVAADFL
                     DGQIPKIPAELHERFEIFKSRDILLEWSPKGVHKANGLAKLIGHLGIDQSEVMACGDE
                     GNDLSMIEWAGLGVAMANATDEIKSAANLVLPKNNDEDGIAWVIEHYVLNED"
     gene            835195..836469
                     /gene="ftsY"
                     /locus_tag="SSUBM407_RS04045"
                     /old_locus_tag="SSUBM407_0758"
     CDS             835195..836469
                     /gene="ftsY"
                     /locus_tag="SSUBM407_RS04045"
                     /old_locus_tag="SSUBM407_0758"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003094514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle-docking protein
                     FtsY"
                     /protein_id="WP_012775180.1"
                     /translation="MGLFDRLFGQKKQEEQVALVEEVEREQSASSEDTVTTEVESATQ
                     EMEKFQSEVAETELTAEQEAQKQRTLDMMAQYYAAKEAAAARVKEAQEQGFDPAIQTK
                     VKEEPVEEVAPVGQESEQDKYQRTLKKTRTGFGARLNEFFANFRSVDEEFFEELEEML
                     ILSDVGVQVASTLTEELRYEAKLQNAKKIDELRRVIIEKLVDIYEKDGQFSEQINFQD
                     DLTVMLFVGVNGVGKTTSIGKLAYKYKQAGKKVMLVAADTFRAGAVAQLVEWGRRVDV
                     PVVTGPEKSDPASVVFDGVKRAVAEGVDILMIDTAGRLQNKENLMAELEKIGRIIKRT
                     LPDAPHETLLALDASTGQNALSQAKEFAKITPLTGLVLTKLDGTAKGGVVLAIRQELD
                     IPVKLIGFGEKIDDIGEFKSEEFMRGLLEGLV"
     gene            complement(836492..837049)
                     /locus_tag="SSUBM407_RS04050"
                     /old_locus_tag="SSUBM407_0759"
     CDS             complement(836492..837049)
                     /locus_tag="SSUBM407_RS04050"
                     /old_locus_tag="SSUBM407_0759"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015646735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_012027149.1"
                     /translation="MQHKGTQILETERLILRPFQASDVESVFQNWTSDEKVTTYLTWP
                     THQTLQDTEDYVQFCLQSYSQEKTYRWVIELKENQQPIGDISVVSLDERVQAAELGWV
                     LGSKWWGQSYMAEALEAVNHYLLEEVGCLRITAVHDSENRPSGRVMEKVGMTYEGTLR
                     QAARNNRGIVDIAIYSLLHTDRKSR"
     gene            complement(837051..837725)
                     /locus_tag="SSUBM407_RS04055"
                     /old_locus_tag="SSUBM407_0760"
     CDS             complement(837051..837725)
                     /locus_tag="SSUBM407_RS04055"
                     /old_locus_tag="SSUBM407_0760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA alkylation repair protein"
                     /protein_id="WP_012027148.1"
                     /translation="MTEMNIILTQLEVASHAGTLKRYEKIGETKPYYGVPMGAISGIA
                     KAYKNRLDLFAPLWQTGVLEAQYLAIQVAKAKPNQLPQADLENCLNEQISVNVLDKLA
                     SIILSKRKDSKDWEEYLLIQDQAIFQRLGWFLRAKYFAGRTASNQEIEESLDHIRQHL
                     QTADPLVQWTMNQCLVEIAVTYPDYLEQGLAIGQELAVYANMKVPKGCTSAYAPDWIE
                     ALLRRK"
     gene            complement(837925..839412)
                     /locus_tag="SSUBM407_RS04060"
                     /old_locus_tag="SSUBM407_0761"
     CDS             complement(837925..839412)
                     /locus_tag="SSUBM407_RS04060"
                     /old_locus_tag="SSUBM407_0761"
                     /EC_number="1.1.1.49"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018372292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate dehydrogenase"
                     /protein_id="WP_012027147.1"
                     /translation="MSSHVLFTIFGASGDLAKRKLYPSLFRLYKAGHIRENFAVIGTA
                     RRPWTKEFFEQTVIESLGDLPDTPRQAHEFANHFYYQSHDVNDTEHYVALRKLQDDLC
                     EKYNTQHNKVFFLSMAPEFFGTIAKHLKSEQIVDGQGFERLIIEKPFGTSLATATKLN
                     DELAAAFNEDQIYRIDHYLGKEMVQNIFAVRFANIIFEHIWNRDYIDNVQITFAEAIG
                     VEDRGGYYDHSGALKDMVQNHALQVLSLLAMDKPASFKEEDVRAEKIKVFQHLRQPSD
                     EDLKRNFIRGQYAAGSIDGKDYVSYLDEPNIAEGSQTETFAGGVFFVDTDRFRDVPFF
                     FRTGKRLTEKGTRVTITFKHAEDIFGQPSEANVLTIFIQPTEGFMLSINGKEVGSHFA
                     LTPAKLNFRHNATALGNSPEAYEKLFFDVLNGDSTNFSHWEEVKASWSLIDRIVDLWA
                     SNQVPLHTYPAGTMGPEAAFDLLESYSCKWVWTPDVWYRERGLLK"
     gene            complement(839491..840306)
                     /locus_tag="SSUBM407_RS04065"
                     /old_locus_tag="SSUBM407_0762"
     CDS             complement(839491..840306)
                     /locus_tag="SSUBM407_RS04065"
                     /old_locus_tag="SSUBM407_0762"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009754929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03943 family protein"
                     /protein_id="WP_012027146.1"
                     /translation="MIRFLILAGYFEMTMYLYISGKLDQYINLHYSYLAYLSMVLSFI
                     LAIVQLYVWVKEIRVHSHLKSKIAKLSSIGLLLIPLAIAWLFPTVSLDSTTVAAKGYH
                     FPLATENDTNTQNQEGATVQYLKPDTSIYFTKSAYQNQMREIADRYLAEETIVVTNEN
                     YMEVMEAIYDYPTEFSGKTIEMIGFVYNDPDNSQQFFLFRFGIIHCIADSGVYGLLST
                     GATTEFPNNTWVKARGTIKVSYHTSLKQNLPTLELQSMVQIEQPDSPYVYRVF"
     gene            complement(840303..841208)
                     /locus_tag="SSUBM407_RS04070"
                     /old_locus_tag="SSUBM407_0763"
     CDS             complement(840303..841208)
                     /locus_tag="SSUBM407_RS04070"
                     /old_locus_tag="SSUBM407_0763"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_012027145.1"
                     /translation="MLGLDQLPTSVLQAGAIFLSIMIEALPFVLIGAIISGFIDVFIT
                     PDKVRKLLPKNKFLAILFGTFIGFIFPSCECGIVPIVNRLLEKKVPSYTAVPFLVTAP
                     VINPIVLFATFTAFGNSLLFALYRALGAIIVSLVLGIILGFFVKGPILKGSKFDHHQH
                     DYSDKTSWQKVGFALIHAIDEFFDTGRYLVFGCLFASLVQVYIPTAVLTTIGHSPLTA
                     ILLMMLLAFLLSLCSEADAFIGASLLSSFGFAPVMAFLVIGPMVDVKNLLMMKHYFKG
                     KFIVGFIITITLVILGYSLILGGVV"
     gene            complement(841210..841356)
                     /locus_tag="SSUBM407_RS10630"
     CDS             complement(841210..841356)
                     /locus_tag="SSUBM407_RS10630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012027144.1"
                     /translation="MAVTYKRQDDLEKMLEEFASFEKLEEIEYPDPKSKEHSEKNNLN
                     QDKK"
     gene            841479..843437
                     /gene="ligA"
                     /locus_tag="SSUBM407_RS04075"
                     /old_locus_tag="SSUBM407_0764"
     CDS             841479..843437
                     /gene="ligA"
                     /locus_tag="SSUBM407_RS04075"
                     /old_locus_tag="SSUBM407_0764"
                     /EC_number="6.5.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011837172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase LigA"
                     /protein_id="WP_012028263.1"
                     /translation="MKTRISELVSVLNQYAKEYYQLDQPSVSDAEYDTLYRELVELET
                     AHPELILPDSPTHRVGGKMLDGFEKYSHVYPLFSLQDAFSREELEAFDQRVRKEFPQA
                     TYICELKIDGLSISLTYEAGNLVVGATRGDGSVGENITENLKRVADVPLTLPEAVDIT
                     VRGECYMPKASFDRVNKQRQEAGEAEFVNPRNAAAGTLRQLDTGVVAQRGLATFLYQE
                     ASPSEATSQSQVLEKLDALGFVTNHEYCLAESIDDTWDFIEKIAERRDDLPYEIDGVV
                     IKVNDLAIQEELGFTVKAPRWAVAYKFPAEEKEAEILSVDWTVGRTGVVTPTANLSPV
                     QLAGTTVSRATLHNVDYIAEKDIRIGDTVIVYKAGDIIPAVLKVVDKYRKEQEIMPIP
                     SHCPSCQSDLQHYEDEVALRCINPICPSQLMSKLEHFASRDAMNIAGLGSSIVEKLFG
                     AGLVHDVADIYKLTVDDLLTLEGFKEKSANKLYQAIQTSKSNSAECLLFGLGIRHVGS
                     KASKILVEKFGDLETLAFADQEAIASLEGLGQVIAKSLTTFFASEGAQQLLAELKEAK
                     VNLTYLGQVVDENAALSGMTVVLTGKLERMKRNEAKAKLEALGANVAGSVSKKTNLVV
                     AGTDAGSKLTKAQELGIEIKDEAWLESL"
     gene            843448..844491
                     /locus_tag="SSUBM407_RS04080"
                     /old_locus_tag="SSUBM407_0765"
     CDS             843448..844491
                     /locus_tag="SSUBM407_RS04080"
                     /old_locus_tag="SSUBM407_0765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002939803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase family lipid kinase"
                     /protein_id="WP_002939803.1"
                     /translation="MEERKRARLIYNPTSGQEIMKKNVAEVLEILEGYGYETSAFQTT
                     AEKDSAKNEATRAALAGFDLIIAAGGDGTINEVVNGIAPLEKRPQMAIIPTGTTNDYA
                     RALKVPRGNPVEAAKVIGKQQTILMDIGLAKNQKNGFHQEHYFINIAAAGTLTELTYS
                     VPSQLKTMFGYLAYVVKGAELLPQVQFTPVRVEHDEGVFEGSVSMIFVALTNSIGGFE
                     QIVPDAKLDDGNFTLLMVKTGNLFEILHLIRQVLDGGKHIESDLVEYIKTKSLSIENL
                     NPDNRLLLNLDGEFGGEAPVRLYNLSNHIEFFADTDLVSDHAITLDTDQMNREDMAKR
                     FIEETDHIDEAIK"
     gene            844628..844828
                     /locus_tag="SSUBM407_RS04085"
                     /old_locus_tag="SSUBM407_0766"
     CDS             844628..844828
                     /locus_tag="SSUBM407_RS04085"
                     /old_locus_tag="SSUBM407_0766"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit C"
                     /protein_id="WP_002936021.1"
                     /translation="MSLGALALGLACLGVSIGEGLLVASYLSSTARQPEMQSKLMAGV
                     FLGVAFIEGTFFVTLAMTFVLK"
     gene            844865..845581
                     /gene="atpB"
                     /locus_tag="SSUBM407_RS04090"
                     /old_locus_tag="SSUBM407_0767"
     CDS             844865..845581
                     /gene="atpB"
                     /locus_tag="SSUBM407_RS04090"
                     /old_locus_tag="SSUBM407_0767"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002906933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit A"
                     /protein_id="WP_012775579.1"
                     /translation="MEEHLSPTLTLGPVTFDLTMVLVSVITISIIFLLVFWASRRMEL
                     KPKGKQNVLEYVYELTINFTKGNLGDAEAKRYSLFFFTVFTFLLVANNLGLMTKLETA
                     EGHNLWTSPTANMAYDFGLATIATVFCHVEGIRRRGFKAYLKSFVTPWAMAPMNILEE
                     VTNLVSLALRLYGNIYAGEVLVSLLLQLSQQSALAYPIAFALNVVWTVFSVFISCLQG
                     YVFIMLVSMYLNKKISSESE"
     gene            845599..846105
                     /gene="atpF"
                     /locus_tag="SSUBM407_RS04095"
                     /old_locus_tag="SSUBM407_0768"
     CDS             845599..846105
                     /gene="atpF"
                     /locus_tag="SSUBM407_RS04095"
                     /old_locus_tag="SSUBM407_0768"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002936017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit B"
                     /protein_id="WP_002936017.1"
                     /translation="MATTITMQSSTILGNFILVTASFAVLIILIRVFAWDKITGIFEE
                     RANKIANDIDAAEEKLTAAANLVQQREDELVQGRIESQKIIQDAVERAKLEKKRILEQ
                     ADVEIQGLKQKAQLEIEAEKREAQENLRVQVAELAVDLASKIILEDLDQQAHSNLIDR
                     YLDKLGDK"
     gene            846106..846639
                     /locus_tag="SSUBM407_RS04100"
                     /old_locus_tag="SSUBM407_0769"
     CDS             846106..846639
                     /locus_tag="SSUBM407_RS04100"
                     /old_locus_tag="SSUBM407_0769"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012027140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit delta"
                     /protein_id="WP_012027140.1"
                     /translation="MNARENAIVQKYALSFVEKVSDHADIWDMYDQISDLISIIHDSK
                     LNRILLSATVSREEKADFVRTVRQSSFWQINDLIEDVIRDGHADLLLETLERVQLQIS
                     KFKNEFEARVVSVYPLTEAQKERLRHLVEQRFSLRVRNITEELDQSLLGGFIVTVNHK
                     VIDASVRTQLKDIRKKL"
     gene            846643..848163
                     /locus_tag="SSUBM407_RS04105"
                     /old_locus_tag="SSUBM407_0770"
     CDS             846643..848163
                     /locus_tag="SSUBM407_RS04105"
                     /old_locus_tag="SSUBM407_0770"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011889023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit alpha"
                     /protein_id="WP_032497571.1"
                     /translation="MESGVLLINAQEISALLKQQIEGFQPDFDYTETGVVTYIGDGIA
                     RAQGLDNAMSGELLVFENGTIGMAQNLETNDVGIIILGQFTDIREGSVVRRTGKIMEV
                     PVGSALIGRVINPLGQPVDGLGEIRTSKTRPIEYPAPGVMQRKSVNEPLQTGLKAIDA
                     LVPIGRGQRELIIGDRQTGKTSVAIDAILNQKGQDMICIYVAIGQKESTVRTQVETLR
                     QYGALDYTIVVTASASQPSPLLFLAPYAGVAMAEEFMYEGKHVLIVYDDLSKQAVAYR
                     ELSLLLRRPPGREAYPGDVFYLHSRLLERSAKVSDELGGGSITALPFIETQAGDISAY
                     IATNVISITDGQIFLKDDLFNSGIRPAIDAGSSVSRVGGSAQIKAMKKVAGTLRIDLA
                     SYRELEAFTQFGSDLDAATQAKLNRGRRTVEVLKQPLHKPLPVEKQVLILYALTNGFL
                     DSVPIDDILAFEEELYAYFDLHYDGLLDVIRTTKDLPDTDELNAAIQAFKDQSVFK"
     gene            848175..849053
                     /locus_tag="SSUBM407_RS04110"
                     /old_locus_tag="SSUBM407_0771"
     CDS             848175..849053
                     /locus_tag="SSUBM407_RS04110"
                     /old_locus_tag="SSUBM407_0771"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002886026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit gamma"
                     /protein_id="WP_002936012.1"
                     /translation="MAGSLNEIKSKIASTKKTSQITGAMQMVSASKLAKSEQLAQSFQ
                     IYASKVRQITTDLLRGELMASDTSNPMLIRRPVQKSGYIVITSDSGLKGSYNSSILKA
                     VMGMIEQDHDSKDEYEIIAIGSMGADFFRARGINPVFELRGLADNPSFEEVQKIISKS
                     VEMYKNELFDELYVCYNHHVNSLTSQVRVQQMLPVEDLDHNEADGYTATFELEPNREV
                     ILEQLLTQYAESTIYGAILDAKTAENAAGMTAMQTATDNAKNVINDLTIQYNRARQAA
                     ITQEITEIVAGASALE"
     gene            849073..850479
                     /gene="atpD"
                     /locus_tag="SSUBM407_RS04115"
                     /old_locus_tag="SSUBM407_0772"
     CDS             849073..850479
                     /gene="atpD"
                     /locus_tag="SSUBM407_RS04115"
                     /old_locus_tag="SSUBM407_0772"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016398931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit beta"
                     /protein_id="WP_002936008.1"
                     /translation="MSSGKITQVVGPVVDVAFAAEDKLPEINNALVVYKNDDSKQKVV
                     LEVALELGDGVVRTIAMESTDGLTRGMEVLDTGRPISVPVGKETLGRVFNVLGDTIDL
                     EESFPADFEREPIHKKAPAFDELSTSSEILETGIKVIDLLAPYLKGGKVGLFGGAGVG
                     KTVLIQELIHNIAQEHGGISVFTGVGERTREGNDLYWEMKESGVIEKTAMVFGQMNEP
                     PGARMRVALTGLTIAEYFRDVEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQP
                     TLATEMGQLQERITSTKKGSVTSIQAIYVPADDYTDPAPATAFAHLDSTTNLERKLTQ
                     LGIYPAVDPLASSSRALAPQIVGEEHYAVAMEVKRVLQRYQELQDIIAILGMDELSDE
                     EKTLVGRARRIQFFLSQNFNVAEQFTGMPGSYVPVAETVKGFKEILDGKHDHLPEDAF
                     RNVGSIEDVVAKAAKMKF"
     gene            850489..850905
                     /locus_tag="SSUBM407_RS04120"
                     /old_locus_tag="SSUBM407_0773"
     CDS             850489..850905
                     /locus_tag="SSUBM407_RS04120"
                     /old_locus_tag="SSUBM407_0773"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit epsilon"
                     /protein_id="WP_002936007.1"
                     /translation="MGQMTVQIVTPDGIKYDHHAAFVLVKTVDGEMGVYSGHEELIAV
                     LEIGEMKVRRVDDENHVDWIAVNGGIIEVNKDIITVISDSAERERDIDISRAERAKLR
                     AERELEEAQTARNIDMEMRATVALQRAINRIRVGKH"
     gene            850965..851189
                     /locus_tag="SSUBM407_RS04125"
                     /old_locus_tag="SSUBM407_0774"
     CDS             850965..851189
                     /locus_tag="SSUBM407_RS04125"
                     /old_locus_tag="SSUBM407_0774"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1146 domain-containing protein"
                     /protein_id="WP_012775178.1"
                     /translation="MVISILQFFSHILFIYLAHHLLVTTVDWSRWLKVTGDNQRKINL
                     LILFLAIALGYLVSTFFLELLMMGRSFANM"
     gene            851213..852324
                     /gene="murA"
                     /locus_tag="SSUBM407_RS04130"
                     /old_locus_tag="SSUBM407_0775"
                     /pseudo
     CDS             851213..852324
                     /gene="murA"
                     /locus_tag="SSUBM407_RS04130"
                     /old_locus_tag="SSUBM407_0775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014637806.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
     gene            852317..852508
                     /locus_tag="SSUBM407_RS04135"
                     /old_locus_tag="SSUBM407_0776"
     CDS             852317..852508
                     /locus_tag="SSUBM407_RS04135"
                     /old_locus_tag="SSUBM407_0776"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012775177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_012775177.1"
                     /translation="MDKDNLSYVGKNLILVAVVLLIAILVFILGLMVGYGVIGDGDNV
                     FAVLSPAKWQELIGKFTGK"
     gene            852538..853377
                     /locus_tag="SSUBM407_RS04140"
                     /old_locus_tag="SSUBM407_0777"
     CDS             852538..853377
                     /locus_tag="SSUBM407_RS04140"
                     /old_locus_tag="SSUBM407_0777"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014735752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA/RNA non-specific endonuclease"
                     /protein_id="WP_01202826