GenomeNet

Database: RefSeq
Entry: NC_012963
LinkDB: NC_012963
Original site: NC_012963 
LOCUS       NC_012963            2798491 bp    DNA     linear   CON 11-OCT-2017
DEFINITION  Komagataella phaffii GS115 chromosome 1, complete sequence.
ACCESSION   NC_012963
VERSION     NC_012963.1
DBLINK      BioProject: PRJNA39439
            BioSample: SAMEA2272385
            Assembly: GCF_000027005.1
KEYWORDS    RefSeq.
SOURCE      Komagataella phaffii GS115
  ORGANISM  Komagataella phaffii GS115
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Komagataella.
REFERENCE   1
  AUTHORS   De Schutter,K., Lin,Y.C., Tiels,P., Van Hecke,A., Glinka,S.,
            Weber-Lehmann,J., Rouze,P., Van de Peer,Y. and Callewaert,N.
  TITLE     Genome sequence of the recombinant protein production host Pichia
            pastoris
  JOURNAL   Nat. Biotechnol. 27 (6), 561-566 (2009)
   PUBMED   19465926
REFERENCE   2  (bases 1 to 2798491)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2798491)
  AUTHORS   Callewaert,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2009) Callewaert N., Department for Molecular
            Biomedical Research, Flanders Institute for Biotechnology (VIB) /
            Gent University, Technologiepark 927, Ghent, 9052, BELGIUM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FN392319.
            Contact: Nico Callewaert
            Unit for Molecular Glycobiology
            Laboratory for Protein Biochemistry and Biomolecular Engineering
            Department of Biochemistry, Physiology and Microbiology, UGent VIB
            Department for Molecular Biomedical Research, UGent Technologiepark
            927, B-9052 Gent, Belgium
            Tel: (32)93313630
            Fax: (32)93313609
            Email: nico.callewaert@dmbr.vib-UGent.be
            ----------- sequencing/assembly
            Unit for Molecular Glycobiology
            Laboratory for Protein Biochemistry and Biomolecular Engineering
            Department of Biochemistry, Physiology and Microbiology, UGent VIB
            Department for Molecular Biomedical Research, UGent -----------
            annotation
            Unit for Molecular Glycobiology
            Laboratory for Protein Biochemistry and Biomolecular Engineering
            Department of Biochemistry, Physiology and Microbiology, UGent VIB
            Department for Molecular Biomedical Research, UGent
            
            Laboratory for Bioinformatics and Evolutionary Genomics VIB
            Department of Plant Systems Biology, UGent
            Web site: http://bioinformatics.psb.ugent.be/
            Bioinformatics Online Genome Annotation System (BOGAS):
            http://bioinformatics.psb.ugent.be/webtools/bogas/ -----------
            * NOTE: finishing of chromosomes in process
            * Final curation of the annotation in progress.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2798491
                     /organism="Komagataella phaffii GS115"
                     /mol_type="genomic DNA"
                     /strain="GS115"
                     /db_xref="taxon:644223"
                     /chromosome="1"
     gene            <5018..>6499
                     /locus_tag="PAS_chr1-3_0003"
                     /db_xref="GeneID:8196519"
     mRNA            <5018..>6499
                     /locus_tag="PAS_chr1-3_0003"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489298.1"
                     /db_xref="GeneID:8196519"
     CDS             5018..6499
                     /locus_tag="PAS_chr1-3_0003"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489343.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0003"
                     /db_xref="EnsemblGenomes-Tr:CAY67059"
                     /db_xref="GeneID:8196519"
                     /db_xref="UniProtKB/TrEMBL:C4QUY9"
                     /translation="MLAEIGDYFRTNSSNGFSSSCYNKEKLSGDLLESDFVNSSFDDT
                     TLHSMLSSSINADPEQSQKPQQRHKNQSSCHQELKIETEDQQEPYLLPDMLTKNIFNS
                     QSSMFVYSSIPQISSVQSFIDTNTFSAVDGGAAPEGNSLSVDSTLGLSSDQSFEKLYS
                     YDQNFEKEPQSPACPLVKCDPVSIMKTSTNSLETAVNTKRRMFQLRNQNEIESLNVSS
                     DIVVATSKFLNHSWIPLIRGRNFGGSNCKPPKKPLFPGARYVTARLRLEYSSCKDMCL
                     PEWNEYELEDSRRIIRIERLFDSNEIVASFSIVGSAVENPETRPVFNPNVKVLEVSCL
                     RCLTNNNESDEENCVNKDLDGRNRDMVKDSFGCKYYITSVEVIKIIELLVGSSSISDP
                     HQMRKERGRVRSNLAQFWSKRLVSSSRKTMKQGFLPTCNDDYFAELAHRINTYDVRKP
                     RLFDKCIKILEWSKLKPALQRAMQSYYMVQLDESSNKIATANN"
     gene            complement(<10239..>11735)
                     /locus_tag="PAS_chr1-3_0004"
                     /db_xref="GeneID:8197942"
     mRNA            complement(<10239..>11735)
                     /locus_tag="PAS_chr1-3_0004"
                     /product="Hexose transporter with moderate affinity for
                     glucose"
                     /transcript_id="XM_002489299.1"
                     /db_xref="GeneID:8197942"
     CDS             complement(10239..11735)
                     /locus_tag="PAS_chr1-3_0004"
                     /codon_start=1
                     /product="Hexose transporter with moderate affinity for
                     glucose"
                     /protein_id="XP_002489344.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0004"
                     /db_xref="EnsemblGenomes-Tr:CAY67060"
                     /db_xref="GeneID:8197942"
                     /db_xref="GOA:C4QUZ0"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4QUZ0"
                     /translation="MNYEYKHISKLVPRHRVPFFISILLTTVLSPVTMGYDSLMMGNL
                     NALPQYLDYFHIRDDAALLGWMSAAVWVGSILSCFLMQQLSDKLGRKKSIVISVIVGL
                     VGVILQSAAKNIAMFSIGRVIIGFGTQLSVAAAPTLISELALPKHRGFLGGLAFTCFQ
                     VGALIASGVTYGTRNITTTWAWRIPSIIQCVPALFSIAALVFIPESPRWLISVGQFDK
                     ASEVISIAEGIDIDAGMKRVQEIQVVIEEEKARVSSSPWKEITKGVYNWKRLFIMLTQ
                     GLVTELAGSSVGTYYFSLLLNQAGVTDVSTVLQVGIIQSSWCLVIALIACFTLDIVGR
                     KPQALFGTTGMIVSFFILGGLIKKYGNSDNVSGSYGAIACMFLFQGFYNLCWTPMNTL
                     YPPEIWPFKLRSAGVTVFKFFNCGFGLFGTFILPIGMSNLGWKFYMLNAGYDIIFLPI
                     IYFVWVETKGVSLETLDELIGCPVVLDEESLSSVELVQVDGRGKSDKQ"
     gene            <12198..>13325
                     /locus_tag="PAS_chr1-3_0005"
                     /db_xref="GeneID:8197943"
     mRNA            <12198..>13325
                     /locus_tag="PAS_chr1-3_0005"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489300.1"
                     /db_xref="GeneID:8197943"
     CDS             12198..13325
                     /locus_tag="PAS_chr1-3_0005"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489345.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0005"
                     /db_xref="EnsemblGenomes-Tr:CAY67061"
                     /db_xref="GeneID:8197943"
                     /db_xref="UniProtKB/TrEMBL:C4QUZ1"
                     /translation="MVSTVQTVKIDVNAHDASTQSIVRPRELSGNKMNSVEMPSKIEP
                     QVFQAASNAFMDGAPYGDWRDSFIERGYAILKGAIPKDRAQYYESQIHDWIRSFSYTK
                     NLNLNDRSTWREKNLPAHLPINVYGLYCCSHEKFMWDIRQEAGIIDAFSKIWGTDELL
                     VSFDGFSFILPERPDLPPPKSWAHVDQSPFKRGLQCVQGIANLGDASDPKDASLVVYS
                     NSHKYFDEFFDTQTEKNGWTSVDYYSLTESERDWFLSKPDVEEIKLSVNPGDLLVWDS
                     RTIHYGGGADPGSEHIRSAVYVSYSPAKFATTQFLELKKKVFESWSGTTHWAHDNIVL
                     RGKDIPLLPNYEPDPENRSEPLEKPELSDKLLKLAGVRRYS"
     gene            complement(<14951..>15364)
                     /locus_tag="PAS_chr1-3_0008"
                     /db_xref="GeneID:8197944"
     mRNA            complement(<14951..>15364)
                     /locus_tag="PAS_chr1-3_0008"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489301.1"
                     /db_xref="GeneID:8197944"
     CDS             complement(14951..15364)
                     /locus_tag="PAS_chr1-3_0008"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489346.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0008"
                     /db_xref="EnsemblGenomes-Tr:CAY67062"
                     /db_xref="GeneID:8197944"
                     /db_xref="UniProtKB/TrEMBL:C4QUZ2"
                     /translation="MSLALNDLVNSYDALTFGMWIAEQPGATYLSWGQSTMNPDSHLL
                     IKALDAETEELVSSFELKIDGSPSEWLDGIYKLEEENQDEESSMEDENLETRASRCGQ
                     YCSNTPGCRDPVCPACSAVERGDWRKRCTIFWLNR"
     gene            <17266..>19083
                     /locus_tag="PAS_chr1-3_0010"
                     /db_xref="GeneID:8197945"
     mRNA            <17266..>19083
                     /locus_tag="PAS_chr1-3_0010"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489302.1"
                     /db_xref="GeneID:8197945"
     CDS             17266..19083
                     /locus_tag="PAS_chr1-3_0010"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489347.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0010"
                     /db_xref="EnsemblGenomes-Tr:CAY67063"
                     /db_xref="GeneID:8197945"
                     /db_xref="GOA:C4QUZ3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C4QUZ3"
                     /translation="MEAGVHRIRKSQRAPKRCIPCANAKIKCDKNIPCSNCKRKNIAQ
                     FCYREPVVVRNVLHNVNNCPPLGYDELAKENKELKSRISELESKQKSSRPYEPTEYNH
                     SNLPSIRFITRNIHSDKANTRFGSLLQQEQDNISYYCNQKQCIDLLESDFFTYYNVLQ
                     IVEFNLSNISFIHCAVIPFVFMEQLQTQPFDIQDFEVYAGDSLKNLWASKLFGLLASG
                     LHLANEALLAVLGICPKKANDYARVFFILALEALHRGNFLEQPNIAAIEAYCAFNMCF
                     HDFVGSHLQNVMVNITICTARALGLDQLDANANGNDETLELEHKKRLWLILLITDWLD
                     CYGRVSIINPGSFKTPLPLNMDEETLCVYEDSTFVSITYQRLMFQIAQNKRSSYYNDM
                     VQTVSISLDTLVEAEKALQELHETLDKIVNTNKHSRSARNQELNPNFSSQKILLHTAI
                     NMELLDINRMTLLFIPREEWIKNRRDHCIRLARNLISFICGMSFLIYFWIFSEALVVC
                     STFLLLDITLVPEEDDQRLQSVLNARDTLTSLCETHLGARRGLAVVDHLLSLVKRPIS
                     PRYDSSPDDVPNIEHYFNGNELKDLFNVIPEGLFKGDSG"
     gene            complement(<19282..>20943)
                     /locus_tag="PAS_chr1-3_0011"
                     /db_xref="GeneID:8197946"
     mRNA            complement(<19282..>20943)
                     /locus_tag="PAS_chr1-3_0011"
                     /product="Putative transporter, member of the sugar porter
                     family"
                     /transcript_id="XM_002489303.1"
                     /db_xref="GeneID:8197946"
     CDS             complement(19282..20943)
                     /locus_tag="PAS_chr1-3_0011"
                     /codon_start=1
                     /product="Putative transporter, member of the sugar porter
                     family"
                     /protein_id="XP_002489348.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0011"
                     /db_xref="EnsemblGenomes-Tr:CAY67064"
                     /db_xref="GeneID:8197946"
                     /db_xref="GOA:C4QUZ4"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4QUZ4"
                     /translation="MSSFFLNNQTVKMMTPLGRARALNFQGKVYDKFPKTYNIYAIAI
                     TATVSGLMFGFDISSVSSFVSQDHYRNYFNRPDSLTQGGITASMAGGSFLGSLFSSDF
                     QDIFGRRVALHMCSVLWIIGAILQCAAQNQGMLIAGRLISGIGVGFGSASAPVYCSEV
                     APAKIRGMIGGLFQFSVTVGIMIMFYIGYGCHYIDGVASFRLAWGLQMVPGLILLVGV
                     FFLPESPRWLANHNRWEDAVEVIANVVAKGDRENADVRLQLDEVQEQLLIDKDASDFG
                     YLDLFKKDCIKRTFIGVSAQVWQQLCGINVAMYYVVYLFQMAGFTGNVALVSSSIQYV
                     LNVVMTVPALFLMDRIGRRPLLIGGGIFMCIWLFGVAGLLGTYSEPIENFSGDDTVRI
                     TIPDQHKAAARGVIACSYLFVCSFAPTWGICIWVYASEIFNNRQRAKGAAFAASANWI
                     FNFALAMFVPSAFRNITWKTYIIFGVFSFCLTIHVFLQFPETRGKTLEEIDQMFKDNI
                     PAWRSASYVPDMPIFNKEKVVSTEHAENASSSSEKALMVQEEESV"
     gene            <24468..>25064
                     /locus_tag="PAS_chr1-3_0013"
                     /db_xref="GeneID:8197947"
     mRNA            <24468..>25064
                     /locus_tag="PAS_chr1-3_0013"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489304.1"
                     /db_xref="GeneID:8197947"
     CDS             24468..25064
                     /locus_tag="PAS_chr1-3_0013"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489349.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0013"
                     /db_xref="EnsemblGenomes-Tr:CAY67065"
                     /db_xref="GeneID:8197947"
                     /db_xref="GOA:C4QUZ5"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:C4QUZ5"
                     /translation="MSVQSFREIVQIPPSTASVNDSTLIIVDAQNEYVNGKLATVNID
                     QTRKAIAEILQKYRSSEHNGKNIVHVVHQTPDGAPVFTPGTALAQELQELTPHSGEKL
                     VVKNFPNSFAKTDLGPYLQSLGSVGKKLVIVGYMAHICVSTTTRAASELGYEVLVAED
                     GVGDRDIPGVKAANLKDVVLRELADGFATIIKGKDIEQ"
     gene            <25978..>27354
                     /locus_tag="PAS_chr1-3_0014"
                     /db_xref="GeneID:8197948"
     mRNA            <25978..>27354
                     /locus_tag="PAS_chr1-3_0014"
                     /product="Flavin-containing monooxygenase, localized to
                     the cytoplasmic face of the ER membrane"
                     /transcript_id="XM_002489305.1"
                     /db_xref="GeneID:8197948"
     CDS             25978..27354
                     /locus_tag="PAS_chr1-3_0014"
                     /codon_start=1
                     /product="Flavin-containing monooxygenase, localized to
                     the cytoplasmic face of the ER membrane"
                     /protein_id="XP_002489350.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0014"
                     /db_xref="EnsemblGenomes-Tr:CAY67066"
                     /db_xref="GeneID:8197948"
                     /db_xref="GOA:C4QUZ6"
                     /db_xref="InterPro:IPR000960"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:C4QUZ6"
                     /translation="MTFEKSVAIIGGGPSGLATAKALAEEHVFDKIVIFEQQPQVGGV
                     WNYSGTKPGNSPVPSDNPSITREWFANRDDEYVSPMYENLETNVIKDLMGYKDYPFPE
                     ACDILPSRQDVLEYVLNYAVDLKDPISVLVNKEVINLQKTGSEWKLRSRDLISQATTE
                     DSFKYVIIATGHYNFPYVPDVPGLQEWAEADPSSISHSKYYINNQKFKGKKVLVIGNS
                     ASGADISLQLTEVTWPVYRSKKSEGIIKPVEIDDIIDISEIKRYDVSSRTATTADNTT
                     ISNIDHIIFCTGYLYDFPFLKSYMEGEDALITDGQITRRLHRQIFYIPDPSLSFVGIM
                     KNIIPFPLAESQGAVIARVYSGRLELPCEAEMRKDEIEEIKKRGGESKFHSFATPTDV
                     EYAQELASLVDKAVPFDTGFKAEIWTEEKKNRRVDFVDIKQQRHREHRERIKRNRKSH
                     ETSAQAEA"
     gene            complement(<27496..>29475)
                     /locus_tag="PAS_chr1-3_0015"
                     /db_xref="GeneID:8197949"
     mRNA            complement(<27496..>29475)
                     /locus_tag="PAS_chr1-3_0015"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489306.1"
                     /db_xref="GeneID:8197949"
     CDS             complement(27496..29475)
                     /locus_tag="PAS_chr1-3_0015"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489351.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0015"
                     /db_xref="EnsemblGenomes-Tr:CAY67067"
                     /db_xref="GeneID:8197949"
                     /db_xref="GOA:C4QUZ7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4QUZ7"
                     /translation="MFAEKKRIPGTNVLKIEPVAQRRLNSCLSCRSRKRKCDKSRPEC
                     SQCKDHGRQCSYYKSNSNSGQKPVIVQEATKIGAEVLTTGPPRNLQAAFWPFVPNHSD
                     SSNPCSREGPIFTNIMSASLYRSVGNPQTNIEALRHFMPTKEKADKLLSQFLKAVHPI
                     VPVMDLEAVATLYVAFWENRAEPTLDTYITLFSILYAGSVSMYEEANMAEDQVESTEY
                     LVSEMRKYVSATEVALAMSHFPRKATITSLQGAVILHSICRNDCKADDSGSIAMLLRI
                     GHLLELHRDPEHYHKLEDFKEIQRRRLLWWHILYLDGLTSLSSGLLPLMSSNEYDTEY
                     PSEDSSTGGLDQIMVFCNCKFRWIECCNDVMRNFFGIHKPTTLGTEKVNLTLSDLNEY
                     CQQQIQKVGKSEDLMKSSQLSFSKVAISIMSTFADRCHMLLYKKMSENTFVSIADDLE
                     TERTKKVPETSSLGGSISGNVSNEFTQCAIHFLNEFCFYGKMPENKQFLWEIRKFQPL
                     QAILALLRSLIYDGEQVCSMQQPDSQFHSKFLLPLDERVVAIERALNNLGYLSEHTTR
                     LCKERWETVRILKERAFRLLFFDVNVNESEWTLSSSPLNDNDPISENLNSISFQELPS
                     IDWDIIEHEMKDIRSSLEEAIAIKIWDQDSGHFLL"
     gene            <29840..>30607
                     /locus_tag="PAS_chr1-3_0016"
                     /db_xref="GeneID:8197950"
     mRNA            <29840..>30607
                     /locus_tag="PAS_chr1-3_0016"
                     /product="Multifunctional enzyme of the peroxisomal fatty
                     acid beta-oxidation pathway"
                     /transcript_id="XM_002489307.1"
                     /db_xref="GeneID:8197950"
     CDS             29840..30607
                     /locus_tag="PAS_chr1-3_0016"
                     /codon_start=1
                     /product="Multifunctional enzyme of the peroxisomal fatty
                     acid beta-oxidation pathway"
                     /protein_id="XP_002489352.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0016"
                     /db_xref="EnsemblGenomes-Tr:CAY67068"
                     /db_xref="GeneID:8197950"
                     /db_xref="GOA:C4QUZ8"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:C4QUZ8"
                     /translation="MSSLKGKVAIVTGGVRGIGRGIALELAKNGARVAVTYVSDSSKD
                     LAAELVSQIDELAGANSGIAIQADIADLKSGELVLEQVQQKFGQDAVDILVNNAGTSK
                     FSLLEDLTEEDFDLQFGINVKGLIFFTKAILPALKKSKSGRIINLSSGAARSGQLGST
                     IYGSTKASINSLTKVWATELGRKYGITVLAVNPGPVITELFTQSLEKSGLPTPPFPAA
                     AERLGQPEDIAEMVGLLVTEKSHWFTGEVVNVNGGRF"
     gene            <31332..>32954
                     /locus_tag="PAS_chr1-3_0017"
                     /db_xref="GeneID:8197951"
     mRNA            <31332..>32954
                     /locus_tag="PAS_chr1-3_0017"
                     /product="High-affinity cysteine-specific transporter with
                     similarity to the Dal5p family of transporters"
                     /transcript_id="XM_002489308.1"
                     /db_xref="GeneID:8197951"
     CDS             31332..32954
                     /locus_tag="PAS_chr1-3_0017"
                     /codon_start=1
                     /product="High-affinity cysteine-specific transporter with
                     similarity to the Dal5p family of transporters"
                     /protein_id="XP_002489353.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0017"
                     /db_xref="EnsemblGenomes-Tr:CAY67069"
                     /db_xref="GeneID:8197951"
                     /db_xref="GOA:C4QUZ9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C4QUZ9"
                     /translation="MTSLSSSEPERYSSPEITEVGKGGEVVVVSRLDKKSNAVQDKYA
                     DEVLRFMEENAADAVPLTEEEEKKLRHKNFTYILAVAIIVTLVLFMDKATIGYTTILG
                     IYIDTDVDKGRFNNLNSVFYGGYLLAQWPGHYLLQKLPVGKYMAGTVLSWAILVGLHA
                     ACNSYASLMVIRFFLGAVEAVAVPAMEMTLGMFLTSREREIAQPVFWTAAAMAPVISS
                     FIAFGLLHVHVSIQPWRIFMAVNAGISLLLAIFVWFFYPDNPAKATHLSTNEKVHLIK
                     KVQESTKSSIEQKVFKKHQAIECLKDPVSWLFFFQAFTLMLANSMTYQQNQLFVDIGV
                     TTFGSSLVSAAGGGFSVVLFGVSALLIRRFPGQSGYFSASYLVPCIIVAIGMVTIPWD
                     NKIALLACMILLNFKGVTYIVALGWTTSSCSGYTKKLYRNVMFMLAYGVANIISPQLW
                     NPKDSPRYYPSWIVQIVIAFFLNLVILLTIRIILARRNAKRRAWIAENGTEGAFGYVI
                     NHDDDGREIKEKVDVAMLDLTDYENKYFIYPL"
     gene            complement(<33147..>35351)
                     /locus_tag="PAS_chr1-3_0018"
                     /db_xref="GeneID:8197952"
     mRNA            complement(<33147..>35351)
                     /locus_tag="PAS_chr1-3_0018"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489309.1"
                     /db_xref="GeneID:8197952"
     CDS             complement(33147..35351)
                     /locus_tag="PAS_chr1-3_0018"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489354.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0018"
                     /db_xref="EnsemblGenomes-Tr:CAY67070"
                     /db_xref="GeneID:8197952"
                     /db_xref="GOA:C4QV00"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C4QV00"
                     /translation="MPKYRRFPVACHNCRKSKIKCDRNYPCSKCTLKGLSCGYPDKFR
                     SLSLDRLIRSPETSPMSRSSAPSTNDLEKTESNSSLEDLSVPDLSRFSSVSSGSLPMS
                     ASSDSRIGISEIKKSILFSHQCESMFLENSFELSGSLVSVVQYPRGVENPVMLPQFVR
                     DKEKNIQLVKTLIDEYFLFADVPSLSFPVTFSELCRVIDDAEENNTWTRFKGYLFLII
                     AILFRILNILPLEHPLFTNYVYLKDREVQIDLFKRFFFIQNLLSLDSSINVEAMFIMV
                     EEALYGEEYDLCKSTVLELQNCIFFQELCSYVSNYDCSTTANMKPKAKFDMLIKDKKL
                     MRWSDLLSKFCRFGALFSIKLFHEPFEERYPLLRDNNLKTELKLNLAESSIKGMAFPL
                     KWTRSSDREDLLVDAIEIEYQLIYDINYHKLKVRNLLAGAGLSESSLATIFDDDFPIM
                     DEEYGQIDVDDYVPLELTISSSKIHHLKKIFDNLFVILNCQMTRLGLTLQSVALCPVP
                     LKLCLSSLKSGVNGILDLMTVFLDVKRFLCGSLAQFEYDQFRRVIPVINLYIFKFVQG
                     FFHVLHLDPQFLILQKHHISILRQMFQQLRTKIMTTANANPLSMIIRYLDAIEQLCER
                     INDDEQRLGTSTGSISPKIKSWYNAKFPGENVIGRDPSEAQDIPVCLKVKCSFIDSLL
                     KGLDSCKMKRRNMLKDSTEHLTVNVSTELLPLPETEYNGTLDNFYELFFNDH"
     gene            <36296..>37459
                     /locus_tag="PAS_chr1-3_0020"
                     /db_xref="GeneID:8197953"
     mRNA            <36296..>37459
                     /locus_tag="PAS_chr1-3_0020"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489310.1"
                     /db_xref="GeneID:8197953"
     CDS             36296..37459
                     /locus_tag="PAS_chr1-3_0020"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489355.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0020"
                     /db_xref="EnsemblGenomes-Tr:CAY67071"
                     /db_xref="GeneID:8197953"
                     /db_xref="UniProtKB/TrEMBL:C4QV01"
                     /translation="MKFVRGILGLFFIALVEFGSCKVVVKQNSLDAELLNSTIGFLKV
                     SKLEYPVAECQDLKLQNMARCRDALEAYPHLSLLYSFGSFMVNQQKESKSLDAFEDLP
                     LQKDLENWRALFDGALNGLKITLIDVSTNFNKMTDINNSLLESYQAVMFKSFQKMITS
                     IQMKNRNVLRYLYRFNNVITDIDYFKDRVGNSTQETLERLYQMENIPDTDGVTKATKY
                     LNRFKIDVYQQINDLLLYLREINANLVTLSITLNSHIERSLLLLNQESIYNEDIAQFE
                     GFLTNFTNLMETSLEEMEKLEQSTVEVKDSFGLLSQLSLTANTYSYLNLSDYLNHLFV
                     ILMNKFMKILVLFSAWVTTYFVNKGSLMDRMQSAHIGAISFALGVWIVGRCFE"
     gene            <37818..>38126
                     /locus_tag="PAS_chr1-3_0290"
                     /db_xref="GeneID:8197954"
     mRNA            <37818..>38126
                     /locus_tag="PAS_chr1-3_0290"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489311.1"
                     /db_xref="GeneID:8197954"
     CDS             37818..38126
                     /locus_tag="PAS_chr1-3_0290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489356.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0290"
                     /db_xref="EnsemblGenomes-Tr:CAY67072"
                     /db_xref="GeneID:8197954"
                     /db_xref="UniProtKB/TrEMBL:C4QV02"
                     /translation="MHGYAPLDDLNFCAYQKCEYQVIGAGCLKISEVFNGSVSYLLGI
                     HSDLLFQKRVETLFVDTELQIRVFIAPKTSDLSGAYEGTMISKEAVNVSIISVNLFDP
                     "
     gene            complement(<38765..>38980)
                     /locus_tag="PAS_chr1-3_0021"
                     /db_xref="GeneID:8196819"
     mRNA            complement(<38765..>38980)
                     /locus_tag="PAS_chr1-3_0021"
                     /product="Putative protein of unknown function identified
                     by fungal homology comparisons and RT-PCR"
                     /transcript_id="XM_002489312.1"
                     /db_xref="GeneID:8196819"
     CDS             complement(38765..38980)
                     /locus_tag="PAS_chr1-3_0021"
                     /codon_start=1
                     /product="Putative protein of unknown function identified
                     by fungal homology comparisons and RT-PCR"
                     /protein_id="XP_002489357.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0021"
                     /db_xref="EnsemblGenomes-Tr:CAY67073"
                     /db_xref="GeneID:8196819"
                     /db_xref="UniProtKB/TrEMBL:C4QV03"
                     /translation="MLNDTVIVTIDSLPTTTRKEDAWNYYSSLMPYFNRKNIAAPEFR
                     VWSPTTLLGQALSSLTTVDRTGNGAFC"
     gene            <39526..>42300
                     /locus_tag="PAS_chr1-3_0022"
                     /db_xref="GeneID:8197955"
     mRNA            <39526..>42300
                     /locus_tag="PAS_chr1-3_0022"
                     /product="Transportin, cytosolic karyopherin beta 2"
                     /transcript_id="XM_002489313.1"
                     /db_xref="GeneID:8197955"
     CDS             39526..42300
                     /locus_tag="PAS_chr1-3_0022"
                     /codon_start=1
                     /product="Transportin, cytosolic karyopherin beta 2"
                     /protein_id="XP_002489358.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0022"
                     /db_xref="EnsemblGenomes-Tr:CAY67074"
                     /db_xref="GeneID:8197955"
                     /db_xref="GOA:C4QV04"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4QV04"
                     /translation="MSYWTPDPQAVEQLQLILNGTVSGSQSIIAEATEALTQARQQPD
                     FENYLLHILLSNNGTDSQIRASAGLTLKNSIMLKEFAEKPDSVKHHILNEILKGLVDS
                     DSLVRNITGNVVTSLFSLFGVKGWPQVLVQLLDLASSEGQEKAQEGAINALAKICEDS
                     SVDLDKSYNGETPSEFIVPRLLQLMNSPIPRVRAKSVTCINLFLLIKSSAIMSRLDEY
                     MQKLFVLATDQDGSVRRSICTAFVDILDADQIKLQPHLDGVINYCLHSVNDQDEEVAL
                     EACEFLLGLSTSLLDESLLVKKLPQIIPTLLSKMAYSELDIFLIENQDAKDDATEADR
                     DEDIKPQMAKSKNSNRATSSKKERDTSQLEDNNDSEDDSDDDDGSDLSEWNLRKCAAA
                     TLDVLATNFPQEVLDIVFPIVRERIMSPEWPVVEASLLALGAIADGCIDLAKPQLPEL
                     IPFFVEKLKAPQPRVRQITCWTLGRYAQWVCTEAGSGGRYGAYFLPTFQAIMTCALDN
                     KKVVQESACSSLANFVEATDQSMITPLVEPLLYHFQQCFKTYQRKNLIILYDAVQTFV
                     EKAGEMIQANEGYISLLLPPLIEKWQQFSDDDQDLWPLLECMSTVAASLGESFAQYAV
                     PVYERAINILQTCVEQDQRCQTSELITPPEKDFIVTSIDLIDGLVQGLTTHSAELIKQ
                     FNSNERNLMHLLLICFEDSFDDVRQSAFALLGDLSIFLLNDIVKPYLHQVMICIDNEI
                     KHRNYNSNAVCNNATWALGEISMRLSKEEITPYLPSFVSLLIPLLEASDMQSTVLENA
                     AITIGRMGISSNEALAPYANDFINQWCKLMLYLEENEEKETSFIGMCRILSVDPRNLV
                     ISNRQAGLAGLTNFLRCVLYYESPSEELYRMFFTLLNGFSAYFGSEWNVIVSALDQQE
                     RDLLQARYNV"
     gene            complement(<42367..>44352)
                     /locus_tag="PAS_chr1-3_0023"
                     /db_xref="GeneID:8197956"
     mRNA            complement(<42367..>44352)
                     /locus_tag="PAS_chr1-3_0023"
                     /product="Allantoinase, converts allantoin to allantoate
                     in the first step of allantoin degradation"
                     /transcript_id="XM_002489314.1"
                     /db_xref="GeneID:8197956"
     CDS             complement(42367..44352)
                     /locus_tag="PAS_chr1-3_0023"
                     /codon_start=1
                     /product="Allantoinase, converts allantoin to allantoate
                     in the first step of allantoin degradation"
                     /protein_id="XP_002489359.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0023"
                     /db_xref="EnsemblGenomes-Tr:CAY67075"
                     /db_xref="GeneID:8197956"
                     /db_xref="GOA:C4QV05"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="UniProtKB/TrEMBL:C4QV05"
                     /translation="MSRAISSTKVVIDEQVIPATIIFSLHNGKIIEIINKVLSPTDPL
                     LQAYNVLPSDYRNLTPLVILPGLVDAHVHLNEPGRTEWEGFATGTQSAASGGVTTVVD
                     MPLNAIPPTTTVLNLNLKIAAAQGQCWCDVGFWGGLVPDNIEDLVPLVHAGVRGFKGF
                     LLDSGVEEFPAITIGYIEKAMEKVSGLHTILMFHDEMQPCASISSPKGADRIQNVDSV
                     TGDSDSSSVSLESGFSSGTKLTTPASTNVSNTPKSCSDLLHDDIEKLDLGMSQSFIKR
                     APAPVKDLLRKAVQPSAKEEDHSHCKLPHVHARSINHSVLTDSQAKALAKSPYLASSE
                     PIYGRAARLAKSPELKPFTNEYYQERERELELERKARHGQFVIYDEDSDEYNAKSPLA
                     IAAVEDSVLETVDSRAYASFLASRPDSFETTAIGEIIACAQKNPTVPLHIVHLATHEA
                     VPLLRAAIEDGLKITAETCFHYLMFAAENIPDGHTEFKCCPPIRTESNRQLLWQALRK
                     NVITTVVSDHSPCTPDLKDLGNGDFFAAWGGIASVGLGLPILWTEGRKLDEPISFTEI
                     AKWTSLNTAKQAGLHHRKGRIAVGYDADFAVFDPDIEYTVETAKTFFKNKLTAYNGVN
                     FSGRVVETILRGNSVYALGKGVSTIPMGDLLLEPRFH"
     gene            <45316..>46830
                     /locus_tag="PAS_chr1-3_0024"
                     /db_xref="GeneID:8197957"
     mRNA            <45316..>46830
                     /locus_tag="PAS_chr1-3_0024"
                     /product="Succinate semialdehyde dehydrogenase"
                     /transcript_id="XM_002489315.1"
                     /db_xref="GeneID:8197957"
     CDS             45316..46830
                     /locus_tag="PAS_chr1-3_0024"
                     /codon_start=1
                     /product="Succinate semialdehyde dehydrogenase"
                     /protein_id="XP_002489360.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0024"
                     /db_xref="EnsemblGenomes-Tr:CAY67076"
                     /db_xref="GeneID:8197957"
                     /db_xref="GOA:C4QV06"
                     /db_xref="InterPro:IPR010102"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C4QV06"
                     /translation="MNSLSKAAKMSISSLASTYGIKNVNLLRTQGFIDGKWVGDSTST
                     FDVTNPATDDLLLKVSNLTVDDAHKAIKSSSDAFKSFKTTTARYRADILNKMYHLLMD
                     NVDDLAIICSLENGKPVADSAGEVKYAASFYQWFGEEAQRLTGDVIPSNIPSNRIITV
                     KQPVGVVGILTPWNFPLAMISRKVGAAIATGCTAVVKPASETPLSALAMAYLAHEAGL
                     PKGVFNILPVDHATTKSIGELFCEDDTIKKVSFTGSTGVGSVLMTQSAKTLKKLSFEL
                     GGNAPFIVFEDADIDKAVEGALISKLRQSGQTCVCANRLYIHESIYDEFTEKLVAKVK
                     KCKLGNGLTEGTTHGPLVHSRAVDKVQQHVKDCLDKGATLLLGGKVRTDLGPNFHDLT
                     VIGDVTQEMAVAHEETFGPLVPLIKFSSEEQVLEWANDTEFGLAGYFFTNNYSRIFRL
                     GEQIECGMVGINTGAISEAAVPFGGIKHSGFGREGSKYGVNDYINIKTMVIGGL"
     gene            <47056..>48600
                     /locus_tag="PAS_chr1-3_0025"
                     /db_xref="GeneID:8197958"
     mRNA            <47056..>48600
                     /locus_tag="PAS_chr1-3_0025"
                     /product="Protein that stimulates strand exchange by
                     stabilizing the binding of Rad51p to single-stranded DNA"
                     /transcript_id="XM_002489316.1"
                     /db_xref="GeneID:8197958"
     CDS             47056..48600
                     /locus_tag="PAS_chr1-3_0025"
                     /codon_start=1
                     /product="Protein that stimulates strand exchange by
                     stabilizing the binding of Rad51p to single-stranded DNA"
                     /protein_id="XP_002489361.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0025"
                     /db_xref="EnsemblGenomes-Tr:CAY67077"
                     /db_xref="GeneID:8197958"
                     /db_xref="GOA:C4QV07"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QV07"
                     /translation="MDLYEQCPSSELLLNERFEPLLTVLTKAWILTSDIVISSPQDIH
                     KRVSNLTGGKLTISLNELIVFRSLLMKELNSQIESNLVNLNTSMLQEQTLKLNDLSFT
                     TGDELLDYYLRGEYDDNVVLPLGYLIEVTGGSSCGKSHFLMQFCLTVQLPIQLGGLGA
                     DLEAPESERTNECKAVYVSTEGYMETRRLSEMCDYYGNIMTTNGIADSDLYPSTSNVL
                     QIQCSDLETQDHIIFVQLPALLEKESGKVKLICIDSISHHVRVEFENRSYQESMARNT
                     YLYDLSRHLKRLAKQYEVCIVFSNQVSDKPITKLISNDRLALDYQLGWMSGWSNETIL
                     YRQNYQDDDGDADASFTSSSRKRDFSSMTEEDFADEEDDGTKEDTDTDERNFTLQDEL
                     SFTEQIKLDKHEYLFGNEVTKLKETKIPALGYLWNTLIDVRIVLFKNSRPIIDENLID
                     SMAFDLGLSDFKNIDQLKENRMMNEGNWATERWCRLCFSPFNGYSSDKVQRFEIWKGG
                     IRGVVN"
     gene            complement(<48593..>49582)
                     /locus_tag="PAS_chr1-3_0026"
                     /db_xref="GeneID:8197959"
     mRNA            complement(<48593..>49582)
                     /locus_tag="PAS_chr1-3_0026"
                     /product="Negative regulator of RNA polymerase III"
                     /transcript_id="XM_002489317.1"
                     /db_xref="GeneID:8197959"
     CDS             complement(48593..49582)
                     /locus_tag="PAS_chr1-3_0026"
                     /codon_start=1
                     /product="Negative regulator of RNA polymerase III"
                     /protein_id="XP_002489362.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0026"
                     /db_xref="EnsemblGenomes-Tr:CAY67078"
                     /db_xref="GeneID:8197959"
                     /db_xref="GOA:C4QV08"
                     /db_xref="InterPro:IPR015257"
                     /db_xref="UniProtKB/TrEMBL:C4QV08"
                     /translation="MKFIDEIDIELVNQALCFETPDYSVRGGCDLFTTKPVGSDKKLY
                     KTIDKHLDDILQESLNWNMSHSPPTASRITDNVDFQTRFSRRASSSSIVKPTLKRKSF
                     NHHQATTLSKSLENIDINESALYDEETPFGPITSTHSRKIFSYLIGILNASYPDHDFS
                     SLTPDYFTAVDSANSMMNRFNSIVLSLGYKDQIDDGDKDINWIWETINSHMDIQDCSI
                     YALEPKDGVLADLEPNTLWCLMWFIFNKKRKRVAFLHLKATIKNKYSPPMRRNSKVST
                     LDEVSGNFNLNDEEYDLTYDDDDPNQEDPDVFIEEDDDEDDNNTIVAEDLQVS"
     gene            <50361..>53057
                     /locus_tag="PAS_chr1-3_0027"
                     /db_xref="GeneID:8197960"
     mRNA            <50361..>53057
                     /locus_tag="PAS_chr1-3_0027"
                     /product="Protein of unknown function, expression is
                     regulated by phosphate levels"
                     /transcript_id="XM_002489318.1"
                     /db_xref="GeneID:8197960"
     CDS             50361..53057
                     /locus_tag="PAS_chr1-3_0027"
                     /codon_start=1
                     /product="Protein of unknown function, expression is
                     regulated by phosphate levels"
                     /protein_id="XP_002489363.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0027"
                     /db_xref="EnsemblGenomes-Tr:CAY67079"
                     /db_xref="GeneID:8197960"
                     /db_xref="GOA:C4QV09"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR022257"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:C4QV09"
                     /translation="MSETTTQGSSVSAFVSTLVVNVVIFSIFVSLFIVLKPKQSRIYQ
                     PRHVVDTVPGELQVEEQPSGVFGWVSFLWKQPTSFYVEKCGPDGFFFLRYLRVFIIVF
                     TLTGLLIWPILFPINATGGGGQEGLDILSYSNNTYKWRVFAHVFLSWVLFGFCIYTIY
                     KELVYYVSFRHALQVSPRYDSLLSSRTLLLDNVPESLLSEGELRTVFPAANHVWYARD
                     HKELEDVVKERTKLAGTYESTLVKSIKKAVKDRKKLTKKGAALPEPADQFETYYKEGK
                     LPTHSLKFLIGKKVSTLDYAPKRLSELNDELATAQNDWQDAKMVGSVFIEFPTQLELQ
                     RAYQAVPYNKELKLSRRVTGVAPDDIIWENLQVGFVARNSKAILAKTVLSLTLIFWAI
                     PVAVVGAISNINYLTTKLPWLDFINNMPDVLMGIITGLLPTVALAVLMSLLPPFIKKM
                     GKISGILTVQGVEMWCQSWYFAFQVIQVFLVTTLASSASSVVESIIDDPSSAMTLLGE
                     NLPKSSNFYIAYALLQGLTISSGVLAQVVGLILYHVLGKALDGTPRKKWNRYNTLGQP
                     GWGTIYPIFQLLLVIVLCYAIVSPLIIIFIVIGLTLIYIAYMYNLTFVMEHSADARGR
                     YYPKALFQTFVGIYLGEFVLIALFVMPENWACVVLEAVMVAVTVAAHLYMRWKFEPLF
                     DAVPLSAIHIAQGDSGFHYPMKDQGLSEISQTGKEFFTETPVTGPVETEKISKSNKDI
                     KQDIESPARTGTGSGSLSSILSPEKNESIQPDTQSHVGFLNRDDEDQSGKVNAKTLQR
                     FFKPRVYSSFEALRKIIPVRWNKRVRYDPQTVEFGYTSPLVRDAPPQIWIPRDSFGLS
                     RTAVSTAREHGVTVSDQNAEIQDDGTLLYTGLPPDYEEAVKE"
     gene            <53292..>54152
                     /locus_tag="PAS_chr1-3_0028"
                     /db_xref="GeneID:8197961"
     mRNA            <53292..>54152
                     /locus_tag="PAS_chr1-3_0028"
                     /product="Cytoplasmic inorganic pyrophosphatase (PPase)"
                     /transcript_id="XM_002489319.1"
                     /db_xref="GeneID:8197961"
     CDS             53292..54152
                     /locus_tag="PAS_chr1-3_0028"
                     /codon_start=1
                     /product="Cytoplasmic inorganic pyrophosphatase (PPase)"
                     /protein_id="XP_002489364.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0028"
                     /db_xref="EnsemblGenomes-Tr:CAY67080"
                     /db_xref="GeneID:8197961"
                     /db_xref="GOA:C4QV10"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="UniProtKB/TrEMBL:C4QV10"
                     /translation="MSYSTRQIGAANTLENRVFIEKDGQVVSPFHDIPLYADESKKVL
                     NMVVEVPRWTNAKLEISKEEKLNPILQDTKKGKLRFVRNCFPHHGYIHNYGAFPQTWE
                     DPNVTHPETKAKGDNDPLDVCEIGEAVGYTGQVKQVKVLGVMALLDEGETDWKVIVID
                     INDPLAPKLNDIEDVEKHMPGLLRATNEWFRIYKIPDGKPENQFAFSGECKNKKYAEE
                     VIQECREAWEKLIFGKTSPGEIDLTNTTLQSTPSFSPSATSAVPTASPAAPAKIDQSI
                     DKWFYISGSA"
     gene            complement(<54199..>54912)
                     /locus_tag="PAS_chr1-3_0029"
                     /db_xref="GeneID:8197962"
     mRNA            complement(<54199..>54912)
                     /locus_tag="PAS_chr1-3_0029"
                     /product="Phosphoribosylanthranilate isomerase that
                     catalyzes the third step in tryptophan biosynthesis"
                     /transcript_id="XM_002489320.1"
                     /db_xref="GeneID:8197962"
     CDS             complement(54199..54912)
                     /locus_tag="PAS_chr1-3_0029"
                     /codon_start=1
                     /product="Phosphoribosylanthranilate isomerase that
                     catalyzes the third step in tryptophan biosynthesis"
                     /protein_id="XP_002489365.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0029"
                     /db_xref="EnsemblGenomes-Tr:CAY67081"
                     /db_xref="GeneID:8197962"
                     /db_xref="GOA:C4QV11"
                     /db_xref="InterPro:IPR001240"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C4QV11"
                     /translation="MALVKICGLQSLEAAETAVNNGASLVGVIMVPGRERTVKQEVAR
                     EISQMVREKRISKGSKYLDSRQLRKEWDDCPLEDWFEYNVKEINSSGPFLVGVFRNQS
                     IDEIQQAIHTHGLDFVQLHGSEDFDSYIRNIPVPVITRYTDNAVDGLTGEDLAINRAL
                     VLLDSEQGGEGKTIDWARAQKFGERRGKYLLAGGLTPDNVAHARSHTGCIGVDVSGGV
                     ETNASKDMDKITQFIRNAT"
     gene            <55032..>56006
                     /locus_tag="PAS_chr1-3_0030"
                     /db_xref="GeneID:8197963"
     mRNA            <55032..>56006
                     /locus_tag="PAS_chr1-3_0030"
                     /product="Subunit of heteropentameric Replication factor C
                     (RF-C)"
                     /transcript_id="XM_002489321.1"
                     /db_xref="GeneID:8197963"
     CDS             55032..56006
                     /locus_tag="PAS_chr1-3_0030"
                     /codon_start=1
                     /product="Subunit of heteropentameric Replication factor C
                     (RF-C)"
                     /protein_id="XP_002489366.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0030"
                     /db_xref="EnsemblGenomes-Tr:CAY67082"
                     /db_xref="GeneID:8197963"
                     /db_xref="GOA:C4QV12"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QV12"
                     /translation="MAAPLKLELPWVEKYRPKLLKDIVGNEDTIERLKAFAIDGNVPH
                     MIISGLPGIGKTTSVHCLAHELLGDMYYDAVLELNASDDRGIEVVRNKIKQFAHKKVS
                     LPPGRHKIVILDEADSMTPGAQQALRRTMEIYSGTTRFVFACNMSNKIIEPLQSRCSI
                     LRYSKLYDEQVLSRLLYICKEEGVKYTDDGLEALIFTAEGDMRQAINNLQSTVAGMGL
                     VNGDNVFRIVDSPHPLVVRQMLFKAVKDSDIDAAVDLLNRLWEKGYSAVDIVSTSFKV
                     MKSVTEIPEADRLEVMREIGFTHMRVLEGVSSYLQLAGMLARITGTVV"
     gene            <56117..>57874
                     /locus_tag="PAS_chr1-3_0031"
                     /db_xref="GeneID:8197964"
     mRNA            <56117..>57874
                     /locus_tag="PAS_chr1-3_0031"
                     /product="Component of the GARP (Golgi-associated
                     retrograde protein) complex"
                     /transcript_id="XM_002489322.1"
                     /db_xref="GeneID:8197964"
     CDS             56117..57874
                     /locus_tag="PAS_chr1-3_0031"
                     /codon_start=1
                     /product="Component of the GARP (Golgi-associated
                     retrograde protein) complex"
                     /protein_id="XP_002489367.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0031"
                     /db_xref="EnsemblGenomes-Tr:CAY67083"
                     /db_xref="GeneID:8197964"
                     /db_xref="InterPro:IPR007258"
                     /db_xref="UniProtKB/TrEMBL:C4QV13"
                     /translation="MRQKQRISRRSISRHQQFQDQDNTNKLELLKQVLNVRQEEETEL
                     NEQNGYQSDYTLSDFSVQDVYSLQELRFLTTQFSEQCKDFSMRTWKHEMAAQEDYSNI
                     LVNTKASLEPLIRYLNNFEVQLKELSLQMEFLQERSNELNQQIEQKNKINRKLAPIVN
                     DLVIPPKVILSVLNDNIDASWTKNIIFIKEKQQLLSKYTEQDELQIKCSPMVVKVLEL
                     LKLTVVERSRDFIINQIKLLRKPNCSSQVIQKQLLDCKLIYSFLKENSPELATQLRKA
                     YAYTMRWYYHQNFSKYLYSLERLEYRTVPRDVLLGETVDSQLHVNEYLNLGTRAELIN
                     SHSTLMPAQIAETNQLSYYIETGFNNFNGALLDNVSTEYLFLSQFFELYKFDEVNDLF
                     KLIFQPTFTIGINYTKNLIRGTFDIYGVLLCIRLSQLYDYELQHRKIPVMDDYINLQL
                     INLWPHFQIIIDENCESLKKAVPKLAVQLHKTKNTLIPLVLTQQFGQLIAGLLKLTTH
                     KVFETEQTEPLTVGVSRLSNEFEAALTKLSSSFKDSNQKELFFYNNFYLVLTMLSDDG
                     KFAHDIVNHFEKLLQAYKS"
     gene            complement(<57876..>59597)
                     /locus_tag="PAS_chr1-3_0032"
                     /db_xref="GeneID:8197965"
     mRNA            complement(<57876..>59597)
                     /locus_tag="PAS_chr1-3_0032"
                     /product="EH domain-containing protein"
                     /transcript_id="XM_002489323.1"
                     /db_xref="GeneID:8197965"
     CDS             complement(57876..59597)
                     /locus_tag="PAS_chr1-3_0032"
                     /codon_start=1
                     /product="EH domain-containing protein"
                     /protein_id="XP_002489368.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0032"
                     /db_xref="EnsemblGenomes-Tr:CAY67084"
                     /db_xref="GeneID:8197965"
                     /db_xref="GOA:C4QV14"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:C4QV14"
                     /translation="MGRKATRGSQLSTEPNPLAAKAAALMYQKSVNHGNSNGSNLASN
                     KPSTPAPPVSQRRVTKKQESTGPHSENHSSADNLAHLKASGKSSSSNTDIISPSASIQ
                     EGMNSALVAAMKVATDSPGLMVSQTTHPTINPIRIPAAGSYPPSGNTELHSQKQHSSS
                     TLSKTLLSTPKPSYPASQKLSSSPCSLASSISNMSDTKLPYSSNHLAIPNPKMKSVTS
                     SSDALLEEPAASRMPTENNSPQLLYSPLVFPSTIPNLSGDLSDAGSTRPSRKPPAQIN
                     DDWSDTNSIGSSIASLIRSAPPVSSSMPSNDFKDYEIPAQPLIYPQRRKPPPIDIDSN
                     LSDSESDPEEEISEVEDTGIPKYTIGLQHHYPHTEDHDFRHPHHQHYHPKNSKLKKIF
                     GLKMNRASRSEVSLEHTVQLRSTMRKEKPKRTFNEDKPWKHRTKNNVIVPQEAKRYQG
                     VWAANRGLILHRDEKDGKSKSRHIDPLQAAKISFASQDDEDSSQLMPNIVVRELWRRS
                     RLPEFTLSKIWDLVADSNKNYLRKNEFIVGTWLVDQCLYGKKLPRTIDESVWNSLNHG
                     GVNVKVK"
     gene            <59902..>60933
                     /locus_tag="PAS_chr1-3_0033"
                     /db_xref="GeneID:8197966"
     mRNA            <59902..>60933
                     /locus_tag="PAS_chr1-3_0033"
                     /product="Nuclear SAM-dependent mono-and asymmetric
                     arginine dimethylating methyltransferase"
                     /transcript_id="XM_002489324.1"
                     /db_xref="GeneID:8197966"
     CDS             59902..60933
                     /locus_tag="PAS_chr1-3_0033"
                     /codon_start=1
                     /product="Nuclear SAM-dependent mono-and asymmetric
                     arginine dimethylating methyltransferase"
                     /protein_id="XP_002489369.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0033"
                     /db_xref="EnsemblGenomes-Tr:CAY67085"
                     /db_xref="GeneID:8197966"
                     /db_xref="GOA:C4QV15"
                     /db_xref="InterPro:IPR010456"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4QV15"
                     /translation="MSSHKDYATDKKSLPFSEQHYFSSYDHFGIHEEMLKDQVRTISY
                     RSAILKNKANFKDKIVLDVGCGTGILSMFAARAGAKHVIAVDMSNIADMAEKIVELNG
                     FSDKITVLKGKLEDVELPYPEVDIIISEWMGYFLLYESMLDTVLVARDKYLKEGGLIF
                     PDKASIHVAAIEDGNYKNDKIHYWENVYGFDYSPFIEIAMSEPLVDTVENGSVVTTSS
                     KLIEFDLNTVTLEDLAFHRDFSITATRDELVHAYIAWFDIEFPGDTEKVVFSTGPHAH
                     YTHWKQTVFYMNQVLDVKRGETITGSMASRPNVSNPRELDIELQWDFQGLGASDPRAK
                     HGKYNYFLR"
     gene            complement(<61003..>62022)
                     /locus_tag="PAS_chr1-3_0034"
                     /db_xref="GeneID:8197347"
     mRNA            complement(<61003..>62022)
                     /locus_tag="PAS_chr1-3_0034"
                     /product="60S ribosomal protein L4"
                     /transcript_id="XM_002489325.1"
                     /db_xref="GeneID:8197347"
     CDS             complement(61003..62022)
                     /locus_tag="PAS_chr1-3_0034"
                     /codon_start=1
                     /product="60S ribosomal protein L4"
                     /protein_id="XP_002489370.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0034"
                     /db_xref="EnsemblGenomes-Tr:CAY67086"
                     /db_xref="GeneID:8197347"
                     /db_xref="GOA:C4QV16"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013000"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="InterPro:IPR025755"
                     /db_xref="UniProtKB/TrEMBL:C4QV16"
                     /translation="MSTRPQVTVISVEGKPSSTSLPLPAVFKAPIRGDIVQSVFTRIN
                     KNKRQAYAVSEKAGHQTSAESWGTGRAVARIPRVGGGGTHRSGQGAFGNMCRGGRMFA
                     PTKIWRKWHVRVNLNEKRYATASAIAATSVQSLVLARGHRIEQIAEIPLVVSNDLEAI
                     QKTKDAIAALKALGASDDLIRVIKSKKLRAGKGKYRNRRFTQRRGPLIVFNEDKGLVK
                     ALRNIPGVETCNVRTLGLLQLAPGAHLGRFVIWTESAFAALDSVYGSETTESVKSNYS
                     LPKNIITNTDISSVINSAEVQAAIRPSLAGKPTHLHVKKVNPLKNHEVMLKLNPYAKV
                     LAEKK"
     gene            <64773..>66368
                     /locus_tag="PAS_chr1-3_0036"
                     /db_xref="GeneID:8197348"
     mRNA            <64773..>66368
                     /locus_tag="PAS_chr1-3_0036"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489326.1"
                     /db_xref="GeneID:8197348"
     CDS             64773..66368
                     /locus_tag="PAS_chr1-3_0036"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489371.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0036"
                     /db_xref="EnsemblGenomes-Tr:CAY67087"
                     /db_xref="GeneID:8197348"
                     /db_xref="GOA:C4QV17"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001138"
                     /translation="MTKPLPLEVKRSRRPTSRACKFCHFKHLQCDATRPCKNCVKRNI
                     GDSCEDIQRRKYGSNGTKKRAQSAQKVQSDSPSASSATNAGTSAVNESKLESSELPMV
                     AQQTQQTPRGLETIPTIPHPNAENNSSFLSPTTSQMFNTGSNTLMDQLKMSVPENNSM
                     YQHDTLFQPPKKYENNSYGYVNAAPQGQHMFYVGYSEPGEQRASPDAEKEPGTNLNSP
                     SSYLSQYSHTQSHTNSQLTNSPSVVYESEIAKQEELQLTSFVEAANNEELDFFDMDFT
                     QRPFIRLLENNTMVSSYPNNSTPKFFDHSRSHGRIPNTAKEVPTEIQQDEEFTPPLIL
                     RHIIKNPDDIYLTRVVKAYQYPKAYHALTKYLKTRFERTQLIEIAKCMSKYRPSFISA
                     TKSLVENDLIFTERSFQRSLLEYESLISMSAAPTIIWRRTGEIVALTNEFSVLTGYSR
                     MSLLSKRTFIIELMDDESVVNYFKLFSSIAFGDLNATLLTNCVLRKAAQDDYLRCACV
                     WTIKRDVFDIPMLIVGQFLPVLD"
     gene            complement(<66404..>69256)
                     /locus_tag="PAS_chr1-3_0037"
                     /db_xref="GeneID:8197349"
     mRNA            complement(<66404..>69256)
                     /locus_tag="PAS_chr1-3_0037"
                     /product="Defining member of the SET3 histone deacetylase
                     complex"
                     /transcript_id="XM_002489327.1"
                     /db_xref="GeneID:8197349"
     CDS             complement(66404..69256)
                     /locus_tag="PAS_chr1-3_0037"
                     /codon_start=1
                     /product="Defining member of the SET3 histone deacetylase
                     complex"
                     /protein_id="XP_002489372.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0037"
                     /db_xref="EnsemblGenomes-Tr:CAY67088"
                     /db_xref="GeneID:8197349"
                     /db_xref="GOA:C4QV18"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C4QV18"
                     /translation="MSQDNNESSPIKDQDAAALLMLFQSQPQNYHRPNQQQQQPSQSS
                     YIYQAPSHIPDKTEQLPHLPRIFDYEVPNQQQQQQQQQQQHQQHQQHQRQQSQSKQSQ
                     QPLSSYHLRPPFSASNESHGKEQNALTPVSSANNDGDKNGSKMSDNNTSPGPAVAALT
                     NDDNRGKARIAAAALAAAAATPMPLLNRSHIPVLGHGSAPTVTTQTVTTTLPVQNDQT
                     LSSIPNSAHATAPSPETSSTSYARGPSLAFLLSSNSQESQEGKQAIEIYKNEKIEPEI
                     ETPRTIFKGEETEPETEQEEAQNVAVNKDSSAKNENPAKVSDPLNDETDNSSTDRMPT
                     MEKVDSEVETETEAEPKTEEKIILDNQIPHRVDPDSGLIGCICGSTEDDGYTVQCDRC
                     FRWQHVACIDPVAISDENAVYWCYLCNPTAGTRKKRAIQDSKTNKRRRGPNTPPLLDA
                     SNEDNSIPNTDNRTKGSRSTTPKAPEERSIPKEKRRAKTIKELEESDDSLMFKENPET
                     LYYSIDSNEYNDKLVKTFVEQLPSSSSLQEQSMTNLSNAKLDKALDQISSRLNVRTYS
                     ENGKQKFNGISKLGLFLDDDAEPNSYVISMLGKVEFKQTYVEDRTNQYSIWGVEKPNV
                     FFHPSLPVVFDARGLGGKSRFIRKSCFPNCEIKTVLTKDGKGCYFVVTTTKEIKAGTE
                     LTLPWNWDRNSPMRSILEGLPFDRIEAHKKPQLVRAVENILNFCECACAIPANCGLFK
                     VRKATSYLFRSTRKTNQSNLSNGPVNSLNKYDEIYKTENFSDHIPIQTRLRNRTLQID
                     KLASNETLVDKTESTSAEKSEGDNNGNSLNENAFVNKRSKSNQSILDRPRELLPYIYR
                     ILKEAQRKRNSIKDTGTKLSERSNDMKPTIESTSGSIDDFPTPVLLLNDPVERTKPGI
                     KSASPSGKEVKEKKKFSLADYMKKKNNGIIYTEVSH"
     gene            <69612..>70063
                     /locus_tag="PAS_chr1-3_0038"
                     /db_xref="GeneID:8197350"
     mRNA            join(<69612..69614,69680..>70063)
                     /locus_tag="PAS_chr1-3_0038"
                     /product="Constituent of the mitochondrial import motor
                     associated with the presequence translocase"
                     /transcript_id="XM_002489328.1"
                     /db_xref="GeneID:8197350"
     CDS             join(69612..69614,69680..70063)
                     /locus_tag="PAS_chr1-3_0038"
                     /codon_start=1
                     /product="Constituent of the mitochondrial import motor
                     associated with the presequence translocase"
                     /protein_id="XP_002489373.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0038"
                     /db_xref="EnsemblGenomes-Tr:CAY67089"
                     /db_xref="GeneID:8197350"
                     /db_xref="GOA:C4QV19"
                     /db_xref="InterPro:IPR005341"
                     /db_xref="UniProtKB/TrEMBL:C4QV19"
                     /translation="MAHRLVTQVIFTGAKVFGRAFTEAYRQAAAATSKQGASAAATAV
                     RDTGISLDEACKILDVQPKGLDNTKIQEKYNYLFDINSKENGGSFYLQSKIYRAKERL
                     EAELKAAEEELKAREGASGKDSSKPE"
     gene            complement(<70518..>71642)
                     /locus_tag="PAS_chr1-3_0039"
                     /db_xref="GeneID:8197351"
     mRNA            complement(join(<70518..71530,71585..>71642))
                     /locus_tag="PAS_chr1-3_0039"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489329.1"
                     /db_xref="GeneID:8197351"
     CDS             complement(join(70518..71530,71585..71642))
                     /locus_tag="PAS_chr1-3_0039"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489374.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0039"
                     /db_xref="EnsemblGenomes-Tr:CAY67090"
                     /db_xref="GeneID:8197351"
                     /db_xref="GOA:C4QV20"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:C4QV20"
                     /translation="MSSTEKQLEEIKRRYADLQKSIDESKKRLKTLGTISSAGQKNHY
                     AIAKPSIPVLHRKQKMLNVWCKKNASEYRHKNRIDIDGSKYVEIKNASRLVPVSHLDA
                     GACDDEKKITIDNREYVRQKTGSFKLLDKSKEIQELCIYFVTTGNCARKSSCRYLHDA
                     NMKSLCKEFLKGTCYNAYCTLSHKPTQFNSPSCKFYNTGFCSNENCSYTHKKDSSEAA
                     VCRPFAVNGICPDGMTCKLRHEFICPEFDESGTCHIRFCALPHPSKKAPTTKMFNNVR
                     NEDNHADNKAPLRVDTTGNSENSKLWSSVSKGLESLLHETNNHSNELSDLSEDSDSEQ
                     LPQKSLEGPDGLEHNDDYVKIT"
     gene            <71803..>73392
                     /locus_tag="PAS_chr1-3_0040"
                     /db_xref="GeneID:8197352"
     mRNA            <71803..>73392
                     /locus_tag="PAS_chr1-3_0040"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489330.1"
                     /db_xref="GeneID:8197352"
     CDS             71803..73392
                     /locus_tag="PAS_chr1-3_0040"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489375.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0040"
                     /db_xref="EnsemblGenomes-Tr:CAY67091"
                     /db_xref="GeneID:8197352"
                     /db_xref="GOA:C4QV21"
                     /db_xref="InterPro:IPR009349"
                     /db_xref="UniProtKB/TrEMBL:C4QV21"
                     /translation="MSDLSRNQVKERARIELSRILPLDDESLDQVITYAFTLRTKEEI
                     AEHFLNLLGESPDSFQFISNFQEMLFPSPRTGKAIQEDSSIARPDPKLSSTSPSPSPS
                     PSPSQSKPSVLRSIKITSGKPSKIKTVRKVVTRPISSSGSALSSDSSNNPLRTQLQVQ
                     NSSNDTQKTMKKTLNSLKDIDSAIAELELNEPVPLDGEPRPAKRFCDCMAQRHPLFEM
                     FPNCLNCGKIICIKEGLQPCSSCGKELLSNEEKSKIEEILNQEKLKLEEKAGIDSSND
                     KTKAKQKKKLILSMNEKGKNNFLEKEIFFNEIDSQKQKQLQQAVEAQEEQKKLDQQKF
                     ELEYYAKIKDKSPELLQAQERLDQLLNFQETSAERTKIIDQASDFELPNQNFNLWASP
                     VERALQLKKQQRQLRKQESSEKAKTGRASHAFNISIADGQVVMNQESIIEDPTDEIDQ
                     GIEDLEARVKKMKNEQLSSNIGKVWNPEEYKQKWKAPVYMHSEDDNSSETQPEPTEEW
                     ERVQNGSVEESEQVLLSLPIM"
     gene            complement(<73492..>75627)
                     /locus_tag="PAS_chr1-3_0041"
                     /db_xref="GeneID:8197353"
     mRNA            complement(<73492..>75627)
                     /locus_tag="PAS_chr1-3_0041"
                     /product="Serine/threonine protein kinase involved in
                     activation of meiosis"
                     /transcript_id="XM_002489331.1"
                     /db_xref="GeneID:8197353"
     CDS             complement(73492..75627)
                     /locus_tag="PAS_chr1-3_0041"
                     /codon_start=1
                     /product="Serine/threonine protein kinase involved in
                     activation of meiosis"
                     /protein_id="XP_002489376.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0041"
                     /db_xref="EnsemblGenomes-Tr:CAY67092"
                     /db_xref="GeneID:8197353"
                     /db_xref="GOA:C4QV22"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C4QV22"
                     /translation="MLLSQHDIKPKRRESKQNRPEIALPSDLQDPPKEIPLRSLQDCY
                     KTVSSLGSGSFGSVVLAKIKDEYVSKLALDLTNPVHKNTLRYVNPSVPCNKSYSGLHV
                     VAIKTMTKRLTHLRDYTKVKEVRFILSVPSHPNLVQIYDLLIDSTTFQLQIVMESMDQ
                     NLYQLMRARKSSLFSPNTLRSILVQLLAGISHIHKHNFFHRDVKPENILVVSNTAYYG
                     SKESIPPSRRKDAYIIKLADYGLARHVDNVKPYTAYVSTRWYRSPEILLRQKFYSCPV
                     DMWAFATVAVEVTSFRPLFPGSNELDQLWKILEVLGSPEPSSNAYSAEFEPDSFASSA
                     VPLGGYWPKAQSLAGDLGFSLPEVAGISMYQLIPRTDLPTNDLLDLLKVVKACLVWDP
                     EKRASATDLQQMSYFRNHVPQYHFSDRTSNEFVSHAPLATRNHHSIHNTGWSKTTNGE
                     NRFVNVQTAPLYNNNDENMEYSKPSYLQSKKRRQDEMVNPKNIENPVYDVDEQSIRKF
                     KEDQYQIDHISQITDKDQMSEDDNEDLFVEFDPQDVRDFTDFSEFKKDLNPSSIEEGV
                     NYQTQHGKYKSQLQDDIMTGISKDDWNTNEYLNYVGSSKYQSDSSLSMMKLLQNCVDF
                     DMLQHDQNTSTLSDSEIQKLHPEGNDILTGSPINIKPVEEEQQEYTWNSERTNQFHSS
                     TPLRPHAQVQGNANILVQDPSLSPKLTAI"
     gene            <77297..>80173
                     /locus_tag="PAS_chr1-3_0043"
                     /db_xref="GeneID:8197354"
     mRNA            <77297..>80173
                     /locus_tag="PAS_chr1-3_0043"
                     /product="Pheromone-regulated protein, predicted to have 5
                     transmembrane segments"
                     /transcript_id="XM_002489332.1"
                     /db_xref="GeneID:8197354"
     CDS             77297..80173
                     /locus_tag="PAS_chr1-3_0043"
                     /codon_start=1
                     /product="Pheromone-regulated protein, predicted to have 5
                     transmembrane segments"
                     /protein_id="XP_002489377.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0043"
                     /db_xref="EnsemblGenomes-Tr:CAY67093"
                     /db_xref="GeneID:8197354"
                     /db_xref="GOA:C4QV23"
                     /db_xref="InterPro:IPR010619"
                     /db_xref="InterPro:IPR024528"
                     /db_xref="UniProtKB/TrEMBL:C4QV23"
                     /translation="MSSLRDRDSPPIETIPGSRSPSRSICYSDISSLADRSVSNPSPE
                     PGALPNPKDISFQTTIRNSASRNIPPSHQNSSSHSFLRKSVSHSRSNSSSRSRSRSRS
                     RSHSRSQSHSRSRYGSKLNSPGIQNDLPLMEDESEDEPEDLPPLLPVFDHLRGHVQAG
                     VTSPDSSRRRQIEEDIDQDADELNVQDDSVGLFDRVSLDSTNDTVANRPVLSENNTNT
                     SSISSNSNTPTQGEASDIENVPHMENQNENENAIQKECTHSTTKTQHGRNFLSRFLNL
                     KGTMIGPSINTDKPPPKDEESQMGQDIQLSDLDANQLKHVTTYLVDKHYDHSKNQNES
                     KNHALAINSYLTEGLNDLDEMAGVQVGKPKNIHQGVLSHLLKLYENPISQTSHSLSID
                     SEDSDEEQETRGRGRSRKKRNHLKISSPLRHHSSSRSKSRIIEMGNLRHSSGEAFPKQ
                     FKSHLRSLSEPRILKSKYAIPSVLFGKEHSRSASKEAKDEFKKLPKFSSTRPKVKKKG
                     PSLLKKKQVETRAQITVHIATILQRQRFILLLCKAFMLYGAPTHRLEEFMTVTAKVLE
                     TDAQFLYLPGCMTVAFGDVLTRTSEMQLVRSVQGLNLGKLDEVYEVYKNVIHDVTSVP
                     EAISAIEKLLNGKDYYSRPVVVLTYALACAMVCPFAFRGKGYDILVSFGVGGLVAMLQ
                     YYVVPLSNVYSTVFEVSATIVVSFVARALGSINENKVCYSAVVQGSIAMILPGYTILC
                     GSLELQSKNIVSGAVRVFYAIIYSLFLGFGITLGAALYGWIDHSATNVTRCATSLSPW
                     YLFIFVPAFATTMAISNQAKFSQLPAMALIGSIGYVATYFAGLRFKNATEIAASIGSF
                     VVGILANVYSRLGRGMAVSAMLPGIFLQVPGGIAAQSSLISGIEIANELTNSSNAHTS
                     SSYSIDTSFGFAMVRVVIGITVGLFAAIIVVYPFGKKNTTIFSL"
     gene            <80453..>83500
                     /locus_tag="PAS_chr1-3_0044"
                     /db_xref="GeneID:8197355"
     mRNA            <80453..>83500
                     /locus_tag="PAS_chr1-3_0044"
                     /product="Pheromone-regulated protein, predicted to have 5
                     transmembrane segments"
                     /transcript_id="XM_002489333.1"
                     /db_xref="GeneID:8197355"
     CDS             80453..83500
                     /locus_tag="PAS_chr1-3_0044"
                     /codon_start=1
                     /product="Pheromone-regulated protein, predicted to have 5
                     transmembrane segments"
                     /protein_id="XP_002489378.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0044"
                     /db_xref="EnsemblGenomes-Tr:CAY67094"
                     /db_xref="GeneID:8197355"
                     /db_xref="GOA:C4QV24"
                     /db_xref="InterPro:IPR010619"
                     /db_xref="InterPro:IPR024528"
                     /db_xref="UniProtKB/TrEMBL:C4QV24"
                     /translation="MSDSVGSSRSPSRTDLRSLSSRGNRLSQTMKNLNPKARSRSQSP
                     SGRRLREEFSKNKSYSRDASFSHNRSSSRTEISSPPLLEDSESDDGNTPVLPKFFSGM
                     GEVEASSFVDNQKATDLESRTERSLDRRQVMERELDQDASSIIERDFNVGTGILPTLS
                     NHTDINERPNQKRVVQFYNSSDDDDDVTTEEESEDVNRNRSGTDGGEKEKDSSTGSFN
                     TIDASTIEQQPSLGQRLKRRMSLFRKSDDPEADENYNELEKVASKVTNDSSSSNGLVS
                     RIVNFRSGIGGLIPGATKDQPTKQLDEENGQNTRDVQLENMNTRNLQTEAKTLIDQHD
                     IYNRIPSSTSLITDGDATLYDSKSSVNGSSSFLTPNPEMYLEQDLDSDQYYEDGDVHS
                     VIARPKKFQAGVLSSLLKLYQNEAGSVSREALSGETSGSVTPLSGTMSPSRMGHSLGP
                     DVAKLTSKLKNIGRSKQTLTIPESGDDNDLDSDDDEGTLHPKFSRSRNSAVSLPGILK
                     KNARDSFSSKSKARAQSKNKSKDAKAEGVEGEEEINLPTFATTRAKNPANRKKKASKY
                     FKPPKKHEARAKITVHIADILQRQRFILRMCKAFMLYGAPTHRLEEFLTMTARVLEID
                     AQFLYLPGCMLVSFGDAATRTSEMQLVKCSQGLNLGKLDEAHKIYKDVVHDIIGVEEA
                     SFKIDELLSSNNPYPPWACVLIYGFSSAMVTPFAFGGRWLDMPVAFGIGLCVGVLQFY
                     MAPRSNLYSSVFEVSASIVVSFLGRALGSIHGGEYICFAAVVQGSLALILPGYIILCG
                     SLELQSRSLVAGAVRMFYAIIYSLFLGFGITLGAALYGWIDSNATNNSVCPRTLSPWY
                     RFIFVPMFSVGLALVNQAKPIQLPVMILISSAGYACNYFAGLHFSQSTEFTASIGAFV
                     IGVLANLYSRVAKGMAVTSMLPGIFVQVPSGIASQGSLLAGLQTANAIVSNSTTTDEQ
                     NTRSSMSFGIAMVQVAIGISVGLFAATLFVYPFGKKRTAIFSL"
     gene            <83814..>86840
                     /locus_tag="PAS_chr1-3_0045"
                     /db_xref="GeneID:8197356"
     mRNA            <83814..>86840
                     /locus_tag="PAS_chr1-3_0045"
                     /product="Essential RNA-binding G protein effector of
                     mating response pathway"
                     /transcript_id="XM_002489334.1"
                     /db_xref="GeneID:8197356"
     CDS             83814..86840
                     /locus_tag="PAS_chr1-3_0045"
                     /codon_start=1
                     /product="Essential RNA-binding G protein effector of
                     mating response pathway"
                     /protein_id="XP_002489379.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0045"
                     /db_xref="EnsemblGenomes-Tr:CAY67095"
                     /db_xref="GeneID:8197356"
                     /db_xref="GOA:C4QV25"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:C4QV25"
                     /translation="MSTPAELLSTKSFSNVESGTAEESLPPSTTTPSSGDSSFINEKL
                     FPSIKSASTSPSSNGSRPVWVNETPASSNLPKKSNSVLRSQNVQDTFTIDNDQQSFQL
                     SKAEIQKAVGDLKNRLNVRIESTISVRTGARTFLISGLPENVKQARREILRKLCKPVD
                     IEFKIPSKARSAVIGPQGKTLKPILDATNAKIDIEKDDNTSEKSEEPGSDEDDIFGPL
                     VTVKVQGDVESCELAKSLIFDIVNKHTLNTSVRIPLAKALRPLVTPVISQLELPSTVE
                     VLVPEVNQGVSNIIVSGPTLDVIKARNALREIIERVESSVVSESKTVPKVLHQYLDAD
                     DIFKETGVSVSIPNADDPSAEVVFFGDASNIPNAVALAKSQTKNYSSYSLDISKAHGG
                     NFQHAQRLAAYFRFTSFFDKLAHTNGVLITSPFFNELVSDDSKSLNVTFSGKASEPEK
                     LQQVKKEIINKVNSIPPSSVRAIDDVNAFFFDRIDQKAAKEENVALIPLGKLAGVSNL
                     LVLVANTTDDEDFLPSQAEIDARLDKVEESLAKWRQLSSNLEERVVEVPENEQKLIST
                     KTLNHLTEKFENTIIINLNRDADGYSADKLVIVGKKEDVDEAITEIQKFIEELKDYEN
                     ACKYTTEILFPVKLLSLLIGQKGHHLDSLREEFDVQVSVESGRDREHHDEQQEVPVKL
                     VGLKANCDACIKKISALQKEWADRKTGKITVEKKYLGSIIGRNGTYVKRFREKYNVQL
                     RVDDGEAEYSDIILVGPSKGVTKALGEIKEFVDYERQNGVTDSITIPKKALSSVIGRS
                     GQTIREISEETGVKITRHGDDEASDESNKSGEKFYLVGTKKGIKDARLRIEEIVKRVE
                     NRVKKTVSVERKYHKDLIGPHGSTLREIIRKAGANVDESQRVWKSYLQVPSVDSESTE
                     IISSGEKAIVEKVISQVKELVGRLESNTTEKITVPRNRHMRLIGYGGSVKNELMEEFK
                     VAINIPKKGSDSEVITISGAPEDIEKVKVRIEELTK"
     gene            <87090..>88757
                     /locus_tag="PAS_chr1-3_0046"
                     /db_xref="GeneID:8197357"
     mRNA            <87090..>88757
                     /locus_tag="PAS_chr1-3_0046"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489335.1"
                     /db_xref="GeneID:8197357"
     CDS             87090..88757
                     /locus_tag="PAS_chr1-3_0046"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489380.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0046"
                     /db_xref="EnsemblGenomes-Tr:CAY67096"
                     /db_xref="GeneID:8197357"
                     /db_xref="GOA:C4QV26"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR006993"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C4QV26"
                     /translation="MDTNQSTPSLIGTSIRGAIDTPDRELFDKEPPSGTLSPSKTRHS
                     KSLTGTLSPSYVTVNQLKEGGALLNDGYTEQLNSVMDGEGHIKEDALDLKQKLYRNKD
                     AQNVSRAKLVSLSEISANEEKYNQEFYDPEMRYAAPACSLSGSRSRAMESDDIDKDKE
                     SLISREATPMKFELTNFDSSSSLRLGAGASRPHLARGDSYQQVHPSDFGHNERLPRHE
                     RTQSSVSSSSINYLRSLSRSRSRLNRSAHGDIATQEELKEEGVLTNDQYSPMPELTEA
                     VDEALKPVDGHVDIEDEDENEGSESDDQTEEETEKASLQEGEPELGDQKGTNPVKDEN
                     PASKTGTFFLEESSSESTQVADSSSKATEAKKEDVAGSETKVAPSDQISDKQPSEIFK
                     TTDATSEAVAEETKHISESKVTSTDDLDDLMNELELEIQGDDSHPLKGSLSTSKAEGD
                     DSAYVPQNTMAFENEPVYLFTSLAGGFQVASRTNRLQTILAANQVAFQMRDLGTDEEA
                     RKVWKRYSSGKSLPGIVRGKDDFIGNWEDIEEANENYEVRSLIYETV"
     gene            complement(<88830..>90017)
                     /locus_tag="PAS_chr1-3_0047"
                     /db_xref="GeneID:8197358"
     mRNA            complement(<88830..>90017)
                     /locus_tag="PAS_chr1-3_0047"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489336.1"
                     /db_xref="GeneID:8197358"
     CDS             complement(88830..90017)
                     /locus_tag="PAS_chr1-3_0047"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489381.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0047"
                     /db_xref="EnsemblGenomes-Tr:CAY67097"
                     /db_xref="GeneID:8197358"
                     /db_xref="InterPro:IPR018961"
                     /db_xref="UniProtKB/TrEMBL:C4QV27"
                     /translation="MRRFLTTTSRPTSKKALLERLEQLTEDALEESPSLLQTPEFKQI
                     LDSLSDSEFKAKYTKELGYANSTKSRFIPKQSQEIALSQPWTGTESQADATLRMLVDK
                     YKPSRLTKSQVRLSSARDASLDYKISKISEKETSFEEDPHFRERYKERLLGPDLLVPS
                     SFATVNNSIKSIANTKIEQAMSEGKFNNLSNRGKPMKLDSSSQSAFIDKTEYHLNNIL
                     KNENALPPWIEKQGMVFSEIKSFRNELDKTWRLKLANHIKSLPLSLEQKLAYPTNVKS
                     NPTVYRISSAEKESLSVKMNSLNSSLRSYNLQAPLPSQKMYLSLEKELQDCFRRVSET
                     SQEIILRHLTGSPTESNPKSLSTAKNKELPTFKDIPQRSNIYQHSTEPLGKLFLNLFK
                     RKY"
     gene            <91088..>91795
                     /locus_tag="PAS_chr1-3_0048"
                     /db_xref="GeneID:8197359"
     mRNA            <91088..>91795
                     /locus_tag="PAS_chr1-3_0048"
                     /product="Ubiquitin-conjugating enzyme (E2) and catalytic
                     subunit of SCF ubiquitin-protein ligase complex"
                     /transcript_id="XM_002489337.1"
                     /db_xref="GeneID:8197359"
     CDS             91088..91795
                     /locus_tag="PAS_chr1-3_0048"
                     /codon_start=1
                     /product="Ubiquitin-conjugating enzyme (E2) and catalytic
                     subunit of SCF ubiquitin-protein ligase complex"
                     /protein_id="XP_002489382.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0048"
                     /db_xref="EnsemblGenomes-Tr:CAY67098"
                     /db_xref="GeneID:8197359"
                     /db_xref="GOA:C4QV28"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C4QV28"
                     /translation="MSNAAAASILLRQFRELTDPKKGVPCFHIELEDDNIFLWNIGVM
                     VLNKESIYHGGYFKGQMKFPLDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHQGGGD
                     PTTDEPDSETWSPAQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNTEKYKERVLQ
                     EVERSRQDIPEGFIMPDADTAYGQPRAEEPEQDAVDDDFWFDSDESYGDDDSIMDGNV
                     SEDDDNVDNVSEDGMDK"
     gene            complement(<91915..>92379)
                     /locus_tag="PAS_chr1-3_0049"
                     /db_xref="GeneID:8197360"
     mRNA            complement(<91915..>92379)
                     /locus_tag="PAS_chr1-3_0049"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489338.1"
                     /db_xref="GeneID:8197360"
     CDS             complement(91915..92379)
                     /locus_tag="PAS_chr1-3_0049"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489383.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0049"
                     /db_xref="EnsemblGenomes-Tr:CAY67099"
                     /db_xref="GeneID:8197360"
                     /db_xref="UniProtKB/TrEMBL:C4QV29"
                     /translation="MLHSRNIAKVLQQGFKPSQLTDESPLAVALITRDGELLSTAMEK
                     SIISNSQVEGDSSFSKSTLSKNDLKIYSLVAIREYHSYQKTQAESGGKVENWHATTIG
                     ERRVLLYSIENTDLLLLSVTRLSYPGDIALIRSQILSETLAAGLQGFKLTAH"
     gene            <92691..>94187
                     /locus_tag="PAS_chr1-3_0050"
                     /db_xref="GeneID:8197361"
     mRNA            <92691..>94187
                     /locus_tag="PAS_chr1-3_0050"
                     /product="Regulatory subunit of Cdc7p-Dbf4p kinase
                     complex"
                     /transcript_id="XM_002489339.1"
                     /db_xref="GeneID:8197361"
     CDS             92691..94187
                     /locus_tag="PAS_chr1-3_0050"
                     /codon_start=1
                     /product="Regulatory subunit of Cdc7p-Dbf4p kinase
                     complex"
                     /protein_id="XP_002489384.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0050"
                     /db_xref="EnsemblGenomes-Tr:CAY67100"
                     /db_xref="GeneID:8197361"
                     /db_xref="GOA:C4QV30"
                     /db_xref="InterPro:IPR006572"
                     /db_xref="InterPro:IPR013939"
                     /db_xref="UniProtKB/TrEMBL:C4QV30"
                     /translation="MTTRQPLKETNNNVCKTPARETRKLNAEKATTQHNQNVYVQNAN
                     VSSSMRQWQQCWREILKSTVVYFEYDAHEDSAERKKAKQHLERLGCTIDMFFNDGVTI
                     IVSKRPFNSKGVYPANDLFHKAIRRNLKVWSYEKVFRFLRNLGELPSADVGNEKVVGT
                     EENRLSSLLKEEKLLGPTDRDPSAKRDDFHYFKAVYFLVYDFQLKYRPIAFREWSKPD
                     DPDIPHIRASTNGGCPFESDYARPNSERMIKKRRMLYERNKEYRLRLYEASNLKKNVE
                     APTSVMNPSPQLEDDNKDEDQETNSILSLNEDNENQIQPIATPLPPQSNKPPVEAPVL
                     KRNDTVLLELMNKSHHVIKDNGEIQASGITNISTQQVSQNSAVHQNRGNGLGPIKAEV
                     YNKKVSTDKRKTVTLQRNFQHEETLQESAKIAQDLAPPQLTVKKDRKRKRERAAYDGY
                     CENCRIEYDNLNTHIKTQIHRSFARDDCNFKNIDNLIFKLAESRSLQI"
     gene            complement(<94332..>94856)
                     /locus_tag="PAS_chr1-3_0051"
                     /db_xref="GeneID:8197362"
     mRNA            complement(<94332..>94856)
                     /locus_tag="PAS_chr1-3_0051"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489340.1"
                     /db_xref="GeneID:8197362"
     CDS             complement(94332..94856)
                     /locus_tag="PAS_chr1-3_0051"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489385.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0051"
                     /db_xref="EnsemblGenomes-Tr:CAY67101"
                     /db_xref="GeneID:8197362"
                     /db_xref="GOA:C4QV31"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C4QV31"
                     /translation="MPDKHYRDYQQVIKLNVGDRIPRSRPSLTSAPSPDDCMPILPMV
                     AMDSTKASDYKIVKRRKIVRTKTGCFCCRKRKKKCDEIRPKCSGCSRNFLVCTYPSEA
                     TLESSQQKANGSSDCHKKRPNFMIIQDDPTKLITRNYNSFVITSISSNRYIQERSSGP
                     AAPFRSISIKSLLN"
     gene            complement(<95232..>96422)
                     /locus_tag="PAS_chr1-3_0052"
                     /db_xref="GeneID:8197363"
     mRNA            complement(<95232..>96422)
                     /locus_tag="PAS_chr1-3_0052"
                     /product="Biotin synthase, catalyzes the conversion of
                     dethiobiotin to biotin"
                     /transcript_id="XM_002489341.1"
                     /db_xref="GeneID:8197363"
     CDS             complement(95232..96422)
                     /locus_tag="PAS_chr1-3_0052"
                     /codon_start=1
                     /product="Biotin synthase, catalyzes the conversion of
                     dethiobiotin to biotin"
                     /protein_id="XP_002489386.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0052"
                     /db_xref="EnsemblGenomes-Tr:CAY67102"
                     /db_xref="GeneID:8197363"
                     /db_xref="GOA:C4QV32"
                     /db_xref="InterPro:IPR002684"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010722"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR024177"
                     /db_xref="UniProtKB/TrEMBL:C4QV32"
                     /translation="MNRQSLMAGRRLFSKVRVVRKPSTLANELGSLYEHNQPIFEPPS
                     PEKKVSALDYAFSLKSPVSTWTKEQLREIYNTPLMELVHRAQIYHRNFHNPSEVQICN
                     LVNIKSGGCTEDCKYCSQSVNNDTNLKAEKLMTVDEVVEQAKIAKSNGATRVCLGAAY
                     RTVSTRKRALERITTMVKEVNKLGLESCVTLGMIEEEHARKLKDAGLTAYNHNIDTSR
                     EHYPNIITTRTYDDRLKTIDNVQKAGISACTGGILGLGETVEDHIGFLYTLCTMKQHP
                     ESLPINRLVPIKGTPIADELARDNSKKLKFESMLRTIATARMVMPTSIIRLAAGRYTM
                     KETEQFLCFMAGCNAIFSGKKMLTTMCNGFDEDKELLAKWGMKPMQSFASKRPSSIVE
                     TCHI"
     gene            complement(<97347..>98426)
                     /locus_tag="PAS_chr1-3_0053"
                     /db_xref="GeneID:8197364"
     mRNA            complement(<97347..>98426)
                     /locus_tag="PAS_chr1-3_0053"
                     /product="Conserved peptide N-glycanase required for
                     deglycosylation of misfolded glycoproteins"
                     /transcript_id="XM_002489342.1"
                     /db_xref="GeneID:8197364"
     CDS             complement(97347..98426)
                     /locus_tag="PAS_chr1-3_0053"
                     /codon_start=1
                     /product="Conserved peptide N-glycanase required for
                     deglycosylation of misfolded glycoproteins"
                     /protein_id="XP_002489387.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0053"
                     /db_xref="EnsemblGenomes-Tr:CAY67103"
                     /db_xref="GeneID:8197364"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="UniProtKB/TrEMBL:C4QV33"
                     /translation="MECKKVKDRLVTEYLKIECSRLNRRIRSLKNPKVEQALLQFKNS
                     RLAHMRKAHLDGIRNPQYTDDAIFQALETMDLDHIFEKAGSLYNSQQQDESKKDSLDE
                     TDFTVVALLDWFKNDFFKWVNKPPCPVCHSEDESRIRMVGSARPTSEELSYGAGVVEV
                     FNCDHCSCAIRFPRYNDPKKLLRTRAGRCGEWNNCFLLCLKALGLKARCVRNVEDHVW
                     SEYYSEHLKRWVHLDSCENAFDQPELYCKGWGKKMSYCFAFDDTLIEDVSAKYITQGR
                     LPKMLDDETIRICLYFFNQEALKMVSENPEAFYSALVKYHRCLSANRKESGSKSRAVN
                     ASLTSLLPRQSGSASWTSERGENGL"
     gene            <98760..>100043
                     /locus_tag="PAS_chr1-3_0291"
                     /db_xref="GeneID:8197365"
     mRNA            <98760..>100043
                     /locus_tag="PAS_chr1-3_0291"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489343.1"
                     /db_xref="GeneID:8197365"
     CDS             98760..100043
                     /locus_tag="PAS_chr1-3_0291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489388.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0291"
                     /db_xref="EnsemblGenomes-Tr:CAY67104"
                     /db_xref="GeneID:8197365"
                     /db_xref="UniProtKB/TrEMBL:C4QV34"
                     /translation="MDETYSQIAMATSMKDNLLSKEFPVDWSAAQDEASLKKLLQQSH
                     EEASTNPPTSIGEFANGMDERFEAILKEEAGKIGILKDKDDTFKVTYMKLIMEKGLLE
                     MQLLDANESDQDSRLLNLDQIGALKSMQTQAKDEFKKEELQKKLNNTYIHALNLLITQ
                     NGLIALDNGSKLNQVDLFSNEEDHQILGVKIENLIFEICSIAAQKNLVLPQPVDSITS
                     LEGKLTWISSCLREITFNETLTRSKSLLGSKSKESTKNSVSDLDLQTALKDLQFSYEY
                     LSRQFENEKLQHSDILSQMRYKLNHSEELLSKLTKDFNNQTNTLVQQENQINQLSKDL
                     AQREKEINDLNKELSISKIDSLGIGENTKSGSKSPLGPNSPKKNNVSATILRSEFKKL
                     VRKINERHEQQLNEERNERQRLETLVKIYEENMKK"
     gene            <100199..>100483
                     /locus_tag="PAS_chr1-3_0292"
                     /db_xref="GeneID:8196820"
     mRNA            <100199..>100483
                     /locus_tag="PAS_chr1-3_0292"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489344.1"
                     /db_xref="GeneID:8196820"
     CDS             100199..100483
                     /locus_tag="PAS_chr1-3_0292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489389.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0292"
                     /db_xref="EnsemblGenomes-Tr:CAY67105"
                     /db_xref="GeneID:8196820"
                     /db_xref="InterPro:IPR003749"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR016155"
                     /db_xref="UniProtKB/TrEMBL:C4QV35"
                     /translation="MAIHVEYFGPATDVTHKRDDLITMESYPVSLNKVWSWINEKYGT
                     EFGDYIITACNIALNTEYIDFDKEKPTLAFDQVQVKDGDEVVILPPVSSG"
     gene            <100843..>103344
                     /locus_tag="PAS_chr1-3_0054"
                     /db_xref="GeneID:8196821"
     mRNA            <100843..>103344
                     /locus_tag="PAS_chr1-3_0054"
                     /product="Phosphatase subunit of the trehalose-6-phosphate
                     synthase/phosphatase complex"
                     /transcript_id="XM_002489345.1"
                     /db_xref="GeneID:8196821"
     CDS             100843..103344
                     /locus_tag="PAS_chr1-3_0054"
                     /codon_start=1
                     /product="Phosphatase subunit of the trehalose-6-phosphate
                     synthase/phosphatase complex"
                     /protein_id="XP_002489390.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0054"
                     /db_xref="EnsemblGenomes-Tr:CAY67106"
                     /db_xref="GeneID:8196821"
                     /db_xref="GOA:C4QV36"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4QV36"
                     /translation="MPDYEKDPEMIRPEDTKDLGCTGRILNVMSLLPNQIFKNSEGQW
                     DVKPVRGNSALYSSNDYLTHNTGWETHLIGWTGELYNSDELQPRSIVSNLESDPLYLS
                     EDDKTALTEKMRAANNSPNIHPVWLLRKDQLRWRKYAENVLWPIFHYMQNQPSDGKQE
                     TEWWYDYVKFNEAYAARIKKIYKPGDIIWIHDYYLLLLPQILRMSLPKAKISLFLHAP
                     FPSSEYFRCLSKRKHILDGMLGADQIGFQSFSFARHFMSCCTRIVGAEILANSVIAYG
                     AHVSVSVAPIGIDVETIEKYAFESKEVEEKVKAIREINGDKKIIVGRDRLDIVRGVVQ
                     KLEAFETFLSMYPQWREKVVLIQVSFPTVFHSAKMEKKVNELIAGINGTYGSFNWTPV
                     QHYQMRVAKDEYLALLRVADLGVITSIRDGNNTTALEYVLCQKKKHSPLILSEFSGTV
                     AVFPEAILVNPWDSVGVANTMHKCLLMDSREKTALEANLYNQIQKNTVQDWTRRLLSD
                     LIQDLRLNHSKKGTPNLNRPLLLSNYQTAERRLFMFDYDGTLTPIVHTPSAAIPSAKL
                     YDTLTLLTKDPRNEIWFISGRDQQFLDKWIGQKLPHIGLSAEHGCFMKKPGSKEWRNL
                     AEDFDMSWQKEVESVFQYYTDNTPGTFIEKKKVAVTWHYRKAEPDFAAFQAANCLQKL
                     LSGVMKKYDVEAMSGKANIEVRPKFVNKGEIVKRLVINADGPGRAPPDFILCLGDDQT
                     DEDMFKALNDIEANWKLEKRPKDRLDGYGVYPVSVGPANKETVAKAYLSDPGQVLETL
                     GLLVGTVSLFETAGTVEINDRGHIVDETFLEPKRF"
     gene            <103456..>105018
                     /locus_tag="PAS_chr1-3_0055"
                     /db_xref="GeneID:8197366"
     mRNA            <103456..>105018
                     /locus_tag="PAS_chr1-3_0055"
                     /product="Class II abasic (AP) endonuclease involved in
                     repair of DNA damage"
                     /transcript_id="XM_002489346.1"
                     /db_xref="GeneID:8197366"
     CDS             103456..105018
                     /locus_tag="PAS_chr1-3_0055"
                     /codon_start=1
                     /product="Class II abasic (AP) endonuclease involved in
                     repair of DNA damage"
                     /protein_id="XP_002489391.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0055"
                     /db_xref="EnsemblGenomes-Tr:CAY67107"
                     /db_xref="GeneID:8197366"
                     /db_xref="GOA:C4QV37"
                     /db_xref="InterPro:IPR004808"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR010666"
                     /db_xref="InterPro:IPR020848"
                     /db_xref="UniProtKB/TrEMBL:C4QV37"
                     /translation="MESALPPVPVKSQAAVRFVTFNVNGTKTLCNYHPWNKMKSFDKI
                     FGYLFADIITLQELKVQKDNLDHELNEIPNYRSFVTLATNRKGYSGVGVFVRIPADEE
                     SDQIKSCLAVVHAEEGITGYLKSSQSTTSYRDLNNIGGYPDISEVLANEIDFQGRCVV
                     LELGNMMVIISVYCFANSMGTEQGEFHRVLFLRCILERAEKLQQMGKTVVIMGDINVS
                     RDLIDNEVYLREGIADKSLIPPINNDGAHFEEANKTAVLQFRTASQPRSLLNSFIKDK
                     YNDSGILHDTFREHHGRVMRSYTVWNTLKNTRPLNIGSRIDLILCSTALLNKFKKCEI
                     LPWLMGSDHCPVIADFEPDESFDSFPFSKQPLSFEARYHYKTHNGCKIDSFFKSRSQG
                     KITPTGVAKPPKSASYQYRSRKKQNPGYFKSSKNNFSDKEQQFFLDSYSDQEAKNKDG
                     RSTDMESFKKILSVAAGPPLCDHNEPCVLRVCKKESKNKGRKFWCCSRAPRPDENSNK
                     LDEYRCNTFQWQ"
     gene            <105118..>105501
                     /locus_tag="PAS_chr1-3_0056"
                     /db_xref="GeneID:8197367"
     mRNA            <105118..>105501
                     /locus_tag="PAS_chr1-3_0056"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489347.1"
                     /db_xref="GeneID:8197367"
     CDS             105118..105501
                     /locus_tag="PAS_chr1-3_0056"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489392.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0056"
                     /db_xref="EnsemblGenomes-Tr:CAY67108"
                     /db_xref="GeneID:8197367"
                     /db_xref="InterPro:IPR005579"
                     /db_xref="UniProtKB/TrEMBL:C4QV38"
                     /translation="MSDSSSTSKKDIYNNPIAPKDKGRGTRVNGKDWKLQKDAMRVRS
                     LGGNLTWEQKKQKRLEEQAIKAKIRELKEEKESIRKSKIEETKRRQSLKEEKERYERM
                     AQVMHRRKVERLKRKEKRNKLLKER"
     gene            complement(<105594..>106537)
                     /locus_tag="PAS_chr1-3_0057"
                     /db_xref="GeneID:8197368"
     mRNA            complement(join(<105594..106460,106535..>106537))
                     /locus_tag="PAS_chr1-3_0057"
                     /product="Component of both the Nup84 nuclear pore
                     sub-complex and of the COPII complex"
                     /transcript_id="XM_002489348.1"
                     /db_xref="GeneID:8197368"
     CDS             complement(join(105594..106460,106535..106537))
                     /locus_tag="PAS_chr1-3_0057"
                     /codon_start=1
                     /product="Component of both the Nup84 nuclear pore
                     sub-complex and of the COPII complex"
                     /protein_id="XP_002489393.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0057"
                     /db_xref="EnsemblGenomes-Tr:CAY67109"
                     /db_xref="GeneID:8197368"
                     /db_xref="GOA:P53024"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="PDB:4L9O"
                     /translation="MVTIGNAHDDLIHDAVLDYYGRRLATCSSDKTIKIFEIDGENQR
                     LVETLIGHEGPVWQVAWAHPKFGVILASCSYDGKVLIWKEDNGVWNKVAEHSVHQASV
                     NSVSWAPHEYGPVLLCASSDGKISIVEFKDGGALEPIVIQGHAIGVNAASWAPISLPD
                     NTRRFVSGGCDNLVKIWRYDDAAKTFIEEEAFQGHSDWVRDVAWSPSRLSKSYIATAS
                     QDRTVLIWTKDGKSNKWEKQPLTKEKFPDVCWRASWSLSGNVLAISGGDNKVTLWKEN
                     IQGKWESAGEVDQ"
     gene            <106689..>107534
                     /locus_tag="PAS_chr1-3_0058"
                     /db_xref="GeneID:8197369"
     mRNA            <106689..>107534
                     /locus_tag="PAS_chr1-3_0058"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489349.1"
                     /db_xref="GeneID:8197369"
     CDS             106689..107534
                     /locus_tag="PAS_chr1-3_0058"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489394.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0058"
                     /db_xref="EnsemblGenomes-Tr:CAY67110"
                     /db_xref="GeneID:8197369"
                     /db_xref="UniProtKB/TrEMBL:C4QV40"
                     /translation="MKLLEATPFKSGDLELDEDQLRNQCLELLECIYQEENRYKTFHQ
                     TGAHNETIQVDTFKGSNGWAGRSNTISANDYNLENVVEALTGCVYEGDKWKIADPTLH
                     TYYEKQYMGKLVESFVILKGAPEPWYCVELNYNLGPLLKTRKFYEYVRVLPPLEQNEG
                     SKVKLFGKESGFIVSVPADIEEIQQTLRSSDNPNLHSDSLLTDLQFSKEWVYAQYSSV
                     ESISYGDSQDLIWNMATASNAGGFVPSFITVLALPRTIAQDVPHLLRWIHQRRRLPKE
                     VNKSE"
     gene            <108281..>110061
                     /locus_tag="PAS_chr1-3_0059"
                     /db_xref="GeneID:8197370"
     mRNA            join(<108281..109009,109048..>110061)
                     /locus_tag="PAS_chr1-3_0059"
                     /product="Uracil permease, localized to the plasma
                     membrane"
                     /transcript_id="XM_002489350.1"
                     /db_xref="GeneID:8197370"
     CDS             join(108281..109009,109048..110061)
                     /locus_tag="PAS_chr1-3_0059"
                     /codon_start=1
                     /product="Uracil permease, localized to the plasma
                     membrane"
                     /protein_id="XP_002489395.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0059"
                     /db_xref="EnsemblGenomes-Tr:CAY67111"
                     /db_xref="GeneID:8197370"
                     /db_xref="GOA:C4QV41"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:C4QV41"
                     /translation="MAFGDKLTHRFHKSSDASTGAASVEEYSTSIHEKSDKSAIGKFL
                     DKIAVQEEKGLSVSQTFLFNFDLRPVESARRVWSWFNYVFFWIADSFNINTWQIAATG
                     VQAGMSWWTCWLSVWVGYFLCGIFVTISARVGIYYHVSFPVSCRSSFGVFGSIWPVFN
                     RVVMSCVWYGVQGYIGGTTMALMLRSIFGNDLNTRIPDGISSPNVTTFEFLSFFLFWL
                     FSLPFIWLEPHKVRHLFTVKSYVVPANGIGPIVKQPSTIHGSEFAWEFIRMVMNSLAN
                     FATLITNAPDFSRFSKTKKSAKWAQLFSIPLCFSITSLIGILVSSASTVIYGETYWSP
                     IDVLGRFLDNYNSGNRAGVFFISLAFALAQLGTNISANSLSAGTDATALFPKYITIRR
                     GGYICAAVGLAICPWELLSSSNKFTTYLSAYSVFLSAIFGVIFADYYIVKRGWLILTD
                     LYNAEKTSAYTYWHGINYRAFVAYICGILPNIVGFVGATGAGSVPQGAMYVYDFNFFT
                     GFASSIVVYVLLCYIHPIPGLPTDIKKDLFKKGWYEIYAEVEEFDVSGGVINGEGQEP
                     EEEAIDYYSEEKKV"
     gene            <110287..>112197
                     /locus_tag="PAS_chr1-3_0293"
                     /db_xref="GeneID:8197371"
     mRNA            <110287..>112197
                     /locus_tag="PAS_chr1-3_0293"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489351.1"
                     /db_xref="GeneID:8197371"
     CDS             110287..112197
                     /locus_tag="PAS_chr1-3_0293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489396.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0293"
                     /db_xref="EnsemblGenomes-Tr:CAY67112"
                     /db_xref="GeneID:8197371"
                     /db_xref="InterPro:IPR004043"
                     /db_xref="UniProtKB/TrEMBL:C4QV42"
                     /translation="MNLDVERGEESYSAEESIPLRSLNNPKPSFELLEDNYELEDNTN
                     VGFFSWLWNGPNYPKDEPTTVKSYSLSQVDSYPFFLRKELQYKIKFAVTVGYIFLWLL
                     INYLLLYDVIFKAPSLDGTEIMSVSCGEVKEIWKGKNDRCGLNAERCTTIADGSVLVK
                     CPALCHRGSWTFSSIPVGDLTIKRRGFFIGGGRKSISDTNSEDILTNAYRADSYPCGA
                     GIHAGLISSFSGGVLNLTFQGTQNNFSSTKGMYGAQDSIPFNSAFPSSYAFGKVHPGK
                     CTNCTDTRFLVLIVNIFLGWIFSYLASMPLVYWVSSIVGFWVLTLSFDPPIIPNVAKN
                     SDSPYELLSLAVQRFLPTCFILYVVWKFASGYTMKETSRGGVRMWVVCFWYPLYWIGV
                     LNNITFDALPVDRLTRSDIAEQKGALISILGIATLILSCAVVQAVQLWKAGKFQKYFY
                     IYLIFIVSLLLLARIPGLTLRLHHYVLALLLLPGTRTRNITAIMFQGILIGLFINGVA
                     RWGMDSILETEIQLKRDDPLGRIKPPRFEGLNADTGILEWESTESTRNFEEYSLLIND
                     VEVYRGSDNHLNVTDLFISAKPDNFLARIYRYRLPSYFRLAGKVSDRGHQAYSDYSKS
                     GIYDGETFREPN"
     gene            <112860..>115268
                     /locus_tag="PAS_chr1-3_0061"
                     /db_xref="GeneID:8196822"
     mRNA            <112860..>115268
                     /locus_tag="PAS_chr1-3_0061"
                     /product="Phosphotyrosine-specific protein phosphatase"
                     /transcript_id="XM_002489352.1"
                     /db_xref="GeneID:8196822"
     CDS             112860..115268
                     /locus_tag="PAS_chr1-3_0061"
                     /codon_start=1
                     /product="Phosphotyrosine-specific protein phosphatase"
                     /protein_id="XP_002489397.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0061"
                     /db_xref="EnsemblGenomes-Tr:CAY67113"
                     /db_xref="GeneID:8196822"
                     /db_xref="GOA:C4QV43"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C4QV43"
                     /translation="MPSPSAHAVASSSVYQGDTLDPASANLETEGSNYFSIKHSEVPT
                     DNLTKSQTSDGKDCYAHSSNNSVSSIQTNFSDITLVDRPFFHSKEPSRTDSLDSKTTL
                     TESLRHKHLQTPPATSSSPFFKFNTPARPIRHSSSKSQTLEPTLRKFPTSPYGFKNPD
                     EIISRMNKDYQHTLSSEVQLLSSSEVAQLLANCHSYEELELSNLIIIDVRPFAEYCKS
                     HLPGSINICLPSTLAKRPTFTLQKCLSILDLNDRNLFYHHLEHSQNLFKDGNIQNLDL
                     ANKLNNGIPYGDRGLPAVLIYDLASRDENSCSLPLSTLTSKFVHDSQWNSPIYTISGG
                     FSQFNEDYPALSLSSLNPNICSVSPDPIQSHAATEASSPKFSRKSSLPVLRRQLTENT
                     VDKSPTLTKFTLPDPPSVPLFKTRLGEEVISSKPDYSMVLNMEDFTDYEKANLPPWIL
                     RIIGDDHGATAISKKFYHLEINEKERLSLAFSNKHQKSDIDAPKVSKGVELGSKNRYK
                     DIFPYEHSRVKLVTSPVLEIDHSEDYINANYLTTGVTPTTYIATQGPLEETIGDFWRL
                     ILDQGSYLIFSLTAQNENGVEKCAPFWKCGEYTSGRKIITVELIESDENVKLGSGKSF
                     SLTVRRLRVSTANISREVLQLQVSSWPDFGTLLMNDLLNLIYLRRYIARNCRDKEHNV
                     PIVVHCSAGCGRTGTFCSIDAVVEHLLKDSSLTSKNCSATYDPVWRIVEEFRKQRVFM
                     VQTLRQYLLVYDTIILFLRLYLKDKDSNVVHDHCDYSGERISIVENFVETKRKEQPPF
                     EAEY"
     gene            complement(<115336..>115623)
                     /locus_tag="PAS_chr1-3_0062"
                     /db_xref="GeneID:8197372"
     mRNA            complement(<115336..>115623)
                     /locus_tag="PAS_chr1-3_0062"
                     /product="Integral membrane protein required for ER to
                     Golgi transport"
                     /transcript_id="XM_002489353.1"
                     /db_xref="GeneID:8197372"
     CDS             complement(115336..115623)
                     /locus_tag="PAS_chr1-3_0062"
                     /codon_start=1
                     /product="Integral membrane protein required for ER to
                     Golgi transport"
                     /protein_id="XP_002489398.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0062"
                     /db_xref="EnsemblGenomes-Tr:CAY67114"
                     /db_xref="GeneID:8197372"
                     /db_xref="InterPro:IPR013880"
                     /db_xref="UniProtKB/TrEMBL:C4QV44"
                     /translation="MFGLGILFYTVLFLVNAIAILSEDRFLNRIGWGSYAPASTPQAS
                     FQTTTFDNYNANPEVSMKTKIVTLISATRTLLRLPLIAINSVVIIYELVLG"
     gene            complement(<115746..>118430)
                     /locus_tag="PAS_chr1-3_0063"
                     /db_xref="GeneID:8197373"
     mRNA            complement(<115746..>118430)
                     /locus_tag="PAS_chr1-3_0063"
                     /product="Molecular chaperone of the endoplasmic reticulum
                     lumen"
                     /transcript_id="XM_002489354.1"
                     /db_xref="GeneID:8197373"
     CDS             complement(115746..118430)
                     /locus_tag="PAS_chr1-3_0063"
                     /codon_start=1
                     /product="Molecular chaperone of the endoplasmic reticulum
                     lumen"
                     /protein_id="XP_002489399.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0063"
                     /db_xref="EnsemblGenomes-Tr:CAY67115"
                     /db_xref="GeneID:8197373"
                     /db_xref="GOA:C4QV45"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C4QV45"
                     /translation="MRTQKIVTVLCLLLNTVLGALLGIDYGQEFTKAVLVAPGVPFEV
                     ILTPDSKRKDNSMMAIKENSKGEIERYYGSSASSVCIRNPETCLNHLKSLIGVSIDDV
                     STIDYKKYHSGAEMVPSKNNRNTVAFKLGSSVYPVEEILAMSLDDIKSRAEDHLKHAV
                     PGSYSVISDAVITVPTFFTQSQRLALKDAAEISGLKVVGLVDDGISVAVNYASSRQFN
                     GDKQYHMIYDMGAGSLQATLVSISSSDDGGIVIDVEAIAYDKSLGGQLFTQSVYDILL
                     QKFLSEHPSFSESDFNKNSKSMSKLWQAAEKAKTILSANTDTRVSVESLYNDIDFRAT
                     IARDEFEDYNAEHVHRITAPIIEALSHPLNGNLTSPFPLTSLSSVILTGGSTRVPMVK
                     KHLESLLGSELIAKNVNADESAVFGSTLRGVTLSQMFKAKQMTVNERSVYDYCLKVGS
                     SEINVFPVGTPLATKKVVELENVDSENQLTIGLYENGQLFASHEVTDLKKSIKSLTQE
                     GKECSNINYEATVELSESRLLSLTRLQAKCADEAEYLPPVDTESEDTKSENSTTSETI
                     EKPNKKLFYPVTIPTQLKSVHVKPMGSSTKVSSSLKIKELNKKDAVKRSIEELKNQLE
                     SKLYRVRSYLEDEEVVEKGPASQVEALSTLVAENLEWLDYDSDDASAKDIREKLNSVS
                     DSVAFIKSYIDLNDVTFDNNLFTTIYNTTLNSMQNVQELMLNMSEDALSLMQQYEKEG
                     LDFAKESQKIKIKSPPLSDKELDNLFNTVTEKLEHVRMLTEKDTISDLPREELFKLYQ
                     ELQNYSSRFEAIMASLEDVHSQRINRLTDKLRKHIERVSNEALKAALKEAKRQQEEEK
                     SHEQNEGEEQSSASTSHTNEDIEEPSESPKVQTSHDEL"
     gene            <118586..>120469
                     /locus_tag="PAS_chr1-3_0064"
                     /db_xref="GeneID:8197374"
     mRNA            <118586..>120469
                     /locus_tag="PAS_chr1-3_0064"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489355.1"
                     /db_xref="GeneID:8197374"
     CDS             118586..120469
                     /locus_tag="PAS_chr1-3_0064"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489400.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0064"
                     /db_xref="EnsemblGenomes-Tr:CAY67116"
                     /db_xref="GeneID:8197374"
                     /db_xref="GOA:C4QV46"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QV46"
                     /translation="MENKDNGAFHDERLTGQRENGKPVYSNGYGALKVQDLLKTSRRN
                     NKLMPDAPASEKQEEIEPNHHPRVQQQGQGYARDNQALYSDQNIDVTNTRRNYRTESP
                     GAISRGPPRERNNDYRGYRRDGERGAKDFSQNYNDTGFSRNFSRDRGYNDYSRGRGNQ
                     RHERRSYRDYAPEEVQDSYHSYRPHNGMVSARERERSSDYQPQQFERNGPSKQRLRNT
                     SEYPNDRYTSSQEHAPRSHSRQNQSRKVDLTNVLPLNEVKRDISFWDVKPRGYEKVQA
                     SRAKLSGLFSLPSAQSDGSKPLPPAPTEKPEMADVLFDTASLSPTLSTLSKKLVVTNF
                     DGVEPEQIVNYLNEYTSQLSSCNASKPVVAFNVVDDKSKIILELDSSQTTTLIYCMNG
                     MNIEELNLKLDLLRPEAYIVGNTEEKTSSTDEVSDVVIDSKNKLALASIPIGTERSSL
                     VNYLSKFGTVTGLELPKLKESGESQSFAFCEFKNSDRSTVVEAIESSKNEQFDLRCFP
                     ACDGLQQEYEVKFQNLEKASKGENFLRTKETKIVQLLNIFEPVISEFEEFGRSIGNFD
                     RVFIPNTEKQADDWKCEKLYMVFHHVDDARKAIDQLAGKLYNDRTVLATFTNEKDFAN
                     GIY"
     gene            complement(<120474..>121475)
                     /locus_tag="PAS_chr1-3_0065"
                     /db_xref="GeneID:8197375"
     mRNA            complement(<120474..>121475)
                     /locus_tag="PAS_chr1-3_0065"
                     /product="Mitotic exit network regulator, forms
                     GTPase-activating Bfa1p-Bub2p complex"
                     /transcript_id="XM_002489356.1"
                     /db_xref="GeneID:8197375"
     CDS             complement(120474..121475)
                     /locus_tag="PAS_chr1-3_0065"
                     /codon_start=1
                     /product="Mitotic exit network regulator, forms
                     GTPase-activating Bfa1p-Bub2p complex"
                     /protein_id="XP_002489401.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0065"
                     /db_xref="EnsemblGenomes-Tr:CAY67117"
                     /db_xref="GeneID:8197375"
                     /db_xref="GOA:C4QV47"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C4QV47"
                     /translation="MESQLRTKPSMGFKKGRKKDPVEKFITSNQVIVKTGLSQLRYMI
                     LAEGLTTHSDLESCPYRCYVWSILLQVPPTESEFYIELVSQGRSQSFDKILNDAHRTL
                     KGDPNYESKVTPTILARTLNCYALMTEIKNENVSRGSKRNSRAYLSSPYIQGMNILMA
                     PFLYVCKTEPQAFLLFDKMINGHMPLYVLPNLEGAHTGVRMVDLCLQIVDPKLHSYLS
                     KKMLKTEIYAFPSVLTLSACTPPLSEVLELWDFLFSYGIHLNVLFIVAQLVLIRSELM
                     KISNPMTLLREFPKLESKKIIKLGISFIEKIPKDVYMLLVKHTHDPTISEQLDAYYR"
     gene            complement(<121654..>124280)
                     /locus_tag="PAS_chr1-3_0066"
                     /db_xref="GeneID:8197376"
     mRNA            complement(join(<121654..124193,124256..>124280))
                     /locus_tag="PAS_chr1-3_0066"
                     /product="Subunit a of vacuolar-ATPase V0 domain, one of
                     two isoforms (Vph1p and Stv1p)"
                     /transcript_id="XM_002489357.1"
                     /db_xref="GeneID:8197376"
     CDS             complement(join(121654..124193,124256..124280))
                     /locus_tag="PAS_chr1-3_0066"
                     /codon_start=1
                     /product="Subunit a of vacuolar-ATPase V0 domain, one of
                     two isoforms (Vph1p and Stv1p)"
                     /protein_id="XP_002489402.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0066"
                     /db_xref="EnsemblGenomes-Tr:CAY67118"
                     /db_xref="GeneID:8197376"
                     /db_xref="GOA:C4QV48"
                     /db_xref="InterPro:IPR002490"
                     /db_xref="InterPro:IPR026028"
                     /db_xref="UniProtKB/TrEMBL:C4QV48"
                     /translation="MTSKEAIFRSAEMSLVQFYIASEISRDIVSVLGDLGTVQLRDLN
                     SNVNTFQRSFVKEIRKLTATEEQLNYLVSQIYQQKPGTIIPEYDGIGAIHSSSLGQPS
                     TASSSEVDDLTTKVQQYEANVRRLAESLEQSKQQELRLIEHRLVLNGSRKFFGSHTHS
                     FDIGNDPETLNNVRLSLDSADGLLMEEESVNMGRNLTIERDFTMISTMNYITGTIDSQ
                     RYHTLEKILWRVLRGNLYLSFVPIDSTFDDTRSGQKVNKYIFLVFTHGDNLINKTKRI
                     VDSLGGTVFHVESNYELFKRELDEINSKLFDLKQVIDHTQNVLNSELLYVCQDISQWQ
                     VEIKKEKAIYNALNQFNYDQTRRCLIGEGWIPKHDLPAVKNALRDVTERSGSDINSVV
                     NELYTNRTPPTFHRTNKFTAAFQSIIDAYGIATYQEVNPGLASVVTFPFLFAIMFGDV
                     GHGLLVFLAALVLILKENKIAKMKRDEIFDMAFTGRYILILMGAFSVYTGFIYNDIFS
                     RSLTLFKSGWKWPSDFDAGQSVEATERGTYAFGIDYAWHGTDNNLLFTNSYKMKLSIL
                     IGFCHMSYSFFFSLVNYRYFKSNVDVIGNFIPGLLFMQGIFGYLSLTIVYKWCVDWVK
                     IGKPAPGLLNMLINMFLSPGTVEEQLYPGQSVVQIILVLIALVCVPWLLLYKPLVLRR
                     RNNQSIQLRYSDLFEHDHINQLSDSENLEDDDFFVIQDIDDEQEPFNFGDVMIHQVIH
                     TIEFCLNCVSHTASYLRLWALSLAHNQLSAVLWSMTIANSFGTTGYSGIFMTFFLFGL
                     WFILTVAILVVMEGTSAMLHSLRLHWVEAMSKFFEGEGYAYMPFSFVDLLKESDNQ"
     gene            <124543..>126299
                     /locus_tag="PAS_chr1-3_0067"
                     /db_xref="GeneID:8197377"
     mRNA            join(<124543..125169,125232..>126299)
                     /locus_tag="PAS_chr1-3_0067"
                     /product="Subunit of a Golgi membrane exchange factor
                     (Ric1p-Rgp1p) that catalyzes nucleotide exchange on Ypt6"
                     /transcript_id="XM_002489358.1"
                     /db_xref="GeneID:8197377"
     CDS             join(124543..125169,125232..126299)
                     /locus_tag="PAS_chr1-3_0067"
                     /codon_start=1
                     /product="Subunit of a Golgi membrane exchange factor
                     (Ric1p-Rgp1p) that catalyzes nucleotide exchange on Ypt6"
                     /protein_id="XP_002489403.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0067"
                     /db_xref="EnsemblGenomes-Tr:CAY67119"
                     /db_xref="GeneID:8197377"
                     /db_xref="InterPro:IPR014848"
                     /db_xref="UniProtKB/TrEMBL:C4QV49"
                     /translation="MVTHTIYNQLVDNNVRVEVVYENYPVIAGTDELSLILRFRYLGK
                     PKLPKEEHSEPDPEDKDAVNSSHKAGSSDTWSGFGRRISSQFSNVTRNVFLKELDKVE
                     EQHEEDDEPVFVVGYTQLFGYLAINENIIDKKKLEDVRKRSVIGNKLAGIEGLELSDK
                     TSNIWQFNNIEFLEPGKSNQIIPLYSTTQAMLFQEISLAQDPLKIFYVKLLVGYQQFE
                     KSGKISVRTLKFPLKLQAYVNRVGQQPFFTLDKPLLGQPIEAQVNEVTDGQKASFASI
                     KSQLKHSDIESESDFSNDKIAVKPIEFLAFMQKLSQANINQVVEIQNEFHKEFLTDYT
                     SPKNENCRLNLINLVSNPSQVLSLRQTERKPLQKNFEELNLFEYDSLLPAKFQTRFLL
                     KRNTKNFAQVDLDKSVFRVNDIIRINIQLLNHIKTTGLIVALERVETISDQYIFKDEK
                     GQIHENLTEQSQLVEKVCEKVVSTINSEQVSANLPIPYNSPGQFKTNIVNVRYLVTIK
                     FILVEESSDLELIYSDNKGDLLRGVEFYSSGSEFLCRLPIKVVPNYEPNFGVVNYV"
     gene            complement(<126349..>127287)
                     /locus_tag="PAS_chr1-3_0068"
                     /db_xref="GeneID:8197378"
     mRNA            complement(<126349..>127287)
                     /locus_tag="PAS_chr1-3_0068"
                     /product="60S acidic ribosomal protein P0"
                     /transcript_id="XM_002489359.1"
                     /db_xref="GeneID:8197378"
     CDS             complement(126349..127287)
                     /locus_tag="PAS_chr1-3_0068"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P0"
                     /protein_id="XP_002489404.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0068"
                     /db_xref="EnsemblGenomes-Tr:CAY67120"
                     /db_xref="GeneID:8197378"
                     /db_xref="GOA:C4QV50"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="UniProtKB/TrEMBL:C4QV50"
                     /translation="MGGINEKKAEYFNKLRELLESYKSIFIVGVDNVSSQQMHEVRQT
                     LRGKAVILMGKNTMVRKALRDFVEELPVFEKLLPFVRGNIGFVFTNEDLKTIRDVIIE
                     NRVAAPARPGAIAPLDVFIPAGNTGMEPGKTSFFQALGVPTKISRGTIEITSDVKVVE
                     KDSRVGPSEAQLLNMLNISPFTYGLTVVQVFDDGQVFPANILDITDDELLSHFTSAIS
                     TIAQISLAAGYPTLPSVGHSVVNHYKNVLAVSIATDYSFEGSEAIKDRLANPEAYAAA
                     APAAGEASAGAEETAAAAEEEDEESEDDDMGFGLFD"
     gene            <127871..>130462
                     /locus_tag="PAS_chr1-3_0069"
                     /db_xref="GeneID:8197379"
     mRNA            <127871..>130462
                     /locus_tag="PAS_chr1-3_0069"
                     /product="Membrane protein of unknown function"
                     /transcript_id="XM_002489360.1"
                     /db_xref="GeneID:8197379"
     CDS             127871..130462
                     /locus_tag="PAS_chr1-3_0069"
                     /codon_start=1
                     /product="Membrane protein of unknown function"
                     /protein_id="XP_002489405.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0069"
                     /db_xref="EnsemblGenomes-Tr:CAY67121"
                     /db_xref="GeneID:8197379"
                     /db_xref="GOA:C4QV51"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR022257"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:C4QV51"
                     /translation="MTTEVNISTETVLTSLAVNSAVFGGFVVAFILLRAKFHRIYQPK
                     SFTKLLPPEDRPKPVSVFAPRMIWDLIRKDKKFLIKFCGIDGYLFLRYMGILTLTFFF
                     GSLILIVLLPVNAVNGVGHDGFDQLAIQNVDDRNRYFAHAFISWVFYGSILYVIYREL
                     YFYNNMRVVIMSSPLYGTKQSSKSVIFQTATPQFLFKSELRKLFDGVKNVWVLQAPKD
                     LAPLVNKRDQVSMKLENAICKILTQSTKRYLKSPDTFVEGTSWSDYVKKRPTTRSFPI
                     FGKKYDLIDHCKTTLIELNEKILDRQANYEESSPVNSVVVEFISQYHAQLAHQSVAHH
                     MPLHFTPSHIGVEPADINWFNMRLSWWERLVRSWAAVASIIALVIFWSIPVSFVGMIS
                     NITYLTNELPWLRWILDLPDQLLGIVTSLLPTIMLALLMMILPIFIRNMAKLYGSVTS
                     QSVELFTQQTFFAFQVVQVFLVVSLSSAAASAVTQIIEDPTSIMDTLATNLPKASNFY
                     IAYIILQGLSGSSSSLFQVANLILYYVFGFAFDNTPRKKHDRYAGLGSMEWGTTFPVY
                     TNLAVIVLSYSIISPLILIFGTVAFALLWFTYMYNLSYVFVSGPDSQGLHYPRALFQT
                     LVGVYLGEICLLGIFAVGRGWGPIVLEIILLAVTVFVHLNMNSSFDRLLSVVPADAMK
                     PLDGVSETPSWVPSGDVENSHNFNESPFLSEEELPKKHKHKKRKQRSLANVPLLVDGE
                     DMGSSITTLGPLDRFFRPWIYYSYETLRTYLPESYQEPTVTDEKQTKHAYDYPSVTQQ
                     QKVLWIPKDPLGFSSQLIQEFKGVIEISHERASINNKGKVEWEGDAPTSGSNVELDKS
                     DKQLVDS"
     gene            <130831..>131703
                     /locus_tag="PAS_chr1-3_0070"
                     /db_xref="GeneID:8197380"
     mRNA            <130831..>131703
                     /locus_tag="PAS_chr1-3_0070"
                     /product="Mitochondrial inorganic pyrophosphatase"
                     /transcript_id="XM_002489361.1"
                     /db_xref="GeneID:8197380"
     CDS             130831..131703
                     /locus_tag="PAS_chr1-3_0070"
                     /codon_start=1
                     /product="Mitochondrial inorganic pyrophosphatase"
                     /protein_id="XP_002489406.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0070"
                     /db_xref="EnsemblGenomes-Tr:CAY67122"
                     /db_xref="GeneID:8197380"
                     /db_xref="GOA:C4QV52"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="UniProtKB/TrEMBL:C4QV52"
                     /translation="MFKRLFSSVQTGSKYSSAYKNYLKLDNGKIGSYMHDIPIEYDQT
                     SGLLNVVVEIPRWTNAKFEISRSLEANPITQDQKDGQLRFVHNLYPNHGFPFNYGAIP
                     QTWEDYTRPSKFVSAYKGDNDPLDIIEVGSKVLEVGQVLRVKVLGSLALIDEGELDWK
                     IITINTEDYHASDVNDIYDIYHVLPGMLENTREWFKNYKKPEGKPSNVFAFNGEFKNH
                     EDTMKVIEECHKNWKALIEGKVTGAKAPKVSNATLEETPGFTTFDEQKLLVKTNAKDE
                     EIPQEVNRLYFFNN"
     gene            <132095..>136741
                     /locus_tag="PAS_chr1-3_0071"
                     /db_xref="GeneID:8197381"
     mRNA            <132095..>136741
                     /locus_tag="PAS_chr1-3_0071"
                     /product="Subunit of the nuclear pore complex (NPC)"
                     /transcript_id="XM_002489362.1"
                     /db_xref="GeneID:8197381"
     CDS             132095..136741
                     /locus_tag="PAS_chr1-3_0071"
                     /codon_start=1
                     /product="Subunit of the nuclear pore complex (NPC)"
                     /protein_id="XP_002489407.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0071"
                     /db_xref="EnsemblGenomes-Tr:CAY67123"
                     /db_xref="GeneID:8197381"
                     /db_xref="InterPro:IPR018864"
                     /db_xref="UniProtKB/TrEMBL:C4QV53"
                     /translation="MADDKDSWTFAQAFELFSKSNDASILDSLDTFLKTNSDLLESKS
                     IPFVFHEFKDDELLHLKENVIRGVQYPVPNEKIIKYCITVSRLLNVDVHEVLRICKQN
                     FVDLVIDRNDSITEIIKLVTQEIALIIQLRCLLLQSKRLTINSDDIFDGIFDYLNEYF
                     IKKGYFEEESPYASLIANEKVNVTVQVLNFLAYLSTEYSATKEQVVTWFKIMELSRFA
                     SILKRSISNSRLESIQSLLSVITNLILDLNNNYGGLDHYKSYLNDAVSIQQISESLNN
                     TSPSCPIVLYSWSILLHRKYLVLESFPDNPHGQKLLGSLGGLHQLQQQYLQFSKISQD
                     QNVIEKLVRCHKNLYYDAIFTTALGTLVLHYLPYLSLTDQVSQMLNTIFKDCLRNILI
                     KLFQDEYFERLLTLARAKFPRSIVSYLNLASLNTNFALEEVTCMKSYMESFDEDSLLN
                     KYEIDDQNPELVKITQDIDIFPPFESSKELSLLMRDGTKGKLLSGNMVVFIYDYNGWT
                     FLGRILQNISRNFNLQDDRVASMISILQVFTRVTEEIVPESAESFFALASTFVDDSDV
                     IEVIFRLFDQCLHARCLQGLEAIAKFIQALCRTLSYRVWSYLSHSQLFSVFASTILGA
                     VEMVSGDYSFTITLIKMVDTLVVGCLSLDTRVSARLKSQVLINITSHMLHIFEIFYHC
                     RFEIEYQKWEIGTLLVDVFGKLLVPVYGIDGVDEPENKATAVFAKSAQKIVDSFLVPD
                     LMDVRSNKPITKAIDDLLTKSSTLDLTGVWYSNWNRAIIGFTELLLSIRSVCGMPPSI
                     LEKTMFAKSPSLVDVYHHHTSLRLDVTKLLTSLVNAKWPNEPPSLLAYLGKDQSYLLL
                     NLLAANLTNSLVDYDIKVSIYDLFSAVMEGDQEGLSIMFITGHGSNEKFQQASISLLE
                     IMKKCVIDLSQYPDSVALHLVDAIALAFNSWTTAKESKDDEPFIGQLITRISKRNLID
                     TPQTNQEFINACYEHRLISKIAEILSLFLFVSNNEKCKRMIVQLIESDEFLETIEADF
                     RIEGYKSSLHNDLHEKFQQNWPGMKLDQFAHSSLVKRKRYGENSVFALGLLDDLFESD
                     ERWADFRNEIIQASINLQYISAQLLVAKSLSALITTYFKKATAVDIKFIKLATQLLLI
                     NDRDGIPAPIFKEPYYERIDLAFFIVYNFSKTTKQVDDKYLADLISAVSQLIISPTDL
                     YRPLLRILYACLKLIKKDTNLFAEHFTIFERVFDLVVCQNTRYLFASLTSDQNLPLFG
                     KLVENILLNLALLKTFFNMNLPKNLANSFAKPLVRHGTLRSILNLYSSSHSLNEKDNL
                     ILADIAITFIHELVTVKGVTKELISNRLFSNLIESPVSLYIQNGHITATSTPRLHNIW
                     SNGLLSIILSILGSFGESVLPEVCSFVTCFAKQIATCIHSWSSDSLSVSLPLIQETSQ
                     LIMLYSLLKALNFKDYMISNNLTFDSGVKQIMSSSSRSRYSNDSEQLQNRFFPGLDTL
                     EQRNALGATLSYLLSHPKYLMSRAVDTNLIENKSSQFQEELINGLKELRNSLKD"
     gene            complement(<136764..>139361)
                     /locus_tag="PAS_chr1-3_0072"
                     /db_xref="GeneID:8197382"
     mRNA            complement(<136764..>139361)
                     /locus_tag="PAS_chr1-3_0072"
                     /product="Splicing factor that reanneals U4 and U6 snRNPs
                     during spliceosome recycling"
                     /transcript_id="XM_002489363.1"
                     /db_xref="GeneID:8197382"
     CDS             complement(136764..139361)
                     /locus_tag="PAS_chr1-3_0072"
                     /codon_start=1
                     /product="Splicing factor that reanneals U4 and U6 snRNPs
                     during spliceosome recycling"
                     /protein_id="XP_002489408.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0072"
                     /db_xref="EnsemblGenomes-Tr:CAY67124"
                     /db_xref="GeneID:8197382"
                     /db_xref="GOA:C4QV54"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QV54"
                     /translation="MEQNTIIPRGEYLQLIENAKGDEPESVLDLRLKFLSIYKFTTQE
                     WNSWLQEMQTENFETVDFYFQLRLKDDSSPSVWLKYIELASNYSTLEEKVTEIFNKAL
                     ISTQYHYTESQIIWSSYWKFMSEQQNVGADVLDSIYLQRLQIPHFDSQETFNHYSVFV
                     TNNFKEAYDSKMKYASKLFNQSKAISDRLEDFELKLLDAQFQPTSKFWIGYIDSVFRL
                     KKFQHARLLAKSIFERATTNRFDVLAIDIWSHYFNVLNEKDIALHPSSVESFIRQFPE
                     HPTPYQYYFSLTLDARSLLKFRSQAFQFDIFTPSKFLEWKNTACSLLWTELDVLLNSD
                     SSSIPILQDLSMFSELALQNDDVLHSLDRSCVEIYSLLDLLDEARALLRKMTEKFPSQ
                     VEIWLFSYQFERSHDNLTTASKILRAGISRWDQLDWPQRLMDEQSRFEGIYNHKDLAK
                     AFAKSSRKLQESSEPMASPSIQSELELENNEEKSGPPKRALEESIYTPSKKSKRDREN
                     LSVLVTSGNKLEELSVRNLFQDCGEIKSVFLRNNLATIEFSTEDGYLAALTKDHKTID
                     GFEISVNKLLSSTVWVTNFPPDQLSQSLEDLFSEVGTVLNTRFPSLRFNTDRRFCYIQ
                     FTSEQAAMDAVAKFNGKVLKDSQGKEYHLVAKISNPEKRSQRSDEGRELFIRNLDFKL
                     TKEDLVPLFEKYGQIDKIYVPCDSETKKNNGFAFITFKEKDAAESALELNSVPLLDRP
                     LDVSLAKKKPKKVSVLEMNPAPKKNSKLTTIEAFDLPETVNSSQLMKIFSAIGPISKI
                     TLKPESHSAFIAYEDVNNSGRAMLVLNGKQVDGFTLKLSEKSTQQQPRKPSQFPTSFI
                     PPSLQRRKV"
     gene            <139578..>140063
                     /locus_tag="PAS_chr1-3_0073"
                     /db_xref="GeneID:8197383"
     mRNA            <139578..>140063
                     /locus_tag="PAS_chr1-3_0073"
                     /product="Nucleolar protein of unknown function implicated
                     in ribosome biogenesis"
                     /transcript_id="XM_002489364.1"
                     /db_xref="GeneID:8197383"
     CDS             139578..140063
                     /locus_tag="PAS_chr1-3_0073"
                     /codon_start=1
                     /product="Nucleolar protein of unknown function implicated
                     in ribosome biogenesis"
                     /protein_id="XP_002489409.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0073"
                     /db_xref="EnsemblGenomes-Tr:CAY67125"
                     /db_xref="GeneID:8197383"
                     /db_xref="GOA:C4QV55"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:C4QV55"
                     /translation="MDSKRYLVSYGWKEGEALKKGGLKRPILVKQKRDTKGLGNDIND
                     GEVWWEKLFDVQLKNLEVYNSDKVKFEQKEIKIDKSPLYSMFVQGEGLTGTIGVEEET
                     VQATVRKQIVDLKEIRRKREKAKKSKRKEEKKEKKKAKESKEKKEKKVKKVKKVQEGQ
                     E"
     gene            <140637..>142182
                     /locus_tag="PAS_chr1-3_0074"
                     /db_xref="GeneID:8197384"
     mRNA            join(<140637..140646,140744..>142182)
                     /locus_tag="PAS_chr1-3_0074"
                     /product="Cytoplasmic ATP-dependent RNA helicase of the
                     DEAD-box family"
                     /transcript_id="XM_002489365.1"
                     /db_xref="GeneID:8197384"
     CDS             join(140637..140646,140744..142182)
                     /locus_tag="PAS_chr1-3_0074"
                     /codon_start=1
                     /product="Cytoplasmic ATP-dependent RNA helicase of the
                     DEAD-box family"
                     /protein_id="XP_002489410.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0074"
                     /db_xref="EnsemblGenomes-Tr:CAY67127"
                     /db_xref="GeneID:8197384"
                     /db_xref="GOA:C4QV56"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QV56"
                     /translation="MSEEKREAKDAAELLNSLSLNKANDNETQPEAKQEVVETGKTEE
                     SIKLESKSEPKTEAEQKEDSNLIKSTYEVKVKLADLQADPDSPLFSVKSFEELGLSPE
                     LLKGLYAMKFQKPSKIQEKALPLLLSNPARNMIGQSQSGTGKTAAFSLTMLSRVDESK
                     PVVQAICLSPARELARQTLEVVQQMGKYTKITTQLVVPEAVPRGQPVTANILVGTPGL
                     TLDLIRRKQIDTSNVKVFVLDEADNMLDKQGLGDQCVRVKKFLPQTAQLVLFSATFPD
                     EVRKYAGKFVPNANSLELKHEELNVDGIKQLYMDCDSQEHKFDVLCELYGLLTIGSSI
                     IFVQRKETANMLYKRMKDEGHTVSILHGDLESSERDRLIDDFREGRSKVLITTNVLAR
                     GIDIASVSMVVNYDLPVDRQGNADPSTYLHRIGRTGRFGRVGVSISFVHDRTSYEQLM
                     AIRKYFGNVEMTRVPTDDWDEVEQIVKKVIKN"
     gene            <142625..>142855
                     /locus_tag="PAS_chr1-3_0075"
                     /db_xref="GeneID:8197385"
     mRNA            join(<142625..142661,142719..>142855)
                     /locus_tag="PAS_chr1-3_0075"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489366.1"
                     /db_xref="GeneID:8197385"
     CDS             join(142625..142661,142719..142855)
                     /locus_tag="PAS_chr1-3_0075"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489411.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0075"
                     /db_xref="EnsemblGenomes-Tr:CAY67129"
                     /db_xref="GeneID:8197385"
                     /db_xref="GOA:C4QV57"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:C4QV57"
                     /translation="MVDSTKIITVIIAVFLPFLAVFMVKGAGRDLLINIILCCFFWFP
                     GILHALYVVLTSS"
     gene            complement(<143053..>143220)
                     /locus_tag="PAS_chr1-3_0076"
                     /db_xref="GeneID:8197386"
     mRNA            complement(<143053..>143220)
                     /locus_tag="PAS_chr1-3_0076"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489367.1"
                     /db_xref="GeneID:8197386"
     CDS             complement(143053..143220)
                     /locus_tag="PAS_chr1-3_0076"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489412.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0076"
                     /db_xref="EnsemblGenomes-Tr:CAY67131"
                     /db_xref="GeneID:8197386"
                     /db_xref="GOA:C4QV58"
                     /db_xref="InterPro:IPR020266"
                     /db_xref="UniProtKB/TrEMBL:C4QV58"
                     /translation="MDFSNFAKNEPKKELSKFEQFKETPAYQVGLNVGLFALGVAFIQ
                     SSLMDLLAPQI"
     gene            <143548..>144219
                     /locus_tag="PAS_chr1-3_0077"
                     /db_xref="GeneID:8197387"
     mRNA            join(<143548..143581,143666..>144219)
                     /locus_tag="PAS_chr1-3_0077"
                     /product="Nuclear protein of unknown function"
                     /transcript_id="XM_002489368.1"
                     /db_xref="GeneID:8197387"
     CDS             join(143548..143581,143666..144219)
                     /locus_tag="PAS_chr1-3_0077"
                     /codon_start=1
                     /product="Nuclear protein of unknown function"
                     /protein_id="XP_002489413.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0077"
                     /db_xref="EnsemblGenomes-Tr:CAY67132"
                     /db_xref="GeneID:8197387"
                     /db_xref="GOA:C4QV59"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C4QV59"
                     /translation="MKVNIRISGGTSFSVTVPDNSTVQDLRTAALVAAPIDLISTRSQ
                     TPYKLVYSGKKLDLADTLTSLGVTDASTVFMVSSDTNTHSPILTPAELSAPHTNNPPA
                     LSSTVKDETGATTTTKITKVRRKSSNKRRCSYLNCMSAPLRMVGDCVHCQGKFCSKHR
                     LLENHHCTELQTCKEQMHERNANKLTSEQTIASKV"
     gene            complement(<144273..>145461)
                     /locus_tag="PAS_chr1-3_0294"
                     /db_xref="GeneID:8197388"
     mRNA            complement(join(<144273..145317,145376..>145461))
                     /locus_tag="PAS_chr1-3_0294"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489369.1"
                     /db_xref="GeneID:8197388"
     CDS             complement(join(144273..145317,145376..145461))
                     /locus_tag="PAS_chr1-3_0294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489414.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0294"
                     /db_xref="EnsemblGenomes-Tr:CAY67133"
                     /db_xref="GeneID:8197388"
                     /db_xref="InterPro:IPR006353"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4QV60"
                     /translation="MFSNSIRNFPARRFAKFARSLSDIGFCFDIDGVLLKGKKAIPGA
                     ANTLRYLQSEKVPFVLFTNGGGVSEESRSHFISKTLGVDISPRQIILSHTPFRALAQD
                     ERLNRVLVVGGPGDSARHVAQEYGFREVLMPIDVLAANESIWPFHRYSKAEIANLAIP
                     VDSSHIYGPSAKPFDCILIFNDPRDMGADIQIVADLLNSHGGYMGTKRHDKGEVPSVP
                     ILFSNNDFFWANDYPQPRFGQGAFKIAVDAIYNKINGTEKMQSMVFGKPEKVSYDYAH
                     HVLIDWRNWLGGKREPASAPVLGRTPERSPFREIYMIGDNPASDIEGGNRAHWNTVLV
                     RTGVFQDHDLVHDTENLIARPSHGVFDNVEAAVRGVLEDVNN"
     gene            complement(<145989..>147617)
                     /locus_tag="PAS_chr1-3_0078"
                     /db_xref="GeneID:8196823"
     mRNA            complement(<145989..>147617)
                     /locus_tag="PAS_chr1-3_0078"
                     /product="S-adenosyl-L-methionine uroporphyrinogen III
                     transmethylase"
                     /transcript_id="XM_002489370.1"
                     /db_xref="GeneID:8196823"
     CDS             complement(145989..147617)
                     /locus_tag="PAS_chr1-3_0078"
                     /codon_start=1
                     /product="S-adenosyl-L-methionine uroporphyrinogen III
                     transmethylase"
                     /protein_id="XP_002489415.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0078"
                     /db_xref="EnsemblGenomes-Tr:CAY67134"
                     /db_xref="GeneID:8196823"
                     /db_xref="GOA:C4QV61"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR003043"
                     /db_xref="InterPro:IPR006366"
                     /db_xref="InterPro:IPR006367"
                     /db_xref="InterPro:IPR012066"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4QV61"
                     /translation="MAKLLLADNCQGQIHLVVGLEHLNLCVSRVKTILEAGATPVLVS
                     PQKSTMLDSLQDLATQGTLKVVDQTFSISQLTQLGRDEVDNVVDKVFVVLDSQYAQLK
                     KDISAHCRRLRIPVSVVDSPELCSFTLLSTYSNADFQLGVTTNGKGCKLASRIKRELV
                     STLPSNIDKVCENIGNLRHRIQQEDDDQVEEIYNRLQLLGEDEDDAIQTSRLNQLVEE
                     FNMTKEQKKLQRTRWLSQLVEYYPLGKLAEVSVDDLSAAYHESSNNVEIAQNGTFDHA
                     KKGSISLVGAGPGAVSLLTLGALSEIYSADLILADKLVPTQVLDLIPRRTEVFIARKF
                     PGNAEAAQQELLSKGLAALDAGKKVIRLKQGDPYIFGRGGEEYLFFESQGYRPLVLPG
                     ITSALAAPVLSQIPATHRDVADQVLICTGTGRRGALPNIPEFVKSRTSVFLMALHRIV
                     ELLPVLFEKGWDPKVPAAIVERASCPDQRVIRTTLENVGRAVQEFGSRPPGLLVVGYS
                     CGIIEKLEKEWEVVEGWDDIGGSTILDTVSNLSK"
     gene            <147888..>149204
                     /locus_tag="PAS_chr1-3_0079"
                     /db_xref="GeneID:8197389"
     mRNA            <147888..>149204
                     /locus_tag="PAS_chr1-3_0079"
                     /product="Nuclear protein that inhibits replication of
                     Brome mosaic virus in S. cerevisiae"
                     /transcript_id="XM_002489371.1"
                     /db_xref="GeneID:8197389"
     CDS             147888..149204
                     /locus_tag="PAS_chr1-3_0079"
                     /codon_start=1
                     /product="Nuclear protein that inhibits replication of
                     Brome mosaic virus in S. cerevisiae"
                     /protein_id="XP_002489416.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0079"
                     /db_xref="EnsemblGenomes-Tr:CAY67135"
                     /db_xref="GeneID:8197389"
                     /db_xref="GOA:C4QV62"
                     /db_xref="InterPro:IPR024318"
                     /translation="MAPPKRPLGLGKSAQKKKQKTDEDGVAESGSSANASELTVELNE
                     EVDADDEVSQLFALWKTFLGAEKDNELVLNGIIHECDRLLRNSQTEKNKYKLNGEFHA
                     IYALALNELAFFHAAKENDVKPYFDEALERIDLGLSHSKEDPRLLFSKAHIIFNRVPL
                     EYISKMTPESSSEGYPNILEVLDDALKSYEAAQNEAIKTERFELFDQETFRVLDSLDD
                     LLSIIDDFGKKKSSDEGIDSEDEEELGFDEDEDSLQLSESHPLKPLGESEKYDIWWRT
                     QTIEFLKNLEKLAQKSDIILKDSSLPIGNLHRDVCKKLGQSYLLEAEEPSAIFTTLEY
                     DSDVEDKEDGINGLQADQARDIAIQLVTEAIQYLEKAEYSDDPKSWADVAEAYVTLGN
                     LHSVDSREQEDCYSKAEKRLQHANKATHGKYEHILNNLLQKSYDDT"
     gene            <149341..>149974
                     /locus_tag="PAS_chr1-3_0080"
                     /db_xref="GeneID:8197390"
     mRNA            join(<149341..149400,149462..>149974)
                     /locus_tag="PAS_chr1-3_0080"
                     /product="Hydrophilic protein that acts in conjunction
                     with SNARE proteins"
                     /transcript_id="XM_002489372.1"
                     /db_xref="GeneID:8197390"
     CDS             join(149341..149400,149462..149974)
                     /locus_tag="PAS_chr1-3_0080"
                     /codon_start=1
                     /product="Hydrophilic protein that acts in conjunction
                     with SNARE proteins"
                     /protein_id="XP_002489417.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0080"
                     /db_xref="EnsemblGenomes-Tr:CAY67136"
                     /db_xref="GeneID:8197390"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR016721"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:C4QV63"
                     /translation="MSKPYKLIGEDVYKNRTEKINSELFTLTYGSVVAQLCRDYNNDY
                     KKVNEQLESMGYNIGIRLIEEFLAKTNFGRCINFKETAEIISKVGFKMFLNTTPTVDN
                     FSADGKQFNLILEDNPLAEFVELPDDNKAVKELWYSNVLVGVLKGALQMVQLDVDVSF
                     VKDILRGDPSTEIKLRLNKILKDEIPAGED"
     gene            complement(<150025..>152073)
                     /locus_tag="PAS_chr1-3_0081"
                     /db_xref="GeneID:8197391"
     mRNA            complement(<150025..>152073)
                     /locus_tag="PAS_chr1-3_0081"
                     /product="Glycerol-3-phosphate/dihydroxyacetone phosphate
                     dual substrate-specific sn-1 acyltransferase"
                     /transcript_id="XM_002489373.1"
                     /db_xref="GeneID:8197391"
     CDS             complement(150025..152073)
                     /locus_tag="PAS_chr1-3_0081"
                     /codon_start=1
                     /product="Glycerol-3-phosphate/dihydroxyacetone phosphate
                     dual substrate-specific sn-1 acyltransferase"
                     /protein_id="XP_002489418.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0081"
                     /db_xref="EnsemblGenomes-Tr:CAY67137"
                     /db_xref="GeneID:8197391"
                     /db_xref="GOA:C4QV64"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:C4QV64"
                     /translation="MTASGYANFIYDLFAWTFLIIFDIFFRDVKTRGAFNIPSQGPVI
                     LVVAPHSNQFVDPLMVLIQTKKSTGRRISFLMAAAYYRKKFIGDLARLTRVIPVERAQ
                     DGLKPASGTIHYADFEKDPCLIEGTDTKFTQECEAKGLIGLPRSGGFGKIAEVLSDTL
                     LRLHKPFSSDRAIKIIKGSTTYKTAPKIDNSMVFKHVFDHLHSGGILGIFPEGGSHDR
                     TELLPLQPGVALMALGALAENSEQPITIVPCGLNYFHPNKFRSRAVVEYGSPIVVGEE
                     QARAYKEDSRKAVAELLKTISTGLKTVTVQCEDYETLMILQAARRLYQYPKKKIPLPL
                     VVQMNRNLTIGYTKFKDLPEIVHLKNSVQTYNYRLNNLGLKDHQVQTVKFKPFKAVAL
                     LAYRLVKLLILAVLSLPGTVLFSPVFIACKYISHKKAREALANSVVKIRANDVLATWK
                     LMVAMVAAPCLYAFYSTLGTFLIFKYDIAIVPYQTKSIVVTFITAWIILVCTTYAAFR
                     IGEIGMDTLKSMKYLTWSLLPSEALEELKAERARLSLEVTEVCNNLGPKVIPEFAKDL
                     EKIEASNEEQEEEEIEDEEKEQLLNKTRLGRAPSTSSVNSLRSVTSSTSMPSELGEVA
                     IFSELPTSSRGSIRSRSSSLSESETTGLSTGIEAKNVRSKIQERIFQKMRNEQINEPK
                     "
     gene            complement(<152732..>153763)
                     /locus_tag="PAS_chr1-3_0082"
                     /db_xref="GeneID:8197392"
     mRNA            complement(<152732..>153763)
                     /locus_tag="PAS_chr1-3_0082"
                     /product="Integral membrane protein"
                     /transcript_id="XM_002489374.1"
                     /db_xref="GeneID:8197392"
     CDS             complement(152732..153763)
                     /locus_tag="PAS_chr1-3_0082"
                     /codon_start=1
                     /product="Integral membrane protein"
                     /protein_id="XP_002489419.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0082"
                     /db_xref="EnsemblGenomes-Tr:CAY67138"
                     /db_xref="GeneID:8197392"
                     /db_xref="InterPro:IPR005578"
                     /db_xref="UniProtKB/TrEMBL:C4QV65"
                     /translation="MYNAFDSSRGNQGKQANGNPYGQYGYNQPSVPQPVGQNYASHQP
                     SVSQQQYQNEPFSQQTYPPQQPQQHQQQQHQLPQTAPQGGAQQQPFQNFFQDPSSAMG
                     LQFSQTALNASQQYMQQNFNSIMHTQDIKYYFQVSNSYVVRKLGLILFPYRTKTWTRI
                     YHNATPVGGPGSTGQEIYAPATEDINAPDLYIPLMSFLSYILVWSVFAGIHGDFHPEL
                     LGYAASKTLALQLLDLVLLKFCIYILSVDAKLWDLVAYSGYKFVAVLVILLIKNIFAL
                     QSRAANYSVYFVFAFSLGFFLMRSLRYVVLSTGIRAQQVNISQTKYRTNFLFVYSFVF
                     QGLLVFFMT"
     gene            <154035..>160655
                     /locus_tag="PAS_chr1-3_0083"
                     /db_xref="GeneID:8197393"
     mRNA            <154035..>160655
                     /locus_tag="PAS_chr1-3_0083"
                     /product="Catalytic subunit of DNA polymerase (II)
                     epsilon"
                     /transcript_id="XM_002489375.1"
                     /db_xref="GeneID:8197393"
     CDS             154035..160655
                     /locus_tag="PAS_chr1-3_0083"
                     /codon_start=1
                     /product="Catalytic subunit of DNA polymerase (II)
                     epsilon"
                     /protein_id="XP_002489420.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0083"
                     /db_xref="EnsemblGenomes-Tr:CAY67139"
                     /db_xref="GeneID:8197393"
                     /db_xref="GOA:C4QV66"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013697"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR029703"
                     /db_xref="UniProtKB/TrEMBL:C4QV66"
                     /translation="MSSKSQFKGSTSARFVKNSGNNSQPYQRRSEEELLSNFNNENAH
                     TKLSLVQEADQIDSVFGFDRYESGPKKVGWLINMHTTTIPSEDLLQGYSGVDYYFLDE
                     EGGGFKVTKQYDPYFFVICKKSYESEVEEYLRKQLEGLLKKASRVEKDDLSLPNHLIG
                     LKRTLIQLSFHNISNLLEARRIIAPIVKQNQLFKEQRDVYNSDLNYNLLNEEEDLDFN
                     TESKSKPLDIAHCLEDIREYDVPYHVRVSIDNNYRIGKWYTLEATDSAQVSFTEMKDK
                     IAFADPVILAFDIETTKAPLKFPDSSIDQIMMISYMIDGEGFLITNREIINAEIEDFE
                     YTPKPEYPGLFTIFNEPDEKALIERFFEHIREVRPTVIATFNGDFFDWPFVEKRAFFH
                     GIDMFREIGFAKDVEDEYKSKYCVHMDCYRWVKRDSYLPQGSQGLKAVTTVKLGYNPT
                     ELDPELMTPYAYEKPQLLAEYSVSDAVATYYLYYKYVHPFVFSLCTIIPLNPDEVLRK
                     GTGTLCEMLLMVQAYENNILLPNKHTDPLERFYEGHLIESETYVGGHVESLEAGVFRS
                     DISTDFRIDPTAIDEILSTLDQSLKFSIEVESKKQLKDITNYDEIYDKIKGELLELKN
                     NPKRHEAPLIYHVDVASMYPNIMTTNRLQPDSMKTDQDCAECDFNRPGKTCDRRLLWA
                     WRGEFYPADYSEYKMIEHALSNDTFAPDKPWLPRKTFDQLSHIQRAALVKSNLSEYSR
                     KVYHRIKQTKTIEKEAIVCQRENPFYVNTVRSFRDRRYEFKGLAKVWKGKASKIPKDD
                     RHSLDEAKKMIVLYDSLQLAHKVILNSFYGYVMRKGSRWYSVEMAGITCLTGATIIQL
                     ARSLVERLGRPLELDTDGIWCILPSSFPEDFDFKMKDGKTLTVSYPCSMLNFLVHEKF
                     TNHQYQELVDPVTHKYKTYSDNSIFFELDGPYKAMILPTSKEEGKGLKKRYAVFNFDG
                     SLAELKGFELKRRGELQLIKNFQSDIFKLFLHGDTLEGCYQTVANVANRWLDVLDSKG
                     VNVEDEDLIELICENRSMSKTLAEYGTQKSTSITTARRLGEFLGEEMVKDKGLACKYV
                     IANRPLNAPITERAVPVTIFSSDTEIKKRFLRRWLGDNSLDNFDPRTIIDWEYYTERL
                     ASVVQKIITIPAALQNISNPVPRIAHPEWLQKKVNSQNDSKKQSSLAQFFGKTTNSDI
                     MKDISNRFKDIEDFGADTNGMSRKMGKVTSRKRKQKELESRIAEKEQKLLEEDCPNEL
                     VDYGSFLKYQKAKWKLQSQNRERRRKLFGASANTATRGTIGNIMRKKAESYVGSSWQV
                     LQYKHDSTCKPGEVKALVFIDGRVQTFTIAVPKKVFLGLKTTDLGSLSIPDECTVEPS
                     TNHLPKGEKVENLFKLTMSEEKFNAERGNCNGLFQHEDVKCVYESQIDCTERIIVELG
                     NSVKFQENQVGALGKALQNGFNQNNFTTLPSERYLSHFNLNVTYLIHIVANGYEVFSL
                     FKSWDPTVSVLVLKPNMAASSLPRNMESVYQDYYRSKKERLSHTIIQYDEQLSFDVVD
                     FTDKNKLLRNLNIKCGEANEEKSSKSLMVIQSNQCTKLVRALKNLNEQPVISMNLREL
                     NLSPLSWKSSVINKIINHYLSLGAGLKDLISMARYGNIPLCNLNVEDKSYLIDIQYAR
                     KLIELGIVLWWSPNPLPDHGGFELDQSMANIEKSLEFPTINKPEIYETVCLELNLSNL
                     TINTILTSALINEAEGLEIGDNENTTSFAEDIFSTPALQALRFLLKSWWDDALKNNVD
                     ADIMVFNFMSWVEKTSSYLYDPSLLYHVYNLTKKSLLHLLGEFKRLGSTIIFANRNKI
                     VLKTSKLLVENSYAYGQYIIKTVRSKSMFSYLEFQVVRYWDMLIWMDQYNYGGNGCAE
                     ITSNEKQDLELINHWQLQQFLPPVLQQEFEDWVVVILDSFLKCKQLDLNGSQSNGTPR
                     QTQIQHILKKQNQQQSLSTDFVYEKPENNIIDMFGNVLEKRIITLKERQLRTLLNPAL
                     KAEYEFPKLAGSQLDLSDPTLEFVKFLCHILSLSKSRNIEVRVLRRNILKLFDVKEFS
                     AEATFKNPSASLRLYNVHCEICNHITDLDLCRDTETEIFNCQNCKRRFNKLALEERLI
                     ADAHKLLVHFYNQDLKCSKCHKLRSSELQLYCSCSGSWIGTVNRGDIVKRMKTFHTVA
                     RFYDFNMLKEVTTTGE"
     gene            <160810..>162201
                     /locus_tag="PAS_chr1-3_0084"
                     /db_xref="GeneID:8197394"
     mRNA            <160810..>162201
                     /locus_tag="PAS_chr1-3_0084"
                     /product="Subunit of the origin recognition complex"
                     /transcript_id="XM_002489376.1"
                     /db_xref="GeneID:8197394"
     CDS             160810..162201
                     /locus_tag="PAS_chr1-3_0084"
                     /codon_start=1
                     /product="Subunit of the origin recognition complex"
                     /protein_id="XP_002489421.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0084"
                     /db_xref="EnsemblGenomes-Tr:CAY67140"
                     /db_xref="GeneID:8197394"
                     /db_xref="GOA:C4QV67"
                     /db_xref="InterPro:IPR020796"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QV67"
                     /translation="MFRDPQWQLLKCFLGDDVSFNNVILQGGSGVGKSFLLNKFLETK
                     ADSIIIQIDCETCLSTEMIMQRILNCIYELDFDFKGKYTAGEVRQTNPASTCHDINSF
                     IDTIVQVIENGLHKPIFIILEKLDECLEDTESFLLALTKEAEVDECLNSVHFVEVIST
                     LIPEKLATIGIPTIYFPNYTLEETKEILKIMKQTTLENQLLQESKAKLEKNAPIDEQV
                     KNFTDEQLVSTTILKSQQQFITTFLGIVVDSFYFVLASDLKELEKIVDKIWVQFKGPL
                     IETNGRIVMGKSDAISVFRQFKSLFRPEYAIPCSVLNEEEGKALLDDDLFNLSLYDKY
                     ILLASYLASFNDPRNDLIFFSKFRDARFDKRKKPMLKKKSVKTLTPNAFSLERLLAIL
                     HAIYESEVELQTDVDLLKSLATLASQDMILKSSNDVLDGNTRWKCNVSWDIIKSIAKS
                     VNFDISVYLQSEY"
     gene            complement(<162207..>162644)
                     /locus_tag="PAS_chr1-3_0295"
                     /db_xref="GeneID:8197395"
     mRNA            complement(<162207..>162644)
                     /locus_tag="PAS_chr1-3_0295"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489377.1"
                     /db_xref="GeneID:8197395"
     CDS             complement(162207..162644)
                     /locus_tag="PAS_chr1-3_0295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489422.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0295"
                     /db_xref="EnsemblGenomes-Tr:CAY67141"
                     /db_xref="GeneID:8197395"
                     /db_xref="InterPro:IPR019191"
                     /db_xref="UniProtKB/TrEMBL:C4QV68"
                     /translation="MDDPFESVLSLEQQFYQDGYNEGYQKGVETHFKEGKEYGVQTGF
                     QKFVFLGFIQGFTKNILASDQENVKVKENALQIESILEPLQDHTSNSDADHELLESAL
                     KKCRNKLRVICNQMQHKTSLSQMENLCLDITGKIPGEILEDAW"
     gene            <162735..>163640
                     /locus_tag="PAS_chr1-3_0085"
                     /db_xref="GeneID:8196824"
     mRNA            <162735..>163640
                     /locus_tag="PAS_chr1-3_0085"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489378.1"
                     /db_xref="GeneID:8196824"
     CDS             162735..163640
                     /locus_tag="PAS_chr1-3_0085"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489423.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0085"
                     /db_xref="EnsemblGenomes-Tr:CAY67142"
                     /db_xref="GeneID:8196824"
                     /db_xref="InterPro:IPR003169"
                     /db_xref="UniProtKB/TrEMBL:C4QV69"
                     /translation="MVSLTEKRPRRAPNKEDDPYLENLDRKKVKLSYQPGYESDSLDE
                     EEGDDDIKLMNEDALELIGKTDEDGEINVVRDTEIQNTHSLNEDNEVQLTSFDLDDEL
                     KEGVFDQNGNFIANKPDSESSNEEEVTYDDKVIEKARTQQQRRLLKKKLAVERRRQER
                     KEIDLKKVLNDLVQFLEISETPMEALQRLSKSKNKEAITQTVDLCSLLGKKGYDGYNM
                     SREELMRLYAQLTGQELRVKRTLEDADNETNDDGYEFQYVGYDEIYGPYSREEILDWK
                     ESYFKDKEVLIRKIGEEFQSIQELK"
     gene            <163919..>165469
                     /locus_tag="PAS_chr1-3_0086"
                     /db_xref="GeneID:8197396"
     mRNA            <163919..>165469
                     /locus_tag="PAS_chr1-3_0086"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489379.1"
                     /db_xref="GeneID:8197396"
     CDS             163919..165469
                     /locus_tag="PAS_chr1-3_0086"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489424.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0086"
                     /db_xref="EnsemblGenomes-Tr:CAY67143"
                     /db_xref="GeneID:8197396"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4QV70"
                     /translation="MNLLNTEHLWSNQDSFLDIPPQELQARDYELENDLFEFFYKSLI
                     HKDNLLKGDQLSSIINLYEEREQYLEHCNHQITRKVIQKIKQTLPERAMIDSQGLMWP
                     SEGLRNKVLSQRSNLFHSYTHLPDSHRLANLTVDFKLQPHSGHYDSKFMQIQPLFEFH
                     KFFTLPKPDVTHFQLRHLVYCVDKNSVFYIENGPESSRIMRLDPETNKIYTQLDLVNS
                     QFADLKISTISANRSLISIGSFNGTLLTYDLHTNRFQEYLLTNHLDGIITYILMSRHR
                     SFANQLMISSNDKFLRSFDYTTNQVIKADKLDFAINTICEGPVSEQSQVLISGDTQNS
                     FIIDRRLPKLSALPIILTGHYDYTFASDWNINHLIATGNQDGTVRIYDTRYLSNTTKN
                     PSGNSTLFTFSGKLNGAIRNLKFDDTGNYLAFAESIDNVYLIDLKSGGLENIDPGLMC
                     PPTPPSSRIPLQYQPISCIGKITGLSFIPSENNTQVLTIGITDFSSGGILQYKIDNYV
                     DPQIAAFI"
     gene            complement(<165520..>165801)
                     /locus_tag="PAS_chr1-3_0087"
                     /db_xref="GeneID:8197397"
     mRNA            complement(join(<165520..165698,165756..>165801))
                     /locus_tag="PAS_chr1-3_0087"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489380.1"
                     /db_xref="GeneID:8197397"
     CDS             complement(join(165520..165698,165756..165801))
                     /locus_tag="PAS_chr1-3_0087"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489425.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0087"
                     /db_xref="EnsemblGenomes-Tr:CAY67144"
                     /db_xref="GeneID:8197397"
                     /db_xref="GOA:C4QV71"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="UniProtKB/TrEMBL:C4QV71"
                     /translation="MSDHKYHFDVKMSCSGCSNAVNRVLNKLDGVKNVDISLEKQTVD
                     VVTSNALGYDTVLQTISKTGKQVIGGNVVE"
     gene            complement(<165932..>168136)
                     /locus_tag="PAS_chr1-3_0088"
                     /db_xref="GeneID:8197398"
     mRNA            complement(<165932..>168136)
                     /locus_tag="PAS_chr1-3_0088"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489381.1"
                     /db_xref="GeneID:8197398"
     CDS             complement(165932..168136)
                     /locus_tag="PAS_chr1-3_0088"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489426.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0088"
                     /db_xref="EnsemblGenomes-Tr:CAY67145"
                     /db_xref="GeneID:8197398"
                     /db_xref="UniProtKB/TrEMBL:C4QV72"
                     /translation="MTSLEEFIDSYDMEVLASQLQGDSIQSSIISLKQQDVELTRQLQ
                     VCNHLSSFYQLFNNLTFDENPSVLQTQHLVESFNKLTYQRHRLDEFLAKHGVDSSKLL
                     IVQDISQQTEAKKQQLTNQLMECLKLYIKIEDSKIEFHSAVDGVSFHKFCSLDDSLNS
                     RRFHRVFEDWLKEHVNQGLSYFQNTLTVSNAEQSFINVIESLESFVRFINDFEEANTS
                     KSFNLKHYTSKTLYDILKPYMLHPEIVFDLLQSKICNIENKTMSRLIELNRLLVTTDW
                     VKNLSDIDIWLDDLVSQWLDTSVESLIEELKYLSQKILTNQSWTETIQEVNKLEAGKW
                     QVERRSSTKNPQMTSTKNTETEWDNWDDGWDSESVNDKRSIDARSIRSKRNSWGDNWD
                     RLSKKDSWSDNGWNDGWNEEFSDNDNDVTETRSNIRADEPEMRTSNTQSHTLRSSVSE
                     QFLQVIKQKFFDPVSKVSSMDIDPDVKDEINDLRSSKSIVIINSIVMLFDSFLTPRYT
                     TPILVYQDLSYLINQIDPQKNSLGDNFLSNLIDSESDFLFQSALQYNDLFVDNDDSSD
                     RLIELASQFQLDFQKKASQFYEKFYYNSNNFTVNETLNITLILTILDQFLQSLSDLIL
                     ERESIGDEESKILANVLIITLQSLLPSKYHGTTDPLAVKIPQTIKHYHKIQSIAFMFQ
                     SSMKVILDELLTKGRYTIWKRNELIRLIKALFIDSEMRSATINEIVDVRTTD"
     gene            <168844..>169668
                     /locus_tag="PAS_chr1-3_0089"
                     /db_xref="GeneID:8197399"
     mRNA            <168844..>169668
                     /locus_tag="PAS_chr1-3_0089"
                     /product="Protein chaperone involved in regulation of the
                     HSP90 and HSP70 functions"
                     /transcript_id="XM_002489382.1"
                     /db_xref="GeneID:8197399"
     CDS             168844..169668
                     /locus_tag="PAS_chr1-3_0089"
                     /codon_start=1
                     /product="Protein chaperone involved in regulation of the
                     HSP90 and HSP70 functions"
                     /protein_id="XP_002489427.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0089"
                     /db_xref="EnsemblGenomes-Tr:CAY67146"
                     /db_xref="GeneID:8197399"
                     /db_xref="GOA:C4QV73"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QV73"
                     /translation="MDQDLKQVLDRDIDLYDLLGVPEDSQDSDIRRGYRQQALIYHPD
                     KNDTPQANVRFQQISTALKILGTPELRNSYDSYKRLKRQRNEKRSQLNERDKRFENEL
                     VKAEEELLRNLKSQQSNAYKEAILREENLKLRRRRESKYLNLPNVTHQVESPVVVKLK
                     WKNLIQGIFTEDEIRDIMSRFGRISKIWFPENNDSDTYHYCFIQFEDYIGGVLATLCD
                     YSKLNPENDPVGKSGSLIKLLRSCRFVESSINLKWDRREMSQAEYIGRTLLNLQSN"
     gene            complement(<169854..>170465)
                     /locus_tag="PAS_chr1-3_0090"
                     /db_xref="GeneID:8197400"
     mRNA            complement(<169854..>170465)
                     /locus_tag="PAS_chr1-3_0090"
                     /product="Subunit of the N-terminal acetyltransferase NatA
                     (Nat1p, Ard1p, Nat5p)"
                     /transcript_id="XM_002489383.1"
                     /db_xref="GeneID:8197400"
     CDS             complement(169854..170465)
                     /locus_tag="PAS_chr1-3_0090"
                     /codon_start=1
                     /product="Subunit of the N-terminal acetyltransferase NatA
                     (Nat1p, Ard1p, Nat5p)"
                     /protein_id="XP_002489428.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0090"
                     /db_xref="EnsemblGenomes-Tr:CAY67147"
                     /db_xref="GeneID:8197400"
                     /db_xref="GOA:C4QV74"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C4QV74"
                     /translation="MAITIRLATIEDIQAMQNANLTNLPENYTLKYYMYHILSWPQLS
                     FVATTTGNDLVLDPTEEYSPDPKQDPQYVNKDEKIVGYVLGKLDDDPDKPPTPITGHV
                     TSLAVMRTYRRMGIAGKLMKQCLYALAENFKADRVSLHVRKSNRAALHLYRDSLKFEV
                     LSIEKSYYNDKEDAYYMKKDLVLEDLVPTKDYEYQDDLESDLI"
     gene            <170783..>171502
                     /locus_tag="PAS_chr1-3_0091"
                     /db_xref="GeneID:8197401"
     mRNA            <170783..>171502
                     /locus_tag="PAS_chr1-3_0091"
                     /product="One of 10 subunits of the transport protein
                     particle (TRAPP) complex of the cis-Golgi"
                     /transcript_id="XM_002489384.1"
                     /db_xref="GeneID:8197401"
     CDS             170783..171502
                     /locus_tag="PAS_chr1-3_0091"
                     /codon_start=1
                     /product="One of 10 subunits of the transport protein
                     particle (TRAPP) complex of the cis-Golgi"
                     /protein_id="XP_002489429.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0091"
                     /db_xref="EnsemblGenomes-Tr:CAY67148"
                     /db_xref="GeneID:8197401"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR016696"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:C4QV75"
                     /translation="MSRILSSAKPIQGIGYDPLIGPQRVEEVEASANNSTSVDHVTPP
                     NFNYDRNLHRMKHDVSLSSFSFLFCELVSWSRERANGIQELEKRLNGLGYTIGLKYLE
                     LLGLRENYITNTTTSKNGLNRDIKIIQMLEFIHTTFWKALFGKTADNLERSQDNVCNY
                     MITDNDPLANRYISVPSEFQNFNCSAFVAGIIEGMLDSAYFQADVSAHTVETKENPNR
                     TVFLIQFDEAVIKREQIRFGS"
     gene            <172250..>173629
                     /locus_tag="PAS_chr1-3_0296"
                     /db_xref="GeneID:8197402"
     mRNA            <172250..>173629
                     /locus_tag="PAS_chr1-3_0296"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489385.1"
                     /db_xref="GeneID:8197402"
     CDS             172250..173629
                     /locus_tag="PAS_chr1-3_0296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489430.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0296"
                     /db_xref="EnsemblGenomes-Tr:CAY67149"
                     /db_xref="GeneID:8197402"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4QV76"
                     /translation="MSTTPRSRSDTISPQTAELIDKPEQDLKPLSKEPKKPMSLAEQR
                     RLIENEFDLEILLKHRELNLVDEEMNKVEAQMIALRNHYNIPVEDKLEREPKDFTEKY
                     LNLLSKYKNEAQERSNNQEAQYTSSPSEFSYRTRSQTSSLRPIGSKFLASSGKCIYRR
                     SDGVLVQLTCKNCERTNFSSAQGFLNHCRIAHNQEFTSQDNAALICGETLPDEEQDKE
                     GLDTVIELRKQNLDPSKNLAKPQLIFTGDSKGDVGAHSTTSTSSPPLTERPASAPRKL
                     SSPGAGANVTKTKSTQHLKQKFKNNPEFEDLLKDTTSEVLRSHLLDDEEEDINANQNL
                     TDENKNLLKEAKRMNLKLSKPTNVERPRSSSSSAGANSQRHRRKSRGGVGLRKREASP
                     GEQEDLPKLRLKLNVNPTTPSPSEDTDASNTTKVKAEDTVPQPNIEPKKPGHMRTRSK
                     VNLAESPGI"
     gene            <173743..>174351
                     /locus_tag="PAS_chr1-3_0092"
                     /db_xref="GeneID:8196825"
     mRNA            <173743..>174351
                     /locus_tag="PAS_chr1-3_0092"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489386.1"
                     /db_xref="GeneID:8196825"
     CDS             173743..174351
                     /locus_tag="PAS_chr1-3_0092"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489431.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0092"
                     /db_xref="EnsemblGenomes-Tr:CAY67150"
                     /db_xref="GeneID:8196825"
                     /db_xref="InterPro:IPR007364"
                     /db_xref="UniProtKB/TrEMBL:C4QV77"
                     /translation="MKYIIEHMEPGFTPWVVLEYSTIIKEVGKENLILTSLPEGTTEA
                     DIPQELIDLGIQWTTDECISIAESRQSLCLLDPAASQDLTPSDSEKFEYFVFGGILGD
                     HPPRDRTGELRKKYGLEGRRLGELQMTTDTAVRSTQLIIQNQIKFEDITFIDYPEIRF
                     NRYEATEMPFRYVMDKTGKPILPDGMIALIKKDTEQSLDDLL"
     gene            complement(<174395..>176539)
                     /locus_tag="PAS_chr1-3_0093"
                     /db_xref="GeneID:8197403"
     mRNA            complement(<174395..>176539)
                     /locus_tag="PAS_chr1-3_0093"
                     /product="Protein with similarity to bovine phospholipase
                     A1"
                     /transcript_id="XM_002489387.1"
                     /db_xref="GeneID:8197403"
     CDS             complement(174395..176539)
                     /locus_tag="PAS_chr1-3_0093"
                     /codon_start=1
                     /product="Protein with similarity to bovine phospholipase
                     A1"
                     /protein_id="XP_002489432.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0093"
                     /db_xref="EnsemblGenomes-Tr:CAY67151"
                     /db_xref="GeneID:8197403"
                     /db_xref="GOA:C4QV78"
                     /db_xref="InterPro:IPR004177"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4QV78"
                     /translation="MFPISVRRQFSVLSHLRVNARWFYAVDVPISKPEQFKYTQTKPP
                     QKFLPFNDSDNSLLEKSFKDGDKTVLQVLEDRLFNCDIRSRQLYPIYWQGPVYEVRRG
                     IWFSNGTPIDQRLADLIEKQYQALKDKLGKEEDQMLFELDDKTSELSPIEKSEDLTTT
                     ITETFGSSESQSPKKLVLFKDDKTVFILPKSSKLLIQLLNPLADELKKSIFSDYKIER
                     GYKAKEKDKAQVNKGSTSAFGDYSFINFFTDTAIDKNAKSDQAEEKMEYHMKNDFAKE
                     DKDTKRDINHIVLCCHGIGQSLGTKLESVNFIHDINIFRKGLATALKEDSELQEISPS
                     ASNHGIQVLPVIWRYNLGFSIDEPISVIDENDGVKKLPSVSDITVDALRPLRNLLGNV
                     VLDILLYYDSWYKKRILSSVVQQCNDVYDKFLQNNPGWNGKVSFVGHSLGSAIFFDIL
                     CKQPDNLNFEDPNFDHKRYLKFKVENYFALGSPLGVFSLLKRQNIAPRSEENLVSVND
                     IDKEVLERPCVGPKCENFYNIFHPCDSIGYRVEPLIRSEFTKFKPSPVPFANKSGFDS
                     QLKEITDFGDEFGDKLTNNISKLFGNKSIGELLLLDSKKPETENLSSDSPEESYKKSS
                     SSKSTRVDISAESLKVIKQLNYSGRVDYCLSEGLFDISIINAIKAHTTYFENKDLTAF
                     VLRELLSPKSKSQLVSKSAVLMSSGDDDNEWL"
     gene            complement(<176666..>177124)
                     /locus_tag="PAS_chr1-3_0297"
                     /db_xref="GeneID:8197404"
     mRNA            complement(<176666..>177124)
                     /locus_tag="PAS_chr1-3_0297"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489388.1"
                     /db_xref="GeneID:8197404"
     CDS             complement(176666..177124)
                     /locus_tag="PAS_chr1-3_0297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489433.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0297"
                     /db_xref="EnsemblGenomes-Tr:CAY67152"
                     /db_xref="GeneID:8197404"
                     /db_xref="GOA:C4QV79"
                     /db_xref="InterPro:IPR007667"
                     /translation="MASVNYPSSFDKKDEFEDMSILDKIWFRCKQQPLVPIGCLATCV
                     AVALAAKGVRTGDRVNAQKWFRWRVGLQGLTLVALVGGSYIYDRQQVTQRKTDEDLAR
                     EKAQHRQDLWIQELERRDQETKRNKERARLARARLEAERSTGILDDEPPK"
     gene            complement(<177343..>178668)
                     /locus_tag="PAS_chr1-3_0094"
                     /db_xref="GeneID:8196826"
     mRNA            complement(<177343..>178668)
                     /locus_tag="PAS_chr1-3_0094"
                     /product="Dihydrolipoyl transsuccinylase, component of the
                     mitochondrial alpha-ketoglutarate dehydrogenase"
                     /transcript_id="XM_002489389.1"
                     /db_xref="GeneID:8196826"
     CDS             complement(177343..178668)
                     /locus_tag="PAS_chr1-3_0094"
                     /codon_start=1
                     /product="Dihydrolipoyl transsuccinylase, component of the
                     mitochondrial alpha-ketoglutarate dehydrogenase"
                     /protein_id="XP_002489434.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0094"
                     /db_xref="EnsemblGenomes-Tr:CAY67153"
                     /db_xref="GeneID:8196826"
                     /db_xref="GOA:C4QV80"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR006255"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:C4QV80"
                     /translation="MFSKSARLVKQVKVSLPVTPMASRRFLQTAPKFMGAASIRNPRL
                     IAPRSLQLIRFQSQTVKVPDMAESITEGTLSQFLKKVGDYVAADEVVATIETDKIDVE
                     VNSPVAGTITELLAAEEDTVEVGQDLFKVEPGAKPEGAAAAPKAEEPGEKKTEEAAPA
                     SSTEKKEEPPAAAWAPPPKTAEPAAPAKKETPKQTKEETSAPKAGTFSRNEERIKMNR
                     MRLRIAERLKESQDTNASLTTFNEVDMTSLMEMRKLYKDEFLEKTGIKFGFMGAFSRA
                     SALAAKDIPSVNAAIENNDTIVYRDYMDISIAVATPKGLVTPVVRNVESLSVLDIEKE
                     ISNLGKKARDGKLTLEDMAGGTFTISNGGVFGSLYGTPIINIPQTAVLGLHGVKQRPV
                     VVAGGKIEARPMMYLALTYDHRMMDGREGVIFLKTIKELIEDPRKMLLM"
     gene            <178973..>179668
                     /locus_tag="PAS_chr1-3_0095"
                     /db_xref="GeneID:8197405"
     mRNA            <178973..>179668
                     /locus_tag="PAS_chr1-3_0095"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489390.1"
                     /db_xref="GeneID:8197405"
     CDS             178973..179668
                     /locus_tag="PAS_chr1-3_0095"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489435.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0095"
                     /db_xref="EnsemblGenomes-Tr:CAY67154"
                     /db_xref="GeneID:8197405"
                     /db_xref="GOA:C4QV81"
                     /db_xref="InterPro:IPR027521"
                     /db_xref="UniProtKB/TrEMBL:C4QV81"
                     /translation="MDLGYDSEDEDDTEMDDLLKQQQEHRKYYDGKVVGMYNKVSLFI
                     FVNIPLAEKEMVGITKLVGQINQLFNDTYLCFEPLESPLHISLSQNLHFQTEDEKDRF
                     CQDLSLESFQENPVRLKTKAPYLFQSITSRKIFLSIKLGGESLGRLGTIVGQINQRIH
                     SYFKAQESHLAYPPDNLHISIGVFNPTTRVSSKDLDDFNRRLSRWNDNSSTGTNLFPE
                     IWLSSPQCSTIGV"
     gene            <179885..>180232
                     /locus_tag="PAS_chr1-3_0096"
                     /db_xref="GeneID:8197406"
     mRNA            <179885..>180232
                     /locus_tag="PAS_chr1-3_0096"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489391.1"
                     /db_xref="GeneID:8197406"
     CDS             179885..180232
                     /locus_tag="PAS_chr1-3_0096"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489436.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0096"
                     /db_xref="EnsemblGenomes-Tr:CAY67155"
                     /db_xref="GeneID:8197406"
                     /db_xref="InterPro:IPR006760"
                     /db_xref="UniProtKB/TrEMBL:C4QV82"
                     /translation="MSDPMDPLSEVKDPSVDESKLTEQELKLYRMYGKIPKRSEILKS
                     KFKDRKFFDSGDYAMSKAGVKQGVEVNSSLNPLKLSGIEEISRVNRNSICNVNNPLVN
                     GKSHLERESTNDQ"
     gene            complement(<180337..>181218)
                     /locus_tag="PAS_chr1-3_0097"
                     /db_xref="GeneID:8197407"
     mRNA            complement(<180337..>181218)
                     /locus_tag="PAS_chr1-3_0097"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489392.1"
                     /db_xref="GeneID:8197407"
     CDS             complement(180337..181218)
                     /locus_tag="PAS_chr1-3_0097"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489437.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0097"
                     /db_xref="EnsemblGenomes-Tr:CAY67156"
                     /db_xref="GeneID:8197407"
                     /db_xref="InterPro:IPR025929"
                     /db_xref="UniProtKB/TrEMBL:C4QV83"
                     /translation="MTESGSNSPRNESKSSLVEPELFGLYKDINKDNEDNSIYDELND
                     NISKHTSHVDDYDTVVGHQPKPPIYIQLAKLAYHLLIIGVLGNVFIKVSEHTHDNRGI
                     LPDLTNFKLFFIFKNIIKSVAHKFHFRFESNEIFDEYSYYISNATEGIILAVLPIFIE
                     RALGFSSKNSNKSRGSNDLGLIMRASVSLVGICFGLRKLEWTSAFQASLAWSLLNPCL
                     WLLLDGTLGGFLTSTIISLVSIILSIAVGFDDTIPKDYSFIHSHDTEAYARVLWVGSF
                     VFLASIIFGKLGRYFFQ"
     gene            complement(<181424..>184027)
                     /locus_tag="PAS_chr1-3_0098"
                     /db_xref="GeneID:8197408"
     mRNA            complement(<181424..>184027)
                     /locus_tag="PAS_chr1-3_0098"
                     /product="DNA binding component of the SBF complex
                     (Swi4p-Swi6p), a transcriptional activator"
                     /transcript_id="XM_002489393.1"
                     /db_xref="GeneID:8197408"
     CDS             complement(181424..184027)
                     /locus_tag="PAS_chr1-3_0098"
                     /codon_start=1
                     /product="DNA binding component of the SBF complex
                     (Swi4p-Swi6p), a transcriptional activator"
                     /protein_id="XP_002489438.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0098"
                     /db_xref="EnsemblGenomes-Tr:CAY67157"
                     /db_xref="GeneID:8197408"
                     /db_xref="GOA:C4QV84"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C4QV84"
                     /translation="MTTSEIYIATYSSVDVYECICNTFPLMRRCSDDWVNVTQILKIA
                     QFPKAQRTKILEKEVHDKTHQRIQGGYGRFQGTWTPLDIARNLAMNYGFGDADLPVLY
                     WDPSKDPMPKRNKQKPTPAKHNLQSGNNSTGSPKRRRATPKKIKQQVQLPVQHTFTNT
                     KLEQPAHIPQYQLHDGYSQHPPLISKSQHSQQYPVPQVSTYIYSQPPTFQQQQQLLQQ
                     QQQHPQPQYTQFINNQQAIIPSQNNFTYNQNPVPRFQNFQTAKTVQAVHNSQGSLSTT
                     ENWSQDELHQHGRKNSDTSVSSNVSLQNGKIPHDDSQLPIIRPPHLSTQQFYTELLLN
                     YFTEDNEQVPYYLIEVPEGFNLDIPIDDEGHTALHWAASIGSVPVVEALLKNRADPLI
                     TNNSGLNALSKLVGFNNSYELMNFSQLLHLLKDCLIIPDANGRIPLHYMMELTSIPDK
                     IQPLEYYFQGILEFVRETQRLAETASPDNKDKDLLKILLNHQDNNGDSSLHIAARTGN
                     AQFIKLLLSNGASVELVNRRKQSCKDMLSIDLLEKLHWEDLQKAKRTSSKSSTQRRGR
                     VNSTDNKPSIGIFNDQVAYYPQYNSSVLSDQTQMSIVPATSQIHSQLHQRQQLLSPEM
                     ITYNPSIPQDTPKTVSQCDSSMNLSTSEQEGNVSFKELREKLPDVINNLNETFETEMA
                     EKDDEGEHYSRMIKDLTTEAHYLEKTIARISQEISSRMNMDQNKMSTAVFINEANKQV
                     SKMTEVLNSNVEELTRLWERSQSLQLAKLVHRQEEKHLDHTEQLNEKETAIKLAIDLS
                     ILQFNRMKLVNEIIHSLADVNVNSKDDLAGNRLYKYKKLISKACGLQIEDVDDDLLNG
                     IEQTLLEGGSI"
     gene            <184470..>185345
                     /locus_tag="PAS_chr1-3_0298"
                     /db_xref="GeneID:8197409"
     mRNA            <184470..>185345
                     /locus_tag="PAS_chr1-3_0298"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489394.1"
                     /db_xref="GeneID:8197409"
     CDS             184470..185345
                     /locus_tag="PAS_chr1-3_0298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489439.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0298"
                     /db_xref="EnsemblGenomes-Tr:CAY67158"
                     /db_xref="GeneID:8197409"
                     /db_xref="UniProtKB/TrEMBL:C4QV85"
                     /translation="MFRHAKKPSWFAYLELPTSHHQRNILTNHVARYNKFISQRIKDF
                     REGKFEGLVLNSNPYNIALNRTLFQNRKGDGSDLTIKTEKYPRIIRNSEKLQFDPFFS
                     PETLSNTTHSMLHISLSPNLEFRNAQSWKSFHNSSIKSKAFPEKKISISFSPRIHVTQ
                     AFVAITPTYESLVPVKALFSHFVNCLKPWAKDVKFNQPLSSPSKVLFHTSLGKFHHAR
                     DNILNDSEMIFLSEILSRSTEDLKKIVEPNCHAQLDSLTPAEYYLSEGELSQLVFEVN
                     HYKVRYGFSTLRVQL"
     gene            <185647..>187506
                     /locus_tag="PAS_chr1-3_0099"
                     /db_xref="GeneID:8196827"
     mRNA            <185647..>187506
                     /locus_tag="PAS_chr1-3_0099"
                     /product="Transcription factor that activates
                     transcription of genes"
                     /transcript_id="XM_002489395.1"
                     /db_xref="GeneID:8196827"
     CDS             185647..187506
                     /locus_tag="PAS_chr1-3_0099"
                     /codon_start=1
                     /product="Transcription factor that activates
                     transcription of genes"
                     /protein_id="XP_002489440.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0099"
                     /db_xref="EnsemblGenomes-Tr:CAY67159"
                     /db_xref="GeneID:8196827"
                     /db_xref="GOA:C4QV86"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4QV86"
                     /translation="MDSNSYWSSQELNYNYKSDPFYDPNSNGIMPELKQVPLPTEDFT
                     NFDIDDVLKQTLHNLEDLDIPIGPASIGVNASSYGQHPQHNKGHSRKTSGSGIFGFTG
                     ENRQLCIPGISPQLLRKTPKTVQMPDLETDRYTDEPPGHYLSSDWDLPLESQILPPSS
                     GVTLLPSSPVKEPESGRPDHYKFPPSDRTSTLDSSEREKDQIYKNHFSVNYLKSLTRM
                     DKHHENGLEPINNQSIGNTGHINNFAREPRYVDDITPLLETNFDSNVEESHIDPNKPL
                     EEQTAEHQGQFFSQKPTQTVQMRSLPVPAPNLVPTSSPIAIPIPANSGTIGQQQNSSP
                     SFKGFMANSSPLRPDIYQTPQHQHHQILGITPDTPDRRPDSGVSWKIVVDGQIDSTDS
                     SPTRKCSTMKTTLPRGHLDYYFVGPNEDRLYTCMYNNCGKLFTRISNIRAHVQTHLCD
                     RPFTCDICGKKFVRNHDLRRHKKKHQDYTQVCPCGKKFSRRDALKTHRERNICIGGFD
                     SDRGVSKSDVGKGRPKKIKQLEAGDIVVAMVNEMDDSPIKQTMKSPKERKQDHVTEQT
                     EEKQQSKQSEDSKNLKLDLYEEKTDVDDKQEFDYLEDDYSFNDLSFRSTQFAY"
     gene            complement(<187594..>193169)
                     /locus_tag="PAS_chr1-3_0100"
                     /db_xref="GeneID:8197410"
     mRNA            complement(join(<187594..193093,193156..>193169))
                     /locus_tag="PAS_chr1-3_0100"
                     /product="Phosphatidylinositol-4-kinase that functions in
                     the Pkc1p protein kinase pathway"
                     /transcript_id="XM_002489396.1"
                     /db_xref="GeneID:8197410"
     CDS             complement(join(187594..193093,193156..193169))
                     /locus_tag="PAS_chr1-3_0100"
                     /codon_start=1
                     /product="Phosphatidylinositol-4-kinase that functions in
                     the Pkc1p protein kinase pathway"
                     /protein_id="XP_002489441.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0100"
                     /db_xref="EnsemblGenomes-Tr:CAY67160"
                     /db_xref="GeneID:8197410"
                     /db_xref="GOA:C4QV87"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:C4QV87"
                     /translation="MQHYGISGDSLRLAALKKLVSTPLEKTRGKVVQAVLLSTHKIQK
                     EEKQLDCVDLEDIIALCHSVPDLVSEKTRRELFKCLSHQLLQCLNQGFSFYGTLQNFG
                     PTPWSYLTRHITSGLITFANHFESSRLEVEGLFLQYLDSFMSINDVELPAFFSLYGFI
                     EGLIDNVHLISFQKLLPRLLDLLSAELLEKVEQLIDSATPAYAEIIENFLSDDNEFCS
                     LIFVEAVGRFFQSYLEYQFCPNRALVTTCLQEKKRKYELLEEDVVANTSTQNTPLIAF
                     PKEIQNRLGDFLNRLLESSIHNCNLMDTGASFISLSSFARIQVLYRAKSNFLQILGFA
                     IYSEVATTDDLKSFISFSLSHPGCMTHKDLGHTVVSLSALLAYFDVNFGYNLLKAYPL
                     LLGSVDVNETICAKNAVFIASAMKPLTQDDVITTIYSLTNALSTDDESAGKLRRLSQV
                     ATTGNQTDNVSLDSFESHFLKNITTTLISFTKTLNDDSITLLVINILTQKYSFSVSVL
                     DKHILLALADCTLFASEDEFNAVMKHFSFTVQIAFEKNNLQLVSSTMDVLYSISSRLH
                     DSPFSTKYSLYLKELLSCVSNFGDVEELEHHRSNKEISGIAVQIAFYLKPLARLLPDF
                     TEEPLVIKNLEITSLFQDVWYNMIIHGFSESSTLFEEHKEYLLRIARSSPPLASAESW
                     NKTETSIRMNAVLRRGTSNRNIKSQKEVVISYLKSGKVNTRGFELQSSTTEILFLGSV
                     SFLESLRVQTGICHKILAYFSDPSVHTTGVEHLIGGISLAFTKKYVQLCDYPLWPGFL
                     TERIPYQLKTMMTYCCSRETVTQSTAFQCCDYLVCNIPSSLCHHTSLFSLLDILTLLQ
                     DSVRDFAENEYNPTVEFYSEASDIRLQLSDSESWRKSTLRKFIDYANKWVNLCISKCG
                     QDVNSLFYSYLTTNYDGRYNDEENFGKSCAVQFLRQKATSHSLTKGHFSLADLSRLFP
                     KDGSLTSQETIEDAYKRCIELEQNLKSNKKVTDRHILEVLESCIGTIHPARNDTAHLL
                     KCAISIPFQCTKNIILPTAINFWLSIIKEFPQLSSSIIAEILHQWELSIQKGHSLFNR
                     SFDITEPEFAPMEYMPSDRAKMDRLGKKAVDNIVPHLLLIRFFLSNFEATRYQSYHIL
                     RSYSDTVLFALRSLKKASIHPYARLPRFELIKLGISVFQVNFRAKSSFSEPLAYALIE
                     AALSWFIKPFKFPFGGNRNWLKSDFDVLIEVTNLFRKMNLQLYAGLESQKRLLLSFLD
                     HELNNVYVWNNVLGTNDIRNKYMLGPVTETQINDAFSINPGLAINLASRYNNNKLTGA
                     LRDLLASNPIAAINYPNAVPFLLNLDNSRDLIVPKSLLIWEPVSPIDSIALFLPPYNR
                     NPTVLQFAMRSLESYDVQLTFFYVPQIVQALRYDNEWGYTTRFVLETAQVSQLFAHQI
                     IWNMMANSYKDEEATIPDDIKPKLDQVLIEMKKSFRPVDLEFYKREFNFFDQVTGISG
                     KLKPYIKKSKAEKKIKIDEEMAKIEVLRGVYLPSNPNGDVVDIHRKSGKPLQSHAKAP
                     FIASFKVRKPVEDDENGDGIPQYRVTDISAIFKVGDDCRQDVLALQLISLFRTIWMNS
                     GVDLYVFPYKVTATAPGCGVIDVLPNSVSRDMLGREAVNGLYEYFISKFGPETSSEFQ
                     KARANFVKSLAAYSVISYLLQFKDRHNGNIMYDSEGHILHIDFGFCFDIVPGGVKFEQ
                     SPFKLTKEMVNVMGGNTSTQAYRWFEELCVKAFLSARPYMETIVRCIVPMLDSGLPCF
                     KPATIKRLRARFVPDKTERQAANYMRGLISKSFESLPTKGYDEFQKITNGIPY"
     gene            complement(<193424..>194230)
                     /locus_tag="PAS_chr1-3_0101"
                     /db_xref="GeneID:8197411"
     mRNA            complement(join(<193424..194143,194213..>194230))
                     /locus_tag="PAS_chr1-3_0101"
                     /product="Constituent of 66S pre-ribosomal particles, has
                     similarity to human translation initiation factor 6"
                     /transcript_id="XM_002489397.1"
                     /db_xref="GeneID:8197411"
     CDS             complement(join(193424..194143,194213..194230))
                     /locus_tag="PAS_chr1-3_0101"
                     /codon_start=1
                     /product="Constituent of 66S pre-ribosomal particles, has
                     similarity to human translation initiation factor 6"
                     /protein_id="XP_002489442.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0101"
                     /db_xref="EnsemblGenomes-Tr:CAY67161"
                     /db_xref="GeneID:8197411"
                     /db_xref="GOA:C4QV88"
                     /db_xref="InterPro:IPR002769"
                     /db_xref="UniProtKB/TrEMBL:C4QV88"
                     /translation="MASRTQFENSNDVGVFAKLTNSYCLVAVGGSENFYSAFEAELGD
                     VIPIVHTTIAGTRIVGRMTAGNRRGLLVPTQTTDQELMHLRNSLPDSVKIQRVEERLS
                     ALGNVICCNDYVALVHPDIERETEELIADVLGVEVFRQTIAGNVLVGSYCALSNQGGI
                     VHPQTSIQDQEELSSLLQVPLVAGTINRGSSVVGAGLVVNDWLAVSGLDTTAPELSVV
                     ESIFRLQDAQPEAISGNLRDTLIETYS"
     gene            complement(<194413..>197124)
                     /locus_tag="PAS_chr1-3_0102"
                     /db_xref="GeneID:8197412"
     mRNA            complement(<194413..>197124)
                     /locus_tag="PAS_chr1-3_0102"
                     /product="Heat shock protein that cooperates with Ydj1p
                     (Hsp40) and Ssa1p (Hsp70)"
                     /transcript_id="XM_002489398.1"
                     /db_xref="GeneID:8197412"
     CDS             complement(194413..197124)
                     /locus_tag="PAS_chr1-3_0102"
                     /codon_start=1
                     /product="Heat shock protein that cooperates with Ydj1p
                     (Hsp40) and Ssa1p (Hsp70)"
                     /protein_id="XP_002489443.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0102"
                     /db_xref="EnsemblGenomes-Tr:CAY67162"
                     /db_xref="GeneID:8197412"
                     /db_xref="GOA:C4QV89"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004176"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR023150"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028299"
                     /db_xref="UniProtKB/TrEMBL:C4QV89"
                     /translation="MEETQFTDRALAIITNATKLAKDNSHPQVQPIHLLAAMAPTDED
                     TTPYLKVLVEKGRFDWQTFERNINRALIRVPSQTPAPTDVSFSGVAAHVIQEAGKMRQ
                     QQKDSYIGQDHLLLALLEDKSITQILKDSSISPDALKTQIINLRGNQRIDSRQADSSS
                     NHEFLDKYAIDLTEQAREGKIDPVIGREEEIRRTIRVLARRTKSNPCLIGDPGVGKTS
                     IVEAVAQRIIDNDVPNILQNSKLYALDLGALKAGAKYQGEFEERIKGVLNEIAESKQM
                     IILFIDEIHMLMGDGKSDAANLLKPMLARGSLHCIGATTVIEYRKYVETDGAFERRFQ
                     RIDVREPTIRETVAILRGLQPKYEIHHGVRILDSALVTAAQLASRYLTYRKLPDSAVD
                     LIDESSASVAVARDSKPEELDTKERELQLLEVEMKALERDADSDKTTEERLTAVKQKV
                     QELEEELVPLRAKYEQERAGHEELTAAKKKLDELEIKATDAERRHDNATAADLRYFAI
                     PDVKRRIAELEEKVAEEEAALSDIAMITNVVGSEQVAETAARLTGIPVQKLTQAENNK
                     LITMERELSSSVVGQSEAVKAVSNAIRLSRSGLANPNQPASFLFLGLSGSGKTELAKK
                     VAGFLFNDEKAMIRIDCSELGEKWSYTKLLGSEPGLIGSDQGGLLTNQLLRHPYSVIL
                     FDEVEKAAPEVLNILLQMLDDGRITASNGTLVNCSNCIVIMTSNLGAQFINSAKGSKI
                     SPETKELVMTAVRAHFRPEFLNRISATVVFNRLSRHAISKIVKIRLAEIEQRFEANAK
                     SIKLDVDDAAIEYLCRNGYSSDMGARPLNRLIQNEILNQLAVLILKGQVKDKETVKIR
                     LGSKGLDVLPNHAVESDSMDVDVDDWVDAAEEEDSDNNHDDQAPLYD"
     gene            <198799..>201141
                     /locus_tag="PAS_chr1-3_0104"
                     /db_xref="GeneID:8197413"
     mRNA            <198799..>201141
                     /locus_tag="PAS_chr1-3_0104"
                     /product="Aconitase, required for the tricarboxylic acid
                     (TCA) cycle and also independently required for mitoc"
                     /transcript_id="XM_002489399.1"
                     /db_xref="GeneID:8197413"
     CDS             198799..201141
                     /locus_tag="PAS_chr1-3_0104"
                     /codon_start=1
                     /product="Aconitase, required for the tricarboxylic acid
                     (TCA) cycle and also independently required for mitoc"
                     /protein_id="XP_002489444.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0104"
                     /db_xref="EnsemblGenomes-Tr:CAY67163"
                     /db_xref="GeneID:8197413"
                     /db_xref="GOA:C4QV90"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006248"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:C4QV90"
                     /translation="MLSARRVLAKINSRGLATVSGLTKDSLVEMNLLEKGNYINYKQQ
                     LDNVNIVKERLGRPLTYAEKLLYGHLDKPHEQDIERGVSYLKLRPDRIACQDATAQMA
                     ILQFMSAGMPSVATPTTVHCDHLIQAQKGGAADLERAIRLNKEVYDFLATACAKYNIG
                     FWKPGSGIIHQIVLENYAFPGELLIGTDSHTPNAGGLGQLAIGVGGADAVDVMAGLPW
                     ELKAPKIIGVKLTGRMNGWTSPKDIILKLAGITTVKGGTGAIVEYFGDGVDTFSCTGM
                     ATICNMGAEIGATTSVFPFNNSMVDFLDATGRSEIGEFAKVFQKEYLSADPGCEYDQV
                     IEIDLNTLEPHINGPFTPDLATPVSKMKEVAVANDWPLEVKVGLIGSCTNSSYEDMTR
                     AASIIEDAASHGVKAKSLYTVTPGSEQIRATIARDGQLKTFTDFGGSVLANACGPCIG
                     QWDRQDIKKGDKNTIVSSFNRNFTSRNDGNPATHAFVASPEMVTAYAIAGDLRFNPLT
                     DKLKDKDGNEFLLKDPVGVGLPVRGYDPGENTYQAPPEDRASVEVVISPSSDRLQRLT
                     PFQPWDGKDAERLPILIKSVGKTTTDHISMAGPWLKYRGHLQNISNNYMIGAINAENG
                     EANNVKNHYTGVYSGVPDTAAAYRDNGVKWVVIGGENFGEGSSREHAALEPRYLGGFA
                     IITKSFARIHETNLKKQGLLPLNFTDPAAYDRIQPDDEVDILGLTELAPGKNVTLRVH
                     PADGSPTWETPLSHTYNAEQIEWFKYGSALNNMAAVKASK"
     gene            <201485..>203490
                     /locus_tag="PAS_chr1-3_0299"
                     /db_xref="GeneID:8197414"
     mRNA            join(<201485..201710,201743..>203490)
                     /locus_tag="PAS_chr1-3_0299"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489400.1"
                     /db_xref="GeneID:8197414"
     CDS             join(201485..201710,201743..203490)
                     /locus_tag="PAS_chr1-3_0299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489445.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0299"
                     /db_xref="EnsemblGenomes-Tr:CAY67164"
                     /db_xref="GeneID:8197414"
                     /db_xref="GOA:C4QV91"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QV91"
                     /translation="MNTEDVYSPVIADNGSEDLLTTTSKEVVTPGDLGAKLEEIKLEY
                     SENETPSEDDSGSERGSLDATTDPDIDADNQWRPSACVFVASLAAEKSDDHLCISVTK
                     HFEQWGKLAIVKVLRDTSNRPYAFVQYTTDDNAKRALKEGQHSILDGRSIRCEPARVN
                     RTLYILTSNDNGLSKVEIINLLKKYGEIEQIVGVDAAGNKAPLSSNSDKRIKEWFVKF
                     VYRDDAIRAYANLRTQVSWHVEWAQNLEPTSTKNQETSTIDKLSIFIGQLSPSITKEE
                     LNERFSRHGKIKESVLVQRPNNVFSFIKFEDEQAAASAVEQENHAILKDRTMHVQYRE
                     IYHTNNYKRPTSDSPKLSLAPPPVNLSSKNNRSFSRNFSQNQTNRVGQMGTAVSPGGG
                     TVGATTTHGYGYSPLVENHGMFSMRYNNSAAPFSFNKRAGYFRSDKTTSWNDRDEKEN
                     GENDNPENQNGKKKRAQSKVQEAPQDSNDTEGRKTSSSTPSSTVRTAVSSNMKESHIS
                     SIATAADDKPLGKKWGPHQDNNIRYASPTYVYYVPSDNVYEGGNNYPAVNNAAYYYPQ
                     PLQYFPSYDPGLAIAAPMDYNNAGAAAATPYYMYYNPASVPMGVEESNEKFAIPFYSN
                     PSTSNSTKNSNHKYFGNANTNANASTNATVTRN"
     gene            <203763..>205481
                     /locus_tag="PAS_chr1-3_0105"
                     /db_xref="GeneID:8196828"
     mRNA            <203763..>205481
                     /locus_tag="PAS_chr1-3_0105"
                     /product="Catalytic subunit of the COP9 signalosome (CSN)
                     complex"
                     /transcript_id="XM_002489401.1"
                     /db_xref="GeneID:8196828"
     CDS             203763..205481
                     /locus_tag="PAS_chr1-3_0105"
                     /codon_start=1
                     /product="Catalytic subunit of the COP9 signalosome (CSN)
                     complex"
                     /protein_id="XP_002489446.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0105"
                     /db_xref="EnsemblGenomes-Tr:CAY67165"
                     /db_xref="GeneID:8196828"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="UniProtKB/TrEMBL:C4QV92"
                     /translation="MEHNCLKVNELALQLAQSLQNSKVSTADPLKKRTSSYRGLSSEP
                     IITEEEPTIKGDYNRFYSQSSDKQVLDNKPWLQDGNYFKTVYISTIALLKMMSHARSG
                     GSIEIMGMLTGKVFANTLVVMDCYLLPVEGTETRVNAQAEGYEFMVSYLDNLKEIKHN
                     ENIIGWYHSHPGYGCWLSGIDVATQNLNQKFQDPYLAIVIDPERSVRQGFVEIGAFRT
                     FAEPAVGRSSSSVSSASGAGISDVAFSSGRNSASGMSSVLSASNISIAEELSKQSITQ
                     NVFDRTTTKIPKGKMTDFGAHSGKYYSLEVKVFRSPLEEKLLDTFGSKTWIKGLTNYS
                     NVVNAEETQVELMHKIMEATENLRKESPSKLPSLVMGNLIYSGASQGTTGNRKRSMSK
                     SSIYSGLQASSGIPSSRYPTKGKNMSGSQFNDDPLARSLDKIPPDSPDQQYDGALSIQ
                     QPKRAYNTHTSRAGGLASVLSSGSMDPQSYSMVGRMSLTNQSPGTALRGLNTPPNKRP
                     QRNPGHTSSGQGGTPGGVSRSKEKINKPIGISMISKDFKVVISQQVNQMLRRHVQNDL
                     FGSNSP"
     gene            <205797..>207935
                     /locus_tag="PAS_chr1-3_0106"
                     /db_xref="GeneID:8197415"
     mRNA            <205797..>207935
                     /locus_tag="PAS_chr1-3_0106"
                     /product="Protein kinase"
                     /transcript_id="XM_002489402.1"
                     /db_xref="GeneID:8197415"
     CDS             205797..207935
                     /locus_tag="PAS_chr1-3_0106"
                     /codon_start=1
                     /product="Protein kinase"
                     /protein_id="XP_002489447.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0106"
                     /db_xref="EnsemblGenomes-Tr:CAY67166"
                     /db_xref="GeneID:8197415"
                     /db_xref="GOA:C4QV93"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4QV93"
                     /translation="MASDHEAARRSPVSGLTKLMKEQSLTGSTLSGKNTDSKELGPNE
                     TAKNSSENLPELVTFHDEISKENNKGHGDDEDDSSNGLYIERRPIPPKIERQQSNLTS
                     SLGSLSSSIPFSAPGGRGSNSIGSNPLYGSGNPGGLSFTPNLANGNLIQSTHITSPNV
                     SSSASIEPRFIISRQKVQQSQNFHNSVSRSGSSTNFFSRSKKNSIVGLDPLSPMEHRV
                     TYSHSPSSNSSGESAGRHSSMADLRRFFKRSTSISGHQPRALSTTSSRQHSPVGSPGT
                     VNYTSQPTIQTTNAHTSTTPSSISIVGNGASRRYPSSSASLQRNESYTAVSNMGSGNL
                     NSNSYSQMIIGGNAQPTVPFHKRYVKFGDSLGAGAGGQVKLVKRTSDNQIFALKEFRP
                     KYSSESKREYTKKITGEYCIGSTLRHPNIIETIEISYDNDRMMQVLEYCDYDLFAIVM
                     SNQMSRPEIDCCFKQILNGIKYLHAMGLAHRDIKLDNCVINKEGIVKLIDFGSAVVFS
                     YPFSNTLIEAQGIVGSDPYLAPEVCIFHKYDPRPVDIWSAAMIYCCMVLKKFPWRIPK
                     LTDLSFKAFATRPESDSLNELLKKVPPPPGYENKPESGPAKASVASTSPKHISTAPPS
                     NHTFNELGEGRLLNALPEDCRPLIGAMVELAPACRIQIDECFKDPWFESLEMCTIEDG
                     VVIHSKSHTHTQVDQSVAHIASLEKKKQRR"
     gene            complement(<208001..>208438)
                     /locus_tag="PAS_chr1-3_0107"
                     /db_xref="GeneID:8197416"
     mRNA            complement(<208001..>208438)
                     /locus_tag="PAS_chr1-3_0107"
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /transcript_id="XM_002489403.1"
                     /db_xref="GeneID:8197416"
     CDS             complement(208001..208438)
                     /locus_tag="PAS_chr1-3_0107"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /protein_id="XP_002489448.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0107"
                     /db_xref="EnsemblGenomes-Tr:CAY67167"
                     /db_xref="GeneID:8197416"
                     /db_xref="GOA:C4QV94"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR006519"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="UniProtKB/TrEMBL:C4QV94"
                     /translation="MSAKNHLIKLIVGAGQAAPAPPVGPALGSKGVKAIDFCKEFNAR
                     TASYQPGVPIPAIITVKPDRSFSFELKSPPTGYLLLRAAGIPKGAPKVGPGQPKVGTV
                     SLKHVYEIATIKKTDQRHEKAELKGIVKSIIATAKSMGIDVVK"
     gene            complement(<208598..>210637)
                     /locus_tag="PAS_chr1-3_0108"
                     /db_xref="GeneID:8197417"
     mRNA            complement(<208598..>210637)
                     /locus_tag="PAS_chr1-3_0108"
                     /product="Ubiquitin-specific protease that deubiquitinates
                     ubiquitin-protein moieties"
                     /transcript_id="XM_002489404.1"
                     /db_xref="GeneID:8197417"
     CDS             complement(208598..210637)
                     /locus_tag="PAS_chr1-3_0108"
                     /codon_start=1
                     /product="Ubiquitin-specific protease that deubiquitinates
                     ubiquitin-protein moieties"
                     /protein_id="XP_002489449.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0108"
                     /db_xref="EnsemblGenomes-Tr:CAY67168"
                     /db_xref="GeneID:8197417"
                     /db_xref="GOA:C4QV95"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C4QV95"
                     /translation="MSNQQERTLGPLVERILAQPVEFQPAKRPDSVTVKPSSYVSFGS
                     VSAAPLTQTLKRGSSPDPKSGGDKSKNLKPKPKSMAEAIAAYTQKKLLPKVLSTTENA
                     PLDDDLGEDLEDLNHKSSESPSVDSDAHQDTDFKASKEEQEEHEVDKEDDEDDDNDDG
                     DEDEDSDYHTAESSDGLQSEDSGSDAETNLDHDVPSATSDTGSDKEDNGSTNSNSSSA
                     TAYLSEVESLKRDSALKQATPPTSPENEEEIEAKRKVFATEADFYQLNELYDDRGSNN
                     STRICKNWRQMSKSRPLGLLNHGVTCYMNSAVQALIHIPAFQHYLNDVCRNKYQSVIA
                     PNSVTKTLAETSAKMWQLEKSPGRNTPLHINPKKLIRRLEEINCMMSKWQQEDSHEYL
                     MSLMSRLQEDSTPKGVKLRASIIHDIFGGSLHQKVTCKNCGHISETQQDFYDLSLSLD
                     NRKRKSASETDHVRTANTEANSDSTNEVENSSTAGNVQHDVQQSTGSRYSIERSIKDF
                     FSSELIKTDKKDKTGYVCEKCNKRTNAVKVSTIDTAPESLIIHLKRFRYDGNSNSSTK
                     VKTGVSYPETLEMTEYTTTNFPARYKLLSVILHEGRSVSSGHYICYSRQPDNTWASYD
                     DEYVNTMPEKQALKDPSAYVLVYQRITHKSILEPSSATSLKRSKPSSPHSKRTKR"
     gene            complement(<210784..>212109)
                     /locus_tag="PAS_chr1-3_0109"
                     /db_xref="GeneID:8197418"
     mRNA            complement(<210784..>212109)
                     /locus_tag="PAS_chr1-3_0109"
                     /product="Putative oxidoreductase"
                     /transcript_id="XM_002489405.1"
                     /db_xref="GeneID:8197418"
     CDS             complement(210784..212109)
                     /locus_tag="PAS_chr1-3_0109"
                     /codon_start=1
                     /product="Putative oxidoreductase"
                     /protein_id="XP_002489450.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0109"
                     /db_xref="EnsemblGenomes-Tr:CAY67169"
                     /db_xref="GeneID:8197418"
                     /db_xref="GOA:C4QV96"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4QV96"
                     /translation="MPIDIINTLVVKGTDGIPGWPIIKRYGLPFVALSLLKVYCGGKL
                     NPWQRDVHGKVYILTGATAGVGSQLAEELAKGGAQLILLVKDPSSSWTVEFVDDLRER
                     TGNPLVYAEQCDLADLHSVRKFATRWLDNTPPRRLDGIVGCAGEALPLGAARSTSSDG
                     VERQVAVNYLGHFHLLALLSPSLRAQPADRDVRVVLTTCTTQAMGQVSLDDPLWLDSQ
                     YPSKRPWQVFGGAKLMLGCFAQEFQRRLDATPRGDKMPSKLRVNVVNPGFMRTASTAR
                     VLSFGSLWGLLLYLLLYPIWFILFKTPIQGAQSYLAALFAEHFIELPGGQFIQDCKIV
                     KPARKELSDFTFQNKLYEKTEKLIDQLERQSAKQRVRSKPKSNSKSKPSKKSGTANVG
                     PEKENDVFASALKATPPDLFPHQRADPAGNKYLDQLEKKLAEQSKKHST"
     gene            <212238..>213680
                     /locus_tag="PAS_chr1-3_0110"
                     /db_xref="GeneID:8197419"
     mRNA            <212238..>213680
                     /locus_tag="PAS_chr1-3_0110"
                     /product="Essential component of the Rix1 complex (Rix1p,
                     Ipi1p, Ipi3p)"
                     /transcript_id="XM_002489406.1"
                     /db_xref="GeneID:8197419"
     CDS             212238..213680
                     /locus_tag="PAS_chr1-3_0110"
                     /codon_start=1
                     /product="Essential component of the Rix1 complex (Rix1p,
                     Ipi1p, Ipi3p)"
                     /protein_id="XP_002489451.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0110"
                     /db_xref="EnsemblGenomes-Tr:CAY67170"
                     /db_xref="GeneID:8197419"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4QV97"
                     /translation="MDESVFYTPSTATDAAELSFLASIRSNKSHVQFRQCAANAASIT
                     GTGQGHRLFVACPEKALIQVYLWGKESPEQKMAVPEELTSLLWVHIFGAGFLVGGGKS
                     GRLYVWELASGYLLSAKEAHYQEVSCLEVSHDGQVLVSGGKDSRVLIWRLADLIQFSS
                     DPLPKPIHVLTNHSLPITSIALTKGISNDIKLFTSSLDGEVRHYNVSNGELLTTFIFG
                     EPVNALAVDPAQRYLYAGLSSGTIRLVPLFIVNHKNQLESNTGCGKLVSATSADDPES
                     QFIITSHQDSPVTCLQVSADGGLLVSADSAGKVFVNDIVSRQVARQLRDCSGPISTLR
                     LLINDLERVEPSDLSTKASTPRILPNLKRSLISDTEISKHDINIPAAGTPEGDIGSLA
                     SDNEQLKEQFDLRGFCNQVRKEHVVYQLNTEEEAAVDQSVQQQQQDTDENVSTQQYAS
                     QLKEMTKAYNELKRVHQDLYSEHLKLLDRD"
     gene            complement(<213708..>214097)
                     /locus_tag="PAS_chr1-3_0111"
                     /db_xref="GeneID:8197420"
     mRNA            complement(<213708..>214097)
                     /locus_tag="PAS_chr1-3_0111"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489407.1"
                     /db_xref="GeneID:8197420"
     CDS             complement(213708..214097)
                     /locus_tag="PAS_chr1-3_0111"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489452.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0111"
                     /db_xref="EnsemblGenomes-Tr:CAY67171"
                     /db_xref="GeneID:8197420"
                     /db_xref="InterPro:IPR013957"
                     /db_xref="UniProtKB/TrEMBL:C4QV98"
                     /translation="MVERPKIKFNIKSRKSVEPDRREKSPSRNDVDYRERQVSPKPDE
                     GSTEIDTPRGRPSEKPKNDLESEVEVDEAMMKVMGFGGFGTTKMKKVGGTDVSGAKTF
                     KPSQYRQYVNRTKGFNRPLSPTRKGKK"
     gene            <214185..>214829
                     /locus_tag="PAS_chr1-3_0112"
                     /db_xref="GeneID:8197421"
     mRNA            <214185..>214829
                     /locus_tag="PAS_chr1-3_0112"
                     /product="Putative RNA-binding protein implicated in
                     ribosome biogenesis"
                     /transcript_id="XM_002489408.1"
                     /db_xref="GeneID:8197421"
     CDS             214185..214829
                     /locus_tag="PAS_chr1-3_0112"
                     /codon_start=1
                     /product="Putative RNA-binding protein implicated in
                     ribosome biogenesis"
                     /protein_id="XP_002489453.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0112"
                     /db_xref="EnsemblGenomes-Tr:CAY67172"
                     /db_xref="GeneID:8197421"
                     /db_xref="GOA:C4QV99"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QV99"
                     /translation="MGEEKLTKKQKKALEFRKSKEEREISKKEKAEKLEQEAKLKAEK
                     EEEEAKRKADAPKKKRKTRRGKGGKISGPRFILFVGNLSFKCTEEDLKNHFKNCSPDT
                     IRPRLDKGFAFLEFKQDDVNVRKRMDIAISMHHTVLNDRKINVELTAGGGGNSTTRLE
                     KIKGKNDKLLQERKDKIKKKLATDMAKAKEKEEGSKDTVKVVGIHPDRAKLIQQ"
     gene            complement(<214954..>215715)
                     /locus_tag="PAS_chr1-3_0113"
                     /db_xref="GeneID:8197422"
     mRNA            complement(<214954..>215715)
                     /locus_tag="PAS_chr1-3_0113"
                     /product="Small rho-like GTPase, essential for
                     establishment and maintenance of cell polarity"
                     /transcript_id="XM_002489409.1"
                     /db_xref="GeneID:8197422"
     CDS             complement(214954..215715)
                     /locus_tag="PAS_chr1-3_0113"
                     /codon_start=1
                     /product="Small rho-like GTPase, essential for
                     establishment and maintenance of cell polarity"
                     /protein_id="XP_002489454.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0113"
                     /db_xref="EnsemblGenomes-Tr:CAY67173"
                     /db_xref="GeneID:8197422"
                     /db_xref="GOA:C4QVA0"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QVA0"
                     /translation="MRSIKCVVVGDGAVGKTCLLISYTTNRFPHDYIPTVFDNYSANV
                     LVNGEPFKLGLWDTAGQEEYDRLRPLSYPQTEIFLICFSVVEPTSFENVKNKWIIEIR
                     HHVPSDVLILLVGTKIDLRDDPHTLDSLHEMGYDPITQEEGEALAKELGCVNYLECSA
                     STQQGVKEIFDYAISAVVQAGQPNVDAKPSPPVPSKSSNNISPTTVTNNSTNVTTTST
                     TSNKPDQKQSTTAPNPASGRLQKFKTRKSKKCLIL"
     gene            <217553..>221934
                     /locus_tag="PAS_chr1-3_0114"
                     /db_xref="GeneID:8197423"
     mRNA            join(<217553..221643,221691..>221934)
                     /locus_tag="PAS_chr1-3_0114"
                     /product="Protein required for beta-1,6 glucan
                     biosynthesis"
                     /transcript_id="XM_002489410.1"
                     /db_xref="GeneID:8197423"
     CDS             join(217553..221643,221691..221934)
                     /locus_tag="PAS_chr1-3_0114"
                     /codon_start=1
                     /product="Protein required for beta-1,6 glucan
                     biosynthesis"
                     /protein_id="XP_002489455.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0114"
                     /db_xref="EnsemblGenomes-Tr:CAY67174"
                     /db_xref="GeneID:8197423"
                     /db_xref="GOA:C4QVA1"
                     /db_xref="InterPro:IPR002495"
                     /db_xref="InterPro:IPR009448"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4QVA1"
                     /translation="MIGHALILISQCLTAVASEKSVDISLRANWFKTPFPLLLLETVA
                     SENESGFHTILDAMFHVSFQSLEFEDADLQFDAIPFAKSDKELYEAWSQKAGATAEKS
                     ITDVYLANKYYAPRVQAHYQHYEEVRSSILGDRCGTNSKAWLYFNNEVYCSSNDVFSL
                     KTGNETGQRQILPFDRVIGAKDNDVPVAIIYGDYKSPLFSQFLSNLAGFIKDGRLRLV
                     WRYIPDESIWQKETLAGYGVDLTLKNTEYIDIDDRDVVANKPVEAKPTVAESNDFWDV
                     YSKEIETVSKKDISLLGYKLTHYVKNLEVSESEKLSILIKLIQDLPKYASFINRQVTD
                     TDATESIVDGWENSFDHIPQGLYINGAVVAQSNLNYMDILNILKREYAFVDDLTRFGV
                     AKVHAQDIMKSFAAHVPDRSVNNTELKRFDIRVHADAIIYLNDIETDPLYSNLSSSRE
                     PYTRQPLSTGEFPPVRENIHELVFVIDLEDRDQVKILLTFFYSMSESRPLRIGLVPFT
                     SDYSVDENFLHVVETQGIHEVIAFLRHVATTVLKNDEEGRLSVLDLGCLYDICYTDLG
                     PKVDDFIDGFSITHPVVIANGKFFDFGKDWWNNPTNKIHLAQELFKDILDLGKAISNG
                     ALSADMRAQDFLYNGSQTYRNPIFSALNKKEPLYGFPDSMKADIPFFAPFDSLEVFKI
                     IEQNEISIATLVIDDQPDSIPITIWLIGNSWDLVFLSQLRYLMSVASDLNPVKIRVYD
                     TSLNPEFSSWLQAEMDKSLADLIILIGARRFDRRDGKYPECPEEAKDFVLKTFNLDIS
                     KAGDPYLILNGRAIKIDGILSDTRLKQLVRSETDSKLQTTYQLLSEHNISTPIVLDRF
                     ELFEYFTMSVSKTYYFSDGYQPDQKLFPRYNTNLLNDTFSIEMAKSNAEGSTMEVTLF
                     IDPLQEESQKLVSLLSLFEELNRVRIKVILNPQKANELDVKRFYRGVFPNSVKFSSAG
                     FALDNEDKALFALVPEKNLFTVDLDVPNRWVVVIKEAVTDLDNVLLEYSGEARGVYEL
                     KSLLVEGYSYATTKQDQITGFNVFHAVLRGHSETTVMPDYGYFQLQANPGLWKFSMNA
                     AGAEVLQLVKFVGKSNYNRIQYTVLNETAIIPVLNLNGNFIEPLFDRTPGQKNASLIG
                     NTTTTKKESSRGRWISWNNQEESKNAGINIFTVTSGHLDERFLSIMANSVMKHTEHTV
                     KFWLIENYMSPAFKENLPFLSQRFGFEYELINYKWPAFLEGQRKRQRAILRYKILFLD
                     VFLPQSLDKVVVVDADQIVRTDLKELVNLDLEGAPYGYVPMCDGREEMTEFKFWKQGC
                     WLKDLGDTFKYHSSGLYVIDLKTFRNIGAGFYLRQLYHLSRDSNPKLKIFSLPQEWLW
                     CETWCSDEGLKDAKTINFCNNPLTKEPKLDIARRIPEWIQYDNEVQQVIDEVSASAKK
                     ISTEHDEF"
     gene            <222375..>223106
                     /locus_tag="PAS_chr1-3_0115"
                     /db_xref="GeneID:8197584"
     mRNA            <222375..>223106
                     /locus_tag="PAS_chr1-3_0115"
                     /product="40S ribosomal protein S3"
                     /transcript_id="XM_002489411.1"
                     /db_xref="GeneID:8197584"
     CDS             222375..223106
                     /locus_tag="PAS_chr1-3_0115"
                     /codon_start=1
                     /product="40S ribosomal protein S3"
                     /protein_id="XP_002489456.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0115"
                     /db_xref="EnsemblGenomes-Tr:CAY67175"
                     /db_xref="GeneID:8197584"
                     /db_xref="GOA:C4QVA2"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR005703"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="InterPro:IPR018280"
                     /db_xref="UniProtKB/TrEMBL:C4QVA2"
                     /translation="MPEVLISKKRKLVADGVFYAELNEYFTRELAEDGYSGVEVRVTP
                     TTTEIIIRATQTNSVLGENGRRIRELTALVQKRFKIDEGKVILYAERVQDRGLSAVTQ
                     CESLRYKLLNGLAIRRAAYGVVRFVMDSGAKGVEVVVSGKLRAARAKSMKFADGFMIH
                     SGQPAKDFIETATRHVLLRQGVLGIKVKIMRDPAAARTGPKALPDFVKIHEPKDEREV
                     PAPFVKSYVAEPVVEAEEAEEQATA"
     gene            <223276..>224018
                     /locus_tag="PAS_chr1-3_0116"
                     /db_xref="GeneID:8197585"
     mRNA            join(<223276..223327,223387..>224018)
                     /locus_tag="PAS_chr1-3_0116"
                     /product="Endoplasmic reticulum packaging chaperone"
                     /transcript_id="XM_002489412.1"
                     /db_xref="GeneID:8197585"
     CDS             join(223276..223327,223387..224018)
                     /locus_tag="PAS_chr1-3_0116"
                     /codon_start=1
                     /product="Endoplasmic reticulum packaging chaperone"
                     /protein_id="XP_002489457.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0116"
                     /db_xref="EnsemblGenomes-Tr:CAY67176"
                     /db_xref="GeneID:8197585"
                     /db_xref="InterPro:IPR013248"
                     /db_xref="UniProtKB/TrEMBL:C4QVA3"
                     /translation="MISYQELLPLGTGLIVTSASFCLGLAYSNWPFDYFTLYSDGGDE
                     AFKQSLDHLLLWSKVPRFVHWTLHGVIGLGYIGCFIKIFKPDPDQSLFEYGTLVLFVV
                     ATVMYLTNIRLGILSAEKGEWGDVDEQTGINVIAASTGLLVFVLIGILLLQFGLWYAV
                     HADRVLKEKYLKEEAAKEAKLEKESEKTEDKAAEESEAKPDSYKSKSKKSSTSGSKST
                     ATTAQKRKA"
     gene            <224173..>224477
                     /locus_tag="PAS_chr1-3_0117"
                     /db_xref="GeneID:8197583"
     mRNA            join(<224173..224217,224283..>224477)
                     /locus_tag="PAS_chr1-3_0117"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489413.1"
                     /db_xref="GeneID:8197583"
     CDS             join(224173..224217,224283..224477)
                     /locus_tag="PAS_chr1-3_0117"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489458.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0117"
                     /db_xref="EnsemblGenomes-Tr:CAY67177"
                     /db_xref="GeneID:8197583"
                     /db_xref="UniProtKB/TrEMBL:C4QVA4"
                     /translation="MAIGDYPVYYKQPIRWLSYHAHTRPHVFYAIAVAALGPVFMMAT
                     PLRRKFLYDDHEPLPANGYPLPNRSRDKTLTGYDD"
     gene            complement(<224540..>225406)
                     /locus_tag="PAS_chr1-3_0118"
                     /db_xref="GeneID:8197586"
     mRNA            complement(<224540..>225406)
                     /locus_tag="PAS_chr1-3_0118"
                     /product="Mitochondrial ribosomal protein of the large
                     subunit"
                     /transcript_id="XM_002489414.1"
                     /db_xref="GeneID:8197586"
     CDS             complement(224540..225406)
                     /locus_tag="PAS_chr1-3_0118"
                     /codon_start=1
                     /product="Mitochondrial ribosomal protein of the large
                     subunit"
                     /protein_id="XP_002489459.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0118"
                     /db_xref="EnsemblGenomes-Tr:CAY67178"
                     /db_xref="GeneID:8197586"
                     /db_xref="GOA:C4QVA5"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005727"
                     /db_xref="UniProtKB/TrEMBL:C4QVA5"
                     /translation="MLAGSLSRLTSLGSRRFFGVSSIARQSLFGEVTSLEHPKETLEP
                     PKNENDASKTVAPTDGKADLRGNAIQYIDPSKDEKLQEFLKSKPIRSVDELLSPLKRE
                     LYLANVKQNGFFKNRQQIELNGSTYMVKLTPEEVKALEPSVYLESYRIKSTPKKANIV
                     LRALKGLRLKEAITQLHFMRKKIATDLYILLERGLKDAETLGYNPEELYISEAWVGSD
                     SHKSKRVECKGRGRTGIITHRHVNVKFVLRSDQTLRRITWEKSQQPKNNKIPGSVIDQ
                     KIRSKPSGFYKW"
     gene            <225743..>226312
                     /locus_tag="PAS_chr1-3_0119"
                     /db_xref="GeneID:8197587"
     mRNA            <225743..>226312
                     /locus_tag="PAS_chr1-3_0119"
                     /product="Protein of unknown function, has homology to
                     kinase Snf7p"
                     /transcript_id="XM_002489415.1"
                     /db_xref="GeneID:8197587"
     CDS             225743..226312
                     /locus_tag="PAS_chr1-3_0119"
                     /codon_start=1
                     /product="Protein of unknown function, has homology to
                     kinase Snf7p"
                     /protein_id="XP_002489460.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0119"
                     /db_xref="EnsemblGenomes-Tr:CAY67179"
                     /db_xref="GeneID:8197587"
                     /db_xref="InterPro:IPR004910"
                     /db_xref="UniProtKB/TrEMBL:C4QVA6"
                     /translation="MGLVYLQYFKDEPTLPKVPEATVDRRDSWGAGSNSRRSSDNTLF
                     SRSSFSTALTNFRDDDSTITETIVDEKLPLVSNDSPYSLSRDSNLLLCNQCYTQVCQM
                     PLIISDNFHGKHGKAYLVSHLLNVELDEKPSTKIMLTGEYLVTNVYCKQCRSCLGWKY
                     LESDSRKENYKVGKFVIELELLEEVSAGR"
     gene            complement(<226504..>227715)
                     /locus_tag="PAS_chr1-3_0120"
                     /db_xref="GeneID:8197588"
     mRNA            complement(<226504..>227715)
                     /locus_tag="PAS_chr1-3_0120"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489416.1"
                     /db_xref="GeneID:8197588"
     CDS             complement(226504..227715)
                     /locus_tag="PAS_chr1-3_0120"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489461.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0120"
                     /db_xref="EnsemblGenomes-Tr:CAY67180"
                     /db_xref="GeneID:8197588"
                     /db_xref="UniProtKB/TrEMBL:C4QVA7"
                     /translation="MCEDICKKKDNYFVKRYAITNDTVTTPLSSNNTDITVTESTTIM
                     PVSSAQYSLLSASTSSYQTSSMVTPTATSQDESFLVAQYTQDYVVTAEETTFTVGIRM
                     TTTVLGSQTVTAEPKTTDLPYFKSVLSSQLESQGMDPDSYYRVSKGSSFGRGQIVGVS
                     IGSFFGVLLVLLALFLLYRRRKKKIHLFPLPDFEKGYVPPSLPNENSPIVPNRGSKPF
                     LFSEESTVPETTEEREVSTTGNQDDELGGLRFGILANQDMSNSPPLSPKATQEGSRHY
                     LGSPVPESLNASVDRTINVVFEEGSSLEEEPVLSEKGQNTIDKQIRTPSRYANVGLDR
                     ERLKSMSSPPPVPRPRKNIHLGQESNQDDNDQEVHDTLQFNTRRVLEEEELSIGSFES
                     SLLSLSDSQSD"
     gene            complement(<227926..>229083)
                     /locus_tag="PAS_chr1-3_0121"
                     /db_xref="GeneID:8197589"
     mRNA            complement(<227926..>229083)
                     /locus_tag="PAS_chr1-3_0121"
                     /product="Protein of unknown function, localizes to the
                     nucleolus and nucleoplasm"
                     /transcript_id="XM_002489417.1"
                     /db_xref="GeneID:8197589"
     CDS             complement(227926..229083)
                     /locus_tag="PAS_chr1-3_0121"
                     /codon_start=1
                     /product="Protein of unknown function, localizes to the
                     nucleolus and nucleoplasm"
                     /protein_id="XP_002489462.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0121"
                     /db_xref="EnsemblGenomes-Tr:CAY67181"
                     /db_xref="GeneID:8197589"
                     /db_xref="GOA:C4QVA8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QVA8"
                     /translation="MAKDKKDEKPDKEGVKVQKQLSSSEEDDSVERAEVKKEKKEKKE
                     KKRSRESKELEELEINLDDAAPLSKKQKRMAKKEKSLEGKPKKESDKPASKSVNGVWI
                     GNLTFDTTRDELRSFLIANTEHLDMKITPENITRINLPKKGPKIRGFAYVDFDKPELV
                     PVCISLSEQSLNGRNLLIKDANSFEGRPEKSKQQQTGGDSGKNKNPPSRILFVGNLSF
                     DTTKEDLEEHFQHCGNIVKIRMATFEDSGKCKGFAFIDFLDVEGATNALNDKLCKRMV
                     GRPLRMEYGEDRSKRSPAFRKPVEEGEIDDSGNVIGSAIEKPKKKTFSDFDDPEEQNH
                     QRSAPQKSFASKPRYNTNEPQGRVKSSVVLANAPRQSAAIVPSQGKKVKFD"
     gene            <229631..>231142
                     /locus_tag="PAS_chr1-3_0122"
                     /db_xref="GeneID:8197590"
     mRNA            <229631..>231142
                     /locus_tag="PAS_chr1-3_0122"
                     /product="UDP-glucose pyrophosphorylase (UGPase),
                     catalyses the reversible formation of UDP-Glc"
                     /transcript_id="XM_002489418.1"
                     /db_xref="GeneID:8197590"
     CDS             229631..231142
                     /locus_tag="PAS_chr1-3_0122"
                     /codon_start=1
                     /product="UDP-glucose pyrophosphorylase (UGPase),
                     catalyses the reversible formation of UDP-Glc"
                     /protein_id="XP_002489463.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0122"
                     /db_xref="EnsemblGenomes-Tr:CAY67182"
                     /db_xref="GeneID:8197590"
                     /db_xref="GOA:C4QVA9"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR016267"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4QVA9"
                     /translation="MSAYQSPKKHVKTQSAYAFDNTTTSIAASQMRNVLNTLVDSVHA
                     ADEHTRERFENEMDTFFGLFRRYLADKASGSTLDWDKINSPTKEEVVKYQDLKSVENT
                     DNLSKLAVLKLNGGLGTSMGCVGPKSVIEVREGQSFLDLSVRQIEYLNRTFDTDVPLL
                     LMNSFNTDDDTHHLIQKYQGHRIRIRTFNQSRYPRIFKDSLLPVPQSYDDSLEAWYPP
                     GHGDLFESLVASGELDVLLQQGKEILFVSNGDNLGATVDTKILNHMIETGAEYIMELT
                     DKTRADVKGGTLISYDGQVRLLEIAQVPKEHVEEFKSIKKFTNFNTNNLWINLKAIKR
                     LVESDSIKVEIIPNNKTIRVGSQEVNVVQLETAVGAAIRHFRNAHGVVVSRSRFLPVK
                     TCSDLLLVKSDLFYLEHGSLKIDPARFGAAPLIKLGSHFKKVKEFQDRIPHMPKILEL
                     DHLTVTGNVQFGKGVQLKGTVIIVCSDGQRIDIPNGSILENVVVTGNLTILEH"
     gene            complement(<231199..>232068)
                     /locus_tag="PAS_chr1-3_0123"
                     /db_xref="GeneID:8197591"
     mRNA            complement(<231199..>232068)
                     /locus_tag="PAS_chr1-3_0123"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489419.1"
                     /db_xref="GeneID:8197591"
     CDS             complement(231199..232068)
                     /locus_tag="PAS_chr1-3_0123"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489464.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0123"
                     /db_xref="EnsemblGenomes-Tr:CAY67183"
                     /db_xref="GeneID:8197591"
                     /db_xref="GOA:C4QVB0"
                     /db_xref="InterPro:IPR009292"
                     /translation="MKAQKFSKASLLDDEDDYSTQLDRILARRKKSQKEDSGDLDTIS
                     FGSLSKAQARLQTEERESKKKVKKVKKPKVLKKQEEDFQPPSDISDDGEFFEEPSQDH
                     QSRTSDRHSKEEPRSKSKHAPSESSAKKRVSKVREIPGLLNGSGSSSLYQDVRFDTAF
                     GKADLQKARENYKFLDEYREKEITELNKILQDDMTEQLLSEREINTIKYKIQSLKSRV
                     DTLKNRDLENEIVRDYKRNHKNFFLKNSDKRKLVQKAKFDSMKPSQREKVIERKRKRQ
                     LGREFKQLEFNQK"
     gene            <232220..>232510
                     /locus_tag="PAS_chr1-3_0124"
                     /db_xref="GeneID:8197592"
     mRNA            <232220..>232510
                     /locus_tag="PAS_chr1-3_0124"
                     /product="mitochondrial 54S ribosomal protein YmL44"
                     /transcript_id="XM_002489420.1"
                     /db_xref="GeneID:8197592"
     CDS             232220..232510
                     /locus_tag="PAS_chr1-3_0124"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL44"
                     /protein_id="XP_002489465.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0124"
                     /db_xref="EnsemblGenomes-Tr:CAY67184"
                     /db_xref="GeneID:8197592"
                     /db_xref="GOA:C4QVB1"
                     /db_xref="InterPro:IPR019716"
                     /db_xref="UniProtKB/TrEMBL:C4QVB1"
                     /translation="MITKYFTKVSVKFNPFGPEAKGARLFLAALPSSLKKSCTINYEV
                     LNSQSNKKPIIEVTYKDKKTLDVNPTSLNFNELSNLFDRHSRKLQLEESIQG"
     gene            complement(<232600..>233496)
                     /locus_tag="PAS_chr1-3_0125"
                     /db_xref="GeneID:8197593"
     mRNA            complement(<232600..>233496)
                     /locus_tag="PAS_chr1-3_0125"
                     /product="Member of the protein disulfide isomerase (PDI)
                     family"
                     /transcript_id="XM_002489421.1"
                     /db_xref="GeneID:8197593"
     CDS             complement(232600..233496)
                     /locus_tag="PAS_chr1-3_0125"
                     /codon_start=1
                     /product="Member of the protein disulfide isomerase (PDI)
                     family"
                     /protein_id="XP_002489466.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0125"
                     /db_xref="EnsemblGenomes-Tr:CAY67185"
                     /db_xref="GeneID:8197593"
                     /db_xref="GOA:C4QVB2"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:C4QVB2"
                     /translation="MKLLSLALLVSLVSADTFYTPKDDVIQLNAYNFKDVVFNSNYSS
                     VVEFYAPWCGHCQNLKNPFKKAAAVSKDYLQVAAIDCDAAENKKLCSDYRIQGFPTIM
                     VFRPPKFDPTSSTNRRSGAHANEVYSGARDTKSIVEFGVSRIKNYVKRVSPNNINQTL
                     GNSEKTQLLLVTDKAKPSALIKSIALDFLNDIESFYYPFNDKTKKALTTRLEEYQQSF
                     SGESITSPSILVLHENEIHIFDGKLDKLSISKFLAEFSTPLEGPLSKRGKFLEHIRRG
                     IKPGRKAKKGKKGKQTKNHDEL"
     gene            <233895..>235595
                     /locus_tag="PAS_chr1-3_0126"
                     /db_xref="GeneID:8197594"
     mRNA            <233895..>235595
                     /locus_tag="PAS_chr1-3_0126"
                     /product="Transcriptional activator of genes regulated by
                     nitrogen catabolite repression (NCR)"
                     /transcript_id="XM_002489422.1"
                     /db_xref="GeneID:8197594"
     CDS             233895..235595
                     /locus_tag="PAS_chr1-3_0126"
                     /codon_start=1
                     /product="Transcriptional activator of genes regulated by
                     nitrogen catabolite repression (NCR)"
                     /protein_id="XP_002489467.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0126"
                     /db_xref="EnsemblGenomes-Tr:CAY67186"
                     /db_xref="GeneID:8197594"
                     /db_xref="GOA:C4QVB3"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:C4QVB3"
                     /translation="MEGNRRNNTGSLKDLEDSPSIWGVYSSAKKLLDLYPRVENRTLR
                     NESKKTQMTKQDSLSGKLHFSELQLDDSADLTEIISSAPGLYYSPDSLENNSGAPSSY
                     SDSKVKSELRKPKPSMMVTPSSMNDSPLHDSNNLDLNSMWKFDSNDDGEEDGMGGDFS
                     DIIQDKSLQEFLSDGASHKLQLAKPTSETTSITTTVTVQKDMSDSSSPKADNDESITR
                     TQCSNCKTEKTPLWRRDGSGNTLCNACGLFQKLHGTVRPLSLKTDVIRKRNSKRQQHQ
                     SSLTHGLCKMQQQQQQVQFQPQQHEHIQPSHSTQTQKQIQQQQQQPYPYPYNNSLPTT
                     AVSFSPYGGSQDSYYLMRGNSLNSNAQKHKNVPILPKPSRGPSNKNIPVPMMPQQQDS
                     PYTSFSPHSAGFKRRKSQISLSGNNPGVSIPASPSSVSSFTSQQPVAVASYFTNAASP
                     INSDLGIISPSNDYGHGFSNSISSSLHQEFQMKRGIPSSPILKNSFQQRFPETARRPS
                     SLSLQTQHVVTGFDVKQEGFPEDKTCGPRRNSKDPGTAGPTPNNRNIAEDLDWLKFGI
                     "
     gene            <235795..>237021
                     /locus_tag="PAS_chr1-3_0127"
                     /db_xref="GeneID:8197595"
     mRNA            <235795..>237021
                     /locus_tag="PAS_chr1-3_0127"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489423.1"
                     /db_xref="GeneID:8197595"
     CDS             235795..237021
                     /locus_tag="PAS_chr1-3_0127"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489468.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0127"
                     /db_xref="EnsemblGenomes-Tr:CAY67187"
                     /db_xref="GeneID:8197595"
                     /db_xref="GOA:C4QVB4"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="InterPro:IPR019770"
                     /db_xref="InterPro:IPR023398"
                     /db_xref="UniProtKB/TrEMBL:C4QVB4"
                     /translation="MSKFFEDINGSRTTKQVAAPHPMQYSWTFWHHVRGKETENVTTS
                     GSVAEPSEQENKETSSEASRNDWQNTLDQYLQTVKQVEFPSVANGGATTTTNIDSCEQ
                     LWQSLSNLRKVSDLPVGTELFLFKSGIKPVWEDPANKAGGRWLIKSRYRRAQCDASTM
                     ERFSLIWERLILRLCGGTYFSNYSDADFEEFQDDICGITLSVRKNEVMIYIWNKNSIS
                     SQKPTNEPQDETEPDQDGEKEAEPDGKLNADANFTPRLNTVNKILAPAISVIKECDLI
                     LEGADPLEDHKIESLANVSELAFDYRFHHSSKRFFVQNFQNDYNAVYKAPHQNRHWNR
                     SNHNSHGPFSSNHNSSGRNFKDRKNNYKAAAKTDTQSLFANLGRSRKGGSGEPGGLLG
                     NKRRLQRSSHKDEDSA"
     gene            <237162..>238673
                     /locus_tag="PAS_chr1-3_0128"
                     /db_xref="GeneID:8197596"
     mRNA            <237162..>238673
                     /locus_tag="PAS_chr1-3_0128"
                     /product="Probable di-and tri-peptidase"
                     /transcript_id="XM_002489424.1"
                     /db_xref="GeneID:8197596"
     CDS             237162..238673
                     /locus_tag="PAS_chr1-3_0128"
                     /codon_start=1
                     /product="Probable di-and tri-peptidase"
                     /protein_id="XP_002489469.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0128"
                     /db_xref="EnsemblGenomes-Tr:CAY67188"
                     /db_xref="GeneID:8197596"
                     /db_xref="GOA:C4QVB5"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017153"
                     /db_xref="UniProtKB/TrEMBL:C4QVB5"
                     /translation="MNFTRLLSTINYKKIPPSIFRSYSTMSIEKKLQSVFSKVDELKP
                     VFIERLANAVAIPSVSGDESLRKEVFKMSEFLVKELESLGAYDIQVKPLGKQPPPVTD
                     ENLELPPIVLARVGKDETKKTIMIYGHYDVQPALKDDGWDTYPFKLVEVNDKLYGRGS
                     TDDKGPVIAWLNVLQAHKELSLELPVNIIFCFEGMEESGSLGLEELVGREADKYFKGV
                     DTCCISDNYWLGTKKPVLTYGLRGCNYYQIIVSGPGADLHSGIFGGVIHEPMTDLIRV
                     MSQLVDVKGKILIPGIDEMVAPVTETEEKLYDDIEFDVNELNAASGSNTAIYQSKNDI
                     LMHRWRYPSLSLHGIEGAFSGGGAKTVIPAKVIGKFSIRTVPDIDSKKMDQYVFDYVN
                     AKFKELGTPNSYKVELIHDGAYWKSDPFNDSFTAAKKATKVVWGVEPDLTREGGSIPI
                     TLTFEQQLKTNVLLLPLGKGDDGAHSINEKIDVKNYIEGAKTMAAYLHYYGEI"
     gene            <238764..>239690
                     /locus_tag="PAS_chr1-3_0129"
                     /db_xref="GeneID:8197597"
     mRNA            <238764..>239690
                     /locus_tag="PAS_chr1-3_0129"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489425.1"
                     /db_xref="GeneID:8197597"
     CDS             238764..239690
                     /locus_tag="PAS_chr1-3_0129"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489470.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0129"
                     /db_xref="EnsemblGenomes-Tr:CAY67189"
                     /db_xref="GeneID:8197597"
                     /db_xref="GOA:C4QVB6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C4QVB6"
                     /translation="MSVLWQTSLGDITIDCSGKDDYVKNFIYLNLLKYYDLVSFHNRI
                     TNDSVSTGLPYYPNQDRRTSYQDLLKEKGHKGKCSSVVNADPQDIENSVGLVLFNVND
                     ANDEPSIDSLITISLTNEGTRSNVVEIGYVTEGFSVLQEINSCDANTKNEPITDIRIF
                     RSYVLHNPFPEISVPSVSAPLLLDIDQLNTISELTSETASRQLALEVMGDLVHANIQP
                     SEKVLFVCKLNPITTAEDLGVVFSRFGKITGSEIVKDRSTGKSKTYGFIEFADVESCE
                     EAYRKMDNVIIDDRRIHVDFSQSTKRFKRAKR"
     gene            <239825..>240685
                     /locus_tag="PAS_chr1-3_0130"
                     /db_xref="GeneID:8197598"
     mRNA            <239825..>240685
                     /locus_tag="PAS_chr1-3_0130"
                     /product="Pyrimidine nucleotidase"
                     /transcript_id="XM_002489426.1"
                     /db_xref="GeneID:8197598"
     CDS             239825..240685
                     /locus_tag="PAS_chr1-3_0130"
                     /codon_start=1
                     /product="Pyrimidine nucleotidase"
                     /protein_id="XP_002489471.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0130"
                     /db_xref="EnsemblGenomes-Tr:CAY67190"
                     /db_xref="GeneID:8197598"
                     /db_xref="GOA:C4QVB7"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR010237"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4QVB7"
                     /translation="MSLSLPELQDPHLESNFIEDVISEQEVLDRSSSQVNIPLESSLP
                     NVHLTYGVGPVPLDDGKVFFFDIDNCLYKRSSKIHDLMQIYIHRYFKDTLQINDKEAW
                     DLHHKYYQQYGLSMEGLVRHNNIDAMEYNSKVDDSLPLEKILRPNRRLREMILRLKKS
                     GKVDRLWLFTNAYKNHALRVIYLLGLGDLFDGLTYCEYDKIPILCKPMKPIFDKALLA
                     AGCKSTKNAYFVDDSALNVKAARELGFAKVIHYVETDDDMEKLDETHKANTVIIRDIL
                     ELEKVCSELF"
     gene            complement(<240682..>242094)
                     /locus_tag="PAS_chr1-3_0131"
                     /db_xref="GeneID:8197599"
     mRNA            complement(<240682..>242094)
                     /locus_tag="PAS_chr1-3_0131"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489427.1"
                     /db_xref="GeneID:8197599"
     CDS             complement(240682..242094)
                     /locus_tag="PAS_chr1-3_0131"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489472.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0131"
                     /db_xref="EnsemblGenomes-Tr:CAY67191"
                     /db_xref="GeneID:8197599"
                     /db_xref="UniProtKB/TrEMBL:C4QVB8"
                     /translation="MSGDDDIGSSSESEIEGGLSLLSNSRLIKDSKPSPPETTPFNDV
                     EVISKYSDDKLIKDLSKYQSNQETLSYIASKAKQRQDVFNKRSNLEEKIKAQVNPEVF
                     KENPAYLDYLVTHYEGKHGINLQDFFFVTNPQPFVILPIEGVGKIRSDQLLNHLAYET
                     REEFIDTIGAKLDDVHDISLFQCKTFLKTIGCKTELIDQPSSITLTLNPHVKTIPQSL
                     IVRKVWYLIQRVSRSPWDLTIQNLLLYTVLYFFMDKLIADGSENTSCVDWLNKSMISL
                     MQWYPSDTQLTTNESFQETMSLLISAINKITTDVNLIARLLLNMDTRNSISRYMCHAL
                     SMHYLSVPIEYQSVNYPMERIKLDCDPESINKEILGLLEKNLEKFCHCELEVSIPRDK
                     LVYKQIQARMSILSSLINYYLPHLSRTQSQKFHEHISSLSQDYFHMHKSQINPTIFET
                     INSLKALEDKLFDKILQSNN"
     gene            complement(<242307..>242726)
                     /locus_tag="PAS_chr1-3_0132"
                     /db_xref="GeneID:8197600"
     mRNA            complement(<242307..>242726)
                     /locus_tag="PAS_chr1-3_0132"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489428.1"
                     /db_xref="GeneID:8197600"
     CDS             complement(242307..242726)
                     /locus_tag="PAS_chr1-3_0132"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489473.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0132"
                     /db_xref="EnsemblGenomes-Tr:CAY67192"
                     /db_xref="GeneID:8197600"
                     /db_xref="GOA:C4QVB9"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:C4QVB9"
                     /translation="MLRRLIRPIWRLPRAPKVQSIRHNSTLNEEYLDTKNLPMRWEKM
                     EKEAQEEIIDHLSDLQDESWKKLSPDNKRACYYLAYGEWGPRNKQTMTVPEVVFKLIT
                     SGILFIVLGVTAVNYAIDKEKKEQLESGSNQSAAQVT"
     gene            complement(<243019..>243594)
                     /locus_tag="PAS_chr1-3_0133"
                     /db_xref="GeneID:8197601"
     mRNA            complement(<243019..>243594)
                     /locus_tag="PAS_chr1-3_0133"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489429.1"
                     /db_xref="GeneID:8197601"
     CDS             complement(243019..243594)
                     /locus_tag="PAS_chr1-3_0133"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489474.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0133"
                     /db_xref="EnsemblGenomes-Tr:CAY67193"
                     /db_xref="GeneID:8197601"
                     /db_xref="InterPro:IPR007482"
                     /db_xref="UniProtKB/TrEMBL:C4QVC0"
                     /translation="MKAIGVKYLHFFYGMSAILWACVVVRSLLLLPLVGLRFFPGGVA
                     DFYLSIAIGNVVLENINHVIFCRKLNYILALELIGRLFIGLGVILNYPIIAKNAAFPT
                     LVLSQGIIELFRYSYTSYKLKFRIPKSFNYLYLAVILVGYSVKTLSEMVLMFLSLGYA
                     DDRFGTFIKIVLLVYIPSAYMFFKHSYARRG"
     gene            <243974..>244873
                     /locus_tag="PAS_chr1-3_0134"
                     /db_xref="GeneID:8197602"
     mRNA            <243974..>244873
                     /locus_tag="PAS_chr1-3_0134"
                     /product="Type I membrane protein with a J domain is
                     required to preserve the folding capacity of the ER"
                     /transcript_id="XM_002489430.1"
                     /db_xref="GeneID:8197602"
     CDS             243974..244873
                     /locus_tag="PAS_chr1-3_0134"
                     /codon_start=1
                     /product="Type I membrane protein with a J domain is
                     required to preserve the folding capacity of the ER"
                     /protein_id="XP_002489475.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0134"
                     /db_xref="EnsemblGenomes-Tr:CAY67194"
                     /db_xref="GeneID:8197602"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:C4QVC1"
                     /translation="MKLHLVILCLITAVYCFSAVDREIFQLNHELRQEYGDNFNFYEW
                     LKLPKGPSSTFEDIDNAYKKLSRKLHPDKIRQKKLSQEQFEQLKKKATERYQQLSAVG
                     SILRSESKERYDYFVKHGFPVYKGNDYTYAKFRPSVLLTIFILFALATLTHFVFIRLS
                     AVQSRKRLSSLIEENKQLAWPQGVQDVTQVKDVKVYNEHLRKWFLVCFDGSVHYVEND
                     KTFHVDPEEVELPSWQDTLPGKLIVKLIPQLARKPRSPKEIKKENLDDKTRKTKKPTG
                     DSKTLPNGKTIYKATKSGGRRRK"
     gene            complement(<244941..>247916)
                     /locus_tag="PAS_chr1-3_0135"
                     /db_xref="GeneID:8197603"
     mRNA            complement(<244941..>247916)
                     /locus_tag="PAS_chr1-3_0135"
                     /product="Protein that forms a complex with the Sit4p
                     protein phosphatase"
                     /transcript_id="XM_002489431.1"
                     /db_xref="GeneID:8197603"
     CDS             complement(244941..247916)
                     /locus_tag="PAS_chr1-3_0135"
                     /codon_start=1
                     /product="Protein that forms a complex with the Sit4p
                     protein phosphatase"
                     /protein_id="XP_002489476.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0135"
                     /db_xref="EnsemblGenomes-Tr:CAY67195"
                     /db_xref="GeneID:8197603"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="UniProtKB/TrEMBL:C4QVC2"
                     /translation="MHHSSTEVSAIWPFFNNSYSNVAINKILQEIENEEHDNDQDAGL
                     TAVQLLQTIRENDDIQKANDTQEPTTPSRSKESKSNKSSKTTSSGHLNKRLLNNLLIQ
                     PNLINELNAGKNSKLIAYITQEKVLSTLIDYCLESLDLKTDYVEDIDDDNEDDFNEDG
                     SPVGHDEEEITFQYDEDNNTGKDNEKAAPADQSDSSSKRLLKRATIAMHILSSDQTPV
                     VYNQFLSSHQYGLISKIWEGVFNRDIAEYFIDKRHNIVMMNGFIAIIENLAEMNVNGL
                     MNFIRFQQTKDSDSLSKHFVNFIPYFPQFSDLLLKLISMDKPYNPIGLIELLVDQDLI
                     GQILEKLRVYYDDCIIQDNLLIFLNGLVNISSNVGYWDDQQNNMENEMNDGNNGSNEA
                     NISAVNGNNTANIGPNDLTRDMVSTSKVNTMINIILNYGDYGLVTCISLFIEIIRKNN
                     SDYDEFDWIMAANDLTSTPNSRDPIYLGVMLKLFIINLPAIVNKYLTDEYYERKQELN
                     TFSSEGQRIDFDGKIRRKMIVSSIGKEIEPLGYERFKIMELIAELLHCSNMMLLNQSS
                     KLDYLLFKRDELRRANQTEKLVHDALTDSILKPVEDAIEDLKIADDTSLHSFETLKKI
                     DSKYIECTYDLSVGNSFKFSLLVSQALPRIILKMDKFPWNNFMHNVIFDLVQQIFNGK
                     LIDDTEGTNDDENQDGDSEAEKSTEYEQNTHGFEDPLCFNKLLIVSLFGEYDAFDQDL
                     PPDGRFARPKEIPGSFNLPAYILYACEKSKLSEEQANVKLGYMGHLVLVAQEVVKFQS
                     IIENFGIHKEQLKTRKLEGEEIADETDDDEGETEDTEEEEQNTENGNTYDTVITNSEQ
                     FSSIKGDLPDIYKISSTKIYTRLYKQLCTSFGEGRFQKWTDFINNELSVVREQYNQVL
                     GGVNEGEVEIDEVPRNPNAIVLDNGDSEEFRKPFDEQESETETEDEESEEEENNDNDR
                     IREDEEAISDDNSSYDSDE"
     gene            <248240..>250629
                     /locus_tag="PAS_chr1-3_0136"
                     /db_xref="GeneID:8197604"
     mRNA            join(<248240..248271,248334..>250629)
                     /locus_tag="PAS_chr1-3_0136"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489432.1"
                     /db_xref="GeneID:8197604"
     CDS             join(248240..248271,248334..250629)
                     /locus_tag="PAS_chr1-3_0136"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489477.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0136"
                     /db_xref="EnsemblGenomes-Tr:CAY67196"
                     /db_xref="GeneID:8197604"
                     /db_xref="UniProtKB/TrEMBL:C4QVC3"
                     /translation="MFGFRGLTVLLPLLYLVYYINTTCPLSDPVATSDSLVCQLTHQS
                     YEYVTPFVERVQHTEHYQLVNKNISPYTQAIDAQYQQYLSPTIDHLSEKAKYYFKIFS
                     VHAKSYFRFAALKSVELKKKGDLYANDVLIPRAITLYHQSYNYTKTTIIPKTKELFHK
                     SSDYLHEEVLPVVYKWYAITWWKTKDVYQFDVKPRLIVVAHLLKLDLVWNKLQEFTQT
                     EYYQTVERPIVLVWEYVSTVIRKLHVLLSSFQREELLISFNQQVESKKEFLRSQFNEF
                     FNASFQLKDLKELGRRNFFDAATVSGVPSAEGSTESEKTDAETEVYETEIEIEIETET
                     ETETETEIETETEIVYDTYSDTINRESPPPNEDDDEDEIEYVDINDVDVDDDDVEIVT
                     QRQTVTLFTTVEDSEPTSENETVSLELQPLEEFKEFVTNISSKAQQQFDDSVKELEDE
                     VIAKLNDKLKPLLRDLSHTINSDYEKTHLLIADINRIKDTSNSEDSDVRPYKYVTRQD
                     VRDELERLSEKVEKQTDAAKAVISNYKGLLEDDIVKIRDKVVTILEEYFDISYTEYSK
                     KIITETSRNSDKAWDEWSEFVALKDKILDVRDDIFTKKPKLENFLKAMTEWDHTLYVL
                     VNESGQYLSLLRAKANVQFQIREAEERRQEELTLKAQEGDDKEEINVDDVQLNDETLG
                     NEIEDDEDDEEEVEEETEEETEEEFEEEYEEEDEEKVEEKVEEEVADNQESAEEIVGE
                     AASDSTKDDDEEEEDTDDEEDYRDEEEADDDEDDQ"
     gene            complement(<250709..>251665)
                     /locus_tag="PAS_chr1-3_0137"
                     /db_xref="GeneID:8197605"
     mRNA            complement(<250709..>251665)
                     /locus_tag="PAS_chr1-3_0137"
                     /product="Molecular chaperone"
                     /transcript_id="XM_002489433.1"
                     /db_xref="GeneID:8197605"
     CDS             complement(250709..251665)
                     /locus_tag="PAS_chr1-3_0137"
                     /codon_start=1
                     /product="Molecular chaperone"
                     /protein_id="XP_002489478.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0137"
                     /db_xref="EnsemblGenomes-Tr:CAY67197"
                     /db_xref="GeneID:8197605"
                     /db_xref="GOA:C4QVC4"
                     /db_xref="InterPro:IPR010591"
                     /db_xref="UniProtKB/TrEMBL:C4QVC4"
                     /translation="MNSGSNENMSYRSLYISKNFNLFNRCVGLPIQYRNAVALDNIRY
                     VQTKAAKEDVLNRYKEKLEKKMKEEGAESIEKLQEKYKDKIEKTKIELNRMDPLTDLE
                     EYERKATKNGHKVTKLRSPRSPDAPIKPYKVLDDFLKLEKIKDLSPDQVEFLWRARFQ
                     EKENVLVAVIPKDVYQKLYTNARENPSFILPLPKEDEGVEIHFIQWAFPGPNTTHCMF
                     TSLAEYKLHKEYAKPHTTLMFHHDISEDKNIVLMNGTVEQDANITLPETQLLVMNLQR
                     FYGALAESPASNRRLQLLKDFTSGNENFSLDLVIQEAQSLEN"
     gene            <251923..>253193
                     /locus_tag="PAS_chr1-3_0138"
                     /db_xref="GeneID:8197606"
     mRNA            join(<251923..252530,252596..>253193)
                     /locus_tag="PAS_chr1-3_0138"
                     /product="Alpha-1,2-mannosyltransferase involved in O-and
                     N-linked protein glycosylation"
                     /transcript_id="XM_002489434.1"
                     /db_xref="GeneID:8197606"
     CDS             join(251923..252530,252596..253193)
                     /locus_tag="PAS_chr1-3_0138"
                     /codon_start=1
                     /product="Alpha-1,2-mannosyltransferase involved in O-and
                     N-linked protein glycosylation"
                     /protein_id="XP_002489479.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0138"
                     /db_xref="EnsemblGenomes-Tr:CAY67198"
                     /db_xref="GeneID:8197606"
                     /db_xref="GOA:C4QVC5"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4QVC5"
                     /translation="MMRARLSLERVNLSFITSVFLASVAVLFISLEMPKVLARDRQIL
                     KLKLGFMGSGLQKGSLETSGNIENTESNINSQTTQHIGTIGASNERANATFYTLCRNE
                     ELYQMLETVQNYEDRFNSKFKYDWVFLNDYPFTDEFKRVISHAISGEAKFGQVPASHW
                     RFPDHIDQQKVYESMDKMDSDNTTGDYLGLPIPYAKSISYRHMVEPDVKLYCDIDYDV
                     FKSMEQNGKRYGFVISMMEFEKTIESLFKEVKNYLQMKGVSRLLEDTDNLSDFVYDEL
                     SGDYTLCHFWSNFEIGDLDFFRGREYNEFFDYLDSKGGFYYERWGDAPIHSIAVSLFM
                     QWNDVKWFSDIGYRHPPYLSCPLSEEVRLEKKCSCDPKQDFTMDAYSCTRFYQDIIRD
                     KQKSQGSNP"
     gene            <253340..>253855
                     /locus_tag="PAS_chr1-3_0140"
                     /db_xref="GeneID:8197607"
     mRNA            join(<253340..253502,253560..>253855)
                     /locus_tag="PAS_chr1-3_0140"
                     /product="Small subunit of the clathrin-associated adaptor
                     complex AP-1"
                     /transcript_id="XM_002489435.1"
                     /db_xref="GeneID:8197607"
     CDS             join(253340..253502,253560..253855)
                     /locus_tag="PAS_chr1-3_0140"
                     /codon_start=1
                     /product="Small subunit of the clathrin-associated adaptor
                     complex AP-1"
                     /protein_id="XP_002489480.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0140"
                     /db_xref="EnsemblGenomes-Tr:CAY67199"
                     /db_xref="GeneID:8197607"
                     /db_xref="GOA:C4QVC6"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:C4QVC6"
                     /translation="MAIKYLIMLSKQGKVRLSKWYTVISQKEKLQLIKELTAIVLNRK
                     AKMCNVLEYKDHKIVYRRYASLFFIAGIDVDDNELLTLEIIHRYVEQMDKAYGNVCEL
                     DIIFNFQKAYHILDELLLDGTLQESSKREVLRRVGQQDQYELEDELDTKF"
     gene            <254890..>256872
                     /locus_tag="PAS_chr1-3_0141"
                     /db_xref="GeneID:8197608"
     mRNA            <254890..>256872
                     /locus_tag="PAS_chr1-3_0141"
                     /product="Protein with a role in cellular adhesion and
                     filamentous growth"
                     /transcript_id="XM_002489436.1"
                     /db_xref="GeneID:8197608"
     CDS             254890..256872
                     /locus_tag="PAS_chr1-3_0141"
                     /codon_start=1
                     /product="Protein with a role in cellular adhesion and
                     filamentous growth"
                     /protein_id="XP_002489481.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0141"
                     /db_xref="EnsemblGenomes-Tr:CAY67200"
                     /db_xref="GeneID:8197608"
                     /db_xref="GOA:C4QVC7"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:C4QVC7"
                     /translation="MVTVKTSLIWILICNIQLVRCFSITSLLKGSQVHRYMQGQRVHL
                     LVNKIESDETQLPYSYYDLPFVCPPMDDAKPVTMSLGEVFNGDRLWDSNYGLYFGIDE
                     SCKRLCDRITQPEALRRADQLIRQGYVVQWTVDSLPGATTFISSSSNSKYYASGFPLG
                     FVKDGDTYLHNHVMIVIRWHTEAADPAKKVIVGFEVYPRSVSDYQCPGASSNFDNYKL
                     DINSTEPAQIPFTYAVYWREEKDLSWENRWSMYFVSELNQGNIHWFSLVNSFVLVLFL
                     STVVGVVLYKTLTRDINEFKSSHRIHDAVTEELKFLPNVQHTDSDSDGWKSIRNEVFH
                     VPSHPLLLSILGGSGFQILLTALSVIIFYTIGVLRPQFKGDFFTISFASFILAGFGSG
                     FAGAQFYFQLKSDPHMTAGWRKVSILCGVFCTSVILSTILFCNFFVWAKSSSFALPIR
                     TILILVLSIIVIEIPLSYMGGYVSKRLKYSWSLKGSSKSSLLRTKSSNDLIIKTPIPK
                     QPFYNKLFVAVPLFGAFPFGIIYVELLFIFRSLWLEKSTYYYMYGFLFVTVGLLCIVI
                     VETAIIATFLSVNKGNYNWHWRSFIIGGSVAFYLTSYSIFYLIFYLKVVDFTSTLIYL
                     IYMALISCTVGVACGSVGLFSSIILMNTIYNAIKDD"
     gene            <257076..>257444
                     /locus_tag="PAS_chr1-3_0142"
                     /db_xref="GeneID:8197609"
     mRNA            <257076..>257444
                     /locus_tag="PAS_chr1-3_0142"
                     /product="Lsm (Like Sm) protein"
                     /transcript_id="XM_002489437.1"
                     /db_xref="GeneID:8197609"
     CDS             257076..257444
                     /locus_tag="PAS_chr1-3_0142"
                     /codon_start=1
                     /product="Lsm (Like Sm) protein"
                     /protein_id="XP_002489482.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0142"
                     /db_xref="EnsemblGenomes-Tr:CAY67201"
                     /db_xref="GeneID:8197609"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:C4QVC8"
                     /translation="MLPLFLLATAKGEPIQVELKNNVTINGYLVDCDSWMNLTLENVL
                     EVDATGEHFKKFPQFYVHGVEIKGVRMDENIIDRARQKEQRARNWNNNNNSNNNQRRN
                     YNNRYSANSSGGNRGNQRQR"
     gene            complement(<257546..>266264)
                     /locus_tag="PAS_chr1-3_0143"
                     /db_xref="GeneID:8197610"
     mRNA            complement(join(<257546..266187,266234..>266264))
                     /locus_tag="PAS_chr1-3_0143"
                     /product="Protein kinase primarily involved in telomere
                     length regulation"
                     /transcript_id="XM_002489438.1"
                     /db_xref="GeneID:8197610"
     CDS             complement(join(257546..266187,266234..266264))
                     /locus_tag="PAS_chr1-3_0143"
                     /codon_start=1
                     /product="Protein kinase primarily involved in telomere
                     length regulation"
                     /protein_id="XP_002489483.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0143"
                     /db_xref="EnsemblGenomes-Tr:CAY67202"
                     /db_xref="GeneID:8197610"
                     /db_xref="GOA:C4QVC9"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021668"
                     /db_xref="UniProtKB/TrEMBL:C4QVC9"
                     /translation="MPTIDYKALSILLRSTKIKDRNEALDQLDQIDSSWSYNTDKSQV
                     SGILLVIDSICAAIDIEKTLYLKSLLVNNANRTVDTRLERSSNSIRRILSALFKLSNV
                     LPKIKTKHYQSFLGGIMDCSLSQLDSGDSIIVLPVALNSFKSLAFLLELYPFRNHLNV
                     EFLDSVLSFILKCLHLLDSTKLEASRTALNERLIRELLVSLCLLINPEDSSNLSIFTN
                     NDHIFSIINSVHFYYSNYFVHTRRASYTIVLIFQIINKLLTNTSIVNIKYCHQLYKLG
                     VSYLNHTEYFNIDSLKDQLVIFLNLIPDFIDLSHFPKLIGDDWNFRSHDLNELNLPDS
                     SLSLFASAENSEPVDPITNSNSGELTQLVIRLLRLLGENTEFQLNVQNIGLFLFPSEQ
                     LNWFALNHIYLDSSSSPKGWLLASGVVEILNRMYRSNDSVSQSISRSNILHPPARKRR
                     KTSQPDTLENILHAAETVEELLLSMITSNETSTILLGLQLCSFHLEKNVNYPESMHDS
                     RRTVSGMSILPPLLRVLEIQIPSLSFWSLLCIRSLLSHERRCEDPGDTFTDRNTVYQL
                     VKYSLESLKEVSTVRISSLVLSELIYLSSKTSMNQKFIDTWSFDENIIALFEGMIDIS
                     EFNGPSIVSKESLFFWLQVSELESKLIKSLKSSSRTRLTLKIQLWLFSKWNTFSWSIQ
                     EEDYPLLVDFISWLATPIAISIISSPITVRNRTFAAYMDLKVAYAPLTSFILNQTVSQ
                     KAASQTFEYTTSQLSQNLEQIDLLFTSLFKKIDDMRSSSENYSFELCLLLRLRERIEG
                     NSNTVNYLSSIEYKVNDILSKQLAKIETEREEFFFELFKLVNQGCINNDSIHFIVQKV
                     DVDDLLADCINYLNSPSRNSTPEVLNEELNLDHSFGEDDFDDLPHKDLASKVRWDVVQ
                     LKETPENRMINFFLQALTFDDSFHKILMILQELTSKESLLIGCSCVVAVLEKESRFVR
                     DLSPPALSKFVRLFAGKLLTNYSTERLESTIVTGCKLLRSLSEVWLGGSLEQDCTDIC
                     NFFIRLQQTHLISTEMALIEVGNLYLHLAELGLDAASSGNGYGVVRFLELFTSYDNNF
                     FKISISNGLRSLLTKLPYRDQQDYYEKLEKVFGTPQETVEKSATFCLFLTSLSLSSDD
                     ILAQVLHSLLGLSSFAHVKCYLPSSFKLISNLGNESSIKHLFSKINLKMFKLWVEKGI
                     SFKKVPFDLLGFKSFNEFLRTNRKEVAAVYLSKDRIQDLTELINTSGTCIPDIVGESF
                     PLSIALSFTSGGVRDEIFSTLRKLLGNDKRLTEEIKLHLVFVIWQVLKFTDFSDLSRI
                     GDMLGKPNHVFLTISTGLRILPDPVISSKTSLHFFKAIIEKYYQTQDLFWTGPVIFFL
                     LRRCLVQIELTDNIIKKKHFIQKIMFLVLIAPASFGFKHIIELLISLSPLLVVKETHE
                     QVSLLIVEVLKESSSAAVSLIPIAYALLWKSQHRHPSDYWVQYLTQLTEEESELTIKA
                     NVYERCLNVLKDQPFKLDASFLEELLLFSETFEQKPLKNAIVLLVSLMMDFTNQTSFA
                     LDIEVLDNQLISMLTGINDTDIYSNAFNLWRARILGHYYLTTGQIATMSSIELDSKLL
                     EDTSNIFPKATDRFDLLVAELLQNSDPASNLEKSHYESVIGALLLTTNFDSKHLRSML
                     NFDTLKKSKEYILPLHYHTCLLASSEVETYGKSFFKKKISEFHISAVSNSSLVSGQWI
                     SDVCMAIINEISDSIPVIKLFAILVHNSPHIVSKIFLPLVLFYVATSKEAIHHMHVII
                     DQFFQIKKETLSSDSINLILELILLIRVGFYKKIKAMEKLYRGMNFPVIIKLAQYARK
                     PKISLVLFEDYHTNMSPAEFSLGNHSPFLRILYHDVDEADILRGLPVKTNIDYAVDML
                     SQSTEDRWKNMVFDIANFDVSFIRKSKTGQTNRLAHTMLSDGMTSLSKLTGEYLSESK
                     QDSVAGTQILEDQYCWSWRLSQWDVPVPQELDTIDKSIFKLLKEINERPNELRLICED
                     SLRKCLVDKPKFIRKTIFKKQNLKSWFNCLAVIRSIEELDRLNDSNLAKELNHYSSNT
                     KWLDNADVEQSDHLLLGRKTALELLVGSKRLSTTNLKLSMLAELARYFNLAKKEGEIQ
                     KSVFASTFMDSISRDFPNEADSSVITFVKDISKFYLAASFWQLQQSSFSVTALKEIID
                     NQKVLPHISSFSFKLLEKPRPLLQSILIEWMSVSRQDTAASIMKDMVTPMLQTSLDDV
                     EPIDRAQIYHVIANFCDKQLLTKSIDESISKMEKYYKQQKKELNDLSEFVHNKGNDKE
                     ERKEATRVYKRIEKQFKANYKEYEAISKSRRRYIETSIMFYLKTISVHDCYDNTDVDR
                     FCGLWLEHSSDDKLNKVIHRKLMDVPLYKFITWINQLMSRLLDEDSNFQRNLKTLILE
                     LSYMHPFHTLYMLKSLRLNDFSNDLSVTSRNEAANKVWEKLQLRDTGFNHRILSKLDE
                     FCDKAVALAGLKLGKVTEISLRSITNGRWWTSTLPQLDVTPPTCTIPIKKDGQYRVSE
                     MVTISSVEEVIKVARSGISLPKIMNIKLSNGKSHKILLKGGTDDLRQDAIMEQVFAKV
                     NSLFARDKNTRKRNLNIRTYKVVPLGPQSGIIEFVDNSIALNDILRKLHSQSDTLSFE
                     EARLKMKEVQDQSNEERLIVYQEICKNVHPVLRNFFFSTFLNPETWFSTRMNYTHGIS
                     STSITGHVLGLGDRHNNNILLDLFSGDPIHIDLGVAFDQGKLLPLPETVPFRLTRDIV
                     DGFGITGVQGCFQTSAEHCFQVLREHSENIKSILDVLRYDPLYSWSVSPIRRHRIQEM
                     ENIEAAVKAQRDGSEAQIAIEGVLRKLFADGLSTEAVVRELIQEATDPANLSLLYLGW
                     CPFY"
     gene            complement(<266471..>267147)
                     /locus_tag="PAS_chr1-3_0300"
                     /db_xref="GeneID:8197611"
     mRNA            complement(join(<266471..266842,267106..>267147))
                     /locus_tag="PAS_chr1-3_0300"
                     /product="60S ribosomal protein L23"
                     /transcript_id="XM_002489439.1"
                     /db_xref="GeneID:8197611"
     CDS             complement(join(266471..266842,267106..267147))
                     /locus_tag="PAS_chr1-3_0300"
                     /codon_start=1
                     /product="60S ribosomal protein L23"
                     /protein_id="XP_002489484.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0300"
                     /db_xref="EnsemblGenomes-Tr:CAY67203"
                     /db_xref="GeneID:8197611"
                     /db_xref="GOA:C4QVD0"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:C4QVD0"
                     /translation="MSGSGASGNKFRMSLGLPVGAIINCADNSGARNLYILAVKGVGA
                     RLNRLPAASVGDMVMATVKKGKPELRKKVMPAIVIRQSKTWRRKDGVFLYFEDNAGVI
                     VNPKGEMKGSAITGPVGKECADLWPRIASNSGVVV"
     gene            <267473..>268054
                     /locus_tag="PAS_chr1-3_0144"
                     /db_xref="GeneID:8196829"
     mRNA            <267473..>268054
                     /locus_tag="PAS_chr1-3_0144"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489440.1"
                     /db_xref="GeneID:8196829"
     CDS             267473..268054
                     /locus_tag="PAS_chr1-3_0144"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489485.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0144"
                     /db_xref="EnsemblGenomes-Tr:CAY67204"
                     /db_xref="GeneID:8196829"
                     /db_xref="GOA:C4QVD1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:C4QVD1"
                     /translation="MNAQEDSLFTPVEDSDQEFITPIDGSSSPLSDVVDTGSEQEENQ
                     QIVINDDEQRDRTNKRKHSVLEVPDGSDTEVSSGDEIEEEEEEEEEDVIVLGSDGEKD
                     PAANKSTIELLEASAKRKDNQKLFKMTECPICFDAINEAVVTPCGHIFCANCIYRAMA
                     SSKPNNAQSQQGHCSLCRKVMSWNGLVHLKMRR"
     gene            <268252..>268911
                     /locus_tag="PAS_chr1-3_0145"
                     /db_xref="GeneID:8197612"
     mRNA            <268252..>268911
                     /locus_tag="PAS_chr1-3_0145"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489441.1"
                     /db_xref="GeneID:8197612"
     CDS             268252..268911
                     /locus_tag="PAS_chr1-3_0145"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489486.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0145"
                     /db_xref="EnsemblGenomes-Tr:CAY67205"
                     /db_xref="GeneID:8197612"
                     /db_xref="UniProtKB/TrEMBL:C4QVD2"
                     /translation="MNICDPTHAENNNQFEDAAVITIDKSPVEIRNHSLTTGSNAKLM
                     SNVGSGLCQYRTVTLGKFRGTFDDRGKRCHRNHEWSKLCRLCVNLPIKPSSLSYCTEK
                     SIVENEPFQTHISHGSTIRVRPNRNRKKSTNELPDINHILSSWGKLTWSLGNRCDAED
                     ALSGSTSSPSTTRRRLRLHVNNTCSSYLTLFNDSIPADSTCSSSLRKFRIFRRSISNG
                     Y"
     gene            <269012..>270202
                     /locus_tag="PAS_chr1-3_0146"
                     /db_xref="GeneID:8197613"
     mRNA            <269012..>270202
                     /locus_tag="PAS_chr1-3_0146"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489442.1"
                     /db_xref="GeneID:8197613"
     CDS             269012..270202
                     /locus_tag="PAS_chr1-3_0146"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489487.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0146"
                     /db_xref="EnsemblGenomes-Tr:CAY67206"
                     /db_xref="GeneID:8197613"
                     /db_xref="UniProtKB/TrEMBL:C4QVD3"
                     /translation="MNSDFDSVVSGSDDAEQCVFIGDSKSDSDSTYSSLNFSGDHPTK
                     TLTEVLALEYQRNMLRLFQLRRHVNKAILEDFNLEFHPEVVNCTDKHLLPDMVFEILK
                     QANDEFVRREYRSKSSAGQVFNKSSLFFVDVNSIANLEIKFTVIDHFNTEVHTYLDRL
                     FGAKITRDSLAVFNQKIDVFIQHHTKLLSAYEIVISSDQNRGLYIPTIPNRHPPKPPG
                     PFIINGSQSPGPNRTPTKAADKSPNKSPNKSPTKSPQVSSKFQFLKLSKHSRTNSADL
                     HISSPIMTRELRNKSTPKKSTSYTALGDTLYPKCINELYITIHTLTKHYEILRALFPD
                     SDLVVYGETSEYLKFQQIKMLLRFTSRCLMKFIVTDFGFLLAQFLETLDSYIATLVVP
                     GSNV"
     gene            <270532..>273357
                     /locus_tag="PAS_chr1-3_0147"
                     /db_xref="GeneID:8197614"
     mRNA            <270532..>273357
                     /locus_tag="PAS_chr1-3_0147"
                     /product="Protein implicated in polar growth, functionally
                     redundant with Boi1p"
                     /transcript_id="XM_002489443.1"
                     /db_xref="GeneID:8197614"
     CDS             270532..273357
                     /locus_tag="PAS_chr1-3_0147"
                     /codon_start=1
                     /product="Protein implicated in polar growth, functionally
                     redundant with Boi1p"
                     /protein_id="XP_002489488.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0147"
                     /db_xref="EnsemblGenomes-Tr:CAY67207"
                     /db_xref="GeneID:8197614"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:C4QVD4"
                     /translation="MYSSRISSPNTPVQVPENGTVVGQLYQVIKDFNARLGDELTLTR
                     GEQVEVISDDSEYNDGWYLGKNLSTGQVGLYPKDFTKIIQNDSHRPSLLRSRSRKMQS
                     SNNSSFTSTPNFQPFPKFPKASGTPNSGGNSVSQELDSVSELQNMSQGSEDYTSTTVN
                     GSGLEQRQSSVKKTMNDIDRALEELTAEKASTPKFSSSPLNNKLNPLDVEQWTPEDVT
                     TYFSSLNFDVQSAGQFARHKINGSILLQLELSYLKELDIQSFGTRFEIFKEIEELRRL
                     QKNSRNIRTPQPETPRHDQNSHPFTPYHERKRSQSMDQAFATPNYPLKSVSIAPPPIS
                     PPKLPHSAESSTPESPGGDFTSPRRAPEPPIEPPQVAYRSYQFGANPATPNNTQTPPL
                     LPHQRKFSHSRAASSLYTFETNHQRNVSSVSQRSQLQTPGSRVHSRNPSESQRRKSSV
                     DVKDKAHRRYSSVFSFMSNNASTPHLNPDNEPVSKRSSLINALTSPSKISLLRYKEAK
                     GKKNGADDLTTFSDANDDSNSADTSVLELKSPKINRRSVSAKESSNNSASITSDLEKE
                     STKRTVSDVRPKPLTKTLTYRKKSQTSAFQEGIRMVTPQEASKTADFSGWMSKKGSLG
                     QWKHRYFTLHHTRLSYFSSLKDTQEKGLIDITSHKVLPSKETDDSFSALYAATTGKGN
                     YFFKLVPPAPGSRKGLTFTQQKIHYFALETRDELRKWMAALMKATIELDESIPVISSC
                     ATPTVSLDKAQEILARNREYAMLKDMELEKEGKALDEREGTPNSKAQDKAGENSSLKT
                     DDNLDDFGFITLSPVDPSLGSLTVDDSAKGLNDSKEALRNSGPDVDSVNTSTESPLIT
                     KPKMRISTTSPMATGALISPKSVQGSFDSDVSSPRTHSLRQNGRATPTVTMLEPPVIP
                     GLDKKEKNGSGMLSGVRRVVSNKRFNK"
     gene            complement(<273407..>275488)
                     /locus_tag="PAS_chr1-3_0148"
                     /db_xref="GeneID:8197615"
     mRNA            complement(<273407..>275488)
                     /locus_tag="PAS_chr1-3_0148"
                     /product="Subunit of the Anaphase-Promoting
                     Complex/Cyclosome (APC/C)"
                     /transcript_id="XM_002489444.1"
                     /db_xref="GeneID:8197615"
     CDS             complement(273407..275488)
                     /locus_tag="PAS_chr1-3_0148"
                     /codon_start=1
                     /product="Subunit of the Anaphase-Promoting
                     Complex/Cyclosome (APC/C)"
                     /protein_id="XP_002489489.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0148"
                     /db_xref="EnsemblGenomes-Tr:CAY67208"
                     /db_xref="GeneID:8197615"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C4QVD5"
                     /translation="MSVQEYNIQKLRGIVYNCLDNEQLDSAQLNVEILCAQNPANLDS
                     IHLHGLVLYRRGLYKSAYNLTANKMHMGCAYVFALCALKLEHPQEGIYVLQKILDTIR
                     EEGISEESMESNLGKNENQRSVLPDIPSFYNLLGKLYASMDDDVNTVVCYSKALELNP
                     FLFEAFEQLSKLGAKIKIGKVYKPTSTFSMNPPAGSELFESIAPDTSVELKQPEDSKP
                     KGRSLFGRSNIMGTPEFSKNKVKNLTTPKVRELKLPEAPTRKTRSSVTSDAFKPPPAN
                     TSSSFPRRSNRLSASKVTSRLLMQPISGLGTPSTYDNDNTTHMDSIKTNKDSWLKRSY
                     NFSNMPPAPNNNSDFRNFNEVTSENELIVLYGRIARAYKAFCQYDCFKAIRLFTSLPE
                     HVVDMPWVLAKLGRLHFEIVNYEQSEFYFQKLRQIDRTRVEDMEYYSTLLWHLHKESE
                     LSYLSHELYQIDKYAPQTWVTIGNLFSLNRDNEEAVRCFQKATQLDQNFAYAYTLQGH
                     EHVANDSFENAFESFRYALSIDKRHYNALYGLGMVHLKLGDFTKAEFHFRKAIDINPV
                     NVILTCCVGMVLEKLGKRELSLKQYDFACKLQPLSMLALFKKAQVLLALQQYDLALKD
                     FEKLQKLAPDEASVHFLLGELYKQLGRKSDAIKQLTIALNLDPKGSHVVKESLEGIQT
                     IDTIDEEMNDH"
     gene            complement(<275739..>276616)
                     /locus_tag="PAS_chr1-3_0149"
                     /db_xref="GeneID:8197616"
     mRNA            complement(join(<275739..276101,276158..>276616))
                     /locus_tag="PAS_chr1-3_0149"
                     /product="Transmembrane osmosensor"
                     /transcript_id="XM_002489445.1"
                     /db_xref="GeneID:8197616"
     CDS             complement(join(275739..276101,276158..276616))
                     /locus_tag="PAS_chr1-3_0149"
                     /codon_start=1
                     /product="Transmembrane osmosensor"
                     /protein_id="XP_002489490.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0149"
                     /db_xref="EnsemblGenomes-Tr:CAY67209"
                     /db_xref="GeneID:8197616"
                     /db_xref="GOA:C4QVD6"
                     /db_xref="InterPro:IPR001452"
                     /translation="MSCSFQLSLVPSPPNLKMSIRNIINDPFATGSLSLAAMSWIITF
                     ISSIVADVQGSFPKLTWWGIVFELFVILFLAVLYIVDDIQPHRLSIVGFLAIATVYTT
                     NSANSLVYSNTSAKNCAAAGSILLSMINLIWLFYYGTDIANSVLVARVFGKQGSNPFT
                     TPQPNRTYTPNDINNTNTNYMSSGQLTGLEKGVDSNAYGNHDDSDDELSADDHYPITV
                     RALYNYDANPEDINELSLKQGEVFKVKDTAGKWWQAKKQSGELGICPSNYVETLH"
     gene            <276804..>282331
                     /locus_tag="PAS_chr1-3_0150"
                     /db_xref="GeneID:8197617"
     mRNA            join(<276804..279923,280016..>282331)
                     /locus_tag="PAS_chr1-3_0150"
                     /product="Ubiquitin-protein ligase (E3)"
                     /transcript_id="XM_002489446.1"
                     /db_xref="GeneID:8197617"
     CDS             join(276804..279923,280016..282331)
                     /locus_tag="PAS_chr1-3_0150"
                     /codon_start=1
                     /product="Ubiquitin-protein ligase (E3)"
                     /protein_id="XP_002489491.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0150"
                     /db_xref="EnsemblGenomes-Tr:CAY67210"
                     /db_xref="GeneID:8197617"
                     /db_xref="GOA:C4QVD7"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="InterPro:IPR003769"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013993"
                     /db_xref="InterPro:IPR014719"
                     /db_xref="UniProtKB/TrEMBL:C4QVD7"
                     /translation="MSLSDPEDSLRRLLVSLPSNVKYDAESSVLKSRLNLALYFSLTK
                     RGEYLGSLVTDLPMDLPSSYSEILEAEDDSYSRLAESMYKCPNYKHHGRPCARQFKQG
                     EPIYRCYECGFDETCVMCMHCFNREQHRDHEVSISIASSSNDGICDCGDPQAWNIELH
                     CQSELEQDDHSSSEVNPDFKSAIRETMDIILDYILDCTIHSASMLPAVQDMMKEDPSD
                     YEMAIQYASDSSSLPIERYGVEDTNVQSWNVVLWNDEFHNYDEAIDCIQQVSRCSLSK
                     GQADAQKINDFGFSIIRRSESLPLLIERCAKVEESGFTITILSDRDVTRLIIIDTIFD
                     WLLTLLEISRPEIQTAIRESLCESLLEEFHADIHEGDFFYREDEYSDTRGLLDFKNRI
                     PAPLVEDVMNELSIDDLKNRKLSSFLNEQPSALVGSRVQYFFYMDLRFWKKARKSLKL
                     LTTSVLVSNLEYKKTFSEQFVKIYSHLLILMAKEDREWLLSNAGNAVVQLFTCPKTSL
                     HLLQPQYFRSIIVPIILLFESYTGNHLLWKRPYQLLSRKKGLKFGLMRSLTDLVTLIT
                     TAHQSEEHLVLFQGKNFIYIIMLFRMFQSALTLVRKEGEHITRESTEFLTYLQISYYL
                     NDVIKGIVEIAQVPEIRKPEHWKVVETNIQILATLISSEPYKFHMVHEKQLIDHDVTK
                     KPTSLINPLNGLLSNMLTTVRANSFSFLTRQVSQINFWSINPEVSFSDDLDYLKLSSK
                     SLEAITLSSQIKIGHWIRNGSMTSKQAQLYCTRFTQYGYIADVHLNQLAILEERDDDR
                     LLLNILDRFNLIDWFYNDQDVLGTVFEERSFYLMNELVKFLYNMFSHRVNFQFESNFT
                     EKTQYEVTQYILYTLCKGSLSFSDLTADFPISVEVTVFDKILDEVAVYEEPKTMNDSG
                     KYSIKKSYYKKMDPMSIYVDSGDFDDVSTAIVKELSILGKIKEENVVIEPQISGPNES
                     NSRVLSRLKRFFISKSVVKLFYKLLQSALSESNETYVIELLHLIQAVLLDEHELYRIE
                     DPVQYFIQIPRDESIIDSLVDSFGEKHIENFKKSKGSQVLETKRAKQKRLAKERQEKI
                     KSRFAKQQKSFMKQNLDAKKSAEHVTTHLSKDNEGLGSSSQDSFHECILCQRAQEGNE
                     MFGIPAYVEKVSTFWDFQPKDESTYTERCLTTIENQMKQLHEETDANNEVREHLYYQK
                     DTPVKSMAPISSRHIVKSCGHHMHYKCFSELLENSRKFSTCPLCRSAINAFVPQFAMK
                     NDASPAFQEAASNISHFEKLNLNQIVSKYLLNDSFLKFIAEESKDQFMYLNEFKDILK
                     DAPDASDHMLSEGLFPSFLAMSTLLGNTLANTEIRLRLSPEKIPQKGNLKRKDSELIT
                     SLLQCVSVISILLKQSYPEEQYLSPFLNKPNSLIIDFAISLLLGKEDSLQETIVGIYK
                     QTILHSLNLLLTNVGDNEHFRRMLSGANSIINDSELAIFKKFVSTATFTSDVSFITCN
                     EQLLVGLYILLEKTTTVYLKQLFLIISMCRPLDLCLNRDYENSNDYDHYLFGQLCKFF
                     NLSSIISYLGSGIPGGNLLEEQNDLILKGQSTLPSTIEYPGLVYLVNLPRELNTFTFS
                     KYDTQDAVNLNFSVCLTCGKRVKHSGDSENEIENFPGYNGVPLTLFHHHKNCPFSGYG
                     EAQCIFLTPKLNKLTALLKIQPPRGISDRSLYHSTFAFPLSSPYLTTHGESHSGHGGL
                     IRKAFLNRDRFRNLNELWLDGELALYISRSLGDSQIVAEPINPVMITMPGGIQEALNL
                     AFTTFLGDQEPGDDDLEDYEYDILLNR"
     gene            complement(<282388..>285638)
                     /locus_tag="PAS_chr1-3_0151"
                     /db_xref="GeneID:8197618"
     mRNA            complement(join(<282388..284993,285056..>285638))
                     /locus_tag="PAS_chr1-3_0151"
                     /product="Nucleolar protein required for normal metabolism
                     of the rRNA primary transcript"
                     /transcript_id="XM_002489447.1"
                     /db_xref="GeneID:8197618"
     CDS             complement(join(282388..284993,285056..285638))
                     /locus_tag="PAS_chr1-3_0151"
                     /codon_start=1
                     /product="Nucleolar protein required for normal metabolism
                     of the rRNA primary transcript"
                     /protein_id="XP_002489492.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0151"
                     /db_xref="EnsemblGenomes-Tr:CAY67211"
                     /db_xref="GeneID:8197618"
                     /db_xref="InterPro:IPR018849"
                     /db_xref="UniProtKB/TrEMBL:C4QVD8"
                     /translation="MNGKLTTSDAVTRYLRGRNTTVEEIIDVSTKLINNELPVYLPDK
                     ETFIFKLLCDRLNDPKNEKFHYNWRVWKLFHEIYYQLSDNKNLLRNLKASEVLSKVAE
                     DIVEKTILDKELIDQVFDVFELLLNELFIGSRNAVKILKYFISLCLISMNEDHQYTVF
                     RYYSSLRTKTEDKVAGEIFKSSFENLLRLYSISQAFVEQITTDNSDNRQTVNEGVIFF
                     GSLLVDKLSKNTKDMQDLNELYSSMIRYYSTQEMRVQMLEELIKRNRTLEPYVLDMLV
                     LDSIATKSFILIETICKLNPLVVMNRTADIFSCYRLNDNVSSLNKTLTLAFVNANELD
                     RFIRIWSLQATSGVAEKSFLDSSLMQDIADNIHTLSFFQLNALIDHLLDAKRIVPLTV
                     VAKGMCFIITNRLYDMTIVNQFISHANKLKPKFDVLFTAKWLTDPSIWELRYTLLCLY
                     DADLKVDFKSLIHCKDRNEYYFYTCFKAIEIDPSIENPKIFSRYLKWLSKELKSKSAF
                     NSSLVSFISFRWIKIIEICFSNSQIKKLLAILLKGNCFFEAHPFFFEQERILDIIFEY
                     FCASSLENPEVFIEFFESAPIQVFSKQNRIDILKVLNDLCINGSDKLKILSINLAVKL
                     LKYSIIESPFSDLSNLKVLFKKFAQFPAEALSLVSSLCSNQTSEFTESLSSFLLKQNL
                     HDESLMFKVSHTVLINSKDSASQKLNAKFIEVARSDIVRYAKYLVDLPLPSNEFSKLK
                     KLIIEGSKGVDPADPRLLDLLKLSIRINCFRPIHILALYLNVGTESFDLTEWVSSLDD
                     EAFFYCFDLVIKSLGEKNDKYPLLINLLQTFIDNSNESPIVPTLLSRSLSSFISQYDP
                     NEEESNLIFLNAIQKSLVGSNKVFTAYLIEQLLVLLNRVYSSLENGSSMVFVKASDIF
                     SFILIYHRSKLYRRDHLLLTTVICQLKCLFKQTSQSSAVAFERVVTNLCQPPNKLSGT
                     QSLVIHSDRVKEAIRPYLPVLVLNYVSLKIKDPMNFTTQERKQKLESAMFIVLQTLKE
                     EELQVINSSLDESGRVIFKSLYDTFRKDHSFD"
     gene            <286111..>286944
                     /locus_tag="PAS_chr1-3_0152"
                     /db_xref="GeneID:8197619"
     mRNA            <286111..>286944
                     /locus_tag="PAS_chr1-3_0152"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489448.1"
                     /db_xref="GeneID:8197619"
     CDS             286111..286944
                     /locus_tag="PAS_chr1-3_0152"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489493.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0152"
                     /db_xref="EnsemblGenomes-Tr:CAY67212"
                     /db_xref="GeneID:8197619"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C4QVD9"
                     /translation="MSYLIISFDSSTNIDDEVSITGSFNHWSEKLPLKRDNKHWEIHL
                     DPKGVTEPLVFKFIIKSPDGSENWCCSDMYQKVTDESGNENNVVDDLERLQTKDPSTA
                     RTVEEEQEEKVDGHSGEQIVDAKNEKANKPVDSESEYENDQSSVHNNTVQSTVDNKAE
                     EFNPFIDEDFQLHPTSPHNSSSSNTASNRLPHQNISNMVHISSIKNGTTTNDHDQESP
                     SESQNPPKTVAKVFYAFPWFFKFLFLRLFGYSNNYFSVRRFVGQLFGFIHKPSENNNS
                     D"
     gene            complement(<287291..>288897)
                     /locus_tag="PAS_chr1-3_0153"
                     /db_xref="GeneID:8197620"
     mRNA            complement(join(<287291..288582,288663..>288897))
                     /locus_tag="PAS_chr1-3_0153"
                     /product="Plasma membrane pyridoxine (vitamin B6)
                     transporter"
                     /transcript_id="XM_002489449.1"
                     /db_xref="GeneID:8197620"
     CDS             complement(join(287291..288582,288663..288897))
                     /locus_tag="PAS_chr1-3_0153"
                     /codon_start=1
                     /product="Plasma membrane pyridoxine (vitamin B6)
                     transporter"
                     /protein_id="XP_002489494.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0153"
                     /db_xref="EnsemblGenomes-Tr:CAY67213"
                     /db_xref="GeneID:8197620"
                     /db_xref="GOA:C4QVE0"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:C4QVE0"
                     /translation="MEKKASSDLELETDSKISETEKRGPVSKLLNGLNYVSKKLDSFG
                     GESTGIERVSPDQRRTNMTRIIIHVMGLWLSGCGVSCTLGCLLAAYCSTMGPRSGLRQ
                     IVSARLFFGPWAVRFPALISAIGFVGWSVTNCVLGGQILYSVSNDKLPIEIGIVIISM
                     ISLVIAIFGIRILLHTETLISIPVFTVLILLYIIGSNEYPNYLNTVSIGDTMTIRGNF
                     LSFFALGFSVTATWGGCASDYYTLLPENTNQLFVFFMTFFAIWIPSFTGAVLSILLGN
                     AATVHEPWLEAYTNNSLGGLLHEIFSRWNGFGMFLLVIFFLSLITNNIINTYSGALEL
                     QLIGGPLSYFPRWFLSVVMVVIFMVCSLAGRDQFATILSNFLPMLGYWISIYFTLLLE
                     ENVIFRSNKTLIKLYQYEFSTIPGEKQDLLEGKSRPYYNFDIYLSRDRLTHGFASSLA
                     FCFGVVGAICGMCQVYYIGPIASKIGSHGADLGMWLAIGFTAVTYPVFRYIELKKFGR
                     "
     gene            <290046..>291266
                     /locus_tag="PAS_chr1-3_0154"
                     /db_xref="GeneID:8197621"
     mRNA            <290046..>291266
                     /locus_tag="PAS_chr1-3_0154"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489450.1"
                     /db_xref="GeneID:8197621"
     CDS             290046..291266
                     /locus_tag="PAS_chr1-3_0154"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489495.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0154"
                     /db_xref="EnsemblGenomes-Tr:CAY67214"
                     /db_xref="GeneID:8197621"
                     /db_xref="GOA:C4QVE1"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4QVE1"
                     /translation="MDFSKDLKQLLSKSSRSRSLSTFAVVAESQDKQPPLSLKFGEPA
                     YSLYPMTSIEISRNQGTIKVPQLSKDKTSISKDMGYTAFKGTSELLDRITSFVAHCFP
                     PKYKNWSPIVTTDHCNSIAKILESFVDESDVILVDTQLDLDVAHLLSVCKPNIHFINL
                     NQIYGSEPNATKLSKLLENWRRFYPYKNHPKLLLTATYGLTGIPQSDTTMKEVLKFAD
                     IYNFMVVETSTFPEGVSYLKHDSKGRVISAQSFRHFNLDLAFIIAHDTIVTAIESYAE
                     FTTTSPSGMSQIIANGVLSSMNDWKGWQESLREISLYYKHRRKQVQDTLQDVVHIKGC
                     LGNYCGIICKDDASKFAENGMHLTQGQELNEYFSSLFQQKYTIVPDDLLLISLSYNIP
                     EEEFSEALKKMEGY"
     gene            complement(<291287..>292912)
                     /locus_tag="PAS_chr1-3_0155"
                     /db_xref="GeneID:8197622"
     mRNA            complement(<291287..>292912)
                     /locus_tag="PAS_chr1-3_0155"
                     /product="Putative RNA binding protein"
                     /transcript_id="XM_002489451.1"
                     /db_xref="GeneID:8197622"
     CDS             complement(291287..292912)
                     /locus_tag="PAS_chr1-3_0155"
                     /codon_start=1
                     /product="Putative RNA binding protein"
                     /protein_id="XP_002489496.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0155"
                     /db_xref="EnsemblGenomes-Tr:CAY67215"
                     /db_xref="GeneID:8197622"
                     /db_xref="GOA:C4QVE2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QVE2"
                     /translation="MSFFPPQFQKTNNSQDSTGRESFDLNGQFDYPEPHNLNVESGIL
                     GRSVPQFGSVAEQDIYHGSPLDLANSMEALSLDKSGPQHFNGGFSRPINGSADSLAAP
                     SRTVYLGNVPTDLTPKELLDHVRSGVIESCKILPEKNCAFISFLDENSAMLFHSDAIL
                     KRLTIKQNDIRIGWGNQTDLHPIVHEAVSKHNATRNVYLGHLPPDITIDEIYTDLYIY
                     GEIEVIKVISEKRIAFVHFTSILSAVRAVQNLPLKNPKYATRKVFYGKDRCAFITKTQ
                     QHNAAQYLGLDPNLENYFLNNVDPDFISTALVQQSNAAAAIATQAGGVNNLGNRTVYL
                     GSLQPDVTVEEVCNVVRGGILEKVRLIYEKYACFITFIDPIAAAQFFAMSSLHGLIIR
                     NRKVKIGWGKHSGPLPNALTLAVSNGASRNLYIGGLDLDDNGEVCEGEPIKTENGPST
                     SKKVIECAKKLRADFEVFGEIEQINFFVEKGCAFVNFSNISNAIKAIDGIKYNKDYEG
                     LKINFGKDRCGNIPKQFNNNHNIATNDFRRMDN"
     gene            complement(<293568..>294752)
                     /locus_tag="PAS_chr1-3_0301"
                     /db_xref="GeneID:8197623"
     mRNA            complement(<293568..>294752)
                     /locus_tag="PAS_chr1-3_0301"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489452.1"
                     /db_xref="GeneID:8197623"
     CDS             complement(293568..294752)
                     /locus_tag="PAS_chr1-3_0301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489497.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0301"
                     /db_xref="EnsemblGenomes-Tr:CAY67216"
                     /db_xref="GeneID:8197623"
                     /db_xref="UniProtKB/TrEMBL:C4QVE3"
                     /translation="MIFDRVVTVNAELFKENEPLSYAKEKCYIRFSNFSLQDRWKDVE
                     KKLDQLISTSHPLVTQLESINLKTVQNDILKFIVMNPECDNIDDLLKSDVDNESLYDQ
                     CVKLLYEGMKFHLDIEFTTAEIPLTAQIELKDINFLSSPELKDNIKFLYKILLFGSYD
                     SKGYNLQVHCIISENGKPIKILFKVVESLLVNKPVFSIELPFKEDVEVDLFEFLSIYH
                     ENMLEYQKNTQQLVYLNQLLDLKLQQNELRVKGMKELVDEIKYEQESAFVQLLNEKKE
                     KLRQLGVGDIDDFDSHSWSNRPRKKMNLGLVKQENDTSNQEINQQTDQQKLLVSQGKV
                     DPQTYADVNVKEEPLTQHASEQTRALSLNDNIPHTDTSSSTNASHTDLSESDDQTDVS
                     DG"
     gene            complement(<294882..>295748)
                     /locus_tag="PAS_chr1-3_0156"
                     /db_xref="GeneID:8196830"
     mRNA            complement(<294882..>295748)
                     /locus_tag="PAS_chr1-3_0156"
                     /product="1-acyl-sn-gylcerol-3-phosphate acyltransferase"
                     /transcript_id="XM_002489453.1"
                     /db_xref="GeneID:8196830"
     CDS             complement(294882..295748)
                     /locus_tag="PAS_chr1-3_0156"
                     /codon_start=1
                     /product="1-acyl-sn-gylcerol-3-phosphate acyltransferase"
                     /protein_id="XP_002489498.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0156"
                     /db_xref="EnsemblGenomes-Tr:CAY67217"
                     /db_xref="GeneID:8196830"
                     /db_xref="GOA:C4QVE4"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR004552"
                     /db_xref="UniProtKB/TrEMBL:C4QVE4"
                     /translation="MSSVVYYVKGFFALLALTSCAVYGVIASTVLSLLGKRNLSQWST
                     ARVFYATFSTLFNIKIEVDRPEILEKLPAILVSNHQSELDVFILGKVFPKRCSMTSKK
                     QLKWVPFLGQFMTLSGVFFLDRANKSTAISTLDTALQKLKNEKGALYIFPEGTRSYAL
                     EPKLLPFKKGAFHMAVQGGIPVIPLVASNTSSLYSPKTKTFKSGVIKIKVLDPIETKD
                     LTKDDVADLAQEVYDKMKTAVDLLGYSPTNDQLEAETDVDTETESETGNTYTDTEEDI
                     TVPGETTQLLDK"
     gene            <295970..>296479
                     /locus_tag="PAS_chr1-3_0157"
                     /db_xref="GeneID:8197624"
     mRNA            <295970..>296479
                     /locus_tag="PAS_chr1-3_0157"
                     /product="Subunit of the Dcp1p-Dcp2p decapping enzyme
                     complex"
                     /transcript_id="XM_002489454.1"
                     /db_xref="GeneID:8197624"
     CDS             295970..296479
                     /locus_tag="PAS_chr1-3_0157"
                     /codon_start=1
                     /product="Subunit of the Dcp1p-Dcp2p decapping enzyme
                     complex"
                     /protein_id="XP_002489499.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0157"
                     /db_xref="EnsemblGenomes-Tr:CAY67218"
                     /db_xref="GeneID:8197624"
                     /db_xref="InterPro:IPR010334"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C4QVE5"
                     /translation="MPKEEPITSTEQQQTFDIYRKAMTFNILSRYDPQVNQLLYLSSH
                     CVVYEFIDNDWSKLDYQGTICLYSRKEYEKQSNIQQHSLDTKTIISNNLFQFGIIIFN
                     RNKPENFSIGIIPNKFIANQSDKKLIVEQQNELIIVKDLLGTVYGLWVFDSKDREMIY
                     KMLDYCINQ"
     gene            <296677..>296964
                     /locus_tag="PAS_chr1-3_0158"
                     /db_xref="GeneID:8197625"
     mRNA            join(<296677..296754,296809..>296964)
                     /locus_tag="PAS_chr1-3_0158"
                     /product="Hypothetical protein identified by homology"
                     /transcript_id="XM_002489455.1"
                     /db_xref="GeneID:8197625"
     CDS             join(296677..296754,296809..296964)
                     /locus_tag="PAS_chr1-3_0158"
                     /codon_start=1
                     /product="Hypothetical protein identified by homology"
                     /protein_id="XP_002489500.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0158"
                     /db_xref="EnsemblGenomes-Tr:CAY67219"
                     /db_xref="GeneID:8197625"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:C4QVE6"
                     /translation="MKYSGLQKEVLKLYRSCIRQAYKKPTENQDHWVRFVHEQFDKYR
                     AIPKRDFATIEHLLRTGHRRLEMYSNDNITDVH"
     gene            complement(<297025..>299673)
                     /locus_tag="PAS_chr1-3_0159"
                     /db_xref="GeneID:8197626"
     mRNA            complement(<297025..>299673)
                     /locus_tag="PAS_chr1-3_0159"
                     /product="GTPase-activating protein for the
                     polarity-establishment protein Cdc42p"
                     /transcript_id="XM_002489456.1"
                     /db_xref="GeneID:8197626"
     CDS             complement(297025..299673)
                     /locus_tag="PAS_chr1-3_0159"
                     /codon_start=1
                     /product="GTPase-activating protein for the
                     polarity-establishment protein Cdc42p"
                     /protein_id="XP_002489501.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0159"
                     /db_xref="EnsemblGenomes-Tr:CAY67220"
                     /db_xref="GeneID:8197626"
                     /db_xref="GOA:C4QVE7"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C4QVE7"
                     /translation="MQVLDASHRLDIEVESPFQPDFASPSFALNNSEGSHATKPASSP
                     DLELETGQICKKCGLVITEGHAYELGEDRWHVECFSCSKCSKSLGCDSNFLVLGTGAL
                     VCSDCSYACTICSKKIYDLAILTGNQAYCSSCFQCRACKNRIEDLRYARTSKGLFCIS
                     CHMKLLEKKKRHEQQRKKLMIHTNNSSSSSTKPSADNSNPNSATTADTSVKNKQLPDL
                     PLPASSNYALNPPVKVHPRDSASNVNTILDSLDVETPGDPPQPVPPPFPRLRPNSPPI
                     SQFVDYTFNSPVELNSDEERVLFKTSPSTKQFLQSPDVLEHRKAVLIDDVDSDVHESS
                     PEVEPEPKSEPTSDTDVVPKGLNINTTSKIFKNDTELNLEKSTNQKIFALSSEENVSH
                     EKEKLTTKISRSLSMRSISSSKNKLGFNFHRRTSSKDMDTAAISQLNTPKARQRQFSA
                     SSQRVPSSVSSHNRTASDLMFLKNSSKTELDHLEAQMKRIQNEVNQLTVQKETLQSEI
                     FDLEKNKQSLLVNIDEIKSRFEGLQTSLNESNTAEQPTDTPLETLVEAPITTIIPRQN
                     STIDESSLSDNFNSGSLSTSAPTSNSKNKPKGRFWRMGKSNKKDIPNSTSNYSLSNVF
                     KSNPVLIQSKDPMNEKLNTNPDLTERDNFFTSMIKSTSTNILYNMANSKTENHPNHLF
                     NMSLQERATYEGLEVPIIVTKCIEKVEQSGLSSEGIYRLSGGSSSLERVESCFSSLSL
                     EDITNEKFDRLHESLNGDINTVAGVLKRYLSKLPEPLVTFDLYEEFVNIARLDDKITS
                     LRTLVNKLLPTHRKTLYMLCKHLNNVVQHGNVNLMNVNNIAVVFAATLARSRVVNLEK
                     EMSDISARRNVTETLISHYDQIFQQH"
     gene            <300197..>302074
                     /locus_tag="PAS_chr1-3_0160"
                     /db_xref="GeneID:8197627"
     mRNA            <300197..>302074
                     /locus_tag="PAS_chr1-3_0160"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489457.1"
                     /db_xref="GeneID:8197627"
     CDS             300197..302074
                     /locus_tag="PAS_chr1-3_0160"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489502.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0160"
                     /db_xref="EnsemblGenomes-Tr:CAY67221"
                     /db_xref="GeneID:8197627"
                     /db_xref="InterPro:IPR003846"
                     /db_xref="UniProtKB/TrEMBL:C4QVE8"
                     /translation="MLRSGSLHFKRFTFTFLVASRRNYSSMIRLAEKSKTQSFTKAFP
                     PDERVPEPSIAWDETKWDLTHKPRQLKSGAFSWVLPEKRDQYKLLTVSRPALNDLGLP
                     DSEEHDNEFFRIVSGQAYNDNPTAQEREYPTPYSQCYAGWQFGSFAGQLGDGRVVNLF
                     EIDNHDNTSKYEIQLKGSGKTPFSRFADGKAVVRSSVREYVISESLHALGIPTTRALA
                     IVTLPHTWAQRYAAENCAITTRFAPSWIRIGTFDLYRWRGDRKGMRTLSDFVISDVFG
                     GKEAVLNNFNNQEPEFAKIVKEEWDEEKFGEFSIYDLMYLEIVVRNAKTVSQWQAYGF
                     LNGVLNTDNTSVLGLSIDFGPFAIMDKFDPDFTSNSEDHTLRYSHRNTPGAVFWSLTR
                     LGEDMAELIGAGPTILSDPHFTEEGIKKEWENQIVTRATAVIELAAILFEHIVTKEYG
                     QLLMKRLGLSSYEEADEQLLLDPLRDMLQKTKLDYNNFFVQLQEAYLKEIDNEGIRSL
                     AESITKSNEDNIVEELEKWLQIYVERLNKHGYEDVDLERRNISSKVNPLFLPRNWIFD
                     EVIQKLADDPSDNRYLKKLEKMAFNPFDPLRWGHDLKDTEAKWLSTSDQVSMLQCSCS
                     S"
     gene            complement(<302251..>302719)
                     /locus_tag="PAS_chr1-3_0161"
                     /db_xref="GeneID:8197628"
     mRNA            complement(join(<302251..302641,302712..>302719))
                     /locus_tag="PAS_chr1-3_0161"
                     /product="Type II membrane protein required for vesicular
                     transport"
                     /transcript_id="XM_002489458.1"
                     /db_xref="GeneID:8197628"
     CDS             complement(join(302251..302641,302712..302719))
                     /locus_tag="PAS_chr1-3_0161"
                     /codon_start=1
                     /product="Type II membrane protein required for vesicular
                     transport"
                     /protein_id="XP_002489503.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0161"
                     /db_xref="EnsemblGenomes-Tr:CAY67222"
                     /db_xref="GeneID:8197628"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:C4QVE9"
                     /translation="MSSRYSSNLHQRDNRSSLFETRSASPYDDAPSKKDYKASLLSQL
                     ESQNEDELSSMSEKVLMLKNLGSRMGDEIKNSQLNIDDLHSTMTNTQTRLKNTFKRMM
                     VMAKKTGISWKLWLLFFFLVWLWFFFVWLR"
     gene            <302957..>303757
                     /locus_tag="PAS_chr1-3_0162"
                     /db_xref="GeneID:8197629"
     mRNA            <302957..>303757
                     /locus_tag="PAS_chr1-3_0162"
                     /product="Highly conserved, iron-sulfur cluster binding
                     protein localized in the cytoplasm"
                     /transcript_id="XM_002489459.1"
                     /db_xref="GeneID:8197629"
     CDS             302957..303757
                     /locus_tag="PAS_chr1-3_0162"
                     /codon_start=1
                     /product="Highly conserved, iron-sulfur cluster binding
                     protein localized in the cytoplasm"
                     /protein_id="XP_002489504.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0162"
                     /db_xref="EnsemblGenomes-Tr:CAY67223"
                     /db_xref="GeneID:8197629"
                     /db_xref="GOA:C4QVF0"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028600"
                     /db_xref="UniProtKB/TrEMBL:C4QVF0"
                     /translation="MSAPDSLKNVKHVILILSGKGGVGKSSITTQTALSLVLKGYKVG
                     VLDIDLTGPSIPRMFGLEDAKIHQSTNGWVPARYNKDLSIVSLGFLLGSKDASVVWRG
                     PKKTAMIRQFLKDVTWPDLDYLLIDTPPGTSDEHIAIAEELQFANPEGCIIVTTPQQI
                     SISDVKKEINFCNKVNLRILGLVENMSGFICPHCAECTNIFSSEGGKNLASQLSLKYL
                     GAIPIDPLFVEMIETQKDSSLLDSYENSRLYLESFKPIIDGVLEEIRE"
     gene            complement(<303761..>304339)
                     /locus_tag="PAS_chr1-3_0302"
                     /db_xref="GeneID:8197630"
     mRNA            complement(<303761..>304339)
                     /locus_tag="PAS_chr1-3_0302"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489460.1"
                     /db_xref="GeneID:8197630"
     CDS             complement(303761..304339)
                     /locus_tag="PAS_chr1-3_0302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489505.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0302"
                     /db_xref="EnsemblGenomes-Tr:CAY67224"
                     /db_xref="GeneID:8197630"
                     /db_xref="UniProtKB/TrEMBL:C4QVF1"
                     /translation="MDFSLTQILPSFSEELSQLNNNLGTVFENFSSDINDEIVASTER
                     QQDIIAMTRKLSKTCDKHKNHKLVVSNDKSLMQDLDDIILSITITKSSLDETIRRLNK
                     AQSQLGNDHYLRNSEKLYRYCKENKLITTKEKLQQYEQLERQLGVSTKLRFPLKQKSE
                     STLSLTDNTVLADFEPSQTESSLKKLFIDEAS"
     gene            <304872..>305927
                     /locus_tag="PAS_chr1-3_0163"
                     /db_xref="GeneID:8196831"
     mRNA            <304872..>305927
                     /locus_tag="PAS_chr1-3_0163"
                     /product="Uridine diphosphate-N-acetylglucosamine
                     (UDP-GlcNAc) transporter"
                     /transcript_id="XM_002489461.1"
                     /db_xref="GeneID:8196831"
     CDS             304872..305927
                     /locus_tag="PAS_chr1-3_0163"
                     /codon_start=1
                     /product="Uridine diphosphate-N-acetylglucosamine
                     (UDP-GlcNAc) transporter"
                     /protein_id="XP_002489506.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0163"
                     /db_xref="EnsemblGenomes-Tr:CAY67225"
                     /db_xref="GeneID:8196831"
                     /db_xref="GOA:C4QVF2"
                     /db_xref="InterPro:IPR004689"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:C4QVF2"
                     /translation="MIDISPFLMVFTGCCGNVFSLETLVTKTTYSVGTMVTFCQFLYV
                     ALVSYLFVMLPGEGGKKTDDVLLAGPKKDWYSSWLPESKVPMKRYYVNIFLFFVTNVL
                     NNYVFVFNIGIPVHVVFRSSSVTVTMLIGYCFLGKTYNAKQIWGSVVLSIGVIITMID
                     NQIAQNEAKGVEYTGNFIDWSAIDLHYMFGIFVMTLANVLTCVMALYTETTYKKYGKS
                     TWMVNLFYQHAFALPLFLFVSLNLKREFEHFTSNHGSLLINCLTQFLCVAGVNKTASL
                     YNAVTLSIILMIRKLVSLLISCYFFDNSFNAMGYFGISMVVVGTALYTMGGRSISPPL
                     AANSEKLDLESKGNNQD"
     gene            <306287..>307342
                     /locus_tag="PAS_chr1-3_0164"
                     /db_xref="GeneID:8197631"
     mRNA            <306287..>307342
                     /locus_tag="PAS_chr1-3_0164"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489462.1"
                     /db_xref="GeneID:8197631"
     CDS             306287..307342
                     /locus_tag="PAS_chr1-3_0164"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489507.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0164"
                     /db_xref="EnsemblGenomes-Tr:CAY67226"
                     /db_xref="GeneID:8197631"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:C4QVF3"
                     /translation="MAYFTLPEEYLPDLQDAVNFFISFAPFLSYGTTIYGISQSQSST
                     GFSLDICATMLLSASLRVMYYFNEKYEFTLLRQCIVMLIIQILLLRTALKYRSNTYSC
                     DNLVQMPNYNVIFVHKMQELVAQLSESLINDSEGIPERLDLIWKAWVSTWRLFFVLII
                     YGNFANLFLLFDVSYARPLNFWQWEEQETYWKFLGCFWTTIVSLELLLYKNEQYGNII
                     GALSLLIESLLPLPQILMFYRVKSVRNFKSILLLSWLGGDMTKISYLVFGTNQVSAFF
                     IIAAVFQMSLNIVITCQFIHYKRIEYEYFSAHTLNGLDEVEFPIEMEMRLARTRSMTS
                     SSSSHGVDVRTRSGTVV"
     gene            complement(<307411..>308442)
                     /locus_tag="PAS_chr1-3_0165"
                     /db_xref="GeneID:8197632"
     mRNA            complement(<307411..>308442)
                     /locus_tag="PAS_chr1-3_0165"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489463.1"
                     /db_xref="GeneID:8197632"
     CDS             complement(307411..308442)
                     /locus_tag="PAS_chr1-3_0165"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489508.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0165"
                     /db_xref="EnsemblGenomes-Tr:CAY67227"
                     /db_xref="GeneID:8197632"
                     /db_xref="InterPro:IPR018608"
                     /db_xref="UniProtKB/TrEMBL:C4QVF4"
                     /translation="MALSPTYQGYISTTGDALIVIQAALNNHLNLLPRRPRERERDGL
                     IRSGNVFVFVEQRSHIKRWTDGIPWSPSRVLGKFLLYRELDKDTPKNSQSDEDTEEGR
                     KRRKTSVDVTDPNTRQLVGSLVTSYDFKEDGLIKKTLSLTFQTGANEERETVHLISYY
                     TPEDVTNHRLNRPSDNPYLANITVSESLLTALRESTLGGRATSDDELSLVRSNSLEYQ
                     EVPMNISMSLPLSTPLSLNTGVNSTTQLQQQQLQQQQQQQQQQQQQQQQQQQPVASLP
                     KFDGSFLLQQGVIPVPHFMDQKMGSSNSWINNWFRPNSSESNGLSVIGPHKGYDEQSP
                     ATSYTLNER"
     gene            complement(<309211..>310680)
                     /locus_tag="PAS_chr1-3_0166"
                     /db_xref="GeneID:8197633"
     mRNA            complement(<309211..>310680)
                     /locus_tag="PAS_chr1-3_0166"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489464.1"
                     /db_xref="GeneID:8197633"
     CDS             complement(309211..310680)
                     /locus_tag="PAS_chr1-3_0166"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489509.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0166"
                     /db_xref="EnsemblGenomes-Tr:CAY67228"
                     /db_xref="GeneID:8197633"
                     /db_xref="GOA:C4QVF5"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR018287"
                     /db_xref="InterPro:IPR027328"
                     /db_xref="UniProtKB/TrEMBL:C4QVF5"
                     /translation="MTTIQPLAPRIQNDSKPITKIVTSKEWVLPPRPKPGRKPSVDTP
                     TTKRKAQNRAAQRAFRERRANRVNELEEKLMELEKEKSIKEGILNNEIKKLQRDKNML
                     LRRLEKLEKQIGIEGQTDRLLAGNDGGFDTSPQQQISPAPSSTGNAPSSNAPSPNSGY
                     RPESTPYTVDNSMSDGGSDSPDCGLCMKDDCVCASIGVKEGTTQASSMELFKPMKAVP
                     LKRRRVGDDDGNEVDFTNAFKKTSLFASRENNSFVALSRSQTQAQPQQIQNSSSSNGN
                     NDMFATSSAVDTNIEECGFCSDDTPCVCREVAREQAQLERANKELLAETSLPPIINGR
                     ANSLTSNARQSLPVLHPGPSVSLKTDAPAISRHASNKDLKTLSTVVTALAEGESQNRG
                     SCTGNPGTCSQCQRDPMSTLFCTTIASKDEEKAPLPKIQDNVFIPCSDAYKTLSRHAN
                     FNEVNFNTLIGKLTTKGMLVEAGSVASVLRELDRKFSNA"
     gene            <311162..>313192
                     /locus_tag="PAS_chr1-3_0167"
                     /db_xref="GeneID:8197634"
     mRNA            <311162..>313192
                     /locus_tag="PAS_chr1-3_0167"
                     /product="Protein with a role in 5'-end processing of
                     mitochondrial RNAs"
                     /transcript_id="XM_002489465.1"
                     /db_xref="GeneID:8197634"
     CDS             311162..313192
                     /locus_tag="PAS_chr1-3_0167"
                     /codon_start=1
                     /product="Protein with a role in 5'-end processing of
                     mitochondrial RNAs"
                     /protein_id="XP_002489510.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0167"
                     /db_xref="EnsemblGenomes-Tr:CAY67229"
                     /db_xref="GeneID:8197634"
                     /db_xref="InterPro:IPR013943"
                     /db_xref="UniProtKB/TrEMBL:C4QVF6"
                     /translation="MRVYSTWTTPKRGGPRLKPVSFHPTTFRPSFILKDSGIPLTSIR
                     CGDLSNVRKVPKLAHRLDRVLFQPLNYHFLQDPRSSVYNFNPYLQNLIPLKELNQKLL
                     EGTFVPSEKDKNLLKLCQEHKTNFYTSTSAVTGILSHMHFLLSNMKGINGDVLSKNFK
                     EKRFRFTKGATIPGVVLAMRKDTEGPDCPFSKRRYAIGADHSADNEIVLSLMGHFMER
                     LLVCPPEIYNQFRADSKVPFEKVKETFHGESVYNFSKISNFILRSQLDCQDQRLPNGN
                     KSFDIKTRAVCAVRHDISHVERDEYTGYQIVRAHDQYESFEREFYELMRSTMLKYSLQ
                     ARIGNMDGIFVAYHNIEKVFGFQYLPLEEIDYILHSDTLESTLNTKNDVQDQDKIMGP
                     LGTHTPDLKRILSTKIANTEYKFSMEIINRILCRILNKKSDPNVTLSDNYRIVFKTGK
                     FKKKVYLFVLASPIDEQMVQRIQNVSKEISNTTLDKQIDIEKLLSGDNDSSESPLNED
                     LLKKNYKSFEHRKMVREINQKTSENAFGYRISVDHLFNGKHSKMAHPMPTSLDDDWAL
                     NTYVTSVRPSLAKFLYLKFLKEKEDICWRSLYDNETESEPDSEIYKEDDLSDSNSEIR
                     SEADKMELHLRELAKDTEPSQYQQLLRAFGGKGRLREEKYRQKPPKHIQLVK"
     gene            <313396..>318975
                     /locus_tag="PAS_chr1-3_0168"
                     /db_xref="GeneID:8197635"
     mRNA            <313396..>318975
                     /locus_tag="PAS_chr1-3_0168"
                     /product="Peripheral membrane protein required for vesicle
                     formation"
                     /transcript_id="XM_002489466.1"
                     /db_xref="GeneID:8197635"
     CDS             313396..318975
                     /locus_tag="PAS_chr1-3_0168"
                     /codon_start=1
                     /product="Peripheral membrane protein required for vesicle
                     formation"
                     /protein_id="XP_002489511.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0168"
                     /db_xref="EnsemblGenomes-Tr:CAY67230"
                     /db_xref="GeneID:8197635"
                     /db_xref="GOA:C4QVF7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR015412"
                     /db_xref="InterPro:IPR026849"
                     /db_xref="InterPro:IPR026885"
                     /db_xref="UniProtKB/TrEMBL:C4QVF7"
                     /translation="MAAWMPQNIQKRLLRYVLQQLSLFAEIDLPNLDVSLGTNSKVHL
                     KELQLDPDKVDIPNFYLRNGVVDDMDLTLTLSNGVNIEATGVNLTLAPSMTNGVDFDP
                     GKLSFSLYQSTADLATSVFFVDQDNNELPKTDKELDDEHDSSKNVANDDDSSPLADKE
                     NPKQPSKMGNMMAKAVEMALSRLQVQLKDINLTIITDESTFQICIEEASFDTTDGVRK
                     IEFKGAELSVLKPSVYPGDQPQGESQDDSEDDDSVDESSSFDSHPTDFMSSSFIGSRE
                     ELENSMLNSQSSVYMSATSKLLTKPKHSTRHPSETKPSVTLGHVNEGTLTFEGLQSFE
                     NVSIIIDQIHVAVSPIPESLTALLETLSKRLKILRVHSAKSKTSNTTTYTFSSKDGLQ
                     EEPEFSDQISTSSSTGFKELKINEIVISLNSALGKNGAFAIDNSLCLSIESLELAMVS
                     EGNLSGTLKTLKMNKSETSEVFSFQPGSNYDVRFEMILDDDNDLYNITILCPKPGVFN
                     LNEEVLNHLLSFCSKIPSTLHSLQSYQYQKAKLASLSNPQSNSNNDQENEIYLQTASF
                     EFILQLTSSDKVKLTSFPLSFNSNTGVIEVERIVVERKFKENQVQGDPPSQDRFKMQP
                     HKSTNSGCLTCRKRQVKCDERKPFCLNCEKSEQKCTGFTHLSKDLPSSSSSLSSDDSY
                     KSILLINGLKTYLFKKPKKVKTFDKSGIQCSYLSPNASEIELIELEMTMSDFTSLIDS
                     LELFFEQLKVVNHPKMDIAKEKTVFRTSFNSRNPVRNPRALGSQTGAMFSHSSLVSFL
                     RINSVSFLLKEALNGFGDVSGRIKSINCNFHVKGFQDFFVGSLDVARIHKLSSQLILE
                     KVDAPGNKKPMLIARLKSSSLTIQLADCLAHYYGEWFSFLHQCNMKEREIVKRQEDIG
                     PKDRARDSNNFVISLHLNNIIIELNPVSLKSKAVLFIKKGCGTVTFGSQRLSISSSLT
                     EITPLLIDDTKNLKNEIKLDSKNSHPLGNSFLLLLMDMGYISMGMLSSVSVSFETESS
                     ASLIAPVNVNVMCDTLRLDICADSLQCLLNLIKDLRQPIIVPFEQKYRTQPETPLDAL
                     KDVDFDAFLPQKTKDSNNVAATKTRTFSETALNGAFRPKVYSDGSLEIIDNYYEHESV
                     NQGLDNRTYGDLEVFEENSEDDISLENSLNMKHDHFYHTSFMDNTRNTEHVPFKLNLS
                     VEAVYIRLFDGYDWKETRVSILNAVRRVEAKAAAELSRIEKIRNTKLRRDSSASNSGN
                     EGSLQTDDDSATSGSVSEPVIEETLYQSIHLSLPVGMEPTLLAERVNNDVNFKRASSD
                     SLDKTQSPSSVSSKSQVSSPQTRRLKLKRSTFHKVALELRNLSITFKLLSSFDPTTIK
                     NKSSIRNPNSAEIVNRISVEVDDFLITDNIPTSTWKTFVTYLKEAGSRELNSKMVHLD
                     IATIRPTRLLATTEMRIETNVLPLRLYVDQDTLDFLTRFGEFKDLRFVPQVVDDDDLF
                     VSKLHVFPVRLKLDYKPKTVDYAGIRSGKTSEFMNFFILDEASMVLRDVVLYGVKITK
                     LNPILNGIWTPDITRNQLKGVLSGLASINSVVKISSGFKDLIAIPMEEYRRDGRLITG
                     VRKGAFSFAKTTGNELLKLGVKLVAGTQTILENTEQVLGGEGNLARMPVQVKERKQRR
                     DSDEGNFYVITDRQTYERNLKKTSMNESIIGKTSLREANRFDEEYDDDDDDEDDLVNK
                     IKPHLRNTMLDSQLFLDDNEIEDEYEEQETDESQKTISLYANQPTTMKEGLQLAYQSF
                     GRNIDSAKRAISKASSKVSEDNRTSNIAYEVMKATPVVVLRPIIGTTEAVSKALLGGL
                     NQFDPDNRSKSEDKYKQ"
     gene            complement(<319065..>319877)
                     /locus_tag="PAS_chr1-3_0169"
                     /db_xref="GeneID:8197636"
     mRNA            complement(<319065..>319877)
                     /locus_tag="PAS_chr1-3_0169"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489467.1"
                     /db_xref="GeneID:8197636"
     CDS             complement(319065..319877)
                     /locus_tag="PAS_chr1-3_0169"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489512.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0169"
                     /db_xref="EnsemblGenomes-Tr:CAY67231"
                     /db_xref="GeneID:8197636"
                     /db_xref="UniProtKB/TrEMBL:C4QVF8"
                     /translation="MTQTTPNLKEEVTSKEQLNNPLKTVHHLSQYPLLKQAWEYVVGF
                     AWVGWVWTNVIQLYTILRVNVVDRVPFVASLLNALDSSFEYLVLQTTDRVLPFLTELT
                     YQDLISIPVKNYELLSKRVSTRWEDLKRSVRPALNPVLRPGGDVLSKFVTSPEDYADE
                     VERLYLIASKTYGNIYEKGQIVTSKINSAYQSELSSKDDQKISDKAFAAARTSRKLSN
                     EFYDNFRQTTNTVLEQTKGSVDQLLEKADKGIKDTASTINKSLRSNTVSASA"
     gene            <322529..>323452
                     /locus_tag="PAS_chr1-3_0170"
                     /db_xref="GeneID:8197637"
     mRNA            <322529..>323452
                     /locus_tag="PAS_chr1-3_0170"
                     /product="Zinc-finger DNA-binding protein"
                     /transcript_id="XM_002489468.1"
                     /db_xref="GeneID:8197637"
     CDS             322529..323452
                     /locus_tag="PAS_chr1-3_0170"
                     /codon_start=1
                     /product="Zinc-finger DNA-binding protein"
                     /protein_id="XP_002489513.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0170"
                     /db_xref="EnsemblGenomes-Tr:CAY67232"
                     /db_xref="GeneID:8197637"
                     /db_xref="GOA:C4QVF9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4QVF9"
                     /translation="MSKRHTNNRDRDGDDRRNRTRIDFITNSDSPKQTNLHHFPRLPT
                     QMSIMGHSDASPEVSEIAPPTPPVKQTEEDIKFLQLANEALEKIGTIDPSIKQVLTRL
                     QYAAPPHGGVPMGNAFSASSVNSVVQNTPLVDELAINHFPNFNNDIFYDEHHLNLHSN
                     NNNNNTNKSIPSVAGTTPTPTTANTLGETTYRKRVYEQVSPTSSMSSQSSSKVDKPFI
                     CSKCALAFRRSSDLKRHEKIHLEVLPNICSRCQKGFARKDALKRHIDTLTCKRNREKL
                     MVKQRLQDSDSGDNGDKGVVHDIFSQFGFGK"
     gene            <323627..>324331
                     /locus_tag="PAS_chr1-3_0171"
                     /db_xref="GeneID:8197638"
     mRNA            <323627..>324331
                     /locus_tag="PAS_chr1-3_0171"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489469.1"
                     /db_xref="GeneID:8197638"
     CDS             323627..324331
                     /locus_tag="PAS_chr1-3_0171"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489514.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0171"
                     /db_xref="EnsemblGenomes-Tr:CAY67233"
                     /db_xref="GeneID:8197638"
                     /db_xref="UniProtKB/TrEMBL:C4QVG0"
                     /translation="MDYNSVLETGPSPKLKDLNEEIRLKLQQIPDYPLDFNIFVYRGV
                     KDIRTEIEPELKEFRVQYNNQNINDDPLTCTARLQDRLLGFLILERHRRDIETLNKTL
                     EAQDSNGKTVTLIELQDPYKYEIKSPLYLQLMSQKDSHKQTFHRVALLQNLEYQFESK
                     VNPEDDDDIKDDNSLIQQFVSNEEIMNFDHLFRQKLSSLKDAAEAQEAMDDSTILQLM
                     IPVAAQKLLVEKDALA"
     gene            <324475..>324960
                     /locus_tag="PAS_chr1-3_0172"
                     /db_xref="GeneID:8197639"
     mRNA            <324475..>324960
                     /locus_tag="PAS_chr1-3_0172"
                     /product="Subunit beta1 of the nascent
                     polypeptide-associated complex (NAC) involved in protein
                     targeting"
                     /transcript_id="XM_002489470.1"
                     /db_xref="GeneID:8197639"
     CDS             324475..324960
                     /locus_tag="PAS_chr1-3_0172"
                     /codon_start=1
                     /product="Subunit beta1 of the nascent
                     polypeptide-associated complex (NAC) involved in protein
                     targeting"
                     /protein_id="XP_002489515.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0172"
                     /db_xref="EnsemblGenomes-Tr:CAY67234"
                     /db_xref="GeneID:8197639"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="UniProtKB/TrEMBL:C4QVG1"
                     /translation="MPIDQQKLEKLQKSGPRRVGGARLKQKRSNRDAEADDTKLQATL
                     QKFNVQTLTGVEEANFFKDDGKVLHFNRVGVQAAANYNTYAFTGYAQEKNITDLIPGI
                     LPQLGAENLQFLQQIAESLQKNPDALNALKNQNQEGAEAEDDSEIPELVEGETFDKNI
                     D"
     gene            complement(<325317..>325787)
                     /locus_tag="PAS_chr1-3_0303"
                     /db_xref="GeneID:8197640"
     mRNA            complement(<325317..>325787)
                     /locus_tag="PAS_chr1-3_0303"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489471.1"
                     /db_xref="GeneID:8197640"
     CDS             complement(325317..325787)
                     /locus_tag="PAS_chr1-3_0303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489516.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0303"
                     /db_xref="EnsemblGenomes-Tr:CAY67235"
                     /db_xref="GeneID:8197640"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:C4QVG2"
                     /translation="MDIISSEEQNNTPTGLFRREICSEIEGNTDYCLEMWKVYNNKKI
                     YLSNSHRVLNLTWRMTSLKSKQIMQKRNREHYLSQFSDLSMGLDPLGFFNDVSNCEQF
                     GGIIAGGIIEAGLIDDSFMDEGNDDNGSNGCSRCSDCGNLVCICADFEWMKFGR"
     gene            complement(<326028..>328487)
                     /locus_tag="PAS_chr1-3_0173"
                     /db_xref="GeneID:8196832"
     mRNA            complement(<326028..>328487)
                     /locus_tag="PAS_chr1-3_0173"
                     /product="Protein of unknown function, mutant phenotype
                     suggests a potential role in vacuolar function"
                     /transcript_id="XM_002489472.1"
                     /db_xref="GeneID:8196832"
     CDS             complement(326028..328487)
                     /locus_tag="PAS_chr1-3_0173"
                     /codon_start=1
                     /product="Protein of unknown function, mutant phenotype
                     suggests a potential role in vacuolar function"
                     /protein_id="XP_002489517.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0173"
                     /db_xref="EnsemblGenomes-Tr:CAY67236"
                     /db_xref="GeneID:8196832"
                     /db_xref="GOA:C4QVG3"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="UniProtKB/TrEMBL:C4QVG3"
                     /translation="MSERQSVLSVGSHPNLAFYNWRLFKSTICDLTIVSSDGPTVQWY
                     SKKFGNSRFTSSSKFTSLDQVFNSGVKLYDMVIVSASSLDELSSICTDLRDFAKRQIQ
                     STGKAFNLLVESTNYVNLEPFIKLTLQEPEVKIFSIMSDFDIRSVKKNTYKVCDSKKE
                     SELVYVGKSDESKREYEADEVVQINKISDLYESCEIDVYKLGTPLEFLSYQWKFALPK
                     ISIEPLSIIFEQPFPKDLHGQMLAKPLISGLIMEVITVIKAMGCKLFKSYDNEDSLIE
                     RLCQLYPSVPLTDDLMEAPKLFYDFYHQNELSLDLLLLQPILLADDNKIRTPYLEFLY
                     AIMSQFSSINTNSTEKSMLWLRKNPENLNSLRAQHEEVLRLRTQLKEAESAPSKHPAE
                     AQTNGRDYKQFQQPHPVAQNAPIQPPSADVGPEEELEELAGVVGAFGDSPDIQRQANF
                     YQQRPPVGPSRLTHPPPSSQVGRANSFVSQMGPNHSMTQLPPQNGPYGSIPTNRSLGN
                     LHGHYQSHGYVENQYDQYGNVIKKPRGQYPNNSHQLPPHALPPQGFPNQRFPIGAAPQ
                     GYGAPPLQQSFGGPTPPGVQYPKPPVQRRVSSVPQMDYAPSEAALGSDMARFPQKTNR
                     KNRQSTLPNLGSASAVGYNGNDFNMMPRQKGHALNAKASQSTLRQPQPVSVAPPVNHL
                     SHRLSVMGMPDQNHSNSATPQSRLQPPNRQGTNSQSHSSNSQGTVTPDRDDRDFTDDR
                     QYLHPGYQNSNPELQPGVAAAGGSAAPTTAGAPGTETTTGSGQQQFASKPLGLNVHEQ
                     KAESDKDKKKKRGLFGRKNKK"
     gene            complement(<329272..>330336)
                     /locus_tag="PAS_chr1-3_0174"
                     /db_xref="GeneID:8197641"
     mRNA            complement(<329272..>330336)
                     /locus_tag="PAS_chr1-3_0174"
                     /product="One of several homologs of bacterial chaperone
                     DnaJ, located in the ER lumen"
                     /transcript_id="XM_002489473.1"
                     /db_xref="GeneID:8197641"
     CDS             complement(329272..330336)
                     /locus_tag="PAS_chr1-3_0174"
                     /codon_start=1
                     /product="One of several homologs of bacterial chaperone
                     DnaJ, located in the ER lumen"
                     /protein_id="XP_002489518.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0174"
                     /db_xref="EnsemblGenomes-Tr:CAY67237"
                     /db_xref="GeneID:8197641"
                     /db_xref="GOA:C4QVG4"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C4QVG4"
                     /translation="MKIWLVLLLVFATVFAETDYYKVLGVAKNADEKDIKKAYRSLSK
                     KFHPDKNPGDDEAAQKFIQVGEAYDVLGDPEKRQRYDRFGAEGLDSRQEQFHDPFDMF
                     QQFFGGGGQQHRGKPKGKSSLLHLEFSLQDFYNGASNDFRIEMQNICETCSGSGSQDG
                     KVHQCDTCKGHGRVVQTRQFGGGMQQRFETICPKCSGTGNLITHKCKKCQGNRVVRGP
                     RIHNVHLGAGTSRNHVEILEGQGDQSPDWIAGDLQIMFKEKAEGNMGYRRIGNNLYRD
                     EALTLKEALHGGWERQIAFLDKIENTITLSKKKGEVVVDGQVDTIKGRGMPLHDHYDE
                     HGDLFIKYHIIYPQQIRDEL"
     gene            <330636..>331979
                     /locus_tag="PAS_chr1-3_0175"
                     /db_xref="GeneID:8197642"
     mRNA            <330636..>331979
                     /locus_tag="PAS_chr1-3_0175"
                     /product="Essential protein involved in mtDNA inheritance"
                     /transcript_id="XM_002489474.1"
                     /db_xref="GeneID:8197642"
     CDS             330636..331979
                     /locus_tag="PAS_chr1-3_0175"
                     /codon_start=1
                     /product="Essential protein involved in mtDNA inheritance"
                     /protein_id="XP_002489519.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0175"
                     /db_xref="EnsemblGenomes-Tr:CAY67238"
                     /db_xref="GeneID:8197642"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR019605"
                     /db_xref="InterPro:IPR029209"
                     /db_xref="UniProtKB/TrEMBL:C4QVG5"
                     /translation="MQEIFTIGLSNHANHVVTHFFNEQESHFDYTGIGKSDLEPEVFF
                     REVKTGNYVSLTPRALLWDLHGGIGKLPGSQRVSAESPADPDFSLDSDFKVEKIVQPP
                     IPESNYQKTLDENKPVFSVDDTKFWSSYSTMIFDETRIKCLEKWENDSGNGHLRSAES
                     VKFDDFTVGADVWKDEGQSFIDNSFRKELEQSDLLDGINLIVDIDSAWAGFGSQMLQD
                     IREELPKKTILGYGLFQKEVNLKRTISRIHGFLGMVDNCSLVVPLFQTSESLYESSAV
                     ESVVVSSINGLFNSKAQDQVSMTQFVDSIRLNSNRNIIGDVFWDDKLLSGPLCPGKIN
                     NRNQYVYSRSVIHRGKGPTNKFYSNFDYLKSQGTSSRGMNQYNVSPLGQPQTFPQIVD
                     NDVYVKLDINTKPRQDLLNMKDIVKRYVSYDEREELVDHLLSLAEEYEYGFIDED"
     gene            <332103..>332474
                     /locus_tag="PAS_chr1-3_0176"
                     /db_xref="GeneID:8197643"
     mRNA            <332103..>332474
                     /locus_tag="PAS_chr1-3_0176"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489475.1"
                     /db_xref="GeneID:8197643"
     CDS             332103..332474
                     /locus_tag="PAS_chr1-3_0176"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489520.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0176"
                     /db_xref="EnsemblGenomes-Tr:CAY67239"
                     /db_xref="GeneID:8197643"
                     /db_xref="UniProtKB/TrEMBL:C4QVG6"
                     /translation="MRSIPPPRQSRLRTIRRLFHVIVASILKGHITDPSVFRRSRRLR
                     YKNTISKIRQSRLSGKATSRQKLRSRLAKKVVNSTTDVLIADTIDENKTLSKPTRNVL
                     RRMIWRMKKTNQGRVNVVVRI"
     gene            <332778..>333800
                     /locus_tag="PAS_chr1-3_0177"
                     /db_xref="GeneID:8197644"
     mRNA            <332778..>333800
                     /locus_tag="PAS_chr1-3_0177"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489476.1"
                     /db_xref="GeneID:8197644"
     CDS             332778..333800
                     /locus_tag="PAS_chr1-3_0177"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489521.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0177"
                     /db_xref="EnsemblGenomes-Tr:CAY67240"
                     /db_xref="GeneID:8197644"
                     /db_xref="UniProtKB/TrEMBL:C4QVG7"
                     /translation="MKAFSKKYKAEWALFSRFLRETNPKNTPPEFVIRDFKASVKNKH
                     SLSTRQRHRINDMCSHLQKSPQLFKNLTLQNTKLGEIINKTACKRQQTPSGDSGAYRI
                     LLDRYNQSIDPVVTREINNEQAELLMRPRDDAVPTMKKDTTKLPDEKSCVTTEEIDAL
                     KVFLINAKKSRDLQRESMFNAKKIYEWTQNNKQNRTFETKTFFTPVCVPKTLVDSKVV
                     VSNDFLFPIANSHSEKEYMIMYRDGSTSKSSVNPLGPKYIPRDMFTILSQLSDPEVYS
                     KKIAKLHKQNWHLIGGGLQEDQLLVFERESDRKSKTFKLGRNLLGGMAAVFVLIVLYP
                     MPLTKL"
     gene            complement(<333805..>334314)
                     /locus_tag="PAS_chr1-3_0178"
                     /db_xref="GeneID:8197645"
     mRNA            complement(<333805..>334314)
                     /locus_tag="PAS_chr1-3_0178"
                     /product="Protein of unknown function that associates with
                     ribosomes"
                     /transcript_id="XM_002489477.1"
                     /db_xref="GeneID:8197645"
     CDS             complement(333805..334314)
                     /locus_tag="PAS_chr1-3_0178"
                     /codon_start=1
                     /product="Protein of unknown function that associates with
                     ribosomes"
                     /protein_id="XP_002489522.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0178"
                     /db_xref="EnsemblGenomes-Tr:CAY67241"
                     /db_xref="GeneID:8197645"
                     /db_xref="InterPro:IPR021346"
                     /db_xref="UniProtKB/TrEMBL:C4QVG8"
                     /translation="MPIGKSLRKVTKNISKSKSAIHPKGRKFKQLTRASLREKKIAAK
                     KELRSEQKQNDLLIVAFFQDSILETSRLDTKIFTIDDMKAFIETFIARDDQELQDLKD
                     SRRPGRPASNKQMLLEARREQECGFYSAGWSVPDLTNEENVQRLRAWEGSFGGVTSLK
                     FVSVSEKSQ"
     gene            <334505..>334930
                     /locus_tag="PAS_chr1-3_0179"
                     /db_xref="GeneID:8197646"
     mRNA            <334505..>334930
                     /locus_tag="PAS_chr1-3_0179"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489478.1"
                     /db_xref="GeneID:8197646"
     CDS             334505..334930
                     /locus_tag="PAS_chr1-3_0179"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489523.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0179"
                     /db_xref="EnsemblGenomes-Tr:CAY67242"
                     /db_xref="GeneID:8197646"
                     /db_xref="UniProtKB/TrEMBL:C4QVG9"
                     /translation="MVKYTEEQLLELQSHAVVSKKDALEAFNALVEEVKTQVPDDQFL
                     NGRRRSSVLGTRPVFRKKKADPPKVDEDGFIISSGKSTRKSVSASDDVEIQQFRELNL
                     KVKSSKISSNPADSSTLVDQPKVAFNAFDALMDSDGDSE"
     gene            complement(<335028..>337223)
                     /locus_tag="PAS_chr1-3_0180"
                     /db_xref="GeneID:8197647"
     mRNA            complement(<335028..>337223)
                     /locus_tag="PAS_chr1-3_0180"
                     /product="Non-essential protein of unknown function"
                     /transcript_id="XM_002489479.1"
                     /db_xref="GeneID:8197647"
     CDS             complement(335028..337223)
                     /locus_tag="PAS_chr1-3_0180"
                     /codon_start=1
                     /product="Non-essential protein of unknown function"
                     /protein_id="XP_002489524.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0180"
                     /db_xref="EnsemblGenomes-Tr:CAY67243"
                     /db_xref="GeneID:8197647"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4QVH0"
                     /translation="MLKLKPKHQRFILQCYPGGKSTEKKPNNAELSHLLYYATTRRTK
                     LEKVGGFLEKKTVKDVGHSRIGNVLVTLDILNQLVIRCSDNLSVFADNVINILTNVST
                     LHDLTVQEHSFILFKSFCENVTVKSFTGEKKIIDRFNKLCNYYIEQQELATKSHTESS
                     DWLILSLKTCEIIAKCYGNFPSLDKRIIAKSMNLILSKLSLNEHQLLNRTKTNVSHEI
                     NTDNVEEVVLKSLKAHFNTTSTTFLTQSTKSVAEFILRSKPSIQGPWSNALLEMLTSW
                     TPVQLRFIVLSSLMSILDHKNEAVLTEKISNLLSSSVSLVGLSVIDVLRQFLTLQANC
                     LKSKLNLTENYVKCISSLALHHYYRSQVPDMVKEISVKLKENYNNIVLFAPVYARNIE
                     MIYQTSKENPKDMKFKYGNIDSWSILFSILALKGSSLNEDERLQVQLPFLKLFITFLQ
                     SLYSENSEYSMAVPNYNEYLTRTTNPLSLCFYMLDKIVPNEESSKLLSQIIPLLLKIF
                     GVNAVKNGAPFVLERPEGESSLLFLHYAATYLDDPEFEDIVSGHISKALNENQNISAL
                     DLSLPNGTKNSNFSPRDIEKQDFVKVIQSNFVSDIPSVDEEMFRVSNGNHVLKNMMMM
                     NRSTRSLSSPYYTRSSPHSSNNSTINIMDVKSFNPRTFSLEIRRPPQISDLKRAVSGQ
                     DPTVSSVTSKLVTPSLLENDNDLISLQDLVHQLAVDSADEKYHQINITP"
     gene            complement(<337444..>341799)
                     /locus_tag="PAS_chr1-3_0181"
                     /db_xref="GeneID:8197648"
     mRNA            complement(<337444..>341799)
                     /locus_tag="PAS_chr1-3_0181"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002489480.1"
                     /db_xref="GeneID:8197648"
     CDS             complement(337444..341799)
                     /locus_tag="PAS_chr1-3_0181"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002489525.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0181"
                     /db_xref="EnsemblGenomes-Tr:CAY67244"
                     /db_xref="GeneID:8197648"
                     /db_xref="GOA:C4QVH1"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027244"
                     /db_xref="UniProtKB/TrEMBL:C4QVH1"
                     /translation="MERMKRGGVSSNYQSIVIGKNTGSLPIRSRSFLKRPGRGSEIPS
                     AQASQPQIYEEETDMELFEPMKCAVKFHEPRASTAPVLLEGKAALGIKPGTIGELESL
                     EGTPRRLMFLVKYVEDEIPSSKVNTSNNPNQPQVSIQTGSLQELLMLKRGSPVLLRLR
                     KRKDAEADVVELRIKDVHLSRGDMWCLSSTLAGTCVYKHEKKSFIDSSIRTTVSKIYV
                     GGRSVFSAYVGKNTRIVFRSESVKLVILIQISSEMWDFEETGQQMFNKLINSLFPKVF
                     SKWTELGAHHLITIVLFSSIDLGNKSWSLLGSGDRPPDRKDYYRVVVDQVSILLWSEI
                     MSALRFEFANFMKDIMLRENKAPCKTDRNEEYVIQGRFLPAVKGNLIEAINLATTLVT
                     DHFRDPELRYTSNHFILISPGTGIYDVDYNLMAHTSKKMAKVDAAIDVICLSQPPLHV
                     VPLFRYKESNSKIRHCIPTWLDVSFWNDSSQYISQWMPRCKIYEIQMMGVVENELKTI
                     NLPNLRINPNSKSINEVIDKYDEDVFKPASPHTTEVKKIPLHLSPEVLQVPKKNSPST
                     ETFKINQTKECQPSTIDVKALGTTNSRLGISARSSLLNFINDDSKSGIGNFIRERISS
                     LPASLVRVKSAEFDKEEPKTQTVRPVSMFTMKEDTIKSKSIQPPRRLEKVVKKVESTT
                     QSPPSLTRTNSSVSVPEDVNSQRDDKLSPYWTTVQNPSKALTSELLKMIGYGRWQHVF
                     PSKVKRRAVKWSSLSTPASLPLTTQVFPRLSDFESNFTFQIYDVILNNNDTKINTGDL
                     IREMIYLRLVLGFQICTGEKVDTVESRRKPGGDPNLLIKYLDKHSYHGSRIYMILEDE
                     IHRISCDYHGKANVQLYRRSNKSINVKAEDVGSYFSNIRTRYDDLYRPSVVDCFKNEI
                     KSYNWNQLDQILAGYYESVDEDQKYYHKMKFVILPADIPEKSYAFKLNENKEKLSPEE
                     LRLEGLRKLIATIHKGRHVAEQDKTKQAKKEEILPEINFYTGDLFTFLSKQSEVYDPD
                     KPHKNTMLVESLGLNTNISMKQLAHYLQSKDGIVLADRKWHFRIHRHCFVGLELVSWM
                     IENFNDIDSREEAERYGNKLMNNGLFSHVEKRHSFLDGHYFYRLNSEYVEKVEPGNTS
                     IKTRESRSNSITDSSKLKSPMLSPQTTRERSGTITDSPLKKVTSKTTDGAPKRFMLSR
                     FVIYDVDQQKKSYRRELVKVHYDRVHNPEHCFHIRLEWLNTTTKLIEDTVNSWTRLCE
                     RYGLKFVETPWAELCSMPEKNPFHSFVTIRLALNPWNEKEFTPEDNNPLDENKFFYHL
                     YLLDKSGFMLDNRTTIFFTKVEINVAYSWGTPEFKFAQFIHKTGAYIAEIRDNGDLFL
                     APNNTHVARVNMDISNNNIYQQQSNYGTYLDSQRVMLEFQSTCGDAEKLRKLFNEARV
                     KWEKSRDIDQAIFGS"
     gene            <341956..>343878
                     /locus_tag="PAS_chr1-3_0182"
                     /db_xref="GeneID:8197649"
     mRNA            <341956..>343878
                     /locus_tag="PAS_chr1-3_0182"
                     /product="Essential splicing factor"
                     /transcript_id="XM_002489481.1"
                     /db_xref="GeneID:8197649"
     CDS             341956..343878
                     /locus_tag="PAS_chr1-3_0182"
                     /codon_start=1
                     /product="Essential splicing factor"
                     /protein_id="XP_002489526.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0182"
                     /db_xref="EnsemblGenomes-Tr:CAY67245"
                     /db_xref="GeneID:8197649"
                     /db_xref="GOA:C4QVH2"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="InterPro:IPR021786"
                     /db_xref="UniProtKB/TrEMBL:C4QVH2"
                     /translation="MAPVYVKGGAWTNVEDEILKAAVAKYGLTQWARVSSLLAKKTAK
                     QCKARWEEWLNPRVNHLEWSRDEDAKLLRLARLMPNQWRSISNITGRTATQCVERYQK
                     LLEEAGGVSSDLRHMELGLSGPGIESNAPVGAEFKLGDINLNPENKPAMLDTVDMDEE
                     ELEMLSEARARLANTQGKKAKRKVREKFLEESRYIAELQKRRELKQAGIGGTKKRKKQ
                     DNQVDYLSDVPFERAPYQGTYDVDDENLANLKEMEDYQLRANKYGIQDQDAQKQKRKR
                     KREKEDEKKKDQMAQIVVFEELYPTKKKKLDLPEPGSVVGDEITDDAIIQATQQLIRR
                     SQKQSFIGSTADELESESTNGKLDNVRPAPVSAKKERKRLVALIRTKFSQLPKPKNNF
                     QITLPHESQAFVTGNENEIRDQYIDLGEAERRIKLHEEEEYFKSLSRRSQTIQRGLPL
                     PSPTAIPSTNNLLQDLVDQEIMKMIESDYNQVNDVPGFRITQLTEEEKQQADLEIFEE
                     ITKNQDSFLKFQDHLRNLDLFKSFEYTKSFRNLRSQYLKTRIDDISKLESTINLQNED
                     IIDKHNQLIQSLEELQTLSIKLDMEYNVFGHFRENERMVIQVRTEALQDEADEAKKIQ
                     RKAELRYNNLLENLNH"
     gene            complement(<343920..>348086)
                     /locus_tag="PAS_chr1-3_0183"
                     /db_xref="GeneID:8197650"
     mRNA            complement(<343920..>348086)
                     /locus_tag="PAS_chr1-3_0183"
                     /product="RNA-binding subunit of the mRNA cleavage and
                     polyadenylation factor"
                     /transcript_id="XM_002489482.1"
                     /db_xref="GeneID:8197650"
     CDS             complement(343920..348086)
                     /locus_tag="PAS_chr1-3_0183"
                     /codon_start=1
                     /product="RNA-binding subunit of the mRNA cleavage and
                     polyadenylation factor"
                     /protein_id="XP_002489527.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0183"
                     /db_xref="EnsemblGenomes-Tr:CAY67246"
                     /db_xref="GeneID:8197650"
                     /db_xref="GOA:C4QVH3"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="UniProtKB/TrEMBL:C4QVH3"
                     /translation="MDVYHQFLEPTVCTHSLSANFTNSVKNDLIIAKGTLLQIFEVIN
                     VTIENKQDEEQPDLELNGAAFGIGEINEDALNVAAIDFSQNVKLSLVAEYKLDGLVTD
                     LCKIRTIEDSHHDYVLVATKGVKFSMIKWDQSSNSISTVSLHHYKKIVENSLIDKFNV
                     DTKLIADPNNHCSCLLANEILFFLPFLQHEVDEELDGKFVENKKLYSNTFLQFSNDLQ
                     PNIKTIIDIEFLHGYSEPTLAVLYTSFPTCTGALPKAKDTVSLQVFSLNLQNKASTSI
                     IEVNNLPYDTDRILPLSSPLNGCLLIGANQIIHLNSMGTAKGISCNLFAAKCSNFKLS
                     DQSNLDLRLEKCVLGQVYNDKVILITEKGAFYAFSFDIVGGVSSINEIQKIAAEKYQG
                     LVLSLPTMFTNIDGKTFFIGCQGSDSVLFGSKARLNTQNVDVNGKSKVITEEDALYEE
                     DLYADDIQNVAQGIDHIDFVKLDSLLNIGPITNFTTGSIEYRSKLQGLPNPNWNDECI
                     IAAGGLHESGQLSLIQPTISPTVRSSLTFNNVEKLWTLEDENGDSHYLITTDSKKANT
                     EVFLVKQNYKHYSSKGFVTGTFTKHIAVIPGKDGTGSYGESRIVQVTAENVILYDFKL
                     KKLLSLSYEGDDIVSVDTFENYMLITKESGMADILHYDEEIEAVEHGDKKESDGETSS
                     KKSKTSKKGRKRRRKEEKMEAFRVNHKLDVIPLPKALSQNDYIFITGCIANSDILNKV
                     DIGYNNIILENGEKGKKSLVFFLVTAENSIVMFLENHKEKVFKLSEAKDFSTFLNIEL
                     IKVGEIGQPDPFIKQITVSEIGDEIEKQVYLTILTIGGEVIIYKQVLNKDSGTFQFIK
                     DNYSANITITGAPDNAYPQGTKLERRLIKLNNIGDSKLSTLFVVGVKSFWITKRHSSS
                     INIHQFTKLSTISCARFNTSRCKNGLMIIDTNKAARMVEIPSNLELSQRLPIRRVPVG
                     CTIKCVAFHKASRTFVVSTVEETPYNCVDEEGNPIVGVDNTINKPASSFKSSIKLISP
                     ISWTVIDSFDLEDEHVCMSLKSMTLNTSRIPMFKNLKEYLVLGISNYRMEDLASNGQI
                     RIVDVVDIIPEPGKPETNHKFKDIFQDATKGAVTSVSDISGRFVIGQGQKIIVRDLQE
                     DNTALPVGFVDTPFYVSETKSFQNLLLVGDSMHSVILVGFDAEPYRMISLGKDVAHVD
                     VCAADFVVFEGNLFIIIADEDGMLHLIQYDPEDPASMQGQRLLRRSIFKTNQYTTCMK
                     MRERKYVIKPPKNQFTNFSEAFEVVAANSDGSFYKVTPISEATYRRLYVIQQQIFDQE
                     NHKCGLNPRENRYLSDQYSIPNQRLILDFDNIRRFLEFDEIKKRDLVHKLGRNTYSEF
                     YRDLLNLQEL"
     gene            <348309..>350630
                     /locus_tag="PAS_chr1-3_0184"
                     /db_xref="GeneID:8197651"
     mRNA            <348309..>350630
                     /locus_tag="PAS_chr1-3_0184"
                     /product="Protein involved in proteolytic activation of
                     Rim101p in response to alkaline pH"
                     /transcript_id="XM_002489483.1"
                     /db_xref="GeneID:8197651"
     CDS             348309..350630
                     /locus_tag="PAS_chr1-3_0184"
                     /codon_start=1
                     /product="Protein involved in proteolytic activation of
                     Rim101p in response to alkaline pH"
                     /protein_id="XP_002489528.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0184"
                     /db_xref="EnsemblGenomes-Tr:CAY67247"
                     /db_xref="GeneID:8197651"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="InterPro:IPR025304"
                     /db_xref="UniProtKB/TrEMBL:C4QVH4"
                     /translation="MSFNLLSVPLRTSKPIPLGESLKELINNQYYQTSAAFKSDIEEI
                     DQLRNDVLSIEPNNDGLALLKRYYVQLASISQKLPDYFMEYPWFGTLGYQVTGPVALK
                     SLYFERINIAYNIAATYSIIGLNEPRATGEGLKKSCIYFQYSSGAFESVLKLVEQKPK
                     ELTLPIDLSVNIMKTLAKLMLAQAQECFWQKAVSNTLKDNVIARLAFQVSQFYDEALS
                     MAYKCDILKSEWIEHMSCKKLHFKAAAQFRLACVAVAASRHGEEIARLRIANTICETA
                     SREAKYHLPSVSSDLESLSKIIKDSLRRSERDNDLIYLQEVPNESDLPPIVAASMVEP
                     KPIVELNSAECAKDTKKYGKILFHDLMPYLVIEIAQAFRERQDSYVVKHIKEPMEMLT
                     KILHTILAENGLPALIDTIQRPQRLPTNILEHCQILNERGGMDKLKVFFEDISKLRHK
                     SEQVLQNCVELLQMEESENEEMRRKHGSQRWNFADSREASADVRKSVQALEGYLKQAH
                     DGDQVIWNDFEQLKPLLSMMSAPNSTKLLEEFVPNSKFVRLPPELNRIVNELRADVNQ
                     VKKLASQRETFINTVKVKSTDLSILPLVVSHYKKLQQNNINTITTELFEEVFRRQVSN
                     FDSDIRFVQKHRDNQIELEKHIKSLVQQFNQLRGNIDASQERQNALQLLDDAYNGYLD
                     LVNNLTQGLSFYNDFTGKANDVYLRCQEFYNFRKQEAMKLEQEIYAVFEQGKSPQKKQ
                     LEDQVSDQPKSEVKSSKGYSNELWNPDVGIKFG"
     gene            complement(<350617..>351984)
                     /locus_tag="PAS_chr1-3_0185"
                     /db_xref="GeneID:8197652"
     mRNA            complement(<350617..>351984)
                     /locus_tag="PAS_chr1-3_0185"
                     /product="Delta 2-isopentenyl pyrophosphate:tRNA
                     isopentenyl transferase"
                     /transcript_id="XM_002489484.1"
                     /db_xref="GeneID:8197652"
     CDS             complement(350617..351984)
                     /locus_tag="PAS_chr1-3_0185"
                     /codon_start=1
                     /product="Delta 2-isopentenyl pyrophosphate:tRNA
                     isopentenyl transferase"
                     /protein_id="XP_002489529.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0185"
                     /db_xref="EnsemblGenomes-Tr:CAY67248"
                     /db_xref="GeneID:8197652"
                     /db_xref="GOA:C4QVH5"
                     /db_xref="InterPro:IPR002627"
                     /db_xref="InterPro:IPR018022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QVH5"
                     /translation="MLRLWKKMTKKSIINIIGTTGVGKSQLSIELAKRFNGEVINTDS
                     MQMYKGLDIITNKHPIKEREGIPHHVMNHVDWKDEYFLHTFEKEALKAIEDIHGRGKI
                     PILVGGTHYYLQSILFHNKVIKTGGSAKDEETSSTLTPHERQMIEGPPEELIGHLKEL
                     DPIVAEKFHPNDHRRIRRALEIYLLTKKPASAYYDRQREEERQQSSLRFNTLNVWLYA
                     DQTVLDARLDSRVDTMLTEGGLDEIQQLYGYYKSLDSQPNLQHGVWQVIGFKEFITWL
                     NEPSEESLQAAVEQMKARTRQYARRQVKWIKKVLANELLKEKAHGYPNGGQIYILEAT
                     NLNQWKENVTSRALEITDAFLEFRHIEQPFASGHLIDLLPQEASSSEKERKKWKHYEC
                     DTCKDADGNKAIFVGDQYEIHLASRRHRSAMNKLKKRQEREHYITGKDAMKKAKCDKQ
                     ESSQI"
     gene            <352171..>353154
                     /locus_tag="PAS_chr1-3_0186"
                     /db_xref="GeneID:8197653"
     mRNA            <352171..>353154
                     /locus_tag="PAS_chr1-3_0186"
                     /product="Putative protein, predicted to be an
                     alpha-isopropylmalate carrier"
                     /transcript_id="XM_002489485.1"
                     /db_xref="GeneID:8197653"
     CDS             352171..353154
                     /locus_tag="PAS_chr1-3_0186"
                     /codon_start=1
                     /product="Putative protein, predicted to be an
                     alpha-isopropylmalate carrier"
                     /protein_id="XP_002489530.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0186"
                     /db_xref="EnsemblGenomes-Tr:CAY67249"
                     /db_xref="GeneID:8197653"
                     /db_xref="GOA:C4QVH6"
                     /db_xref="InterPro:IPR004686"
                     /db_xref="UniProtKB/TrEMBL:C4QVH6"
                     /translation="MASAIPGPIPLPQSRYDLNTYMGRVKHCAGISDPSMLLNTSADV
                     ETAKTLISDFKNGKIKQMTPELWRAKRVLDSTIHPDTGETVLLPFRMSSCVLSNLVVT
                     AGMLTPGLGSIGTLFWQVANQSLNVAINIANSNKSHPLSTRQLITNYTLAVTASCSVA
                     LGLNSIVPRLKSLAPNTRMILGRLVPFAAVVSAGVVNVFLMRGEEIKKGISVFDQDGN
                     DVGLSKKAAFYAVGETAASRVINATPIMVIPPLILVKLQKGFLKGKGVGIQTFTNIGL
                     ICATSLIVLPFALAVFPQRQQIHVSKLETKFHNLTDSRGNKLNTVEFNRGI"
     gene            complement(<353182..>354477)
                     /locus_tag="PAS_chr1-3_0187"
                     /db_xref="GeneID:8197654"
     mRNA            complement(join(<353182..354348,354403..>354477))
                     /locus_tag="PAS_chr1-3_0187"
                     /product="Mevalonate kinase, acts in the biosynthesis of
                     isoprenoids and sterols, including ergosterol"
                     /transcript_id="XM_002489486.1"
                     /db_xref="GeneID:8197654"
     CDS             complement(join(353182..354348,354403..354477))
                     /locus_tag="PAS_chr1-3_0187"
                     /codon_start=1
                     /product="Mevalonate kinase, acts in the biosynthesis of
                     isoprenoids and sterols, including ergosterol"
                     /protein_id="XP_002489531.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0187"
                     /db_xref="EnsemblGenomes-Tr:CAY67250"
                     /db_xref="GeneID:8197654"
                     /db_xref="GOA:C4QVH7"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006205"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C4QVH7"
                     /translation="MDLPFVVSAPGKVIIFGEHAAVYNKPAIAAALSLRTYLLVTPNE
                     DSELIRLEFPDIHFNKSWRKDHFPWDQKPNYNGKPSLSQELEPELVDALSLFLADITS
                     PFHYSSAYTFLYLYISLVSKTVPGATFSVRSTLPIGAGLGSSASISVCLATAFALLDG
                     HISKPTIGRDERTLSESADCQFIEAWSFQGEKCLHGNPSGIDNAVATHGGAVMFQRKE
                     GSMPSVRTSMRNFPSLRLLLTNTKTARRTATLVANVSTLVTEFAKTSEFILNAIDSLT
                     REAYILMTKPVLDAEARRRLRELIRINHGLLISLGVSHPSLEKIRMTADLLALGETKL
                     TGAGGGGCAITLLKESVEESKVLELVEELENEGFETFETTLGGKGVGATFNPTLDPSE
                     FIKMDRIQIEHNVWSSDWKFW"
     gene            <354846..>356198
                     /locus_tag="PAS_chr1-3_0188"
                     /db_xref="GeneID:8197655"
     mRNA            <354846..>356198
                     /locus_tag="PAS_chr1-3_0188"
                     /product="Constituent of 66S pre-ribosomal particles,
                     required for maturation of the large ribosomal subunit"
                     /transcript_id="XM_002489487.1"
                     /db_xref="GeneID:8197655"
     CDS             354846..356198
                     /locus_tag="PAS_chr1-3_0188"
                     /codon_start=1
                     /product="Constituent of 66S pre-ribosomal particles,
                     required for maturation of the large ribosomal subunit"
                     /protein_id="XP_002489532.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0188"
                     /db_xref="EnsemblGenomes-Tr:CAY67251"
                     /db_xref="GeneID:8197655"
                     /db_xref="GOA:C4QVH8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR028599"
                     /db_xref="UniProtKB/TrEMBL:C4QVH8"
                     /translation="MSESQEQIKIRFITRDEDETIHVSENPLYVPVSLKRYGLSEIVN
                     HLIGHDSPIPFDFLINGTLLKTSLEEYLKSRELSTEAFLTLEYSRAVLPPDFLASFNN
                     EDWISSVDTLSSDPKLATQPKILSGSYDGIVRIWDMSGNNEAQLAGHGGPIKDVKFIS
                     SSKLMSAGNDRQIRLWDATIPQEFQENGEAQQESISATTIAILEGHKAPVLSLALDSP
                     TNRILSGSADHSLAFWSTNPDDMNASAPLINEFAHVSSSARKRAKLAIEDSSIKRRAP
                     LSFLEGHSSPVEGVIFDKKDSTVGYSASQDHTVKTWDLVTARCVDTRATSYSLLSITQ
                     LDKVGLIACGSSARHINLHDPRVDSNKSVVQSQLIGHTNFVVSLAPSPNNEYMFVSGS
                     HDGTSKVWDIRANKSVFTITRESEEKKNNNKVFGVAWNREIGIVSGGDDKKIQINRSV
                     "
     gene            complement(<356233..>357447)
                     /locus_tag="PAS_chr1-3_0189"
                     /db_xref="GeneID:8197656"
     mRNA            complement(<356233..>357447)
                     /locus_tag="PAS_chr1-3_0189"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489488.1"
                     /db_xref="GeneID:8197656"
     CDS             complement(356233..357447)
                     /locus_tag="PAS_chr1-3_0189"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489533.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0189"
                     /db_xref="EnsemblGenomes-Tr:CAY67252"
                     /db_xref="GeneID:8197656"
                     /db_xref="InterPro:IPR012901"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4QVH9"
                     /translation="MRIDRADYLEINKLVTRLSIALILFALIQPRYPYSIPFGFILAM
                     LVSYKNPIVERMWKRFLFMGLPKLSTEDKKLLQAIDALSKYKARSTSWNDRRRVLFRR
                     MPWRHQNIAMKLGFTARINDVQKCINENSKLTESVIEMVRDEYSLPPSCPPDLAIEDN
                     IRVIETLCHYARDWSSLGDVEVQPLVDYIKDSITKVLSQDAQRQTNVIVPGSGLGRIS
                     HELALLPFHSVHSVEYSTLMYLFNKFVYSDSPKTYKVYPFAHSYSHHVEAKDQQRSID
                     FTQLPERPSNLHIHNQDFNEFTLSSQQENLVIVTAFFLDTAENMFEYFDTIDALMNSV
                     TGTKLWINVGPLKYGTAARVEFSYDELKALLSEYNWKLLDEQDPKPLGYLTNLKGLWQ
                     GNYGVTMWTATK"
     gene            <357578..>358006
                     /locus_tag="PAS_chr1-3_0190"
                     /db_xref="GeneID:8197657"
     mRNA            <357578..>358006
                     /locus_tag="PAS_chr1-3_0190"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489489.1"
                     /db_xref="GeneID:8197657"
     CDS             357578..358006
                     /locus_tag="PAS_chr1-3_0190"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489534.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0190"
                     /db_xref="EnsemblGenomes-Tr:CAY67253"
                     /db_xref="GeneID:8197657"
                     /db_xref="GOA:C4QVI0"
                     /db_xref="InterPro:IPR004568"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="UniProtKB/TrEMBL:C4QVI0"
                     /translation="MTVLGIGTDLIRKTRFETILTKHNYPNVTSSHVVRLAKRILHPE
                     REYPLFLKSSKDCDKSQCVQLLAGSWCVKEALFKSLSYSDQQLFSFKDWFKLNDPKGR
                     PFIMNQDYFTKHPNEEFLVSITHDGDYIASTVIRQQLNNA"
     gene            complement(<358071..>359651)
                     /locus_tag="PAS_chr1-3_0191"
                     /db_xref="GeneID:8197658"
     mRNA            complement(join(<358071..359554,359594..>359651))
                     /locus_tag="PAS_chr1-3_0191"
                     /product="GMP synthase, an enzyme that catalyzes the
                     second step in the biosynthesis of GMP from IMP"
                     /transcript_id="XM_002489490.1"
                     /db_xref="GeneID:8197658"
     CDS             complement(join(358071..359554,359594..359651))
                     /locus_tag="PAS_chr1-3_0191"
                     /codon_start=1
                     /product="GMP synthase, an enzyme that catalyzes the
                     second step in the biosynthesis of GMP from IMP"
                     /protein_id="XP_002489535.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0191"
                     /db_xref="EnsemblGenomes-Tr:CAY67254"
                     /db_xref="GeneID:8197658"
                     /db_xref="GOA:C4QVI1"
                     /db_xref="InterPro:IPR001674"
                     /db_xref="InterPro:IPR004739"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="InterPro:IPR022955"
                     /db_xref="InterPro:IPR025777"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C4QVI1"
                     /translation="MTVVEPVGDVFNTILVLDFEFNVYAEMLPCTQKISELPFTPTGV
                     IFSGGPFSVYEEGSPHVDKEIFNLNVPILGICYGMQELAWIDNVENVARGEKREYGPA
                     TLNVQDKDCALFKDVDHSQVWMSHHDKLHNLPSGFKTVATTENSQFAGVANEAKKIYG
                     IQFHPEVTHSVQGKTILKNFAVNVCGATQNWTMENFIDTEINRIRTLVGPTAEVIGAV
                     SGGVDSTVAAKLMKEAIGDRFHAIYVDNGVMRKNETITVKKTLDDGLGINLTVVDAGE
                     QFLSQLKGVTDPEKKRKIIGNTFIHVFEKVAADIKPKDGSEIEFLLQGTLYPDVIESI
                     SFKGPSQTIKTHHNVGGLTENMKLKLIEPLRELFKDEVRHLGQLLDIPEDLVWRHPFP
                     GPGIAIRVLGEVTPEQVKIAREADYIFIEEIKKAGLYRKISQAFAALLPVKSVGVMGD
                     QRTYEQVIALRAIETSDFMTADWFVFEAAFLKKVASRIVNEVDGVARVTYDITSKPPA
                     TVEWE"
     gene            <359951..>360889
                     /locus_tag="PAS_chr1-3_0192"
                     /db_xref="GeneID:8197889"
     mRNA            <359951..>360889
                     /locus_tag="PAS_chr1-3_0192"
                     /product="Alpha subunit of both the farnesyltransferase
                     and type I geranylgeranyltransferase"
                     /transcript_id="XM_002489491.1"
                     /db_xref="GeneID:8197889"
     CDS             359951..360889
                     /locus_tag="PAS_chr1-3_0192"
                     /codon_start=1
                     /product="Alpha subunit of both the farnesyltransferase
                     and type I geranylgeranyltransferase"
                     /protein_id="XP_002489536.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0192"
                     /db_xref="EnsemblGenomes-Tr:CAY67255"
                     /db_xref="GeneID:8197889"
                     /db_xref="GOA:C4QVI2"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="UniProtKB/TrEMBL:C4QVI2"
                     /translation="MVVFEDFEWDDITPIDIAETTAPLCHILYTEEFKKVMGYAKALM
                     AQKEYSERAYFITDEVINIASAHYTIWKYRFDIVVHLKKNLVQELDWCDNIAYENEKN
                     YQIWPYRQQIIELLEKETESVDDLLKLEYPLLDIMIEQDSKNYHVWSHRRWLVEKFKL
                     YRTQRELEFTNDKINLDVRNNSAWNHRFLVQFGDIESNSSCDKEYLRDEIILTKDKID
                     LCPENPSSWNYLQAIYKKFSVILLIEDLNLFAIQYTHLVENPRVISIQALELTAEIYQ
                     KSDKNKSEEIYELLSTTYDPIRKNYWSFCKNLLYQN"
     gene            <360974..>361957
                     /locus_tag="PAS_chr1-3_0193"
                     /db_xref="GeneID:8196429"
     mRNA            <360974..>361957
                     /locus_tag="PAS_chr1-3_0193"
                     /product="Protein phosphatase"
                     /transcript_id="XM_002489492.1"
                     /db_xref="GeneID:8196429"
     CDS             360974..361957
                     /locus_tag="PAS_chr1-3_0193"
                     /codon_start=1
                     /product="Protein phosphatase"
                     /protein_id="XP_002489537.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0193"
                     /db_xref="EnsemblGenomes-Tr:CAY67256"
                     /db_xref="GeneID:8196429"
                     /db_xref="GOA:C4QVI3"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016278"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C4QVI3"
                     /translation="MATPTRILGGIYVSSIEPLTQGVDLKKEYNISSILSVLTDDVPE
                     EYTKNYNYKQISVLDDDKTNILQHFDEANNFIDEALFGAAADLKDERKRHKSSILVHC
                     AQGCSRSVVVVAGYLMKKYKLDVKSSIYAIRRKKPDIAPNDFFIEQLNLYNEIQSMDS
                     PLYKQWKLELALKNDTFQIEDSMYNNTAAEATADSELRCKRCRQKIALSTSFVPHIPP
                     PEEDRQSQFIKRAGNNRIIGVEKGSSKCTHFFVEPLDWMKAELSKGELEGKFCCPKCQ
                     GKVGAYSWHGSRCSCGKWMIPAIHLQDARVDEIDFKNSRVDEVKHKADNVQ"
     gene            complement(<361991..>362797)
                     /locus_tag="PAS_chr1-3_0304"
                     /db_xref="GeneID:8196430"
     mRNA            complement(<361991..>362797)
                     /locus_tag="PAS_chr1-3_0304"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489493.1"
                     /db_xref="GeneID:8196430"
     CDS             complement(361991..362797)
                     /locus_tag="PAS_chr1-3_0304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489538.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0304"
                     /db_xref="EnsemblGenomes-Tr:CAY67257"
                     /db_xref="GeneID:8196430"
                     /db_xref="UniProtKB/TrEMBL:C4QVI4"
                     /translation="MYPSKEESKLSVSILERKKTKKTTQNNSFAPPLTSYSSETPGST
                     SLTRNHESRGPNNGLIITEETSVHQHNLNYLSHQVSSKLNELDSYRTLGFNYLQPPGI
                     STTMKMRKAQEKEQKEHSHTQEVHTTEQAHYSQINSEEVGNSAMSLIDMDSSFHMDYE
                     GLNNSNMLDDQSNISAQSHEDSVSFDEDENVDSDFMVIEEDEDEDEEFEVGEIESPER
                     QNEINEDDRVLAITAPTRFQSNRLHPRFSSGSVNSNSHLRNEVTYSEDEC"
     gene            complement(<363027..>364304)
                     /locus_tag="PAS_chr1-3_0194"
                     /db_xref="GeneID:8196833"
     mRNA            complement(<363027..>364304)
                     /locus_tag="PAS_chr1-3_0194"
                     /product="Heme A:farnesyltransferase"
                     /transcript_id="XM_002489494.1"
                     /db_xref="GeneID:8196833"
     CDS             complement(363027..364304)
                     /locus_tag="PAS_chr1-3_0194"
                     /codon_start=1
                     /product="Heme A:farnesyltransferase"
                     /protein_id="XP_002489539.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0194"
                     /db_xref="EnsemblGenomes-Tr:CAY67258"
                     /db_xref="GeneID:8196833"
                     /db_xref="GOA:C4QVI5"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006369"
                     /db_xref="InterPro:IPR016315"
                     /db_xref="UniProtKB/TrEMBL:C4QVI5"
                     /translation="MMKRTVSPSFIRSMASASCFYSSNKVLLPSVINFSRSGTEFKLQ
                     FIPNYRLPGSRPIVTDTAHVLEQVGRKALTCQPSDSVCQQKDSKDFHDRQALPFTVKP
                     KEKGTKPARVLSTKDYIRAYVALTKPNLTFLVMLSSISTYALTPNSAGIAELVFLSIG
                     TMLCSGAANAINMGREPNYDKMMVRTSARPVVRGIVSPKEAFTFAGITGTIGTAILYF
                     GVNPTVAGLGFLNIVLYSWIYTSLKRKSILNTWVGAIVGAIPPLMGWAVSSSLADPGA
                     WCLAALLYAWQFPHFNSLSHNIRSEYKRAGYVMTAFENPKLNARVALRYSFLMFPICF
                     GLAYFNVTDPYFVLDSSLLNGWMSYWTFKFWLQQASNYSRKTLAAGGASQAAVELANG
                     YARKAFWCSVWHLPGILVLAMLHKKGQWDRFFS"
     gene            complement(<364618..>365625)
                     /locus_tag="PAS_chr1-3_0195"
                     /db_xref="GeneID:8196431"
     mRNA            complement(<364618..>365625)
                     /locus_tag="PAS_chr1-3_0195"
                     /product="Essential, non-ATPase regulatory subunit of the
                     26S proteasome"
                     /transcript_id="XM_002489495.1"
                     /db_xref="GeneID:8196431"
     CDS             complement(364618..365625)
                     /locus_tag="PAS_chr1-3_0195"
                     /codon_start=1
                     /product="Essential, non-ATPase regulatory subunit of the
                     26S proteasome"
                     /protein_id="XP_002489540.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0195"
                     /db_xref="EnsemblGenomes-Tr:CAY67259"
                     /db_xref="GeneID:8196431"
                     /db_xref="GOA:C4QVI6"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:C4QVI6"
                     /translation="MPTVVTNESSLLQTTVSVAPLVLLSVVDHYERVVQAPNAPTNSN
                     DKRVVGVILGDNTNKNLIKVTNSFAIPFEEDEKNRDIWFLDHDFIESMMEMFKKINAK
                     ERLIGWYHSGPKLKSSDLQINELFKRFTPNPLLLIVDVNSTDIVDIPTDSYLAIEEIR
                     DDGSSAEKTFIHLPSIIQAEEAEEIGVEHLLRDIRDQACGNLSIRLTNNFKSLKSLND
                     RIANIVQYLRKILSGELPINNVILGKLQDIFNLLPNLVAVQGDPTKPATASANQLATS
                     FNVKTNDELMMVYISSLVRSILAFHDLIDNKIENKKNNEKDKEFTPTEEEPQQAAIES
                     K"
     gene            complement(<367154..>368302)
                     /locus_tag="PAS_chr1-3_0197"
                     /db_xref="GeneID:8196432"
     mRNA            complement(<367154..>368302)
                     /locus_tag="PAS_chr1-3_0197"
                     /product="Protein of unknown function required for
                     establishment of sister chromatid cohesion"
                     /transcript_id="XM_002489496.1"
                     /db_xref="GeneID:8196432"
     CDS             complement(367154..368302)
                     /locus_tag="PAS_chr1-3_0197"
                     /codon_start=1
                     /product="Protein of unknown function required for
                     establishment of sister chromatid cohesion"
                     /protein_id="XP_002489541.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0197"
                     /db_xref="EnsemblGenomes-Tr:CAY67260"
                     /db_xref="GeneID:8196432"
                     /db_xref="GOA:C4QVI7"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QVI7"
                     /translation="MPPYAQIVIGPPGSGKSTYCNGMNQFLSSIGRYSMIINLDPAND
                     QLPYDVTIDIRDYITLEEIMDETNLGPNGGLVFAMQTFKESIEEFISEVRLLIKRNHK
                     AESAYLIFDCPGQVELYTNNDIVSQIFRILQKELDFRLVVVSLTDSINIMKPSSYISS
                     LLLALRSMLQMDLPQINVFSKIDLLKGYIEQERYGRVKPPKDKGTTTDDGLPFSLEYY
                     TQVQDLKYLLPYLEVEENNTRTNFFKHKYYKLNEAISDLIEDFSLLSFEVLSIEDKNS
                     MISLLAIIDRANGYSMGSNELGNDTIWEDAIRQSSVANFLQDINIHERWVDEKEKYDE
                     VERIRREKQFKEATNNEELLNQTIDPEKDWEDALKKWETSTGKPAFKE"
     gene            <368486..>370294
                     /locus_tag="PAS_chr1-3_0198"
                     /db_xref="GeneID:8196433"
     mRNA            <368486..>370294
                     /locus_tag="PAS_chr1-3_0198"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489497.1"
                     /db_xref="GeneID:8196433"
     CDS             368486..370294
                     /locus_tag="PAS_chr1-3_0198"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489542.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0198"
                     /db_xref="EnsemblGenomes-Tr:CAY67261"
                     /db_xref="GeneID:8196433"
                     /db_xref="InterPro:IPR024325"
                     /db_xref="UniProtKB/TrEMBL:C4QVI8"
                     /translation="MNLEQNEKLTELLTKMKMLDDIDAKNKLNDESGDTEALPIMEIR
                     EELDDNDGVLRSTVKQAELNNDELETLVEKIVELEDKNNASSQIEEIKEQAKDTDAEE
                     ETETRVVQDRTVLIKNTEKKDESLPSDNPDDVELVDDLLEEMYVSKSGNQPSTNGNEH
                     AAVGLKPILKQASQSSRFKRKKKGKQTKESKTVAFTHSEVREFDTTESVVNASSKVNT
                     APAIDPEELLSLEVIAGEMEHEGLDVDEDSSLPIEGEFDYDFEDEDDDSEDDISWIPD
                     SDSANGMLWSQVQKLRQEKERPKESAVVADIVETIPIPDDSNPIPDQPVSEVVLERSI
                     TEAPLPMEIVDEVNLGFNKNNSNDQEHLKTNPKTAKVSRFKRSLSNKSANVIENHTVQ
                     PKIIPPSIEKSDKIEEIIDPKPETEPTEVEPSNDISIVQPTLDYPSLNDDIDSMAKAY
                     VLGLYDDDIQTEGEVVNELKDFEKINAIVEARERKENSKQKQEGEEELPEDKSILTDV
                     MEHETDDDDEEEFELDEHAPIMSVEDTDLDIQLSTDQLDQQINLDYHTLRQKMVHLYN
                     GGFKKSEKEQEIEPIDENGNPIKISRFRAARLNLNV"
     gene            complement(<370881..>372110)
                     /locus_tag="PAS_chr1-3_0199"
                     /db_xref="GeneID:8196434"
     mRNA            complement(<370881..>372110)
                     /locus_tag="PAS_chr1-3_0199"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489498.1"
                     /db_xref="GeneID:8196434"
     CDS             complement(370881..372110)
                     /locus_tag="PAS_chr1-3_0199"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489543.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0199"
                     /db_xref="EnsemblGenomes-Tr:CAY67262"
                     /db_xref="GeneID:8196434"
                     /db_xref="UniProtKB/TrEMBL:C4QVI9"
                     /translation="MGFKFQRQGIAASVFLVLYAIYFGVAANIIWQKKTFNSFYTCLL
                     AFGLIRLGSQVCGIAFATLGYEHLNWLIAHLVLGAAEYFLLILTTFLVVSYAHKETLG
                     SSYMTKALFLIPLGFFKLDVDRLLLIHIGGILANFLVISGASTLAGLTPEQYLFDTNT
                     VNISNGLRITGQIILLAFNILAGLYALHSIIYLKIRSYFVFSVLLATPFLLVRGTYAV
                     VACFVDKLDSFSIENYTLSGMNPEFVITEYVLATTMEYIAASIFLSTFYLNKRQKNKI
                     MHAVLNEEEPEEEFEEKSEGNSGEKSEEKSEEKSEEKSEEKSEEKSEEKSEEKSEEKS
                     EEKSEEKSEEKSEEKSDVKSGEKSGEKSGEKSGEKSGDELDEKSEEKFEDELEGESEE
                     NLEESNNNHKESLEGGH"
     gene            complement(<372861..>373796)
                     /locus_tag="PAS_chr1-3_0200"
                     /db_xref="GeneID:8196435"
     mRNA            complement(<372861..>373796)
                     /locus_tag="PAS_chr1-3_0200"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489499.1"
                     /db_xref="GeneID:8196435"
     CDS             complement(372861..373796)
                     /locus_tag="PAS_chr1-3_0200"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489544.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0200"
                     /db_xref="EnsemblGenomes-Tr:CAY67263"
                     /db_xref="GeneID:8196435"
                     /db_xref="UniProtKB/TrEMBL:C4QVJ0"
                     /translation="MRITRILKQDNKLKNLLYSSIKPKSNNLLDFFDKPLSELTTKRP
                     IKDSILGLRETTKDKIVPSKVLKFICYDSMLDKSDFDHLIPHFHHRKFDFDDRAIKFD
                     VIKGRRSSKYGLKSNGNYYLIFPSKEWSTAFYLETLDKQIVGMNFKPKFIDPEGDVEN
                     GLAELKSPSSKSSFQDEVLPFSDLPWLKSHLKVSDYINLPDQPTQQDTNDVSELPSHE
                     PLKNTVTIPPIDRRNVVILRNMIPQMTAKELGEKLRDYSLYRVQDRAVWELENKLFIV
                     IFDNPDDARLVVRRFNGKHWKDDPNLPVVFAEVLE"
     gene            <374601..>376433
                     /locus_tag="PAS_chr1-3_0201"
                     /db_xref="GeneID:8196436"
     mRNA            <374601..>376433
                     /locus_tag="PAS_chr1-3_0201"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489500.1"
                     /db_xref="GeneID:8196436"
     CDS             374601..376433
                     /locus_tag="PAS_chr1-3_0201"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489545.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0201"
                     /db_xref="EnsemblGenomes-Tr:CAY67264"
                     /db_xref="GeneID:8196436"
                     /db_xref="InterPro:IPR028012"
                     /db_xref="UniProtKB/TrEMBL:C4QVJ1"
                     /translation="MIESTFDINSYLNVDAFEDLNDMDMVMHELTACEEEPVKFEVDT
                     KENPSVFVADISQKIEWSDNDMGLLLTEAVREENEAQDSAARRAETQIQPERKSENQI
                     STPVRMQEPVQFPIQTQFQIQSPVNQKVQTSGPIPVPSKISFQVLENNHTTPQFSEPR
                     RSRESSIEHLGTTPGGNSMFSLDGNTSSQDLDFFESSPQDVHRQFMLNSEEEVGPYNH
                     AIQDPPWETTTNQTFNFCSFNSVQFDPNCQSETIAEGYEADGHFNSQGGSLVEAIDVM
                     SVDGPVPVQVGGAQVVAQDTAFCSSEYVQNMLKKMVISTKTSSSESGCDAGEEINPQE
                     SKVIVEEIFPSQEEQMGFSSFSSQPGQELETHTANGGESLRTQSRHRRSLSANYSYFQ
                     AQDRKQVVPLEYFRIPNRIKAESFPPIRDGYYYISNSKAHDPYQPLVLRFREDDRSNV
                     EGLCPYCTVNVIDIRSYDEVFFNIKKSSYVHHLGKNHGVLSDGTRIPDPFLLIDDFVF
                     HEKKRGKQVSGVAEERTVHHMAAVCPHLDCMNMSSMTFHAMPDYNPSKGWFNRLLAYT
                     RHYYECHKKRNLERFIVEPNDENKRLFTQKMKGQLMNYEWKTIL"
     gene            <376933..>378369
                     /locus_tag="PAS_chr1-3_0202"
                     /db_xref="GeneID:8196437"
     mRNA            <376933..>378369
                     /locus_tag="PAS_chr1-3_0202"
                     /product="Essential subunit of Sec61 complex (Sec61p,
                     Sbh1p, and Sss1p)"
                     /transcript_id="XM_002489501.1"
                     /db_xref="GeneID:8196437"
     CDS             376933..378369
                     /locus_tag="PAS_chr1-3_0202"
                     /codon_start=1
                     /product="Essential subunit of Sec61 complex (Sec61p,
                     Sbh1p, and Sss1p)"
                     /protein_id="XP_002489546.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0202"
                     /db_xref="EnsemblGenomes-Tr:CAY67265"
                     /db_xref="GeneID:8196437"
                     /db_xref="GOA:C4QVJ2"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="InterPro:IPR019561"
                     /db_xref="InterPro:IPR023201"
                     /db_xref="UniProtKB/TrEMBL:C4QVJ2"
                     /translation="MSSFRVLDLVKPFTPFLPEVISPERKVPFQQKLMWTGVTLLIFL
                     VMSEIPLYGITSSDSSDPLFWLRMMLASNRGTLMELGISPIVTSGMVFQLLQGIQILD
                     VNMENKADRELFQTAQKVFAILLSIGQATVYVLTGMYGPPGELGVGVCLLLVLQLVFA
                     GIVVILLDELLQKGYGLGSGISLFMATNICEQIFWKTFAPTTVNRGRGKEFEGAFISF
                     FHLILTKKDKKRALLESFYRDNAPNMFQVIATLVVFFTVVYLQGFRLEIPVKSTRQRG
                     PYGTYPIRLFYTSNMPIMLQSALTSNIFIISQMLYSHFPDNAFVKLIGTWEAQPGSAQ
                     LFAASGLAYYMQPPMSLSQALLDPIKTVVYVVFVLTTCAIFSKTWIEISGSSPRDVAK
                     QFKDQGLVIAGHRDATVYKELKKIIPTAAAFGGATIGALSVVSDLLGTLGSGTSILLA
                     VTTIYGYYELAVKEGGFSKGGPSGFVDL"
     gene            <378490..>378918
                     /locus_tag="PAS_chr1-3_0305"
                     /db_xref="GeneID:8196438"
     mRNA            <378490..>378918
                     /locus_tag="PAS_chr1-3_0305"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489502.1"
                     /db_xref="GeneID:8196438"
     CDS             378490..378918
                     /locus_tag="PAS_chr1-3_0305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489547.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0305"
                     /db_xref="EnsemblGenomes-Tr:CAY67266"
                     /db_xref="GeneID:8196438"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:C4QVJ3"
                     /translation="MSRLGRVWNATAPLLERKSKFIGWSTPLTEISQLEPVLQEFTEC
                     HQKVLSKATHPKMYAWRLTDDAGKLLNQGSHDDGESGAGNRLLGLLELYKCRNVLVVV
                     SRWYGGIPLGPSRFRCISSAAQESLKIGGFITTKTKLNRK"
     gene            complement(<378944..>380332)
                     /locus_tag="PAS_chr1-3_0203"
                     /db_xref="GeneID:8196834"
     mRNA            complement(<378944..>380332)
                     /locus_tag="PAS_chr1-3_0203"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489503.1"
                     /db_xref="GeneID:8196834"
     CDS             complement(378944..380332)
                     /locus_tag="PAS_chr1-3_0203"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489548.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0203"
                     /db_xref="EnsemblGenomes-Tr:CAY67267"
                     /db_xref="GeneID:8196834"
                     /db_xref="UniProtKB/TrEMBL:C4QVJ4"
                     /translation="MSISNYYVATNSNDSGNHRQEQLEIPTNKTRSESFPKVSEQVHH
                     VPQQNLELQRLQQQLQGQQIQQQLQQHVNQSLQNVQPVQPMFDHQLQNQQQQQQQQQQ
                     QQQLQGIPSNSPSHYFRQPTQNLHNGNFNMNMNLNMNLLQQQQQQQQQQQQLARQYQQ
                     LQQQQQQHQHQQQALPPPQQQYFNQATEFPVTSQAITTLQHIQQQPTNYFQNSIFATR
                     KEAYLQYHDCPYESIRKENFWVKNNDNLTKISCQLKGCDFKVNIKKIRNTTKDSQTSL
                     PKEETLGFELKEIHAHNHQHLPTYQISDQMYIPVGLHKELQKLMELHPDTTSAKLLKS
                     YEINEVLGLNIDKFEKTTKSKLLRFMTRQRSKLKLSTPKHQKRKTDDFYQGSEQSKAD
                     SNGKTESVDLADADGQVPPKRQRTKADTTESEFYTQLQLDPTDSMLKNSLSDEDDMSA
                     MAQVTGISGKEE"
     gene            <380877..>382112
                     /locus_tag="PAS_chr1-3_0204"
                     /db_xref="GeneID:8196439"
     mRNA            <380877..>382112
                     /locus_tag="PAS_chr1-3_0204"
                     /product="Putative protein of unknown function with strong
                     similarity to alanyl-tRNA synthases from Eubacteria"
                     /transcript_id="XM_002489504.1"
                     /db_xref="GeneID:8196439"
     CDS             380877..382112
                     /locus_tag="PAS_chr1-3_0204"
                     /codon_start=1
                     /product="Putative protein of unknown function with strong
                     similarity to alanyl-tRNA synthases from Eubacteria"
                     /protein_id="XP_002489549.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0204"
                     /db_xref="EnsemblGenomes-Tr:CAY67268"
                     /db_xref="GeneID:8196439"
                     /db_xref="GOA:C4QVJ5"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="UniProtKB/TrEMBL:C4QVJ5"
                     /translation="MTIIGRLACQNNSFLRDIETQVVSQTPCQDATNELPPDRRGLIG
                     ENQLYLVELEDTVLFPEGGGQPSDTGIVASEDHSFDVIYVGRNGLNAVHYVIAPGDLP
                     LKVGDNVVVSVNWESRWDHMQQHTGQHLLSALLKIHFDVPTLGWGMGTGDTVLNYVEI
                     PRKLEDFEIEQLNLQIKATINQNLPISVVEHDEIHEEKGSMRDIRIGHLDNNSCCGTH
                     LQSSLQIKNVIALNQISGKKTNTRLQFIVGDRVNDFVSQSFSILKNLRNQLSCPDELI
                     PEKVAQLNSSIKASNTTEKKMLKELAEIKAQEIVASPSKIIFVDSEFSNDFTSNIFKL
                     SNKAIKDKTVILLSGKNQGSLIVYGENVKDTTDGISSVLEKSVLKGGGSPSKYQGKIQ
                     FEKNERNKLVKYLETISSH"
     gene            complement(<382190..>383221)
                     /locus_tag="PAS_chr1-3_0205"
                     /db_xref="GeneID:8196440"
     mRNA            complement(<382190..>383221)
                     /locus_tag="PAS_chr1-3_0205"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489505.1"
                     /db_xref="GeneID:8196440"
     CDS             complement(382190..383221)
                     /locus_tag="PAS_chr1-3_0205"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489550.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0205"
                     /db_xref="EnsemblGenomes-Tr:CAY67269"
                     /db_xref="GeneID:8196440"
                     /db_xref="UniProtKB/TrEMBL:C4QVJ6"
                     /translation="MRNPEHRSRRLLFKNVANTASTVVTTTLQTPTKEQFDLVLTDKQ
                     QRLNDTINARTITPSPKYTLNLNHKPSKLDLIDSSFTSFPLAPPRDNETGQDSTVSSD
                     MDATPEPRYDSPSIKKRILSTYLKELKRNSSRHDEDITLVEDYIPMPKTLGKKRVSIV
                     DFKQRMKRHHTQSTIYDDSGNCHQPSIIPGLFQSSSFASSLTPFGTSINELQKPLHVD
                     KFNETDLKYCVICEKPLYDLSSLIQNCPYKEIVCSDCRANYEVYFKVLEQLEAEEASN
                     GYDSDDSRFFVEEMPPEQSKEYQLIQGLRKIKAMDDLRRVQSLDEIQRRFGEKGNLWE
                     YIKNRLKKQ"
     gene            complement(<383439..>385151)
                     /locus_tag="PAS_chr1-3_0206"
                     /db_xref="GeneID:8196441"
     mRNA            complement(<383439..>385151)
                     /locus_tag="PAS_chr1-3_0206"
                     /product="Permease of basic amino acids in the vacuolar
                     membrane"
                     /transcript_id="XM_002489506.1"
                     /db_xref="GeneID:8196441"
     CDS             complement(383439..385151)
                     /locus_tag="PAS_chr1-3_0206"
                     /codon_start=1
                     /product="Permease of basic amino acids in the vacuolar
                     membrane"
                     /protein_id="XP_002489551.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0206"
                     /db_xref="EnsemblGenomes-Tr:CAY67270"
                     /db_xref="GeneID:8196441"
                     /db_xref="GOA:C4QVJ7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4QVJ7"
                     /translation="MSETTPLLPEIIEDPSTGTPGIVANELMQEEQLTKVYSSSRSTG
                     SLASSDGEYAVPSKQLYVIISSLFMCSYLSALDTTVVTTLLSTISSDLEEMDRSSWIA
                     TSYLLSCCAFQPLFGKISDIFGRKVMILLCIGSFAIGCLISSYSYSLWPLVISRYLAG
                     IGAGGMSVLGTVAMSDLISLRKRGVFQGGANIFYGLGSASGGVIGGLIADNWGWRAVF
                     SFQVPIALCCATAITICFHLPEGSPGNGYPNSDMWKKFQSIDFAGSILLATSLTGLVA
                     AAALGGHELPYGSASFILLVVISLGLLAWFAYIELHSEQPAIPIELLNTRTVLSACLA
                     NWFYSISVYSYMYYIPIYFTTSMDFSPTDNGLRMIPNFFGIAFGSVGSGIYMRKTGKY
                     LKFIAVTCLLGVLGTIRICFINPDISLFTQFTLTVVPGFGYSCMLTVTLLALIASVPM
                     EKQASTTSIQYAFRSTGSTIGVSLAAAIFRHGLSTTLGRNVSNALPDTEDPKIISEIL
                     QQALKSTDYIKEAPKWAIEAIRSSYDFSCHLVFYFCLITVTMGYVSVMMMREHKLHTS
                     VNRE"
     gene            complement(<385335..>386378)
                     /locus_tag="PAS_chr1-3_0207"
                     /db_xref="GeneID:8196442"
     mRNA            complement(<385335..>386378)
                     /locus_tag="PAS_chr1-3_0207"
                     /product="Essential protein involved in assembly of
                     cytosolic and nuclear iron-sulfur proteins"
                     /transcript_id="XM_002489507.1"
                     /db_xref="GeneID:8196442"
     CDS             complement(385335..386378)
                     /locus_tag="PAS_chr1-3_0207"
                     /codon_start=1
                     /product="Essential protein involved in assembly of
                     cytosolic and nuclear iron-sulfur proteins"
                     /protein_id="XP_002489552.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0207"
                     /db_xref="EnsemblGenomes-Tr:CAY67271"
                     /db_xref="GeneID:8196442"
                     /db_xref="GOA:C4QVJ8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR028608"
                     /db_xref="UniProtKB/TrEMBL:C4QVJ8"
                     /translation="MSLSLVHTFTGHTDKCWATSIHSKLPLLATVSGDRTCRVYNLET
                     KRLIVVLDDDSHSKTLSSVEWKPTGEFPSLAIGSFDSTISIWGNEEAVLEDEDNWTLM
                     AIIEGHENEIKGVSWSHDGVYLASCSRDKSIWIWEADDNNEEFECVFVVQEHSQDVKH
                     VTWHQHENVLASSSYDDTVKLFKQDDYDEDDWVNVADLTGHEGTVWSSDFEKKGERVT
                     RLSSSSDDGTIRIWKILHAADDQPSIDSKLPSTIKTDTNQDMWELETILPIIHHGPIY
                     SVAWGENGYIASVGSDGRIVVYKELNSKEWQIIISQPHSHGVYEINNIKWHGDRLITA
                     GDDGLVKLWELAL"
     gene            <386517..>388001
                     /locus_tag="PAS_chr1-3_0208"
                     /db_xref="GeneID:8196443"
     mRNA            <386517..>388001
                     /locus_tag="PAS_chr1-3_0208"
                     /product="Mitochondrial peripheral inner membrane protein"
                     /transcript_id="XM_002489508.1"
                     /db_xref="GeneID:8196443"
     CDS             386517..388001
                     /locus_tag="PAS_chr1-3_0208"
                     /codon_start=1
                     /product="Mitochondrial peripheral inner membrane protein"
                     /protein_id="XP_002489553.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0208"
                     /db_xref="EnsemblGenomes-Tr:CAY67272"
                     /db_xref="GeneID:8196443"
                     /db_xref="GOA:C4QVJ9"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:C4QVJ9"
                     /translation="MNQRILRLVRNYAVPAKKNAPKLTGGLQPLQGIQLKKQYIPRPN
                     QRVTYEHQPPPSPSELKAEKVIRKRRNPWLRFIPSLVVIGGTVWLLFSYNYFFVEDED
                     LEFLNPSEFKKYTITFKQQIDEDHYLIELTRKNRSKILNSMKLKMTSMWNGHRLWSVE
                     IKQPDISIVRKYTPLPLYVASNNSEEPFIKIINSEGEEGKMMLYIKTYPEGEMARWIS
                     QTPLYSDLELRGPFVDYEFPFHPLDKATDRPQLRNVLSKLPPDSELPEDMPSPDNYNF
                     FGAGTGISPFLQCLYSPNPPKGKVNLFHSANTEEEIPKVFSSLNYFLQKTSRLNYYRF
                     IRDKGEMITDVPASVVSNYRGYKDLKFVKEYEEKKLLKQKMEQLKSGNSTDDNSSTAA
                     AESQVKLAQLQDSEKQRVEPSLAKSKSTSYFDNALQLLLFKRESNDNSPSPASLSLVC
                     GPEGYISYISGTPDFNNPENIDAGEVSGLLGKKGWTKENVKRLQ"
     gene            <388190..>389002
                     /locus_tag="PAS_chr1-3_0209"
                     /db_xref="GeneID:8196444"
     mRNA            <388190..>389002
                     /locus_tag="PAS_chr1-3_0209"
                     /product="Target membrane receptor (t-SNARE)"
                     /transcript_id="XM_002489509.1"
                     /db_xref="GeneID:8196444"
     CDS             388190..389002
                     /locus_tag="PAS_chr1-3_0209"
                     /codon_start=1
                     /product="Target membrane receptor (t-SNARE)"
                     /protein_id="XP_002489554.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0209"
                     /db_xref="EnsemblGenomes-Tr:CAY67273"
                     /db_xref="GeneID:8196444"
                     /db_xref="GOA:C4QVK0"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:C4QVK0"
                     /translation="MSSFDEGIALEEQPIYQDLPDFNEKANKLSNKLIVISNDIQKLK
                     QSLGFFDKYLNKDYNYQQFNKYQKNALQLINKLMAQFRDITADKKYLMDLRFVDISAV
                     QKFQKDQLVNGISDNLNEFKELQNWFTRLDSKLNEMEVVEQEARIQQQQQQQAQEGEQ
                     IIIEYEPINAAELEYQQDLINERELEIENIANGIVELNELFQDLGTLVTSQGELMDNI
                     ENNLYSVVDDSRAGHSELRRAEAYQKRSTGLCMWLLVILAVILLFILLIIFA"
     gene            <389319..>389741
                     /locus_tag="PAS_chr1-3_0210"
                     /db_xref="GeneID:8196445"
     mRNA            <389319..>389741
                     /locus_tag="PAS_chr1-3_0210"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489510.1"
                     /db_xref="GeneID:8196445"
     CDS             389319..389741
                     /locus_tag="PAS_chr1-3_0210"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489555.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0210"
                     /db_xref="EnsemblGenomes-Tr:CAY67274"
                     /db_xref="GeneID:8196445"
                     /db_xref="GOA:C4QVK1"
                     /db_xref="InterPro:IPR007763"
                     /db_xref="UniProtKB/TrEMBL:C4QVK1"
                     /translation="MSSSIQRTLRNLWKNGFKKSFKQLQGYNDIKSGRLVGTDSFGNK
                     FYEVDDPVEIHMRTRFVEYTGFWRQDMSEVEPGWHYWLAYGTDVPPNQLKPEEKSVRA
                     YPVKKHVPNLTYTDGAYVPYNTARPKCATWDPKVTERP"
     gene            complement(<389860..>390987)
                     /locus_tag="PAS_chr1-3_0211"
                     /db_xref="GeneID:8196446"
     mRNA            complement(<389860..>390987)
                     /locus_tag="PAS_chr1-3_0211"
                     /product="Deoxyhypusine synthase, catalyzes formation of
                     deoxyhypusine"
                     /transcript_id="XM_002489511.1"
                     /db_xref="GeneID:8196446"
     CDS             complement(389860..390987)
                     /locus_tag="PAS_chr1-3_0211"
                     /codon_start=1
                     /product="Deoxyhypusine synthase, catalyzes formation of
                     deoxyhypusine"
                     /protein_id="XP_002489556.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0211"
                     /db_xref="EnsemblGenomes-Tr:CAY67275"
                     /db_xref="GeneID:8196446"
                     /db_xref="GOA:C4QVK2"
                     /db_xref="InterPro:IPR002773"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:C4QVK2"
                     /translation="MANIEGKLPDILSESVLKSSVPVPEDFVEVKGIDYDKPESRNMK
                     AKDLIKGMRTMGFQASSLSEACEIIDEMRQWRGKHIDDLEEHDRKGEFDGEGYQKSTI
                     FMGYTSNLISSGLRDTLRYLVQNKMISAIVASAGGIEEDLIKCLAPTYMGDFALKGKG
                     LRDQGMNRIGNLLVPNDNYCKFEEWIVPILDSMLEEQEQNVVSKGVDALDGDAMVWTP
                     STVIDRLGKEINDETSVLYWAHKNKIPVFCPSLTDGSIGDMLFFHTFKASPKQLRIDL
                     VNDIRRINSMSMEASKAGMLILGGGLIKHHIANACLMRNGADWAVYVNTGQEFDGSDA
                     GARPDEAVSWGKIKAEARSVKVFADVTLVFPLMVAATFASE"
     gene            complement(<391121..>392590)
                     /locus_tag="PAS_chr1-3_0212"
                     /db_xref="GeneID:8196447"
     mRNA            complement(<391121..>392590)
                     /locus_tag="PAS_chr1-3_0212"
                     /product="Lanosterol 14-alpha-demethylase"
                     /transcript_id="XM_002489512.1"
                     /db_xref="GeneID:8196447"
     CDS             complement(391121..392590)
                     /locus_tag="PAS_chr1-3_0212"
                     /codon_start=1
                     /product="Lanosterol 14-alpha-demethylase"
                     /protein_id="XP_002489557.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0212"
                     /db_xref="EnsemblGenomes-Tr:CAY67276"
                     /db_xref="GeneID:8196447"
                     /db_xref="GOA:C4QVK3"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:C4QVK3"
                     /translation="MPGISSIELLVLTVVFLTVFHFIIYPLCFHPLSNVPGPKIAAIT
                     RQWILYQTWSENRNKTILKLHEQYGTIVRIGPNEVDISDASYIKDIYVKNLDKSTFYR
                     QFGAYGAYNTFSEIEKTPHLERKKVTSKFYSKTNVATNPLQSRMRSIIDQTIDRIKST
                     QHSIDVYNLFQQMALDVMCVFSFGTEVYDKPLVRQPEKAQDLVNNFRWASSTWFWTTL
                     VPFLEPYVISQHVKDAACKTATWVMDFSAQASTCSDLEHGSKPLTLVGVLKNSGLDMN
                     HVASEVIDHVVAGHETTGITLAYLLYELAANPDIQRTLKDELKVYQEKDYDFSQIDVL
                     PYLEAVLQETFRLHAAIPGQEPRVTPIGGMKWRGNEQVPSMTIPGGTIVTMEPWTLHR
                     DAKVFPDPLVFKPERWLADEHSLFPMKRQILTFGAGVRMCIGKNLAIQEMKLLLVGLL
                     RNHHVVLDPSVDYESDVVMADKYTTHPANHRLFLTFCRD"
     gene            complement(<392782..>394197)
                     /locus_tag="PAS_chr1-3_0213"
                     /db_xref="GeneID:8196448"
     mRNA            complement(<392782..>394197)
                     /locus_tag="PAS_chr1-3_0213"
                     /product="Protein kinase"
                     /transcript_id="XM_002489513.1"
                     /db_xref="GeneID:8196448"
     CDS             complement(392782..394197)
                     /locus_tag="PAS_chr1-3_0213"
                     /codon_start=1
                     /product="Protein kinase"
                     /protein_id="XP_002489558.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0213"
                     /db_xref="EnsemblGenomes-Tr:CAY67277"
                     /db_xref="GeneID:8196448"
                     /db_xref="GOA:C4QVK4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C4QVK4"
                     /translation="MPTIKLADYKTIANLGSGKSGKVILVESVQTKLQYAVKVISLKE
                     KKPSIDFYNYNNLSRIQNEVKLLTLINKYHHENILEFIGMVQSSSNNYIFLEFCAQRE
                     LSPSLFRKLTMVESLSYVRQLVNGILFIHQLSIIHRDLKPSNILINEAGTLKISDFGI
                     SYKLTNDDKIDRFELSNLVGTPLFVGPELVNFNNTKMHLGFPIDYWAFGITLFYLYFD
                     YFPFFNDNEYKLFNDTLTKELELPLYEELTTTDRDSQFFSYLLRIISALLNKDPTERL
                     SLNQLQHDEFLLNGMSKKEVKRFLNYNNTLLHHKSSPLSLFRLKPSRSKTSKLNISNP
                     LKETFEHIKDNHLSSIDQAHKQRFQLNESSVSLPIKPNSMTISPLKNRFDDTLFKRSP
                     SPLKAPSVFPKPTIAIHPEERTSMHTLPNDLSELSPQYQTNLIKSKGYNNLNNVLKSQ
                     APHFLDMNEYWDQVERNHEQS"
     gene            <394737..>396632
                     /locus_tag="PAS_chr1-3_0215"
                     /db_xref="GeneID:8196449"
     mRNA            <394737..>396632
                     /locus_tag="PAS_chr1-3_0215"
                     /product="Polyamine transport protein specific for
                     spermine"
                     /transcript_id="XM_002489514.1"
                     /db_xref="GeneID:8196449"
     CDS             394737..396632
                     /locus_tag="PAS_chr1-3_0215"
                     /codon_start=1
                     /product="Polyamine transport protein specific for
                     spermine"
                     /protein_id="XP_002489559.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0215"
                     /db_xref="EnsemblGenomes-Tr:CAY67278"
                     /db_xref="GeneID:8196449"
                     /db_xref="GOA:C4QVK5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4QVK5"
                     /translation="MSTRSLHSIDSLVPDVPENGEYRVTEFAPQEEEGHNHYHPLSQL
                     SSVLSHVAHHDREDELELEKLVTQNKEGIERKISRITSRAGTLGPVEKMVDAPLAIAD
                     PDPNSTIHELDEWKYQVDRETNLRLVEFVPGDKVNPKNFSKARKWVITFVLGLVCFNV
                     AIGSAIVTGEMLGPQVDLHASEEVVILASVTMFVLAFGIGPLILSPLSEEFGRNMVYI
                     PTLFLAIVFIIPCALAQNIATLIVCRFIDGLFFSGPMTLIGGSLADCWLEDERGLAMA
                     IFSAAPFLGPVIGPLIGGYLGMYKGWRWNYWLLMIFTGFCYCLLLVTIPETHAGTLLK
                     RRAKKLRKVTGDPSYRALVELRIRSTREMVDETLLRPLILLREMIVFLITVYMSIIYG
                     LLYMFFFAYPIVFMEGKGWNAGKTGLTFIPIAVGIFIAVALAPLFNKDYNKRAQKYRD
                     QGLLPPPELRLIPMMIGCWTVPMGLFAFAWSSYPRLSWAGPSISGLACGIGFTLLYNP
                     ANNYIVDSYQHYAASGLAAKTFLRSIWGASVPLFTVQMYHRLGYQWATSLMAFISLAC
                     CAIPFMFFIFGARIRQRSKYAYTGEGSEKSNSLDQKATNNNTVTSLAPSFSSANNESY
                     KTSSENV"
     gene            <396823..>399285
                     /locus_tag="PAS_chr1-3_0216"
                     /db_xref="GeneID:8196450"
     mRNA            <396823..>399285
                     /locus_tag="PAS_chr1-3_0216"
                     /product="Non-essential protein of unknown function"
                     /transcript_id="XM_002489515.1"
                     /db_xref="GeneID:8196450"
     CDS             396823..399285
                     /locus_tag="PAS_chr1-3_0216"
                     /codon_start=1
                     /product="Non-essential protein of unknown function"
                     /protein_id="XP_002489560.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0216"
                     /db_xref="EnsemblGenomes-Tr:CAY67279"
                     /db_xref="GeneID:8196450"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:C4QVK6"
                     /translation="MAPSLNDIMNLRKQRSNSHVMDTPSAPRNIDSLSSYRSRSVSSN
                     TSLNDLMFDTMPTQQSPPAHSLDRLMSMATVSNIKKKLSLPTSIGPGRKGSINSDLLS
                     VVSTESANKSPSIISDTSNYLSVSNSGEHLKKEEQLLINVLATGGFTSQITKMNHVKG
                     SSHLPIELFMCRSENNVYLPYVDPKKFRGSAIENLLQESGDEDYEDRYDNCNSESSRS
                     GTPKPADALETDRLNHSIVVIIKLKKSALLTPKVRIRYQTLVTAFWPLGYIDDEDKLI
                     HHECYKVAKDVDWDLSLDEANHFIPFKEDSEYSVSDSSGSGDDDGTGVFSIPYNNVKT
                     LELLKVSQYQDYDEDKLKMIPDDETRKGGYVYKPGYYCFTLSVMIPNVAPESTNLIYS
                     KLQHQVVAQLQKNLVSNIPEPELSYSMSPRSSELSRFNFLRRKSESVELEPETFKADI
                     PVVRLPPPMGTTTFNKSIYVNKVWGNALNYEVLLPQKYVRLTNSNENATMNLQLKLVP
                     LIKDIQLKRIKINVLERVKYVSKDMTHEYRYGDIPNSKTKSQKERKITLFEIRTRDKS
                     KHESLRTEVIKNCQDDNLLTACFNNGDVKSRKMRQKTDEIVITNPVKVSCPLTFKAAF
                     PGKEQTYGLNPDFTTFTSVVVKHRLQICFRISVPEEGNSEKFHHYEVIIDTPLVLISP
                     DCKDDILTLPDYSENPRSGFSLTSTQKDQEDSDNLPTFEEAVLQPSSPLMQPSSSTDM
                     AALQRRLSATDSMMSFSGLDNEFNTIDDVLNNADALSGSIPNEVFFKKDIQFGANLSQ
                     FHEDTVGPRDKPPSYQDAIDQK"
     gene            complement(<399372..>400175)
                     /locus_tag="PAS_chr1-3_0217"
                     /db_xref="GeneID:8196451"
     mRNA            complement(<399372..>400175)
                     /locus_tag="PAS_chr1-3_0217"
                     /product="Protein involved in assembly of mitochondrial
                     respiratory complexes"
                     /transcript_id="XM_002489516.1"
                     /db_xref="GeneID:8196451"
     CDS             complement(399372..400175)
                     /locus_tag="PAS_chr1-3_0217"
                     /codon_start=1
                     /product="Protein involved in assembly of mitochondrial
                     respiratory complexes"
                     /protein_id="XP_002489561.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0217"
                     /db_xref="EnsemblGenomes-Tr:CAY67280"
                     /db_xref="GeneID:8196451"
                     /db_xref="InterPro:IPR024621"
                     /db_xref="UniProtKB/TrEMBL:C4QVK7"
                     /translation="MSSVAYRLTPGLRTRPLHAVQFGLRFKSTTPPPQSGGGAKGVVP
                     SINKIGIPMKSYIPPSFNRLNFLSHPIISIKCLLRRCGLLALNTYQVLDIRKNIGKPD
                     FVLWKNNSIENFILVNKLFANGHLKPLKSKVSSFVFKSLESRLKSLPENTKLDWKLLK
                     FNKPPKLVNLHNFPNDDGSTMCVQVIYKFDTQQRLITVKNGSDATTFDRNLVQYVGFN
                     VDPYSNEVVLAGSLFESDLTTKISDSQANPTQRQLLDTMARNGDIFRNQ"
     gene            <401261..>402358
                     /locus_tag="PAS_chr1-3_0218"
                     /db_xref="GeneID:8196452"
     mRNA            <401261..>402358
                     /locus_tag="PAS_chr1-3_0218"
                     /product="Probable catalytic subunit of a mannosylinositol
                     phosphorylceramide (MIPC) synthase"
                     /transcript_id="XM_002489517.1"
                     /db_xref="GeneID:8196452"
     CDS             401261..402358
                     /locus_tag="PAS_chr1-3_0218"
                     /codon_start=1
                     /product="Probable catalytic subunit of a mannosylinositol
                     phosphorylceramide (MIPC) synthase"
                     /protein_id="XP_002489562.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0218"
                     /db_xref="EnsemblGenomes-Tr:CAY67281"
                     /db_xref="GeneID:8196452"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4QVK8"
                     /translation="MKTELKILIWAHIALVLFLCYETFDLMTLLYDDTFKDSLLDSDL
                     NSDISSRPQLIPKIIHQTYKTNDIPEIWQDGQKKCQELHPDYKYIMWTDEMARNFISE
                     EYPWFLKTFDSYKYNIERADSIRYFVLNHFGGIYIDLDDGCARRLDPLLSVPAFVRKT
                     TPSGISNDVMGSVPRHPFFIKTIKSLESYNRNWLVPYITIMYSTGPLFLSVIWKQYKR
                     WGVPESGVVRILQPADYKSGPNAFFNITEGSSWHLGDAKFIKSLADHIGTAVIGGFLI
                     AIAILSVEFAIYLSLVALANSRAMKKCISFIKDIPSRFSRDSEIDENKVNNHIYKIAL
                     LKRRNRKDSNLPVVHIDVADDIEKQIMNQPM"
     gene            complement(<402413..>403903)
                     /locus_tag="PAS_chr1-3_0219"
                     /db_xref="GeneID:8196453"
     mRNA            complement(<402413..>403903)
                     /locus_tag="PAS_chr1-3_0219"
                     /product="Cis-golgi GTPase-activating protein (GAP)"
                     /transcript_id="XM_002489518.1"
                     /db_xref="GeneID:8196453"
     CDS             complement(402413..403903)
                     /locus_tag="PAS_chr1-3_0219"
                     /codon_start=1
                     /product="Cis-golgi GTPase-activating protein (GAP)"
                     /protein_id="XP_002489563.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0219"
                     /db_xref="EnsemblGenomes-Tr:CAY67282"
                     /db_xref="GeneID:8196453"
                     /db_xref="GOA:C4QVK9"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C4QVK9"
                     /translation="MGRRKGYQKITEMSQVDHKSNKGGLMQANGSGSLPFFFKSLTNG
                     SSNSVDRPSIDSRRSSHRWDSETSSPKPMKFQDDDEDWDDDILSDLTIKGEKFPPFRG
                     DDDTTKYLNSIVNQPDSISVKEPTVELQKSPLNKSIRKNFKSLIKDPLSLLSDLDLAE
                     EKKIYGVKFEKFYSILQDEQTNEEQELNKLQNLSWNGIPKRLRMIIWQMLLRYMPINN
                     SRRVAQLERKRQEYQQSLSEMFKDSKKDNNVWHQISIDIPRTNAHVKFFSNTKIQDSM
                     SRILYIWAIRHPASGYVQGINDLVTPFFHVFFENYMENDFNVQEDDIEELSQSTGFED
                     ILKAVEADTFWCLTKLLDTIQDNYIHEQPGIHRQISNLVKISEKVDNALTEHLEEHGL
                     QFIQFAFRWMNCLLMREFRLELVIRMWDTYLSEFPQGFKDFHVFVCCAFLMKFSEELK
                     EMEFQDLIMFLQDNSKTSHWNDKDIELLLSEAFIWQSLYKNQLTYT"
     gene            <404112..>405281
                     /locus_tag="PAS_chr1-3_0220"
                     /db_xref="GeneID:8196454"
     mRNA            <404112..>405281
                     /locus_tag="PAS_chr1-3_0220"
                     /product="NAD-dependent 5,10-methylenetetrahydrafolate
                     dehydrogenase"
                     /transcript_id="XM_002489519.1"
                     /db_xref="GeneID:8196454"
     CDS             404112..405281
                     /locus_tag="PAS_chr1-3_0220"
                     /codon_start=1
                     /product="NAD-dependent 5,10-methylenetetrahydrafolate
                     dehydrogenase"
                     /protein_id="XP_002489564.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0220"
                     /db_xref="EnsemblGenomes-Tr:CAY67283"
                     /db_xref="GeneID:8196454"
                     /db_xref="GOA:C4QVL0"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="UniProtKB/TrEMBL:C4QVL0"
                     /translation="MGHLENKNMIPKYGTCLHHYTDSPPSQSAPHLHLRTESNLIKKL
                     NFFDCIYCLISYLESSTKPDLSPKSIHRRAAMSYRAGKTILASTIAKKYSEELTSVTS
                     KMATKPKLVGLLGNQDPAAKTYAEWTARTCESLGFQYELIQCPKENLEDEIYKCNQDD
                     AVNGIMVYFPVYNDGQDQYLQQCVSIEKDVEGLNFKYVSNMYHNIRYLDAPENTKKSI
                     LPCTPLAMVKILEYLGVYNTLLPYGNRLFGKTITIVNRSEIVGRPLAALLANDGATVY
                     SVDINNVQKFERGDGLQLKSHRVVDTEFELKDVAPKSDVIITGVPSSNYKFPLEYVKD
                     GAVVINFSSEKNFDDRIKDIASLYVPSIGKVTIAMLLRNLLRLMNNKKPHSVEEI"
     gene            complement(<405553..>408720)
                     /locus_tag="PAS_chr1-3_0221"
                     /db_xref="GeneID:8196455"
     mRNA            complement(<405553..>408720)
                     /locus_tag="PAS_chr1-3_0221"
                     /product="Nuclear pore-associated protein, forms a complex
                     with Thp1p"
                     /transcript_id="XM_002489520.1"
                     /db_xref="GeneID:8196455"
     CDS             complement(405553..408720)
                     /locus_tag="PAS_chr1-3_0221"
                     /codon_start=1
                     /product="Nuclear pore-associated protein, forms a complex
                     with Thp1p"
                     /protein_id="XP_002489565.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0221"
                     /db_xref="EnsemblGenomes-Tr:CAY67284"
                     /db_xref="GeneID:8196455"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="InterPro:IPR017173"
                     /db_xref="InterPro:IPR024293"
                     /db_xref="UniProtKB/TrEMBL:C4QVL1"
                     /translation="MSAFGVVPSVLNTGNQIKQKNGTLFKKSSGVYNKQQRDHNSRDK
                     KRSARKTNTPPTPTESTSAKKSSTQSDDKVSPDILQLSHIEIQYVGPLLSNPESLGYV
                     KQNNNTKIKTPKYLVDTDSNLVFGPDTTNKWDIENQHKMIEMESSHQGDWQGIYEQFQ
                     EMNKVERQKMEDLGLVAKEGQSMDLTNAISFKGSCVDMCPVYDRVKREVQRDVDPLER
                     DPATGKISRERALKKFVRPSGQAPPLPSDVRPPHILVKSLNYIVDNLLDKLPQSHSLI
                     WDRTRSIRQDFTLQSYSGLEAIECNERICRIHLLCAHIMPGSDQSDFSKQQEIEQFTK
                     SLKTLTDIYDVVRSKGGKCANEAEFRAYNLLVHFRDPNLIHEIQNLPTRILKDERVQL
                     ALMFRSLLLNNNFKEYQRNIPGCLGVFQQFFNMCFDPATPFLIGCVLELNFEEIRFYA
                     LKSISRSYHKKSAPLTTQKLASMLGFDSEDKLLTFTNYFKTPTCTNSRNETCIDISKL
                     RYESFTDLAAPKQIYTSRLDNKLKGFTYKDVVDQGLNNTSLHIANLKETMAQNQHIAV
                     EKLPNISFPQHALSSTPFEVESKSDIVRSSSGSAPPQTLIPPIQEKVITSQIQPPITP
                     VVPTEEIQTLPKIEEPRFKDLPNFENACKEVSSILIKKTISPLIAPIVNNQLEEYNRR
                     QTVLRDQERQNQRRQLLISSLQEELYSAFIREQVYIQVVDTQAKECFNKNLKRRIFQK
                     FIGGLITLKNKQMNKRRKLDEIQVFKNKVVSSSQLRYSVSRSQTEDNSTSNSSDEEAS
                     AVQMNITLSPSVDPLWSPIDIKFILDSNLKLFEDNKDKYWNFMFAIADWTILPSKWLR
                     YKFQLQNPSLINTVESSNYKAKLRALPSDKLLTREYMEHCRFLVFQVGKVDESSNLKE
                     SLFRDSQFINRLMKYAKKYSQYQIGVLVLYYHEDDSFDKQKIIDLLLLEQYTNKLVNS
                     LEIVDMNKLTNDELIKALTTLVHNYKDKGINKSVPTSSTKGHTTSIMEQDMTVYSYST
                     SNSRDAKLNYILKQAYPRRGFHLKQ"
     gene            <409074..>412721
                     /locus_tag="PAS_chr1-3_0222"
                     /db_xref="GeneID:8196456"
     mRNA            join(<409074..409198,409265..>412721)
                     /locus_tag="PAS_chr1-3_0222"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489521.1"
                     /db_xref="GeneID:8196456"
     CDS             join(409074..409198,409265..412721)
                     /locus_tag="PAS_chr1-3_0222"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489566.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0222"
                     /db_xref="EnsemblGenomes-Tr:CAY67285"
                     /db_xref="GeneID:8196456"
                     /db_xref="GOA:C4QVL2"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR025651"
                     /db_xref="UniProtKB/TrEMBL:C4QVL2"
                     /translation="MPGKICSPYDTSFFENSLSLRVDGAIGAMSLSPCSRDAVLAGRN
                     GLVVIDLDDPFAQPRHLHHVTSWEVADVQWSPHRSRAEWAVSTSNQKALVWNLSRPSS
                     DAIEHVLHLHTRAITDINFHPQDPNVLSTCSVDTFCFSWDLRTPRLPVGKYTDWRAAA
                     SQVKWNYRDPNILASAHNNHFYIWDVRKGAVPLMKVDAHDGRINGLDFSKHNRSELIS
                     CSNDMSVKVWDYEKDSLNFQSCIRTDFPVSRARHIPFAKDCVGIMPARGGNNCIYISN
                     FRDEEQLDEEKTTKLKPLYVFKGHSEPVRDFLWRTRYQENDKNIDNREFQLVSWSKDC
                     DLKLWPITDDLYTKFGHERNKPLPAGTVLEKYTYQTFREEPESPSTKFNVDLQSPWLN
                     ATILRRRKKNKIINGNAEYDGQQQEHLNWISGVRIGKPSINPSNDEADKEAIADTNLF
                     FGADTAQPYNLGEEVSIVGHKFPNVRFEKISVSTGELIVSLYGPWGDPVEGDDDYDSD
                     LIYLRLDLFFPEEYPSQPSSSNRNFRFSLEENHNLNPEKKKAIIEGLNEISTKYMAHN
                     RCFLEPYLRFLMGEKVDLDLEEDLLPLDPFDIPYDSDNDGDDHLTRPQTLSDSEEEEE
                     DDDLVPMKSSVDAIPIRSTPGFDSTPIPKGCGAVWTSSGHLVCFFLPKQDKAKNILMD
                     FDHQGFGIASGRNDENFEQQNDDVESNASEDSFTKDWNDIIQGDIKEPGLFGNFKGGV
                     SGAQLGPSKSVTEKSIEDQNFKSGKHNKNLVRIYDFRHLIPAKMELAFEYRLLGETPD
                     RLAKYNAEIAEKHGYKELADCWNLLSVVLVTDVEIERYDNDQIDGLDIYHLGTLSKMN
                     HKFFWGAHPFGRRVLVKRIIDYYEKLQNVQMLAMLSCILTENYEDSNNPNTVAVSKRL
                     EGKIDERPSMVFNGTNFSNSAAELGRNRIESISSTMSTFDGVSLRSGNSFEKTAGSSQ
                     KRGIHYGNNSSNMPLQMALENKSSSQTRSLIQKPSNPALPVVRLEMVNHPNMDLYEDV
                     YYMPLLDSSESKFKKYRDEYASLLFAWGLPVNSIKMLKFNYPRKENECSPEDSNFNAE
                     FKGKYKTVVEKDALYKKMRKLSLKSSQDDPQLERDRVFFNSFKYALSLRQRMCHYCCT
                     AAKRRVFVCQKCQHILHASCAVQWWEQDHQTMCPSGCGCECLVHHSE"
     gene            complement(<414994..>420189)
                     /locus_tag="PAS_chr1-3_0225"
                     /db_xref="GeneID:8196457"
     mRNA            complement(<414994..>420189)
                     /locus_tag="PAS_chr1-3_0225"
                     /product="Catalytic subunit of 1,3-beta-D-glucan synthase"
                     /transcript_id="XM_002489522.1"
                     /db_xref="GeneID:8196457"
     CDS             complement(414994..420189)
                     /locus_tag="PAS_chr1-3_0225"
                     /codon_start=1
                     /product="Catalytic subunit of 1,3-beta-D-glucan synthase"
                     /protein_id="XP_002489567.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0225"
                     /db_xref="EnsemblGenomes-Tr:CAY67286"
                     /db_xref="GeneID:8196457"
                     /db_xref="GOA:C4QVL3"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:C4QVL3"
                     /translation="MISNESQEISDQPEIETPFNEPYYSWVSNKESPLTKEEILSIFL
                     KLGNIFGFQHDSVMNMYDHYMVQLNSRCSRTEPHVALVSLHSDYIGGEHSNYRKWYFI
                     TQLEFDPDFEWVLNDKKSNRKSMYTKKDTDYPDEYSLANLKASNLFNAIQYRWKQRCY
                     QLSTSDLTEQVALYLLIWGEANQLRFMPELICFIYKTALDFLNFTKANEDISLFFPEF
                     DYLDRVVTPIYNYIRDQQYHLRENCYVQRERDHNRVIGYDDVNQFFWYYDNYKKLRLL
                     DKTKLISLPSYEWYSKLGEVKWEKVFYKTYKENRSWWHLATNFNRIWVIHLCMFWYYT
                     CFNSGTLYTKDYSQLLNNQPTPAAVLSSCSLAGVIACLVQIIAVFCEWTFLPATWFYT
                     KTIILKLLLMFFLFCINLAPSVYIFGFIPLDVFSHNAFILSIVQFVISIITVLFCSIQ
                     PLGRIVGCFNRNQISAQDIFTASYPRLSTRSQILSHLIWILIFGAKFTESYFFLTLSL
                     RDPIRNLSNLEMTRCIGDALIGKVLCQHHPKVVLVLMFLTDLILFFLDTYLWYIIFNI
                     VFSVGLSFSLGISVLSPWRNIFTRLPQRIYSKILSTSEMEVKYKPKVLISQIWNAVVI
                     SMYREHLLSVDHVHRLVYNQIPDEADGRTTLRQPSFFVSQDDSSLTLKDYLIPFSEAE
                     RRVSFFAQSLSTPLPEPVSTQAMPIFTVLVPHYGEKILFSLKEIIKEDQNSRLTLLEY
                     LKQIYPIEWGCFVNDTKLMAHATGDYEFPELDMTSKELESRLLESKTYDLPFYCVGYK
                     SSSPEYTLRTRIWASLRGQTLYRTVSGFMNYFKAVRLLHRVENPDILEDVIETEFLED
                     YLDCVARNKFHLIVSMQRYQQFSEREMEDTMAILKVYPDLKIVSLEKVEVGEECFFYS
                     VLYSGRNKNEDGTLAPVYRIRLSGNPILGDGKSDNQNHALIFYRGEYIQVIDANQDNY
                     LEECLKIRSVLAEFEEMEIDTTSPYIPGVADKNNSPVAIVGAREYIFSENSGVLGDVA
                     AGKEQTFGTLFARTLAEIGGKLHYGHPDFLNAIFMTTRGGISKAQKGLHLNEDIYAGM
                     NALMRGGRIKHCDYYQCGKGRDLGFGSILNFTTKIGAGMGEQMLSREYYYLGTQLPLD
                     RFLSFYYAHPGFHINNLFIILSVQTFMLVLLNLGALSYESIKCIYDKNVPITDLQIPI
                     GCYQITPVLDWVSRFVFSIFICFFISFAPLFIQELIERGVYKAFSRLFLHFLSLSPLF
                     EVFVCQIYSNSLKSDLVFGGAKYISTGRSFAITRNSFTHLYANYAPTSIYSGARLFLV
                     LLFATLSMWKPALLWFWITLVALCVSPFIFNPHQFVILEFFLDYREYIRWLTRGNSKW
                     HQNSWIGFTRSGRSRILGTKKPERNQDFTHAISMTHRTSLASTFFVELIIPIIQAVAA
                     FIAYTFVNSQNGVKNVEATHSVIRIIIVTMLPIVLNIVTLLVVFILSCLTGPIFSVCF
                     KNTASLLAGIAHGMGLFNHVLAFLVLWLLENWNFTRTLAGLICSIFIQRAILQGVKIL
                     LLTRETLLDSSNRAWWSGKWIGSGLGVLILSQPLREFLVKIIELSLFAADFVIGHTIL
                     FVISIFLLVPFVDQWHSSILFWLKPTRKYRGRIYSLKQKARRRRSAIRYFLIFIIILI
                     VFVGLIVGPIVSAKFIPNMQQFIPEQGHGLFQPTGQNNNDTGPNAPSTIPTQKPEPRT
                     WSTWA"
     gene            <420955..>422571
                     /locus_tag="PAS_chr1-3_0226"
                     /db_xref="GeneID:8196458"
     mRNA            <420955..>422571
                     /locus_tag="PAS_chr1-3_0226"
                     /product="Beta-1,3-glucanosyltransferase, required for
                     cell wall assembly"
                     /transcript_id="XM_002489523.1"
                     /db_xref="GeneID:8196458"
     CDS             420955..422571
                     /locus_tag="PAS_chr1-3_0226"
                     /codon_start=1
                     /product="Beta-1,3-glucanosyltransferase, required for
                     cell wall assembly"
                     /protein_id="XP_002489568.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0226"
                     /db_xref="EnsemblGenomes-Tr:CAY67287"
                     /db_xref="GeneID:8196458"
                     /db_xref="GOA:C4QVL4"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR012946"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C4QVL4"
                     /translation="MFKSLCMLIGSCLLSSVLAADFPTIEVTGNKFFYSNNGSQFYIK
                     GVAYQKDTSGLSSDATFVDPLADKSTCERDIPYLEELGTNVIRVYAVDADADHDDCMQ
                     MLQDAGIYVIADLSQPNNSIITTDPEWTVDLYDGYTAVLDNLQKYDNILGFFAGNEVI
                     TNKSNTDTAPFVKAAIRDMKTYMEDKGYRSIPVGYSANDDELTRVASADYFACGDSDV
                     KADFYGINMYEWCGKATFSNSGYKDRTAEFKNLSIPVFFSEYGCNEVQPRLFTEVQSL
                     YGDDMTDVWSGGIVYMYFEETNNYGLVTIKSDGDVSTLEDFNNLKTELASISPSIATQ
                     SEVSATATEIDCPATGSNWKASTDLPPVPEQAACQCMADALSCVVSEDVDTDDYSDLF
                     SYVCENVSSCDGVSADSESGEYGSYSFCSSKEKLSFLLNLYYSENGAKSSACDFSGSA
                     TLVSGTTASECSSILSAAGTAGTGSITGITGSVEAATQSGSNSGSSKSSSASQSSSSN
                     AGVGGGASGSSWAMTGLVSISVALGMIMSF"
     gene            <423294..>424901
                     /locus_tag="PAS_chr1-3_0227"
                     /db_xref="GeneID:8196459"
     mRNA            <423294..>424901
                     /locus_tag="PAS_chr1-3_0227"
                     /product="Beta-1,3-glucanosyltransferase, required for
                     cell wall assembly"
                     /transcript_id="XM_002489524.1"
                     /db_xref="GeneID:8196459"
     CDS             423294..424901
                     /locus_tag="PAS_chr1-3_0227"
                     /codon_start=1
                     /product="Beta-1,3-glucanosyltransferase, required for
                     cell wall assembly"
                     /protein_id="XP_002489569.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0227"
                     /db_xref="EnsemblGenomes-Tr:CAY67288"
                     /db_xref="GeneID:8196459"
                     /db_xref="GOA:C4QVL5"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR012946"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C4QVL5"
                     /translation="MLSILSALTLLGLSCASDLTPPIEVTGNKFFFSNNGSQFYMKGI
                     AYQQDTSNSTTGDNFIDPLANVEACRRDFPYLEELHTNVIRVYAIDVDADHDECMQLL
                     EEAGIYVIADLSEPGDSIITTDPAWDVHLYDRYTSVIDELQQYDNVLGFFAGNEVITN
                     RSNTDAAPFVKAAIRDMKAYMEDQGYRQIPIGYSANDDALTRISSANYFACGDSDVRA
                     DFYGYNIYSWCGRSSFTTSGYDDRTEDFRNLSVPLFFSEYGCNEVQPRLFTEVQALYG
                     ENMTDVWSGGIVYMYFEEENNYGLVTIEPDGDVSTYSDFNYLRSELATISPSLATQSE
                     VSATATELECPPTGNNWRASTDLPPTPNKEVCECLQNTLACVVADDVEPEDYADIFNY
                     VCSRIECGDIGTDAEIGEYGPYSFCDAKEKLSFVLNLYYEDQNGASSACDFDGSASIV
                     STTAVSSCVSILQSASTVGTAPSSSRTATGSGSSGTGSGSGSSADATSTESDDAAFIH
                     KPKSGSELLMAAFFVTFVTSGFTYTLL"
     gene            complement(<424946..>425803)
                     /locus_tag="PAS_chr1-3_0228"
                     /db_xref="GeneID:8196460"
     mRNA            complement(<424946..>425803)
                     /locus_tag="PAS_chr1-3_0228"
                     /product="Essential protein involved in rRNA and snoRNA
                     maturation"
                     /transcript_id="XM_002489525.1"
                     /db_xref="GeneID:8196460"
     CDS             complement(424946..425803)
                     /locus_tag="PAS_chr1-3_0228"
                     /codon_start=1
                     /product="Essential protein involved in rRNA and snoRNA
                     maturation"
                     /protein_id="XP_002489570.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0228"
                     /db_xref="EnsemblGenomes-Tr:CAY67289"
                     /db_xref="GeneID:8196460"
                     /db_xref="GOA:C4QVL6"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:C4QVL6"
                     /translation="MGLAEPKNRQRFGLDPRNTTWSNDTSRFGHQHLEKLGWTPGSGL
                     GLVSHATTTHIKVRVKDDNTGLGAKLARKNKKDEFDSGECTGLDVFQRLLGRLNGKET
                     EIGDELDRQRKENVINGKWGIAFVKGETLQSTWDREAKAFVLRRKRRISESIEDAEVQ
                     RKLLKKEKKERKEKKEKQDKKESKHKPKKEKSEKQAKKEAKKEAKKEAKREAKKEAKR
                     EAKREAKDNLKQQGLIENTVTKESMLLPKSNTNIIASRLAVRSRWIKQKRAAVMDSKA
                     LNEIFMVAQ"
     gene            complement(<426304..>427350)
                     /locus_tag="PAS_chr1-3_0229"
                     /db_xref="GeneID:8196461"
     mRNA            complement(<426304..>427350)
                     /locus_tag="PAS_chr1-3_0229"
                     /product="Cell wall protein with similarity to glucanases"
                     /transcript_id="XM_002489526.1"
                     /db_xref="GeneID:8196461"
     CDS             complement(426304..427350)
                     /locus_tag="PAS_chr1-3_0229"
                     /codon_start=1
                     /product="Cell wall protein with similarity to glucanases"
                     /protein_id="XP_002489571.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0229"
                     /db_xref="EnsemblGenomes-Tr:CAY67290"
                     /db_xref="GeneID:8196461"
                     /db_xref="GOA:C4QVL7"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C4QVL7"
                     /translation="MQVKSIVNLLLACSLAVARPLEHAHHQHDKRGVVVVTKTIVVDG
                     STVEATAAAQVQEHAETFAESTPSAVVSSSSAPSSASSASAPASSGSFSAGTKGVTYS
                     PYQAGGGCKTAEEVASDLSQLTGYEIIRLYGVDCNQVENVFKAKAPGQKLFLGIFFVD
                     AIESGVSAIASAVKSYGSWDDVHTVSVGNELVNNGEATVSQIGQYVSTAKSALRSAGF
                     TGPVLSVDTFIAVINNPGLCDFADEYVAVNAHAFFDGGIAASGAGDWAAEQIQRVSSA
                     CGGKDVLIVESGWPSKGDTNGAAVPSKSNQQAAVQSLGQKIGSSCIAFNAFNDYWKAD
                     GPFNAEKYWGILDS"
     gene            complement(<428302..>429198)
                     /locus_tag="PAS_chr1-3_0230"
                     /db_xref="GeneID:8196462"
     mRNA            complement(<428302..>429198)
                     /locus_tag="PAS_chr1-3_0230"
                     /product="ER membrane protein that interacts with exocyst
                     subunit Sec6p and with Yip3p"
                     /transcript_id="XM_002489527.1"
                     /db_xref="GeneID:8196462"
     CDS             complement(428302..429198)
                     /locus_tag="PAS_chr1-3_0230"
                     /codon_start=1
                     /product="ER membrane protein that interacts with exocyst
                     subunit Sec6p and with Yip3p"
                     /protein_id="XP_002489572.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0230"
                     /db_xref="EnsemblGenomes-Tr:CAY67291"
                     /db_xref="GeneID:8196462"
                     /db_xref="GOA:C4QVL8"
                     /db_xref="InterPro:IPR003388"
                     /db_xref="UniProtKB/TrEMBL:C4QVL8"
                     /translation="MSESIESKGPQTTCCGGKCLSQKSASILTWKNPIKTGTVFGGII
                     VALLLIRYVNVFKLVFRLATYVLFATASAEFIGKIAVGQGFISRIRPDYFAKLSSKAP
                     LVADHVAKYLSGFELKFQQLLYAENVENTFKAAGISYILYILTGLISVWWLLFVSTLV
                     VFTVPKLYEIYQKEIDEAVTRYAEVAKNKADDLQTLAIEKSKPLLDKAETQLGPVGKY
                     VKQAFPVRTASTSAKADIPAETSEKEVPKSAADVKISETASENISELPSAPTTKLEDF
                     VADVEKKTDESRAELAAEGVAL"
     gene            complement(<429532..>430890)
                     /locus_tag="PAS_chr1-3_0231"
                     /db_xref="GeneID:8196463"
     mRNA            complement(<429532..>430890)
                     /locus_tag="PAS_chr1-3_0231"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489528.1"
                     /db_xref="GeneID:8196463"
     CDS             complement(429532..430890)
                     /locus_tag="PAS_chr1-3_0231"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489573.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0231"
                     /db_xref="EnsemblGenomes-Tr:CAY67292"
                     /db_xref="GeneID:8196463"
                     /db_xref="GOA:C4QVL9"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="UniProtKB/TrEMBL:C4QVL9"
                     /translation="MPHPLTIASKQYDQSWHQELNPYALSFWDIARSGEPNSSSLYRL
                     IQYECSYYMSLNRCIWIYKRNCPLKNEQQLSLFNNLSTMMDLSLRFLHDIYTEYHGIP
                     KLLETFGNLSFVKDLPGNVSIDISAILETHLVRSSALYASYLTNRDDQYWLYCLIKDS
                     ASRWLTSRNKISIEMDGYDDLMAYLREPAQLGIIYQEYIESLEDDEVRNKLLSYMSSF
                     KAEEREYFKVDEIIDDALEIDRVLGELQLGVKNTMACIQHHFDNNLKVCQYFQHCSKL
                     SNTSNVESKYIDSSYSCYMDKLKSQQQQFEEIFEGFKMNLQNPIDQFLAISNHFKIWI
                     EKYLKYSKKQFKYWDHLLESRDRLKGLEPFLELSRMLVSCIPELYVQLITDFLRLTTA
                     GSKVYTYKQLLSLFEAHTRLNKQAILKSDSKLIQFSIGEMSTTMVLPSKHMWDRQASL
                     KQ"
     gene            <431103..>433937
                     /locus_tag="PAS_chr1-3_0306"
                     /db_xref="GeneID:8196464"
     mRNA            <431103..>433937
                     /locus_tag="PAS_chr1-3_0306"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489529.1"
                     /db_xref="GeneID:8196464"
     CDS             431103..433937
                     /locus_tag="PAS_chr1-3_0306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489574.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0306"
                     /db_xref="EnsemblGenomes-Tr:CAY67293"
                     /db_xref="GeneID:8196464"
                     /db_xref="GOA:C4QVM0"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR024763"
                     /db_xref="UniProtKB/TrEMBL:C4QVM0"
                     /translation="MSLSSWRQFSFFELTPIKDPNLGSEKSLYSDPSLTSVCASPEYL
                     IIATAFNKVQLITKDYIKKFDFTAYELGWNIVHLVYLTDSHFLCTIAERQGFPLTLKL
                     WNLKKLMAMEKSDESLEFEFHSSCQIANGNNNFPMTAFTHCNNFSILCFGFSNGSVIL
                     VRGDLLHDKGTRQRLVFESNEPVTNLLFKDENSLYLTTTSKIYTIPTTGKNQGKPDKI
                     IDRGVGVDIGCCTLDHKRHLVVGNDSMLQCYSTRGKSNAIALDISKKKLFAFGKYILI
                     ISNDHKLLIIDVINMFIALNENIETAISNIFLLWDDVYMLGSDGVLYRIHELDQKAQL
                     DIVVSRNLYDIAIRLAQSMTGIEESDILTVHRKYGDYLYEQQSYGEAMTEYIKCLALG
                     KTSEIIAKYKDSSKISRLALYLEAMVEEGQARKDHITLLLCSYCKLKQIDKLLEFPQK
                     HPDVEFDLFTLIDLCRESDYLEVASTIAKQFNEPSIVVDIELNDLNKTKSTLAYLRTL
                     QIEDLLRVLLDHLKPFLTRLPHPTTKLLIEVFTGKFKPTPVSQEEKISEPEEKQFPVL
                     QSYQAFVSYMASLTETSTSENEQKDDISPTYLPPRPSIIFSSFIDHPNEFIIFLEACL
                     ESHDYYGGNDQDRSDILTTLYEVYLTMAQEEPDQKSEWEEKALTLIKNNKAKMNETSI
                     ILISNLYGFNAGEMLVRDQQVGFEIDLFRSAMSNGDLQSIQSILQEYAEEQPELYRLG
                     LSYYISDPDIFKKVEESGAFKQLLDTITTRNLMTPLQIVQKLGENSIATVGIVKEYLL
                     RYVTAMRTEILNNEKLIDHYSKQIERDNAQVEDLKHNPVTLQNTRCHSCSLPLDLPII
                     YFLCHHSYHERCLNDSEYENSKHLRSELECPKCAEKTDTITALRKEQEEVSQRNDLFA
                     VALENSSDRFKTITGFFAKGSIFDGVNYLN"
     gene            <434139..>435239
                     /locus_tag="PAS_chr1-3_0232"
                     /db_xref="GeneID:8196835"
     mRNA            join(<434139..434161,434216..>435239)
                     /locus_tag="PAS_chr1-3_0232"
                     /product="Mitogen-activated protein kinase involved in
                     osmoregulation via three independent osmosensors"
                     /transcript_id="XM_002489530.1"
                     /db_xref="GeneID:8196835"
     CDS             join(434139..434161,434216..435239)
                     /locus_tag="PAS_chr1-3_0232"
                     /codon_start=1
                     /product="Mitogen-activated protein kinase involved in
                     osmoregulation via three independent osmosensors"
                     /protein_id="XP_002489575.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0232"
                     /db_xref="EnsemblGenomes-Tr:CAY67294"
                     /db_xref="GeneID:8196835"
                     /db_xref="GOA:C4QVM1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008352"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4QVM1"
                     /translation="MSQEKFTRTQIFGTIFETTARYDELNPVGMGAFGLVCSAKDKLT
                     EQQVAIKKIMKPFSTPVLAKRTYRELKLLNHLRHENLITLTDIFLSPLEDIYIVTELQ
                     GTDLHRLLTSRPLEKQFIQYFLYQILRALKYVHSAGVIHRDLKPSNILINENCDLKIC
                     DFGLARIQDHQMTGYVSTRYYRAPEIMLTWQKYDTEVDIWSAGCIFAEMIEGKPLFPG
                     KDHINQFSIITELLGSPPTDVIDTICSENTLRFVQSLPHREPVPLIERFQGVEPVAID
                     LLEKMLVFDARKRITAEESLAHEYLEPYHDPTDEPVAAEKFDWSFNDADLPVDTWRVM
                     MYSEILDFHQVEDQ"
     gene            complement(<435273..>437543)
                     /locus_tag="PAS_chr1-3_0233"
                     /db_xref="GeneID:8196465"
     mRNA            complement(<435273..>437543)
                     /locus_tag="PAS_chr1-3_0233"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489531.1"
                     /db_xref="GeneID:8196465"
     CDS             complement(435273..437543)
                     /locus_tag="PAS_chr1-3_0233"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489576.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0233"
                     /db_xref="EnsemblGenomes-Tr:CAY67295"
                     /db_xref="GeneID:8196465"
                     /db_xref="GOA:C4QVM2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C4QVM2"
                     /translation="MIPTIDPKDPELVSEDTAQSASARKRSKVSRACDECRRKKIKCD
                     ATFLANSNTLLKPCTNCYKYNCSCSFTRVPLKRGPSKGFARDGSGYERRRSSSVHSVS
                     SSQSVTSPVPSHASLPIPPANPVSLPRLNVPGDGLLSPKAVPPTNLFWKVPYELPSFS
                     DRRSSVASADSFRRPSIYQSDSEDDFYSATGSQRNSISQAPRQRNLSPALSVSSTSSL
                     NNRIKSLNMVASTLESNIHNYYSQGFNSSLPILPLDERILSTLLSNVSNGSSSASWDA
                     IRSPILELFDKSILMLLRSYESQFNFNDLLDHVTEMQSIYPRIRSHLLSDELLKLIFL
                     MSGVLTDYALILTGQPYSTGLSITVSVFNDWKTYENVQRVLVINRAGSLDLDYDSLPF
                     LFARCYLSLATLDLIYSLSFSSPRLISSFANLPILDIVQKCGITKDAKLDETPLPVLD
                     QFLNCFLPGDTYPTALNTLKTGLVLLDFTNNRSTTLRFPFINIHDDNHMTGLSHLLSN
                     VSDFMSQFTEVHSDSKDSQLLFLRCIWAFWEIGSVLSELIDHFISSSANSQVGDKDAS
                     FFYEHQLKVTTLLGTFSNIASAFLTSSTTAASHPPPSISPFHIISMVESFKMVQFLNK
                     LIASFISLNEKLEKRELEDELSKCKEELNNLNERFQAVSSVQTLPVVHVLFRDLVFSS
                     NRLDTQRDRASSVVSATTTTSTATTTATTKKSSFGNLLHSDEENILPTVIDWCKEQKH
                     SAEMFLNKNDLNGWLY"
     gene            <438485..>439744
                     /locus_tag="PAS_chr1-3_0234"
                     /db_xref="GeneID:8196466"
     mRNA            <438485..>439744
                     /locus_tag="PAS_chr1-3_0234"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489532.1"
                     /db_xref="GeneID:8196466"
     CDS             438485..439744
                     /locus_tag="PAS_chr1-3_0234"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489577.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0234"
                     /db_xref="EnsemblGenomes-Tr:CAY67296"
                     /db_xref="GeneID:8196466"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="UniProtKB/TrEMBL:C4QVM3"
                     /translation="MLHTPSIRESHDKSQSVVNSYEQDDTEKALNDRIESFIQSLREP
                     KFDKPLTLDEIGSLFQTFYDEYHQQAVILVGSQQMNGISRTPLASSQEDLSTDENKPF
                     ARPVDRVFLYDQRAEKRLTDLFYSKLYSSSSSATDAEINVNLNTKLDRLRMSNLSLEQ
                     LALSCEGTSQQLVKKLSAAHIDRVLVRLKRERGPFEKITSLAQIHDLINSVVSLDGDS
                     SLALAIFVCIYFFRDLFLQLHYIRRFSNPYVLQEHGKLSYSLTNFQAALEFLLNVTAK
                     DLGLSDPAITALPAHEKKPYSYNLRSFLGRFAQPLPTDEDDRLLSKLTSSVMKNLRPL
                     SASPSSTSLNEGVTASLTPKNARSRATSLIGQRRNSNSCTVASNELLQLVIHLKKNDL
                     HNKQFEQLTILELRQLLHDYKTIMDTV"
     gene            <441285..>442427
                     /locus_tag="PAS_chr1-3_0235"
                     /db_xref="GeneID:8196467"
     mRNA            <441285..>442427
                     /locus_tag="PAS_chr1-3_0235"
                     /product="Phosphatidylinositol 4,5-bisphosphate
                     5-phosphatase with a role in secretio"
                     /transcript_id="XM_002489533.1"
                     /db_xref="GeneID:8196467"
     CDS             441285..442427
                     /locus_tag="PAS_chr1-3_0235"
                     /codon_start=1
                     /product="Phosphatidylinositol 4,5-bisphosphate
                     5-phosphatase with a role in secretio"
                     /protein_id="XP_002489578.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0235"
                     /db_xref="EnsemblGenomes-Tr:CAY67297"
                     /db_xref="GeneID:8196467"
                     /db_xref="GOA:C4QVM4"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C4QVM4"
                     /translation="MLREISRRVSSPTNFAVYLSKSRSFIQTCSSKLYMRIHLLTFNC
                     GKNEFRDNTALEELSKSVENSLPDDPPEIVAIAFQELTSIRTSFDYNLVHEILLDVND
                     AIVQRVSEHYQVTYHTLGLTHNGAITLSLLVLRPSRFYNIRTSYLPRGVAFSSLKGGV
                     GIRVAYKSQVINNDDENDKELTFVSCHLNANEGEVNFNRRNQDLNKILSEMDFSDQYS
                     VLKPDSHIFVLGDLNYRCSKVGEVENVSEIDELEKVKGDLDFTEAPIHFAQTYKYIIG
                     TQDTFRTNRIPSWCDRILFLNYQEDLQPEYNSLPELTISDHKPVYLTITVPNTVPFII
                     YRKPTYYGSLVKTVSKATDTMFRFSMIKKTYLFLLTLAGLYYVTYG"
     gene            complement(<442490..>443059)
                     /locus_tag="PAS_chr1-3_0236"
                     /db_xref="GeneID:8196468"
     mRNA            complement(<442490..>443059)
                     /locus_tag="PAS_chr1-3_0236"
                     /product="Protein involved in retention of membrane
                     proteins, including Sec12p, in the ER"
                     /transcript_id="XM_002489534.1"
                     /db_xref="GeneID:8196468"
     CDS             complement(442490..443059)
                     /locus_tag="PAS_chr1-3_0236"
                     /codon_start=1
                     /product="Protein involved in retention of membrane
                     proteins, including Sec12p, in the ER"
                     /protein_id="XP_002489579.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0236"
                     /db_xref="EnsemblGenomes-Tr:CAY67298"
                     /db_xref="GeneID:8196468"
                     /db_xref="GOA:C4QVM5"
                     /db_xref="InterPro:IPR004932"
                     /db_xref="UniProtKB/TrEMBL:C4QVM5"
                     /translation="MDNITDRLPSVWGEKYVRLRASYQKLLDKSTPHLYARWALCYVL
                     VFVFLLRIFFSEGWYVVCYTHAIYMLSLFLQFLSPKFDPSLEQQQQDELVEDGLQGVD
                     IEDNDEFRPFIRRLPEFKFWIKATQASLLALICSFIPLLDIPVFWPILLMYFVVLFSL
                     TMKRQIQHMIKYHYIPFDLGKAKYNRGAK"
     gene            <443467..>446820
                     /locus_tag="PAS_chr1-3_0237"
                     /db_xref="GeneID:8196469"
     mRNA            <443467..>446820
                     /locus_tag="PAS_chr1-3_0237"
                     /product="Karyopherin/importin that interacts with the
                     nuclear pore complex"
                     /transcript_id="XM_002489535.1"
                     /db_xref="GeneID:8196469"
     CDS             443467..446820
                     /locus_tag="PAS_chr1-3_0237"
                     /codon_start=1
                     /product="Karyopherin/importin that interacts with the
                     nuclear pore complex"
                     /protein_id="XP_002489580.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0237"
                     /db_xref="EnsemblGenomes-Tr:CAY67299"
                     /db_xref="GeneID:8196469"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:C4QVM6"
                     /translation="MSSIPPEINNVLLSIIQALLTGAGDKQIYAQAEHSLNTEWIDKE
                     QVEVLLLFLAEQAVQGQSDDIRAFSCVLFRRFAIKSPTGKGFEKPYYDFTSKQINHIS
                     KEVKAQIQKILLQGFVSSSGVPGHIRHKLADCISEVAKDSANEWPTLIPTLVECITNS
                     NDPVTIESAFRVFIDAPKLIGDTYIREMIPVFSKGLNHENNQVKVGASTSFVSVFRVL
                     SRDSRNVASELLPSILNSLPTLLSNGDEESLTSILESLIDLIELSCKIFKPMFTQIIE
                     FVSAVAKDKDLDGSTRIAAMEILPTFAESAPNMCKSNELFTNSVILNTLSMMTEVSID
                     DEQAAEWANSDDSQEDEDEEEYNAARLVLDRVSLVLGGESLASPLFQFLPQMLQSQQW
                     RERQAALMALSSAAEGCRNVLITEIDKILSLIIPCLKDEHPRVQYACCNALGQISTDF
                     ANIIQKTSGAIILPGLIGMLTPQHTFRVQAHAAAAIVNFSECASKEVLEPFLDDLLTN
                     LLNVFSSPKRYVQEQVLTTIAVVADAAEQKFVKYYDTMMPLLFNILTADLASLANTNL
                     RAEAIECATLIASAVGREKFLPHSQELIRILGDIQNNESESDPQVKQYLQQGWFRICK
                     VIGKDFFPCLPGVLPPLILDAKVQQSRLEVDKDEAKELATNQDYDIVQVKGKFIAIHT
                     SLLDDKAAAIETLQDYLQILGTEMYPYLNEIAYEIVIPGLLFFLHDGVRGVCSLIIPS
                     LLQCSIEATGVNSKQTMDLWHACIDQLMLVLSSDRVPELIVAYYNCIAQCLEKLDASC
                     LNEQHLFQLGGVIQENLTNVFESIKAKENKEPNEEGEFYDDEDDYDDLDEISDDELLD
                     EIVKGFSSIFKCFKGRFLPVFNQLLPTVASFINDENSDIRVAGLCMISDVIEHAGADS
                     IQFKEMFLSPVGESLVSEDPQVRQAAAYCVGVSIQYGSALTSYGEYIINLTPTMINIV
                     QDANSRNGDNLNATENVIATLGKFYHQLKASNTTNFNIQGKGLDILLDEWVKSLPIIM
                     DEECAIFCYNFLLKLIEGNDPSVTNNVLHVIDSMIQGLLTTLQGNTKSKVIQAVKSLL
                     NNIPSDQVMALVNKYPQEAQLKLNKMLNA"
     gene            complement(<446912..>448387)
                     /locus_tag="PAS_chr1-3_0238"
                     /db_xref="GeneID:8196470"
     mRNA            complement(<446912..>448387)
                     /locus_tag="PAS_chr1-3_0238"
                     /product="Phosphatidylglycerolphosphate synthase,
                     catalyzes the synthesis of phosphatidylglycerolphosphate"
                     /transcript_id="XM_002489536.1"
                     /db_xref="GeneID:8196470"
     CDS             complement(446912..448387)
                     /locus_tag="PAS_chr1-3_0238"
                     /codon_start=1
                     /product="Phosphatidylglycerolphosphate synthase,
                     catalyzes the synthesis of phosphatidylglycerolphosphate"
                     /protein_id="XP_002489581.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0238"
                     /db_xref="EnsemblGenomes-Tr:CAY67300"
                     /db_xref="GeneID:8196470"
                     /db_xref="GOA:C4QVM7"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR016270"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="UniProtKB/TrEMBL:C4QVM7"
                     /translation="MLNPVRNASQFSSQLRPLLNQLDSNLPAFNLNAKDLDIITHPQD
                     FYTTLLDKIDNAKERIFLTSLYLGKDQTELLSKLTSSLDRNKDLKLYILMDYLRCTRD
                     SPKTSTASVLSKLTEKYGSRVDVRLYHTPNTNKFWSMVLPSRFNEGLLGLQHMKFYGF
                     DDDLIISGANLSQEYFQDRQDRYYHFRGCHNLCNYYFDLQSAVSRISYKILPDIYKKF
                     PKDYIVNWPSTNATCEPYINSDRFVKDASLLLTNILTNRTEDVNENPTDTVVYPISQL
                     TPILSKEKLNTEKSTIFQLLSYINSNSLKWVLTTGYFNMYPPFMKKLLTPTAYPKEDM
                     GKVICASPQANSFYKSKGFSKHVPEAYLHLVRKFIRRLTDSGLHKQIGVYEWQNGVVH
                     TPNGWSYHAKGLWIYDKETQLPNITVVGSTNYTKRSYSLDLENNLVLVTNNLGLQKKL
                     QGEVENILSHTTKFNSLKQFDEKYKIPYWVKTVTDMLGSHF"
     gene            <448506..>450149
                     /locus_tag="PAS_chr1-3_0239"
                     /db_xref="GeneID:8196471"
     mRNA            <448506..>450149
                     /locus_tag="PAS_chr1-3_0239"
                     /product="DRAP deaminase, catalyzes the third step of the
                     riboflavin biosynthesis pathway"
                     /transcript_id="XM_002489537.1"
                     /db_xref="GeneID:8196471"
     CDS             448506..450149
                     /locus_tag="PAS_chr1-3_0239"
                     /codon_start=1
                     /product="DRAP deaminase, catalyzes the third step of the
                     riboflavin biosynthesis pathway"
                     /protein_id="XP_002489582.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0239"
                     /db_xref="EnsemblGenomes-Tr:CAY67301"
                     /db_xref="GeneID:8196471"
                     /db_xref="GOA:C4QVM8"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C4QVM8"
                     /translation="MSKRLPQRDAHGFKVKKVVLDSHRKIEGNGVSIFEEESQGASYI
                     KDYVHGLRRVTPYYFTFLTHCKERWQDRKLIEVFKSEFRMKPFSYYYNAIANGEVKLN
                     DQVANVDSVLRNGDLISHRIHRHEPPVTLDEIEIAYEDDEITVINKPSGIPVHPTGRY
                     RHNSITMIMKQEMGTIAHTCNRLDRLTSGIMFLGKTAMKTAKMVQQIKERNVGKVYIA
                     KCKGKFPLGLQVVDKPLLTIDPRLTFNLVDLEDGKEAKTLFRRISYDTKDNTSIVKCM
                     PLTGRTHQIRVHLQFIGYPIANDPVYSSPYVWGLTLGKGFLHKENPGYLKEVSERSEK
                     IGKTKQSTSWYYPEESGELLLEEGCEVCGSELYSDPGVNDLILWLHAYRYYSHEQSWD
                     YSTKMPKWSIEGHHREMMKLAIEEAKKCDHTETAFNVGCIITDENGEIISRGYSREFE
                     GNTHAEQCALMKLDYKLPPGSILYTTMEPCSERLSGNKPCVNRIIDLKGEVITVFVGV
                     VEPKKFIADNTGKRQLEDAGVNYLHIDGYEDEILALATR"
     gene            <450432..>451226
                     /locus_tag="PAS_chr1-3_0240"
                     /db_xref="GeneID:8196472"
     mRNA            <450432..>451226
                     /locus_tag="PAS_chr1-3_0240"
                     /product="Flavin adenine dinucleotide (FAD) synthetase"
                     /transcript_id="XM_002489538.1"
                     /db_xref="GeneID:8196472"
     CDS             450432..451226
                     /locus_tag="PAS_chr1-3_0240"
                     /codon_start=1
                     /product="Flavin adenine dinucleotide (FAD) synthetase"
                     /protein_id="XP_002489583.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0240"
                     /db_xref="EnsemblGenomes-Tr:CAY67302"
                     /db_xref="GeneID:8196472"
                     /db_xref="GOA:C4QVM9"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C4QVM9"
                     /translation="MVTVLSNSSKQTTQIQHNHNMIKDSFLSVCEHSYNLITDFLNES
                     DPENELLTSTQEQVRKSYDILFESLNLYKLDELSISYNGGKDCLVLLIIYLAVIYDKY
                     QNESIPRDYKLNALYIKNESMFQEQDDFIKKSAAKYQLNLQPFRDTMKRALHKYLVQN
                     PCIKAVIIGIRRCDPYGKDLHYLQETDPSWPRLMRVNPILEWDYHQIWFFLRHLKIEY
                     CKLYDMGYTSLGGTNNTIKNPDLQDGDGYLPAYLLDDSEKERSSRL"
     gene            complement(<451229..>451885)
                     /locus_tag="PAS_chr1-3_0241"
                     /db_xref="GeneID:8196473"
     mRNA            complement(<451229..>451885)
                     /locus_tag="PAS_chr1-3_0241"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489539.1"
                     /db_xref="GeneID:8196473"
     CDS             complement(451229..451885)
                     /locus_tag="PAS_chr1-3_0241"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489584.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0241"
                     /db_xref="EnsemblGenomes-Tr:CAY67303"
                     /db_xref="GeneID:8196473"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4QVN0"
                     /translation="MDYQNRVGSKKGSGGLASAEDTDKHRKERLRQLLRSNINIESDP
                     YVVRTRTGQYDCKLCLTTHVNESSYISHTQGKRHQLSLMRREAEVSKNENRTDGGNIG
                     NGMGISSIPKRKYVKIGKPGYKVKKTRDADEHLGLSLEIAMKEFNRVKPMYTIMSKME
                     TTTTPVKGQCIVISGEPYENIGFDIPVELDGFNLGETWDYWDQDSKLYYVQLTYDRTS
                     "
     gene            complement(<451979..>453271)
                     /locus_tag="PAS_chr1-3_0242"
                     /db_xref="GeneID:8196474"
     mRNA            complement(<451979..>453271)
                     /locus_tag="PAS_chr1-3_0242"
                     /product="Component of the evolutionarily conserved
                     kinetochore-associated Ndc80 complex"
                     /transcript_id="XM_002489540.1"
                     /db_xref="GeneID:8196474"
     CDS             complement(451979..453271)
                     /locus_tag="PAS_chr1-3_0242"
                     /codon_start=1
                     /product="Component of the evolutionarily conserved
                     kinetochore-associated Ndc80 complex"
                     /protein_id="XP_002489585.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0242"
                     /db_xref="EnsemblGenomes-Tr:CAY67304"
                     /db_xref="GeneID:8196474"
                     /db_xref="GOA:C4QVN1"
                     /db_xref="InterPro:IPR005549"
                     /db_xref="UniProtKB/TrEMBL:C4QVN1"
                     /translation="MRKQYIFPILDIKELVMCLQSCGFTASEDLIGRPTREYVQTLLE
                     QVADQYLGISSQVIYKIKENNKENNSVHVVIYLQRIMYQFLKVCGIDDFNIMDIMKPD
                     SNRVLVILSGIVNFARFREEHLIDCESFLNTSEQMVKEYKNLEQSNEKMKENIEQLKQ
                     GDNDIDKINKENKDIENKLKSLISKQEELTQQRLAYKEERINLIEKLRENDELIGNLR
                     QFNLQLQEESSTSIKTRNQALQEQLNQEQTVLSGLELKSRNLSVSIESFSLLNVEVEN
                     YLKLMRDVEAEVNKQELLMEKLGKHGEALETDQLKSNELKYRVHQLSRQLNTQKDKID
                     TLKTTMEEKRKTNNEKLTTIHDQYTTLIAERDLNEQDLNTKKNYIDSLEQKMSEMSRL
                     LDQEVQDCNLELLRLNSHLKLYLKEMEKTKVNEYIQIM"
     gene            <453444..>454193
                     /locus_tag="PAS_chr1-3_0243"
                     /db_xref="GeneID:8196475"
     mRNA            <453444..>454193
                     /locus_tag="PAS_chr1-3_0243"
                     /product="Subunit of a complex, with Slx4p, that
                     hydrolyzes 5' branches from duplex DNA"
                     /transcript_id="XM_002489541.1"
                     /db_xref="GeneID:8196475"
     CDS             453444..454193
                     /locus_tag="PAS_chr1-3_0243"
                     /codon_start=1
                     /product="Subunit of a complex, with Slx4p, that
                     hydrolyzes 5' branches from duplex DNA"
                     /protein_id="XP_002489586.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0243"
                     /db_xref="EnsemblGenomes-Tr:CAY67305"
                     /db_xref="GeneID:8196475"
                     /db_xref="GOA:C4QVN2"
                     /db_xref="InterPro:IPR000305"
                     /db_xref="InterPro:IPR027520"
                     /db_xref="UniProtKB/TrEMBL:C4QVN2"
                     /translation="MYYVYLLQSQEKPQSFYIGSTNNPQRRLAQHNGDLAAGGAFRTK
                     REGYRPWKMVLLCLGFHSKIAALQFEHAWQHSHLTRHIEDKLSHSNSIHIKLANLKKL
                     LGSEGFRRWNISVYILDRAIYKSWCLNRYGVQTPEYLRMDVLEVELSEFMKVIEEKDE
                     NLVASKKNTGEREEDKDEEGNSNPSCSLCSTNITTENFQAQFCACYHCQTQFHVICLA
                     RSFTSDLLPVKGSCSQCNKVLYWLDLMRSVR"
     gene            complement(<454182..>455689)
                     /locus_tag="PAS_chr1-3_0244"
                     /db_xref="GeneID:8196476"
     mRNA            complement(join(<454182..454933,454981..>455689))
                     /locus_tag="PAS_chr1-3_0244"
                     /product="Cytoplasmic and mitochondrial histidine tRNA
                     synthetase"
                     /transcript_id="XM_002489542.1"
                     /db_xref="GeneID:8196476"
     CDS             complement(join(454182..454933,454981..455689))
                     /locus_tag="PAS_chr1-3_0244"
                     /codon_start=1
                     /product="Cytoplasmic and mitochondrial histidine tRNA
                     synthetase"
                     /protein_id="XP_002489587.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0244"
                     /db_xref="EnsemblGenomes-Tr:CAY67306"
                     /db_xref="GeneID:8196476"
                     /db_xref="GOA:C4QVN3"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004516"
                     /db_xref="InterPro:IPR015807"
                     /db_xref="UniProtKB/TrEMBL:C4QVN3"
                     /translation="MLRRFIRTMSESKIKEFTLKTPKGTKDWADKDMVIREGIFSYLS
                     TLFKKHGGVTIDTPVFELREILSGKYGEDSKLIYNLEDQGGELTSLRYDLTVPFARFV
                     AMNGISSIKRYHIAKVYRRDQPAMTKGRMREFYQCDFDVAGAYDTMVPDAEMLEILCS
                     GLQGLGINDFKVKLNHRKILDGIFEVCGVKEEDVRKVSSAVDKLDKSPWEIVRKEMVD
                     EKNQPEEVADRIGEYVKLILLANESASQGIRDMAILSDYVEAFGISKLLSFDLSLARG
                     LDYYTGLIYEAVTAQSAPPTTVDSKKKKSLKEDDDASDYVGVGSIVAGGRYDNLVGMF
                     SASKKSIPCVGVSFGVERIFSLVRQRLVQDQQVRASHTNVFIMAFGNGFLTERMAVAK
                     RLWDAGIETEYLYKNKSNPRRQFEAAEKLGCSIAVILGKDEVAQGKVRVKTLNTGVND
                     DGELVDLDNVAPYVKEKLEGIVRVDDISRLIGNLTN"
     gene            complement(<455818..>458397)
                     /locus_tag="PAS_chr1-3_0307"
                     /db_xref="GeneID:8196477"
     mRNA            complement(<455818..>458397)
                     /locus_tag="PAS_chr1-3_0307"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489543.1"
                     /db_xref="GeneID:8196477"
     CDS             complement(455818..458397)
                     /locus_tag="PAS_chr1-3_0307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489588.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0307"
                     /db_xref="EnsemblGenomes-Tr:CAY67307"
                     /db_xref="GeneID:8196477"
                     /db_xref="GOA:C4QVN4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C4QVN4"
                     /translation="MSNSPGSPRKLRKIPPPLRKLRSTTDLFNLRDYSRTKLSQQTPR
                     SSISIEETSGISSLSLSTLATTPTSPNDNRNFLSKRRSSSIQSFSTPSSSVKSSRSHF
                     PQRKFSSNLINESCCFCELLLSIRSTGKMSVSLSCGHYCHYDCILVLIESDLKFPNCP
                     ECACQTEPVEDTISMNLVQDKLLNVSATSSFSSVLDTPAQLNNQFFFPDSSVNTVTPI
                     DFEQSKSANTLCVFPEFGDSSRGYKSLETPRDRAIDTLLSPPALFKSSFYSKEVSPLA
                     ADYPDTLTNRNQIFKELSSPQLKIVPIIDKITINDVDPTFELDCTVSIKGPYQSSIRD
                     LSDLELQTKGDIQTDILNTIGSSIDEPLGTLLLFDIFQVGVDESEWSELLIVFFERML
                     ITMDIKGKQVVGKVAVDTISSITSQMEDTIILNLTLLSLPELILYSRDMTLIDKWKIV
                     LQKALKKIDQCIPLRSLSLNGWSFLEDKSLVPNLESQDLYQQVKDQMLTHISLELDLI
                     ICIPLITNHPKELRTLFKTLLSALQTQNETMNQKNRIGLVLLGKRKANFVGCIDPEWE
                     KWDEYLNEIPFSKPKKSQSSSLSSKELKRVLHSIFTCSERDALDHRYLKEIVLIDYYG
                     EVDINLNAKISNYFLFKETQSYNPNYVNNAINQYSIVFSQTFQELEQKILDYVLIQLS
                     EQYSRKISFEVELPEDYVKVKEIRTIRSISKENTLQIEVQNLQFNREVHALMKFEIEL
                     SNLKKSPHYVSIPLINHQMEDVNVQLRFSSSQIPQYHHNYCHSNHSNEILEIPLIQAP
                     LSPKKDPLILRKLFEDSLLEQLLQGKQLSFDSDEMNAYRKVHGASIETNGRFEMLNHL
                     LAN"
     gene            <458691..>458996
                     /locus_tag="PAS_chr1-3_0308"
                     /db_xref="GeneID:8196836"
     mRNA            <458691..>458996
                     /locus_tag="PAS_chr1-3_0308"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489544.1"
                     /db_xref="GeneID:8196836"
     CDS             458691..458996
                     /locus_tag="PAS_chr1-3_0308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489589.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0308"
                     /db_xref="EnsemblGenomes-Tr:CAY67308"
                     /db_xref="GeneID:8196836"
                     /db_xref="UniProtKB/TrEMBL:C4QVN5"
                     /translation="MYPFQTILIGLSETGRQKSNDRNFDAWIGKKRVVCVFFLIGIIQ
                     GSPVVILDSQFKVCEAALSQIFRIGTLFRRLWAISCNNSQIRESFLVFQKVNSPDCH"
     gene            <459272..>460138
                     /locus_tag="PAS_chr1-3_0245"
                     /db_xref="GeneID:8196837"
     mRNA            join(<459272..459468,459787..>460138)
                     /locus_tag="PAS_chr1-3_0245"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489545.1"
                     /db_xref="GeneID:8196837"
     CDS             join(459272..459468,459787..460138)
                     /locus_tag="PAS_chr1-3_0245"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489590.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0245"
                     /db_xref="EnsemblGenomes-Tr:CAY67309"
                     /db_xref="GeneID:8196837"
                     /db_xref="UniProtKB/TrEMBL:C4QVN6"
                     /translation="MFHRRKQPVAPKGPTLKLDSPDPIPIMEASPPRTPWISEAITRL
                     GGPIAQWMNAQDQAYARVSLKFVGILAFLSIFVVVSGATTVAFIPVLAITLAASLLSA
                     FVVSIIYLGYTGFTAEEGWVRRLLAPLADLLPPSVGVSEVVKKNGSAKVATVTEIDPD
                     DERLEGVSNDKVSEQQNSEAVS"
     gene            complement(<460227..>460973)
                     /locus_tag="PAS_chr1-3_0246"
                     /db_xref="GeneID:8196478"
     mRNA            complement(<460227..>460973)
                     /locus_tag="PAS_chr1-3_0246"
                     /product="Essential protein associated with the U1 snRNP
                     complex"
                     /transcript_id="XM_002489546.1"
                     /db_xref="GeneID:8196478"
     CDS             complement(460227..460973)
                     /locus_tag="PAS_chr1-3_0246"
                     /codon_start=1
                     /product="Essential protein associated with the U1 snRNP
                     complex"
                     /protein_id="XP_002489591.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0246"
                     /db_xref="EnsemblGenomes-Tr:CAY67310"
                     /db_xref="GeneID:8196478"
                     /db_xref="GOA:C4QVN7"
                     /db_xref="InterPro:IPR004882"
                     /db_xref="UniProtKB/TrEMBL:C4QVN7"
                     /translation="MAHYEQRKLLEQLMGSDSLIRLPKDYGEENEDSSVVLNDPRVCR
                     SFVVGTCPYTLFSGTKGDIGTCPKLHMERHRILYESLRKEGTTLPDYERQYLSELRRY
                     IDDCDYRIKVALARLEHTPEERAQLSDVTRSLDDLSTKIGIMTQEIEQLAQTSPEETT
                     KLVIESRKLQETCDERDRLGKQYAEMLDNLGQAAQQKLQVCEVCAAYLSRLDSDRRLA
                     DHFVGKIHLGYLLMRTELERLQGVQRQNNK"
     gene            <461199..>461774
                     /locus_tag="PAS_chr1-3_0247"
                     /db_xref="GeneID:8196479"
     mRNA            <461199..>461774
                     /locus_tag="PAS_chr1-3_0247"
                     /product="Catalytic subunit of the mitochondrial inner
                     membrane peptidase complex"
                     /transcript_id="XM_002489547.1"
                     /db_xref="GeneID:8196479"
     CDS             461199..461774
                     /locus_tag="PAS_chr1-3_0247"
                     /codon_start=1
                     /product="Catalytic subunit of the mitochondrial inner
                     membrane peptidase complex"
                     /protein_id="XP_002489592.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0247"
                     /db_xref="EnsemblGenomes-Tr:CAY67311"
                     /db_xref="GeneID:8196479"
                     /db_xref="GOA:C4QVN8"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019757"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR026730"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:C4QVN8"
                     /translation="MDLTFLRTTLSWTLRAGCLIHFFHSHVYEFKETRGESMLPTLQA
                     RHDYVHTLKNYKFGRNIQTGDIIVALKPTDPDQRVCKRITGMPGDIVLIDPSSGSLEK
                     DKSDASSTAFERYIVIPDGHVWLTGDNLSHSLDSRTYSVLPMGLIKGKIVAANDMNKS
                     WKSLWGFRWIEGGVQRADTPSWSRISPSDVT"
     gene            <461920..>462672
                     /locus_tag="PAS_chr1-3_0248"
                     /db_xref="GeneID:8196480"
     mRNA            <461920..>462672
                     /locus_tag="PAS_chr1-3_0248"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489548.1"
                     /db_xref="GeneID:8196480"
     CDS             461920..462672
                     /locus_tag="PAS_chr1-3_0248"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489593.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0248"
                     /db_xref="EnsemblGenomes-Tr:CAY67312"
                     /db_xref="GeneID:8196480"
                     /db_xref="GOA:C4QVN9"
                     /db_xref="InterPro:IPR008814"
                     /db_xref="UniProtKB/TrEMBL:C4QVN9"
                     /translation="MKLISVGIVTTLLTLASCLKIKNGIVSVGQEEFAFGTKSIPLYR
                     NQDIKVEFSLKTDEGKFPQQVALSLDSESASEIVYPKLSGSKAQFTIPVKKLSGAIKS
                     QPFDLTLIAGDVDTSKNLQEFIASILPVEKLTTYEPPVRLEAKEEIRHIFRQQESTVP
                     AGLSLIFIGGIAAILAGLLITWTVSDSYNLKNFPSSSCQKIWHVLFLGSIVGLEGIFV
                     QYYLGSSIFDTLFKASIVGSVGLVAGSRVLRR"
     gene            <462856..>464373
                     /locus_tag="PAS_chr1-3_0249"
                     /db_xref="GeneID:8196481"
     mRNA            <462856..>464373
                     /locus_tag="PAS_chr1-3_0249"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489549.1"
                     /db_xref="GeneID:8196481"
     CDS             462856..464373
                     /locus_tag="PAS_chr1-3_0249"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489594.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0249"
                     /db_xref="EnsemblGenomes-Tr:CAY67313"
                     /db_xref="GeneID:8196481"
                     /db_xref="UniProtKB/TrEMBL:C4QVP0"
                     /translation="MDISIEELVRETQNLTTTGSSDRRSLYLIESNYRQIIQRISFEP
                     SLESVRLHIDTIHPLVSALSSSHQHDRAIQGKLLQHLNTLIMFHFWHKRFAGNILELS
                     KNDQVLSIWEQAVSNQEDTQFNENCGPGILSLREYHSIGLQDMSTHNVIPHQRYILKL
                     LLTVRSYFLTPNEVDLLKLHAKSAVGHELVCWFIIMSDIKPSLLLHRELQFSIDKNSL
                     WLNGLIMKSPPVDFEPLVRLLHTKPFFLFKHKALLQHVCVSLTQILHTSNNVIDEYKD
                     VHSVLCLQAFLILIGDILVTALNNWRYKLKLNNPNLENELLDGPPVGWINQYRLNGFY
                     SNERVIQDTLMSIIICLQQQTRHLIKGFDEAYLQLQINSLLSTAVLCENMGDESGLLH
                     SANMAVWAKVVQLYGDQAIVKLLNMATGRCFKDVRLVGAVGRLLAEPVGTSQQSPRNE
                     ISENVTSKTAMESILITPLAERFVRRFGADMRLSVLTARLTRRLSSDSRLSKVFA"
     gene            complement(<464370..>465522)
                     /locus_tag="PAS_chr1-3_0250"
                     /db_xref="GeneID:8196482"
     mRNA            complement(join(<464370..465026,465112..>465522))
                     /locus_tag="PAS_chr1-3_0250"
                     /product="Mitochondrial carrier protein involved in the
                     accumulation of CoA in the mitochondrial matrix"
                     /transcript_id="XM_002489550.1"
                     /db_xref="GeneID:8196482"
     CDS             complement(join(464370..465026,465112..465522))
                     /locus_tag="PAS_chr1-3_0250"
                     /codon_start=1
                     /product="Mitochondrial carrier protein involved in the
                     accumulation of CoA in the mitochondrial matrix"
                     /protein_id="XP_002489595.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0250"
                     /db_xref="EnsemblGenomes-Tr:CAY67314"
                     /db_xref="GeneID:8196482"
                     /db_xref="GOA:C4QVP1"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002167"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4QVP1"
                     /translation="MDKQIKPIIPVLGLRQEHQDSERSVSVSESPVSKMSQKLPLKLN
                     NPKVIDKQSLQYVIYSGVAGGVAGSAAKTLIAPLDRVKILFQTANPEFSRFSGSFSGL
                     FKAVRQIYGYDGVAGLYQGHSATLLRIFPYAAIKFLGFALLFFTYPLDLIRVRLAFET
                     HREVNRARGGKFLGIVRRVFNEEPRFQVTALDTLARLGNFYRGFAPTIFGMIPYAGVS
                     FYTHDLIHDVFRSRHLKGYTVQEEEFKTLEDLTVKTNSSHDRRLPLYVWAQLTAGGAA
                     GMLAQAAAYPFEVIRRRMQVGAVTNNGEYLSILRTASQIYVENGARGFYVGLTIGFIK
                     VVPMFACSFFVYERIKRRLGI"
     gene            <466221..>467435
                     /locus_tag="PAS_chr1-3_0251"
                     /db_xref="GeneID:8196483"
     mRNA            <466221..>467435
                     /locus_tag="PAS_chr1-3_0251"
                     /product="Mannosyltransferase of the cis-Golgi apparatus"
                     /transcript_id="XM_002489551.1"
                     /db_xref="GeneID:8196483"
     CDS             466221..467435
                     /locus_tag="PAS_chr1-3_0251"
                     /codon_start=1
                     /product="Mannosyltransferase of the cis-Golgi apparatus"
                     /protein_id="XP_002489596.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0251"
                     /db_xref="EnsemblGenomes-Tr:CAY67315"
                     /db_xref="GeneID:8196483"
                     /db_xref="GOA:C4QVP2"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4QVP2"
                     /translation="MAKADGSLLYYNPHNPPRRYYFYMAIFAVSVICVLYGPSQQLSS
                     PKIDYDPLTLRSLDLKTLEAPSQLSPGTVEDNLRRQLEFHFPYRSYEPFPQHIWQTWK
                     VSPSDSSFPKNFKDLGESWLQRSPNYDHFVIPDDAAWELIHHEYERVPEVLEAFHLLP
                     EPILKADFFRYLILFARGGLYADMDTMLLKPIESWLTFNETIGGVKNNAGLVIGIEAD
                     PDRPDWHDWYARRIQFCQWAIQSKRGHPALRELIVRVVSTTLRKEKSGYLNMVEGKDR
                     GSDVMDWTGPGIFTDTLFDYMTNVNTTGHSGQGIGAGSAYYNALSLEERDALSARPNG
                     EMLKEKVPGKYAQQVVLWEQFTNLRSPKLIDDILILPITSFSPGIGHSGAGDLNHHLA
                     YIRHTFEGSWKD"
     gene            <467706..>469409
                     /locus_tag="PAS_chr1-3_0252"
                     /db_xref="GeneID:8196484"
     mRNA            <467706..>469409
                     /locus_tag="PAS_chr1-3_0252"
                     /product="DNA-binding protein involved in either
                     activation or repression of transcription"
                     /transcript_id="XM_002489552.1"
                     /db_xref="GeneID:8196484"
     CDS             467706..469409
                     /locus_tag="PAS_chr1-3_0252"
                     /codon_start=1
                     /product="DNA-binding protein involved in either
                     activation or repression of transcription"
                     /protein_id="XP_002489597.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0252"
                     /db_xref="EnsemblGenomes-Tr:CAY67316"
                     /db_xref="GeneID:8196484"
                     /db_xref="GOA:C4QVP3"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR015010"
                     /db_xref="InterPro:IPR015280"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="InterPro:IPR021661"
                     /db_xref="UniProtKB/TrEMBL:C4QVP3"
                     /translation="MSEPNTKKQKLTPYKNILVDNAGNPLSFHILGYFTKSDRSQLIN
                     MILEMGGKIVPDLPPLVDGVLFLTGDYKSIDEDTLKQLGDVPIYRDSFIYQCFVHKTS
                     LPIDTFRIDKNVDLAQDLINRALQESVDHVTSASTAAAAAVVVATNGLSSKPDARTSK
                     IQFTPEEDRFILDFVRRNPKRRNTHQLYTELAQHMKNHTNHSIRHRFRRNLSAQLDWV
                     YDIDPLTNQPRKDENGNYIKVQDLPQGIRGHYSAQDDYNLCLSVQPFIESVDETTGQE
                     FFKPLKGVFDDLESRFPHHTKTSWRDRFRKFASKYGVRQYIAYYEKTVELNGVPNPMT
                     NFTSKASIEKFRERRGTSRNSGLPGPVGVEAVSSLDHISPLVTSNSNSAAAAAAAAAV
                     AASASASSAPNTSTTNFFEQENIAQVLSAHNNEQSIAEVIESAQNVNTHESEPIADHV
                     RKNLTDDELLDKMDDILSSRSLGGLDDLIKILYTELGFAHRYTEFLFTSCSGDVIFFR
                     PLVEHFLLTGEWELENTRGIWTGRQDEMLRASNLDDLHKLIDLHGKERVETRRKAIKG
                     E"
     gene            complement(<469467..>470540)
                     /locus_tag="PAS_chr1-3_0253"
                     /db_xref="GeneID:8196485"
     mRNA            complement(<469467..>470540)
                     /locus_tag="PAS_chr1-3_0253"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489553.1"
                     /db_xref="GeneID:8196485"
     CDS             complement(469467..470540)
                     /locus_tag="PAS_chr1-3_0253"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489598.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0253"
                     /db_xref="EnsemblGenomes-Tr:CAY67317"
                     /db_xref="GeneID:8196485"
                     /db_xref="GOA:C4QVP4"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C4QVP4"
                     /translation="MSKASPETTHLLHHDPYDKTERSAAQKSSWKNTLYIIFATVVSV
                     PLLYLFLVYLPNLAPESVSELPIIRKVDKLDFSNQLEVPRRLILIGDVHGSLKPLKKL
                     LRKLDYNPKGSTDTVLLLGDFISKGPQSVEVVDLAIKNKFQCILGNHEISVLQRYNQF
                     HGLSGLKYRNNESDIENYDLQSGQLYPLDDEMRLAKQLYPRHIEYMGTCPFIYDLGPV
                     PRYNRKHTNYKETVDGVAVHAGLNWNVHELYDQDVTEVTEMRAMLPPDFSKATDDKSI
                     PGSVGWAKIWNHWQNNITDSDDFDGLKNRKVYYGHHASRGLNVRPYTMGIDTACVKGD
                     RLTAVVITYHKGKIREKLVSVGC"
     gene            complement(<470731..>472842)
                     /locus_tag="PAS_chr1-3_0254"
                     /db_xref="GeneID:8196486"
     mRNA            complement(<470731..>472842)
                     /locus_tag="PAS_chr1-3_0254"
                     /product="GTPase-activating protein for yeast Rab family
                     members"
                     /transcript_id="XM_002489554.1"
                     /db_xref="GeneID:8196486"
     CDS             complement(470731..472842)
                     /locus_tag="PAS_chr1-3_0254"
                     /codon_start=1
                     /product="GTPase-activating protein for yeast Rab family
                     members"
                     /protein_id="XP_002489599.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0254"
                     /db_xref="EnsemblGenomes-Tr:CAY67318"
                     /db_xref="GeneID:8196486"
                     /db_xref="GOA:C4QVP5"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C4QVP5"
                     /translation="MTDHVTSTAGKSQLLYAKSKVFLHLTKHKTGNVEGFLTITKRTA
                     STSNKELAINFIPKSILNSEDVKTLEWFDLYGLDGEKEYSPYHEDANQTKQSSSNEPV
                     KKAYITRPSNSSSTAYAFGVTIGSLYSIAVRPPSIHWKGSIILHSTLGERLPPIFFHD
                     DECPGFKRELSRKRKQFQPFSENNLKGGEIPYWGGDRFITVLRKYAAVEANPAEKTIL
                     MINPTPSDLSTFIPQDAIERSNDKTSLFGQGKWKLLTTMAKLTNFTKNKVNEVAQNFE
                     QPEVKAISEDFESARVYLAKWALSIEEEANRTRSKLILNDDYKSLLIEKLGKDFSSLV
                     TPQDINNASRKDPLKKAEWDSYFDTNGLPKITIQEIKDRIFHGGVDPEIRPQVWPYLL
                     QVYPWDVSTQEKHSLEITLQEQYLDLKTCWQTDINKRETDLFKDQKFRIEKDINRTDR
                     DISIFKRLPEETSDDNEDVSVIKNPNLNTLRTILITYNELNANLGYVQGMNDLLSPLY
                     YVIRDETIVFWSFVKFMDRMERNFVRDQSGMRLQMKTLNELTQFMLPEFYLHLEKCES
                     NNLFFFFRMLLVWFKREFPYETILKLWEIFWTDYYSSQFHLFFALALLDKHSNTIINN
                     LSRFDEVLKYFNDLSMTENDVDDLLMRAELLFLKFRSMVNVIDIKERYEGSAQLISSD
                     LRDLIGTELVIQKENEPCSVE"
     gene            complement(<472985..>473629)
                     /locus_tag="PAS_chr1-3_0255"
                     /db_xref="GeneID:8196487"
     mRNA            complement(<472985..>473629)
                     /locus_tag="PAS_chr1-3_0255"
                     /product="Polyamine acetyltransferase"
                     /transcript_id="XM_002489555.1"
                     /db_xref="GeneID:8196487"
     CDS             complement(472985..473629)
                     /locus_tag="PAS_chr1-3_0255"
                     /codon_start=1
                     /product="Polyamine acetyltransferase"
                     /protein_id="XP_002489600.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0255"
                     /db_xref="EnsemblGenomes-Tr:CAY67319"
                     /db_xref="GeneID:8196487"
                     /db_xref="GOA:C4QVP6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C4QVP6"
                     /translation="MSKSIPKHICIRPVTLYDLQKCLDLEEACFPESERASRDKVAYR
                     LKYCPELSSGLFIRTFEENKNKDDEYVLPNHSSVKEEKLIGLIMGTKCYDDRITERSM
                     EIPKLTTEGLVDTSIPDNDKVGHVESASNIGIHSLIIHPDYRGQNLATLLFKDYLQKM
                     SQQEVGSQIILIAHERLVPFYEKLGFNNLGPSQCRHGGESWIDFAIPIVHVNDD"
     gene            <473818..>474057
                     /locus_tag="PAS_chr1-3_0256"
                     /db_xref="GeneID:8196488"
     mRNA            <473818..>474057
                     /locus_tag="PAS_chr1-3_0256"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489556.1"
                     /db_xref="GeneID:8196488"
     CDS             473818..474057
                     /locus_tag="PAS_chr1-3_0256"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489601.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0256"
                     /db_xref="EnsemblGenomes-Tr:CAY67320"
                     /db_xref="GeneID:8196488"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C4QVP7"
                     /translation="MSDINTDSEILPLELVDKAIGSQVRILLINDREFEGTLVGFDEF
                     VNVILSDVTETGPEGTIHRDEMLLTGTTIAMFVTV"
     gene            complement(<474086..>475011)
                     /locus_tag="PAS_chr1-3_0257"
                     /db_xref="GeneID:8196489"
     mRNA            complement(join(<474086..474619,474709..>475011))
                     /locus_tag="PAS_chr1-3_0257"
                     /product="3-methyl-adenine DNA glycosylase involved in
                     protecting DNA against alkylating agents"
                     /transcript_id="XM_002489557.1"
                     /db_xref="GeneID:8196489"
     CDS             complement(join(474086..474619,474709..475011))
                     /locus_tag="PAS_chr1-3_0257"
                     /codon_start=1
                     /product="3-methyl-adenine DNA glycosylase involved in
                     protecting DNA against alkylating agents"
                     /protein_id="XP_002489602.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0257"
                     /db_xref="EnsemblGenomes-Tr:CAY67321"
                     /db_xref="GeneID:8196489"
                     /db_xref="GOA:C4QVP8"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="UniProtKB/TrEMBL:C4QVP8"
                     /translation="MSKINLLATRNQIKIRKAMSKRSIRQVKAAVANGHTNGKVSAPP
                     LALPTEFISYHDAHFIKAVEHLLKIDNTLYDSVVQGPFERFKKKRQILLPMIWATTSA
                     GGELTQYRLVAEEDATVMRGLGLSARKVQYTKDIARAFIEEEDSLLEFFFECSEEELF
                     KKMIAWKGIGPWSVTMFSVFSLNKMDCFTVLDLGVVRGASKYLQARPELLAELKDEVA
                     QLEKTKKKKAKKQAVSSNKKWIAVDEQIIERLAERFQPYRTALMVMFWRIGSVDLQVL
                     ES"
     gene            <475067..>476257
                     /locus_tag="PAS_chr1-3_0258"
                     /db_xref="GeneID:8196490"
     mRNA            <475067..>476257
                     /locus_tag="PAS_chr1-3_0258"
                     /product="DNA damage-inducible v-SNARE binding protein,
                     contains a ubiquitin-associated (UBA) domain"
                     /transcript_id="XM_002489558.1"
                     /db_xref="GeneID:8196490"
     CDS             475067..476257
                     /locus_tag="PAS_chr1-3_0258"
                     /codon_start=1
                     /product="DNA damage-inducible v-SNARE binding protein,
                     contains a ubiquitin-associated (UBA) domain"
                     /protein_id="XP_002489603.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0258"
                     /db_xref="EnsemblGenomes-Tr:CAY67322"
                     /db_xref="GeneID:8196490"
                     /db_xref="GOA:C4QVP9"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019103"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C4QVP9"
                     /translation="MKLTITLAHNDQILDIDVSSEMLLSDLKVLLELETSVLKNDQQL
                     FYNNNLLTGDDSPLEDLGLKDNELIILSKVEAHSDVNSHLNSVREQLIQNPLYQASLP
                     PSLRDKLDDPQGFKEEVEKLIQLGQFGQYGPSRTSVQQELDRLQRDPDNPQNQKRIME
                     LINEQAIEENMNTAFEISPESFVSVNMLYINVEINGVHCKAFVDSGAQTTIMSPKLAE
                     KCNLANLIDKRFRGVAQGVGSSEIIGRIHSAPIKIEDIIVPCSFTVLDTKVDLLFGLD
                     MLRRHQCVIDLKNNCLQIADRKTEFLGEADIPKEFFNQPMEAPSTAPVPKPVQPPQQL
                     GQRPAGSPPSTIQRPAVQPPPVDIPPEKIQQLINLGFGEEESKEALIRSRGNVEVAAA
                     LLFN"
     gene            complement(<476258..>476821)
                     /locus_tag="PAS_chr1-3_0259"
                     /db_xref="GeneID:8196491"
     mRNA            complement(<476258..>476821)
                     /locus_tag="PAS_chr1-3_0259"
                     /product="Cytoplasmic protein required for replication of
                     Brome mosaic virus in S. cerevisiae"
                     /transcript_id="XM_002489559.1"
                     /db_xref="GeneID:8196491"
     CDS             complement(476258..476821)
                     /locus_tag="PAS_chr1-3_0259"
                     /codon_start=1
                     /product="Cytoplasmic protein required for replication of
                     Brome mosaic virus in S. cerevisiae"
                     /protein_id="XP_002489604.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0259"
                     /db_xref="EnsemblGenomes-Tr:CAY67323"
                     /db_xref="GeneID:8196491"
                     /db_xref="GOA:C4QVQ0"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C4QVQ0"
                     /translation="MATLTPPLHFNRIHPGLYRGSYPRPINYTFLQSLALKTIIAITP
                     ETITEENDKELYDFCQKNNISVQHIDCQLSGKGKKRGVPLDYEKVTKILELIINADKS
                     PVYMYCINGGQITSLVVACLRKISFWSSISIYNEFITYATTINHNDRVFIENFQVKLN
                     VPENKVSWLWTGLNKNVIENHPSITII"
     gene            <476939..>477907
                     /locus_tag="PAS_chr1-3_0260"
                     /db_xref="GeneID:8196492"
     mRNA            <476939..>477907
                     /locus_tag="PAS_chr1-3_0260"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489560.1"
                     /db_xref="GeneID:8196492"
     CDS             476939..477907
                     /locus_tag="PAS_chr1-3_0260"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489605.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0260"
                     /db_xref="EnsemblGenomes-Tr:CAY67324"
                     /db_xref="GeneID:8196492"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="UniProtKB/TrEMBL:C4QVQ1"
                     /translation="MDPETKEAPTPVPDEVSKKQEENILPIGDTVEQIYNEIEEKGKK
                     LTSSLSSYWNSFQAHVLPSNESTSNLFETLGKKTELYINELDEDLLTIQNTTTSYLKK
                     IGSFWDQSEPETKSEPVDSNSKSEAQLKTLNTSRDLYLIDSSTDKQFLEFEKSFKYDG
                     LNVQNTKKLYLQDGDQPLVELIKELVPGKMSEEAFWAKYFYMRQKIGKQNGKDEKKSS
                     PSQPKKEEVEDFNWDDSDEESEFAIVQKPNVELTEEGEVLKEDETEADPEKKDIGKAT
                     TKTVQDAGTDIETLPDTRKPTTNETAKTETKSGAKNVEEDDDDDWE"
     gene            complement(<477935..>480061)
                     /locus_tag="PAS_chr1-3_0261"
                     /db_xref="GeneID:8196493"
     mRNA            complement(<477935..>480061)
                     /locus_tag="PAS_chr1-3_0261"
                     /product="Ubiquitin isopeptidase"
                     /transcript_id="XM_002489561.1"
                     /db_xref="GeneID:8196493"
     CDS             complement(477935..480061)
                     /locus_tag="PAS_chr1-3_0261"
                     /codon_start=1
                     /product="Ubiquitin isopeptidase"
                     /protein_id="XP_002489606.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0261"
                     /db_xref="EnsemblGenomes-Tr:CAY67325"
                     /db_xref="GeneID:8196493"
                     /db_xref="GOA:C4QVQ2"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C4QVQ2"
                     /translation="MTCQSVEELDAIVESKLREVDNKVSNGNVDFIKQYLIQAMNYYD
                     KYRSEIKKIGPTEKNPKYYCFQEAAYVNYKASQALLRERIPKLPGFGGYKSAYSKIYR
                     ELIEMVEGQEHEIAQIKSGLRKNFCDDTLVLRLRSLKSPSATQPKSLPDSTPTSQFKP
                     KPSKPFSITINEEYISVDQLSRLLKTNPNDILLIDLRSRQEYDVYHIEDGSGVDMSIC
                     IEPMSIRNGYTAEDLYQLSMAVNPDYERRLFKNRSQYELLVCYGNYDNEATVQMFMTI
                     MNKDTSLKRRSVYLKSGIKGWNQDLSFQDSKPNGYLTSTTDYFSNTPKHTITPKSSKS
                     SSKPTLKTTVNSGPAHTVGINNLGNTCYMNCILQCLLESDKFVSFFLQGDYKKHININ
                     SRLGSRGILATGFHLLVLLISRSSGKTVTPSSFAKDVSTVNKNFKLGEQQDCFEFLDF
                     LLDSLHEDLNECGNEPPIAELTPEEEKLREALPIRIASTIEWERYLKNNFSIVEDVFQ
                     GQYFSRLECTVCKSTSTTYNSFSSLSLPIPLDRQNVTLDDCFQAFCSVEELNGDDRWH
                     CPSCKKKQVAFKKLGISRLPSVLIVHFKRFQVKWETGHIIKIDKFISYPFKLSMDKYW
                     PKAQSEEELRNLEKLPSRNQNPPFNYRLTGVANHFGTRTSSGHYTSYVQKGGQWYYFD
                     DSAVTSNVDRHKIVNGNAYVLFYRRS"
     gene            <480240..>482597
                     /locus_tag="PAS_chr1-3_0262"
                     /db_xref="GeneID:8196494"
     mRNA            <480240..>482597
                     /locus_tag="PAS_chr1-3_0262"
                     /product="Mitochondrial membrane protein that coordinates
                     expression of mitochondrially-encoded genes"
                     /transcript_id="XM_002489562.1"
                     /db_xref="GeneID:8196494"
     CDS             480240..482597
                     /locus_tag="PAS_chr1-3_0262"
                     /codon_start=1
                     /product="Mitochondrial membrane protein that coordinates
                     expression of mitochondrially-encoded genes"
                     /protein_id="XP_002489607.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0262"
                     /db_xref="EnsemblGenomes-Tr:CAY67326"
                     /db_xref="GeneID:8196494"
                     /db_xref="UniProtKB/TrEMBL:C4QVQ3"
                     /translation="MLQVWRSSKTFGTKRWRLVSYKKLVNTKLGYQLLHTSRLSNNEE
                     QKFQSIIGNSIEELTESQEKVHHVPQESSEMQAVANGNVKKPPKAHKIIILKAEDSLS
                     RNRRIFEKQLQPEIEPIMNLLDFESQKKQLLVFQTKVTEKVLIDSIHTMKPSDVNVSV
                     NRFEQIAQDLASSYTLNQLRLYCQTYYNDQIPHKISKKKLITDIILSKHWNLQKTSSI
                     DPLRDVITEKVIQLSGTRDLFLLLSSDGIILQHWAKTGATIAVSTEDSQLTVRATKAT
                     VDFIEVMLAKILEKKETQLINMSIIKEIMNDVHLSDFPLNQLMTVSNVHFKKIDDSDE
                     LFSMCSLGSNKIELAKRLLVAALNYRPNTTESVIQLTDKSSTIFFPYNESTTLPWNYH
                     AHGLYRLRTPHKRVSQDSKVQFEPVGEDLVENLKGILEQIDQVEQEITKIEGLQEQEQ
                     IPHENNPDLSFDELEEIAYKDTNTELNNETDQILTEFQENGLSNKIDSTVSDLTIDPA
                     RVFSALSGINGTKNDVEYVASLGKVLFPNQNVGDDHYFQGHVPSIKQLVNSLPLFSQH
                     DPSFSETQDSYDHYLRIKFLPSLFEKGDSTQIIESVDKDSLKKPPVEFWFPIQNHHEK
                     KTVQIEGLQVVRVNQEKNVSIPLPSEVCDVRFSSNETTPIVRPNETSQDFSIWLKDQP
                     GIREFLQNSTIALGSRLNLLSNVNIEIHGETVNYTFTEIEQRRQLELNYRQHLLQYSA
                     VEGGLLGGKRTEVNLVNMAEAPATTESFAKFSKDVLDLVRILSCT"
     gene            <483173..>483670
                     /locus_tag="PAS_chr1-3_0264"
                     /db_xref="GeneID:8196495"
     mRNA            <483173..>483670
                     /locus_tag="PAS_chr1-3_0264"
                     /product="Cytoplasmic peptidyl-prolyl cis-trans isomerase
                     (cyclophilin)"
                     /transcript_id="XM_002489563.1"
                     /db_xref="GeneID:8196495"
     CDS             483173..483670
                     /locus_tag="PAS_chr1-3_0264"
                     /codon_start=1
                     /product="Cytoplasmic peptidyl-prolyl cis-trans isomerase
                     (cyclophilin)"
                     /protein_id="XP_002489608.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0264"
                     /db_xref="EnsemblGenomes-Tr:CAY67327"
                     /db_xref="GeneID:8196495"
                     /db_xref="GOA:C4QVQ4"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C4QVQ4"
                     /translation="MELTALRSSNPNTMIDQPLGRIVFELYDDVPKTIENFRALCTGE
                     KGYGYKDSIFHRVIPQFMLQGGDFTKFNGTGGKSIYGEKFADENFIHKHTKPGLLSMA
                     NAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGLDVVSKIETLGSSSGATKTQLKIT
                     NSGEL"
     gene            <483919..>485007
                     /locus_tag="PAS_chr1-3_0309"
                     /db_xref="GeneID:8196496"
     mRNA            join(<483919..483994,484055..>485007)
                     /locus_tag="PAS_chr1-3_0309"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489564.1"
                     /db_xref="GeneID:8196496"
     CDS             join(483919..483994,484055..485007)
                     /locus_tag="PAS_chr1-3_0309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489609.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0309"
                     /db_xref="EnsemblGenomes-Tr:CAY67328"
                     /db_xref="GeneID:8196496"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:C4QVQ5"
                     /translation="MSTISSKLSNLSLYDIRKASRKIQNSLSNYTELENLIRNATTTD
                     PWGPTSKQCEEIRNHLLEILNTAQLTASDERYGSYYDEDYGVEYGNPASDAISFVITR
                     IVEYSNRFSREGFVGKLKKNYITNGNEHRIVSKCLSLLEYLVINCYQPPLDILPHVAK
                     HVDYLKELHNVYQCVSSKDGHPDKHTEIVREKAGRVVQLIKDKRLLARHRQLLHKANQ
                     KIVNSSSRGNSSYNYDTEILGDESNDSATDGDEFGEYQQPPVTPIMNQQETPITPATA
                     TFVNTKPVENNFQDLIDLFPSDQNPTTSLQSNITVIQPQVQEKSQADKQQPKKDVFES
                     LLKRPTKK"
     gene            complement(<485030..>485737)
                     /locus_tag="PAS_chr1-3_0265"
                     /db_xref="GeneID:8196838"
     mRNA            complement(<485030..>485737)
                     /locus_tag="PAS_chr1-3_0265"
                     /product="Highly-acidic cytoplasmic RWD domain-containing
                     protein of unknown function"
                     /transcript_id="XM_002489565.1"
                     /db_xref="GeneID:8196838"
     CDS             complement(485030..485737)
                     /locus_tag="PAS_chr1-3_0265"
                     /codon_start=1
                     /product="Highly-acidic cytoplasmic RWD domain-containing
                     protein of unknown function"
                     /protein_id="XP_002489610.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0265"
                     /db_xref="EnsemblGenomes-Tr:CAY67329"
                     /db_xref="GeneID:8196838"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:C4QVQ6"
                     /translation="MDYKEEQTQEIEILESIYPDELERISDTEFTISLLLETASERKH
                     RLSLHVTYPETYPEVTPDLKVSVDDSFDAEEGGESDDEESSSEEQVVRLENEIFFTSD
                     DLKKLEFRLIDEAYDNIGIPSIFSLTSTLKDAAETLFQEKLNKATKEHEEELLKIERE
                     EQKKFRGTPVTVESFNAWRLRFRKELGLDEKQKKRLEKLHNGKLTGKEIFERGLAGGD
                     DVDEVTESVAQLTTEDS"
     gene            <485953..>487137
                     /locus_tag="PAS_chr1-3_0266"
                     /db_xref="GeneID:8196497"
     mRNA            <485953..>487137
                     /locus_tag="PAS_chr1-3_0266"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489566.1"
                     /db_xref="GeneID:8196497"
     CDS             485953..487137
                     /locus_tag="PAS_chr1-3_0266"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489611.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0266"
                     /db_xref="EnsemblGenomes-Tr:CAY67330"
                     /db_xref="GeneID:8196497"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C4QVQ7"
                     /translation="MATLDEIIVKARNFIETQRPDEALEFLESHAQGNEQNSKFLSVL
                     GETYLEISDLDQAYDLLKKACQLDPNAEENVEKFLYLGQMIGGKDGEELLNIGINRLT
                     NQLETLSNDANTDSKIEELLKLHGDKYKVAKYLVTKLDQALFVLIEIWMTDLCMEPEA
                     ESKCEELITKAIRFDDEIAQSRPEDRNPEVWSTLANIRISQQRPDDARQAVNKAWELF
                     NQKKSQLESISSDPDTDDKAVNEATVEYIELIQPLITLTRYSIELGLLELAISIASSI
                     QDINEQNVDSFYLEGFAHSLLAKKQQLNIEDIGQLIENEDLELDLKDPRTQQTVQDAR
                     VALSSAFKLLQVDSIAEETDEELVEKINQLLNQVGGFLLKEKDTTGIDETNWENEIEQ
                     DI"
     gene            complement(<487236..>487709)
                     /locus_tag="PAS_chr1-3_0267"
                     /db_xref="GeneID:8196498"
     mRNA            complement(<487236..>487709)
                     /locus_tag="PAS_chr1-3_0267"
                     /product="Protein involved in the HOG (high osmolarity
                     glycerol) pathway"
                     /transcript_id="XM_002489567.1"
                     /db_xref="GeneID:8196498"
     CDS             complement(487236..487709)
                     /locus_tag="PAS_chr1-3_0267"
                     /codon_start=1
                     /product="Protein involved in the HOG (high osmolarity
                     glycerol) pathway"
                     /protein_id="XP_002489612.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0267"
                     /db_xref="EnsemblGenomes-Tr:CAY67331"
                     /db_xref="GeneID:8196498"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:C4QVQ8"
                     /translation="MFEYTSVIDFGYDDDDPNYFGCYDKKLFKAHELDTDVERDYSEE
                     PTDNYEPQPSEIKAIALYAFTPENDNELALQEDQLVIISYEYGQGWLVAQDPRTGETG
                     LVPEEYVHFVDDEQQIATNYGEESQDDVEENILVSPIETKAGTKQDEWVDVASDD"
     gene            <487915..>488532
                     /locus_tag="PAS_chr1-3_0268"
                     /db_xref="GeneID:8196499"
     mRNA            <487915..>488532
                     /locus_tag="PAS_chr1-3_0268"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489568.1"
                     /db_xref="GeneID:8196499"
     CDS             487915..488532
                     /locus_tag="PAS_chr1-3_0268"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489613.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0268"
                     /db_xref="EnsemblGenomes-Tr:CAY67332"
                     /db_xref="GeneID:8196499"
                     /db_xref="GOA:C4QVQ9"
                     /db_xref="InterPro:IPR006973"
                     /db_xref="UniProtKB/TrEMBL:C4QVQ9"
                     /translation="MTSAHRPTFDPVKGKAEQMRSAVTHARSLPSHTKMKYRRATRTE
                     DLEGKNAEAKKNDNENDDENEDGMLSYSKFTLVEDGPYKEHKNSGDNDDGHFYSQEQV
                     NQSNLGSSQTEVNNSESSSEYESESEDEETLLRELEKIKQERKEKKMEEIETEMRTIP
                     QKRSWRNSTFRNTNSKKTTTDKKSSYTNDTLKTDYHQKFMDKFIK"
     gene            complement(<488587..>490008)
                     /locus_tag="PAS_chr1-3_0269"
                     /db_xref="GeneID:8196500"
     mRNA            complement(<488587..>490008)
                     /locus_tag="PAS_chr1-3_0269"
                     /product="Proline oxidase, nuclear-encoded mitochondrial
                     protein"
                     /transcript_id="XM_002489569.1"
                     /db_xref="GeneID:8196500"
     CDS             complement(488587..490008)
                     /locus_tag="PAS_chr1-3_0269"
                     /codon_start=1
                     /product="Proline oxidase, nuclear-encoded mitochondrial
                     protein"
                     /protein_id="XP_002489614.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0269"
                     /db_xref="EnsemblGenomes-Tr:CAY67333"
                     /db_xref="GeneID:8196500"
                     /db_xref="GOA:C4QVR0"
                     /db_xref="InterPro:IPR002872"
                     /db_xref="InterPro:IPR015659"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:C4QVR0"
                     /translation="MLYRRALLGSRVLARTIKTSTSAATTGATNFELPQRLEQHGMAI
                     DMPHKDASQASKYDHLKGLSASELINYGVIGMATINKPILDLVIKIFPYVPMVFVKMF
                     VYNLYCGGQTVEDVRKTGQRLKSRGIQNMMASLTIEGCNGNDNIDIPFILKETNKSVD
                     KMIVPHTLEMIKQAENINDVAPGYVALKPTGMAEDAANVLKNYNKPEYRERFEKLVDN
                     CRNVTSNIYKTNIDLLKKYPDRVAPFVVAVIDAEKHQLQQGVYELQRRLFKEFNPKGK
                     PVSVAGTIQMYLKEGLPLIELEKKLASEGNYRVGLKLVRGAYIHSEPDRNVIHDTKQN
                     TDYAYDSGVARCIQEIVNSNSLNGSDIGHLVVASHSRESQMQATTLLDALTHEDMSKY
                     LQRSNVVLGQLLGMADDVTHTLITKYGVKNLIKYVPWGPSKETKDYLLRRLEENGDAV
                     RADNGWPLVMGVVKTLFQRIIRI"
     gene            complement(<491053..>492424)
                     /locus_tag="PAS_chr1-3_0310"
                     /db_xref="GeneID:8196501"
     mRNA            complement(join(<491053..492351,492404..>492424))
                     /locus_tag="PAS_chr1-3_0310"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489570.1"
                     /db_xref="GeneID:8196501"
     CDS             complement(join(491053..492351,492404..492424))
                     /locus_tag="PAS_chr1-3_0310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489615.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0310"
                     /db_xref="EnsemblGenomes-Tr:CAY67334"
                     /db_xref="GeneID:8196501"
                     /db_xref="InterPro:IPR008812"
                     /db_xref="UniProtKB/TrEMBL:C4QVR1"
                     /translation="MDQLLAKAGNQVVTFAIRSGITIASGYAIKTIGKYVDKIPAKDR
                     KSVEFLKRKLQLRIEIVTGAIDLIKLVAARGNSNLQSTLELTSDLTNDIYEFDDFLAE
                     LTDKLEKGKSSESLKEVQDYMKFLLTKIEEAIPLINLALTTSGANLTGGLPSTVSPGR
                     LLQASNYVTLADSKFTDSEQQVGPSFDLTLFQIFSGSSNVSWKEEMARCIVKVVRVPS
                     KSQEYSYKLIITESFDDDRYHESSEPNVKELDVAHVIRLFFSASSKLLRLEDRNCPVL
                     ILKTKKGSEKEEAIEWTAFSEYSKAPGSDSEDEEEDFSEEDNDRVTRKVNAARNLLYA
                     NNTPAVGKEPPKLSESIENANTSLSLLEYILRLCALQGNDQQSILKVTDERLAIYLAD
                     ESSESQEKRSKREGSGSKDWRKSITPPPAEITSKLDNLTLNETGLEK"
     gene            complement(<492550..>493866)
                     /locus_tag="PAS_chr1-3_0271"
                     /db_xref="GeneID:8196839"
     mRNA            complement(<492550..>493866)
                     /locus_tag="PAS_chr1-3_0271"
                     /product="Non-essential tRNA:pseudouridine synthase"
                     /transcript_id="XM_002489571.1"
                     /db_xref="GeneID:8196839"
     CDS             complement(492550..493866)
                     /locus_tag="PAS_chr1-3_0271"
                     /codon_start=1
                     /product="Non-essential tRNA:pseudouridine synthase"
                     /protein_id="XP_002489616.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0271"
                     /db_xref="EnsemblGenomes-Tr:CAY67335"
                     /db_xref="GeneID:8196839"
                     /db_xref="GOA:C4QVR2"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C4QVR2"
                     /translation="MRPFPSLLKNHHLRLLMSDTDYRKWSKPQLISRILQLEGKSGEL
                     ALMESKPRKNEVDFSTATIRQIALKFSYLGWNYQGLAVQREATDLPTIEFKILEALRQ
                     CRMIPSLNPIDCAFSRCGRTDKGVSAMNQVIGLNVRSRLTPEELESPENDIKELDYIN
                     ILNQLLPSDIRIHGVCLRPPKGFDARFSCRGRHYKYVFQDEGLDLESMKKAAPMFEGV
                     HDFRNFCKVDGAKQMTNYTRAVRSSQILPLEGHPGYYVFDLKGTAFLWHQVRCMVAIL
                     LMIGQGFESPDIVSKLLDIQSHPQKPVYVMAHDIPLVLYDCIYDDDVNFQPATNANKI
                     LKSHQEFRGVYYDYHLKYIISNFMRNIVMPGPIQITAGKQLHNTGDGKGKFANKHVKL
                     LNRPTVEEPEVLNEKWRKKRKLIAEQESKEELQETNGISNGDVPSI"
     gene            <494007..>494786
                     /locus_tag="PAS_chr1-3_0311"
                     /db_xref="GeneID:8196502"
     mRNA            <494007..>494786
                     /locus_tag="PAS_chr1-3_0311"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489572.1"
                     /db_xref="GeneID:8196502"
     CDS             494007..494786
                     /locus_tag="PAS_chr1-3_0311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489617.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0311"
                     /db_xref="EnsemblGenomes-Tr:CAY67336"
                     /db_xref="GeneID:8196502"
                     /db_xref="UniProtKB/TrEMBL:C4QVR3"
                     /translation="MKEYTLKEWDTSKFGSKWQQIYHRKMVQPAKKYHSLMTLLGFLL
                     ALLTHCIMYLSFYQMTAFLALFRCFMSLTITCIIFSASIKYQEKIYHNFNYFSSIFLE
                     EYITFTEQLMEEYNIDSSALLNLEYISDRNSTADISLGSIIQLWQSPSVYDSYLLCEA
                     LDHEDSFSDIWIDSLFLRSLNTGCLFNISLDMAYFVTSSACLLVHLALLNFPAVKFVP
                     SMEIFYLDIASSTLVLLLCNYLNWEVWNTLGDKKRQYCDLV"
     gene            <494885..>496729
                     /locus_tag="PAS_chr1-3_0272"
                     /db_xref="GeneID:8196840"
     mRNA            <494885..>496729
                     /locus_tag="PAS_chr1-3_0272"
                     /product="Putative ATP-dependent RNA helicase, nucleolar
                     protein"
                     /transcript_id="XM_002489573.1"
                     /db_xref="GeneID:8196840"
     CDS             494885..496729
                     /locus_tag="PAS_chr1-3_0272"
                     /codon_start=1
                     /product="Putative ATP-dependent RNA helicase, nucleolar
                     protein"
                     /protein_id="XP_002489618.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0272"
                     /db_xref="EnsemblGenomes-Tr:CAY67337"
                     /db_xref="GeneID:8196840"
                     /db_xref="GOA:C4QVR4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QVR4"
                     /translation="MTTSSLDWDSLSYKLQPWILEGISSLGYDSMTPVQASTIPLFCK
                     HKDVVVEAVTGSGKTMAYIIPVLEKIAQYYAQDLPLLRGDVLAMILLPTRELASQVQR
                     NFDQLLKFQPDDNKITTQLLVGAVGSVREDVYSFLQNRPQILIGTVGRMLEFLGSSNV
                     KPKSLQVLVLDEADRLLDLGFSHDVLTIIEKLPRQRRTGLFSATISSAGSDIFKTGLA
                     NPVRIVVKNNNSDGSKNAVPDSLGISYISLTTDKKIKTLLELLFKYHYKKAIVYLPTC
                     VGVQYFYLLLQALINNLDLPISSEDLNLFSIHGKLETAARLKALNGFADSFASKSVLL
                     TTDVAARGLDIPEVDLVIQLDPPTDPDMFLHRSGRTGRANKVGKAIVMLNEGRELDYI
                     DFMKVRNVHISELKFNGDLELDEISQAMHSWLLDDRARYDLAVRAMVAFVKSYSKHTA
                     SSIFRLQGLDYIKLCRMYGLFRVPKMPETKFITKEKYEEENVDEEGWIIKVDMDSYKY
                     SHPDKEEKRLEELRTHKKLKESKLRAAKRREQKAKNASWSLQTKQKEIKQERRSITEQ
                     RQLAKERERIANYNSDDEENEVDWKDAIREQKRRKTTSTAVQGSFDDL"
     gene            complement(<496764..>497927)
                     /locus_tag="PAS_chr1-3_0273"
                     /db_xref="GeneID:8196503"
     mRNA            complement(<496764..>497927)
                     /locus_tag="PAS_chr1-3_0273"
                     /product="Putative cysteine synthase, localized to the
                     mitochondrial outer membrane"
                     /transcript_id="XM_002489574.1"
                     /db_xref="GeneID:8196503"
     CDS             complement(496764..497927)
                     /locus_tag="PAS_chr1-3_0273"
                     /codon_start=1
                     /product="Putative cysteine synthase, localized to the
                     mitochondrial outer membrane"
                     /protein_id="XP_002489619.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0273"
                     /db_xref="EnsemblGenomes-Tr:CAY67338"
                     /db_xref="GeneID:8196503"
                     /db_xref="GOA:C4QVR5"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:C4QVR5"
                     /translation="MPRLDHSLTIAVLAASVCLAAFGLRRRKVSGVVADGIDQCIGNT
                     PLVKVHSLSRATGCEIYAKLELANPGGSAKDRVALAIIRKNEKNGVIKPGRGDTIFEG
                     TSGSTGISFAMLCDSLGYKAHICLPSDTSEEKLQLLESFGAIIEKVKPASIVDPNQYV
                     NAARRGAEVMSQDPSSTSVGVFADQFENDSNWRIHYTTTGPEIWNQLQGKLDYFVTGS
                     GTGGTIAGCARFFKEQKRKVQVFLADPQGSGLYNRIKHGVMFDTVEKEGTRRRHQVDT
                     VIEGIGLNRVTHNFHMGESFIDDSVRVLDEEAMKMASYLCRNDGLFLGSSSCINAVGV
                     LKLIKEGVIPESSTVCFIACDSGNRHLSKFWLEARLYKDIELDDIITSAVHKL"
     gene            <498266..>500863
                     /locus_tag="PAS_chr1-3_0274"
                     /db_xref="GeneID:8196504"
     mRNA            <498266..>500863
                     /locus_tag="PAS_chr1-3_0274"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489575.1"
                     /db_xref="GeneID:8196504"
     CDS             498266..500863
                     /locus_tag="PAS_chr1-3_0274"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489620.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0274"
                     /db_xref="EnsemblGenomes-Tr:CAY67339"
                     /db_xref="GeneID:8196504"
                     /db_xref="GOA:C4QVR6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4QVR6"
                     /translation="MDKSKIRYKRSRSARACEVCHARKVRCDAVDIFPCTNCKTFGNE
                     CVIPEVRKRRARKIHEEKNGDLSLNSSSPASSSSTTKIKPELPGKGRINLAVSATETI
                     AATVTPGTGADKSVGSSYKNQTWDFSGSTSCLNQVMATVSTKELSGSEYYRSPEVKAF
                     HEMEMEALKIKGAFLIPTEELCKILISCYFQHVHPWSPIINRTHFEKHYLPNLRNPPS
                     ILLLQCVLLAGSRVCKHPQLMDPETGSVDTCSFIFYYRAKAIYDSNLETDPISLVQSI
                     SLLGHFWESAESVVKNIFYWSRLAITLAQSYGFHRCLQPSSKTSAEDLKLIRRIFWCL
                     FIRDRGISVAFGRPLTIDLDDCDVPLLSTRDFIEIDEDNKAISPLTLAAEHVDFVMHS
                     LKLAEIMGIVLKQQYTVKAENLESVYHINIVKHCDMIMGNWLHNLPSTLCYHASDPAQ
                     QSLPRAIINCNYYAVLCLIHRRNILKRVKHPLPNKDDYYPSWGVTFQAAHMISQIGKY
                     LQTSGQLQYVSNSLVFSFYIATVMMIYHLYNKNRKAAAIAKQSIDTLCSCLNELSKVW
                     KIALLCSKILDILLKDEAKRLEFVQNVICVSVDVGKKNKVHSKSQNVQTAEYGDALLS
                     EDPKPKENSGNDLSMPLNEKRPPAAIFNNGLSQNPNLINIMTQSFPGFTNEDNLIPMD
                     GNTNPDSFPAQTSQDFNNLQHNLDLFKPNKLFPSYDNGDSHPPLDRENLNRLNKSKNN
                     HKFQITKSHSNESPKTEDSVSSGNEFVIEKIINDNWMPMFDVPANAETTDNDAQHVSS
                     ATNTGSGSSVEDAHPSEPLSATLLDPSVFNLANGNILNPETVYGPNMEGFDFHSGNFA
                     RSDWFNFFQ"
     gene            <500977..>502728
                     /locus_tag="PAS_chr1-3_0275"
                     /db_xref="GeneID:8196807"
     mRNA            <500977..>502728
                     /locus_tag="PAS_chr1-3_0275"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489576.1"
                     /db_xref="GeneID:8196807"
     CDS             500977..502728
                     /locus_tag="PAS_chr1-3_0275"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489621.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0275"
                     /db_xref="EnsemblGenomes-Tr:CAY67340"
                     /db_xref="GeneID:8196807"
                     /db_xref="UniProtKB/TrEMBL:C4QVR7"
                     /translation="MPLTYHHPYLNGDVVHTKRSVKGKENGGNLDLSNGSLPLFSSVK
                     ELQGLKFEGFQELSSFIKGKKGSILDITANSDGSQEEDNDQVSVDGDQDMIEETQTEK
                     SLEDHFISLSLFQEKLLGRKELQLLTIGVNNLPTGVTRSAGLVAGFLESVIDDYLVDF
                     LPNDGNSKYFWSFVDNDVVEFKVVFIQFRSFELLRMVIQIFEKMNLKMHISEGCKKVL
                     EQVETFERDEDAEKVKEYIELISKLSSRKLHSYKSHGDVVEKLDNLSKYYNRYRIDPK
                     ELVDVPNELVDTVKKEIVEFRLNVLKLEKSKRETQMLNDKRKARMRLRRMLQLNNVSG
                     NLGNSRNEDEDEDEDEYEDENEKQFNEMTDEEYERRRMENVQLNHKKKFELYESSVHK
                     NDIARINNIHNFENNIKHSSYESKLVPSRREKFLEEYVLHIKESTNSIDKNIQYYKKH
                     VNYVNFREKVKLKEEAMDAQDREEENFEAKAVQESDQFLQSLGKKSQPQQIPDSLHQP
                     IIEKINQVINDLLGMTEESLTRFIFNFFRDNFFQLDHSNVEYLAFIKELEETLDEDAR
                     KASDEIEQFIQVQVSKP"
     gene            <503314..>505887
                     /locus_tag="PAS_chr1-3_0276"
                     /db_xref="GeneID:8196808"
     mRNA            <503314..>505887
                     /locus_tag="PAS_chr1-3_0276"
                     /product="Mucin family member"
                     /transcript_id="XM_002489577.1"
                     /db_xref="GeneID:8196808"
     CDS             503314..505887
                     /locus_tag="PAS_chr1-3_0276"
                     /codon_start=1
                     /product="Mucin family member"
                     /protein_id="XP_002489622.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0276"
                     /db_xref="EnsemblGenomes-Tr:CAY67341"
                     /db_xref="GeneID:8196808"
                     /db_xref="UniProtKB/TrEMBL:C4QVR8"
                     /translation="MINLNSFLILTVTLLSPALALPKNVLEEQQAKDDLAKRAVYTNI
                     TSGTLDIPISFDVSTIDVPSISIPSFLTSSFLFDDPAVTTSQESTNANVETVSTNSDD
                     TTQVADATDSLLTTEVAVTLSSSEDESPASTPTQVAPTGGSETSTTTSPAPVFTFTFE
                     PPTYTTSYGDESSLSSSTQTEDTSTTSSSVPIFTWPFEPPSNSDSETGDATSSSTPSP
                     AESSGESTGFIRPSIITSSDLTFPVSPSDLPTGGSVVSSDETSYSTPSPDESPVESSD
                     APTLVLPPVTSSSEPPVITVTVPPNETSDVSSDETSYSTPSPDEPPAESTFVTQSSPL
                     VVTSSETPVVTISEPTTITPSEVPPTLSTESSVETPGVVSSIPPIESSIPPAEPTTVT
                     SSEPAIVPPIVETTVSSSIESVESTVISEAPSPVTTSAETPSELPSTEDTSVEVPPTS
                     VVSSPRETFTSSDTATPTISPLPYLTPSVSSQETSETIETSTTLEVPSPATPTQQASS
                     STVTTPIVGTDSVVGTAPSQVPYPAVGSTSTTRTQTWIPTSLIIATSTQPSGTARSTQ
                     TASGSRDEPTSTLPKAISLNPTGEPEEGYELITVGFKEPLNYAFVVGNSMSPVQIFEY
                     LPGVLCYPYESELDASKITVLQLVPYTSPDVSYIITVAEVYFKSSLIGDLQSEIHDTS
                     SSLYSNPDPSERALANLIDPRVPITGLNLGSTSSQTSGNGSGNSDNSSNSDGDGLDST
                     ESQGSSNTGKVAGIAVGSVMGFTLYLGSIALFYRYRKNKSKLASDEAAVGSSESPETT
                     QISNVSYSSPGAIVVGSTNSHIGSNSSPEVTSSTIRGDSTHSNLPKISGPVSTYNSLG
                     W"
     gene            complement(<505963..>506577)
                     /locus_tag="PAS_chr1-3_0277"
                     /db_xref="GeneID:8196809"
     mRNA            complement(<505963..>506577)
                     /locus_tag="PAS_chr1-3_0277"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489578.1"
                     /db_xref="GeneID:8196809"
     CDS             complement(505963..506577)
                     /locus_tag="PAS_chr1-3_0277"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489623.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0277"
                     /db_xref="EnsemblGenomes-Tr:CAY67342"
                     /db_xref="GeneID:8196809"
                     /db_xref="GOA:C4QVR9"
                     /translation="MSNGPAKYTIINRLVQPILPIKKQLLEENPNHSLRLLSLYRRHL
                     RLRPFISPRADIKQFYTDLVRLRFKEDIELRRKHFTTPYTPLDKDSIIERVIRTLEIV
                     NNGCVDSPNSIERQIIRNILDVEYANKNIKMVPLMSVEYFKEELWKGRELDVVSEPKL
                     YDWVNKIDISNKSKKKNEQLNLLTALRNHYRSVASFNEVQKTLL"
     gene            <507150..>507623
                     /locus_tag="PAS_chr1-3_0278"
                     /db_xref="GeneID:8196810"
     mRNA            <507150..>507623
                     /locus_tag="PAS_chr1-3_0278"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489579.1"
                     /db_xref="GeneID:8196810"
     CDS             507150..507623
                     /locus_tag="PAS_chr1-3_0278"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489624.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0278"
                     /db_xref="EnsemblGenomes-Tr:CAY67343"
                     /db_xref="GeneID:8196810"
                     /db_xref="UniProtKB/TrEMBL:C4QVS0"
                     /translation="MVPYYSETDHTLVVQCYCRSFNEKLTEKFRTQLQHSAILKNCID
                     ELQELNFSLELISTRPILYEELVEHLNFLMTSNMFQLETTVPIVFSFYGIDSFLETIK
                     YWETLCDALSTTSTRSLMSLNMIKLLNNNMIQSENFTTHFFKENRHFYNFASFFA"
     gene            complement(<507620..>508201)
                     /locus_tag="PAS_chr1-3_0279"
                     /db_xref="GeneID:8196811"
     mRNA            complement(<507620..>508201)
                     /locus_tag="PAS_chr1-3_0279"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489580.1"
                     /db_xref="GeneID:8196811"
     CDS             complement(507620..508201)
                     /locus_tag="PAS_chr1-3_0279"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489625.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0279"
                     /db_xref="EnsemblGenomes-Tr:CAY67344"
                     /db_xref="GeneID:8196811"
                     /db_xref="UniProtKB/TrEMBL:C4QVS1"
                     /translation="MSRLRRLNRKLGYPGDDGNGDDVEYFSYATLKEQVEIINEFKNS
                     TQDNHFLGSKFVRVSLMGFQSLIILVCTFLITLPAYRHNGNSLYSFIAVTSSFLSFVL
                     LQSYGIKLLNGDQSRRLLDTLAASYDISKFSLATFNLVYSLVLVAFKWKHLNGTDIIY
                     IYPLLMSIIVETIVYDQRTIQDQIDELENLKTD"
     gene            <508560..>509138
                     /locus_tag="PAS_chr1-3_0280"
                     /db_xref="GeneID:8196812"
     mRNA            <508560..>509138
                     /locus_tag="PAS_chr1-3_0280"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489581.1"
                     /db_xref="GeneID:8196812"
     CDS             508560..509138
                     /locus_tag="PAS_chr1-3_0280"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489626.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0280"
                     /db_xref="EnsemblGenomes-Tr:CAY67345"
                     /db_xref="GeneID:8196812"
                     /db_xref="InterPro:IPR009009"
                     /db_xref="InterPro:IPR014733"
                     /db_xref="UniProtKB/TrEMBL:C4QVS2"
                     /translation="MQFLKTISLAIISTLVSSAVGGPIRKFGNDSKQCTDSSFYHTLN
                     TTFITNSTSTRFNSSSLEPTEPSTTVTVETSASSSEQTPVESSSGSETTGRGTFYNVS
                     ADACGTSHTNADDVVAIAQSLYESLGVSNEYVSTACGRYINASYGGKSVRVQVVDACA
                     SCSENDLDFSPSAFQKLADPELGVIQVTWSFE"
     gene            <509334..>509574
                     /locus_tag="PAS_chr1-3_0312"
                     /db_xref="GeneID:8196813"
     mRNA            join(<509334..509472,509525..>509574)
                     /locus_tag="PAS_chr1-3_0312"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489582.1"
                     /db_xref="GeneID:8196813"
     CDS             join(509334..509472,509525..509574)
                     /locus_tag="PAS_chr1-3_0312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489627.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0312"
                     /db_xref="EnsemblGenomes-Tr:CAY67346"
                     /db_xref="GeneID:8196813"
                     /db_xref="InterPro:IPR007513"
                     /db_xref="UniProtKB/TrEMBL:C4QVS3"
                     /translation="MARGNQRELARQKNLKKQQQQKSKRDGDPVKNKENDAAILREKQ
                     AKADARKAAEAAEKAKKK"
     gene            complement(<509630..>510661)
                     /locus_tag="PAS_chr1-3_0281"
                     /db_xref="GeneID:8196841"
     mRNA            complement(<509630..>510661)
                     /locus_tag="PAS_chr1-3_0281"
                     /product="Subunit of the core complex of translation
                     initiation factor (eIF3)"
                     /transcript_id="XM_002489583.1"
                     /db_xref="GeneID:8196841"
     CDS             complement(509630..510661)
                     /locus_tag="PAS_chr1-3_0281"
                     /codon_start=1
                     /product="Subunit of the core complex of translation
                     initiation factor (eIF3)"
                     /protein_id="XP_002489628.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0281"
                     /db_xref="EnsemblGenomes-Tr:CAY67347"
                     /db_xref="GeneID:8196841"
                     /db_xref="GOA:C4QVS4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR027525"
                     /db_xref="UniProtKB/TrEMBL:C4QVS4"
                     /translation="MRPILLKGHERPLSQVKFNRDGDLLFSVSKDSVASIWYSSNGER
                     LGTLNGHSGAISAIDIDPTTTFAITGSADFSAKLWRVETGECIFTWNTVTPVRGVEFN
                     KDASKVLVLTAEVMGHPGTISIYPVDFTKEEQSTEPLLVIKRQPELGVFTVAGWSYGD
                     KYIIAGHNDGSISKIDAETGEFLETAKYHEGIVTDLQFSPDRTYFITSSKDQSAVLVD
                     VLEFKLLKQYQAKAPVNSAVITPVKDYIILGGGQDAKDVTTTKSADGKFESKIFHKIF
                     KDEIGRIKGHFGPINTIAIHPKGTGFASGGEDGYVRLHHFDQPYFDFQYDVEKTAAAT
                     NKASLQTAS"
     gene            complement(<514184..>515893)
                     /locus_tag="PAS_chr1-3_0285"
                     /db_xref="GeneID:8196814"
     mRNA            complement(<514184..>515893)
                     /locus_tag="PAS_chr1-3_0285"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489584.1"
                     /db_xref="GeneID:8196814"
     CDS             complement(514184..515893)
                     /locus_tag="PAS_chr1-3_0285"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489629.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0285"
                     /db_xref="EnsemblGenomes-Tr:CAY67348"
                     /db_xref="GeneID:8196814"
                     /db_xref="UniProtKB/TrEMBL:C4QVS5"
                     /translation="MKIRVPFLILSCLSTAICIVNSSLAIYLCKKVSFEPTLVALAVG
                     ELIPLAGIVVVGTSQGGVLFMGCLLVSCVASLASGITWLARIVKNVERMAKYLESYYN
                     LTICLISLFILSQVFKIVLTHFIPHSTPKIEFPKDEESFALETILNYKASAQTLVQET
                     NIPTHLPNEGQATWCNDNNDSVKIHEPAQYSQDIKSSMQLGSERSSQQCFDPEEYKVH
                     NHKESLKSKRSLEFEKNIIRNISNSLLPPVLQQGKSDISYLRNEMMGTPEKSHQDNEN
                     HDSEGKLFIDDLSDIPESYPQKDLWNSNRTGNISHVSLRNWNENYTDWNQRQERKGVT
                     TELYQLNPEFRNTEQLFHNNDASSVEHMEQETSFGAPSLYSFSNNKLRQAESQDSSTV
                     EANVGLTLMTNVGSKQTLIQEEEGLDIQSKGKQRRSSIATFKNTSPIKKLRELKNEIR
                     SKNSVHHKSNSSLTSSIHVGMTFASAPTSPVKRKTHSLSKSMSCFHVSSQSIHRGDRS
                     LRTVHGSPEKPNLSTLRHYPPLSDNPSSRESSQGSSCPSMFVGQYDREKWTKLKSKEE
                     VIV"
     gene            complement(<520327..>521769)
                     /locus_tag="PAS_chr1-3_0287"
                     /db_xref="GeneID:8196815"
     mRNA            complement(<520327..>521769)
                     /locus_tag="PAS_chr1-3_0287"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489585.1"
                     /db_xref="GeneID:8196815"
     CDS             complement(520327..521769)
                     /locus_tag="PAS_chr1-3_0287"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489630.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0287"
                     /db_xref="EnsemblGenomes-Tr:CAY67349"
                     /db_xref="GeneID:8196815"
                     /db_xref="UniProtKB/TrEMBL:C4QVS6"
                     /translation="MTPESSELLSKLLKTLEDRTFDSAIIADSIASLSGDTSLHEDTD
                     GSGLSPTLKLLAPKLLDVTKDTSVTIDQHKSTLNLWEALFSNLTFNCIIEEIPLVFIL
                     DSINSGNSDLVLLAIKVVLKADPIDSIANTSIIKHLISLLGVEDTPVSVVNGIENFIN
                     IALLTGGDLIKRRFTSTEIISILLQMKRNESETIQARLYEVVFVLLTYTKQEEIPQDL
                     YLITENQFNSLNDILLKSLIIQFYTRLLKLAHNSDHSKDWLLRKIRPQYQYILKLFFD
                     PEYHGEEKFLLVPEAVKTIATLSYINDGEVFNNLEEKHSILSTATDSFYGDGSVLLLS
                     DINPTVLIPKYQTFISSLPLRASLIPIIKNLITTPETFSFLSLPTTSLRNLPMLELFD
                     ILASVSAFEYSSQVLLHEWPSIMRNLLDENVSITEPEVRFLKRQILENLLQYNASVLG
                     IWSTQIKRVHRELISGKRLEAQPVLGDSVS"
     gene            <521885..>523117
                     /locus_tag="PAS_chr1-3_0288"
                     /db_xref="GeneID:8196816"
     mRNA            <521885..>523117
                     /locus_tag="PAS_chr1-3_0288"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489586.1"
                     /db_xref="GeneID:8196816"
     CDS             521885..523117
                     /locus_tag="PAS_chr1-3_0288"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489631.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0288"
                     /db_xref="EnsemblGenomes-Tr:CAY67350"
                     /db_xref="GeneID:8196816"
                     /db_xref="GOA:C4QVS7"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C4QVS7"
                     /translation="MSLSKNEIINLDVGFTEQRLDSLYSDLGLLREQNEIGYEFNLKA
                     WKRLIIHLMDNGYFDQKIVINGKKLEEKVTIPGYLKPRLDLVINELYKDGELVRLDDF
                     KNSLNGGSLFLPIFQWISNRSFNSGDSNHRLKDIDYLDFEQLKKYTENVASLLEKHRD
                     HYTDRVVHKDSLVQRFSHKFCKEDFELILLFLSKEKKLLQIEGEVVKFGDTPIDESDI
                     AIVSLKKSADQMETELNYLNERLEVTTTNAKTYLKNGNKIMAKSCLKIKKLVELNIER
                     TSSNFYKVSELLNSINHAKNNLAVVNTLESSHYILKQLNGEVGELNHVHELMEAISNE
                     TAKVDQVSELLGEASNDVDIDDEYEKLLKEQTEKDNLEDERLTERLKNLKTSESQEKE
                     KTKQPVDQPERYNQKILN"
     gene            complement(<523189..>524532)
                     /locus_tag="PAS_chr1-3_0289"
                     /db_xref="GeneID:8196817"
     mRNA            complement(<523189..>524532)
                     /locus_tag="PAS_chr1-3_0289"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489587.1"
                     /db_xref="GeneID:8196817"
     CDS             complement(523189..524532)
                     /locus_tag="PAS_chr1-3_0289"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489632.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-3_0289"
                     /db_xref="EnsemblGenomes-Tr:CAY67351"
                     /db_xref="GeneID:8196817"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C4QVS8"
                     /translation="MTESLFQHEVGPAIQAAIEQQKFLLIYSTTDGEDKWGDELILNN
                     PKFPDLVKGKAITFKLVQGSRDFDNFKQVFPGVTVPSVIVINAGQVVDLLQGPLTRDE
                     FNNRITKILSTQVKTSSNPLPKKEKESKSSLRKDSRYLAAEIYKKEQRKRQQQEKEER
                     ERILELVRLDQRERKRRQSSSSNDKDIVSEPLVENVHSTHDNDEMYIIQLRLFDGTAI
                     RHAFNSRDTLENVRHFITESYPEYQQKTYYFYKPLQRITFSDTDEFKSLFDLKLNRAS
                     LILKPREFYGTGNNTNSSFTPAGSSIFGRIQGFIGSVMGHNQTTASSTQESTKEESSE
                     DHVEDEEFMSCNGSMKSPQHSPLLRSEGNAPFLSHANQSSLNLNSSASNFSVTEPHRT
                     EEALSRPESRNSNSILSSRINSSTRIRTLNHQGEDPDKRQVFNGNNLDLVDDKNK"
     gene            <526519..>529209
                     /locus_tag="PAS_chr1-1_0002"
                     /db_xref="GeneID:8196818"
     mRNA            <526519..>529209
                     /locus_tag="PAS_chr1-1_0002"
                     /product="Plasma membrane H+-ATPase, pumps protons out of
                     the cell"
                     /transcript_id="XM_002489588.1"
                     /db_xref="GeneID:8196818"
     CDS             526519..529209
                     /locus_tag="PAS_chr1-1_0002"
                     /codon_start=1
                     /product="Plasma membrane H+-ATPase, pumps protons out of
                     the cell"
                     /protein_id="XP_002489633.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0002"
                     /db_xref="EnsemblGenomes-Tr:CAY67352"
                     /db_xref="GeneID:8196818"
                     /db_xref="GOA:C4QVS9"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006534"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C4QVS9"
                     /translation="MSAEEPTKEKIPINHSDDEDEDIDQLIEDLQSVHGFDDEEEEEH
                     HEGATAKPVPEELLQTDPAYGLTTDEVHKRRKRFGENKMAEEKENLLVKFCMFFVGPI
                     QFVMEAAAILAAGLEDWVDFGVILALLFLNASVGFIQEYQAGSIVDELKKTLANSATV
                     IRDGQVVDILADEVVPGDILKLEDGVVIPADGRLVSEECFLQVDQSAITGESLAVDKK
                     TGDSTYSSSTVKRGEAYMVVTATGDSTFVGRAAALVNKASAGQGHFTEVLNGIGTILL
                     VLVIATLLVVWVACFYRTSPIVRILRFTLAITIVGVPVGLPAVVTTTMAVGASYLAKK
                     QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEADDLMLTACLAASR
                     KKKGLDAIDKAFLKSLISYPRAKAALTKYKVIEFQPFDPVSKKVTAYVESPEGERIIC
                     VKGAPLFVLKTVEEDHPIPEDVHDNYENKVAEFASRGFRSLGVARKRGQGHWEILGIM
                     PCMDPPRDDTAQTVNEATHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGG
                     AGDMPGSEIADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKAD
                     TGIAVEGASDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEL
                     FLGLWIAIMNRSLNIDLVVFIAIFADVATLAIAYDNAPYSPKPTKWNLPRLWGMSIIL
                     GIILAIGTWITLTTMLLPRGGIIQNFGSVDGVLFLEISLTENWLIFITRAAGPFWSSC
                     PSWELAGAVIIVDIIATMFTLFGWWSQNWTDIVTVVRVWIFSFGVFCVMGGAYYLMSE
                     SEGFDRLMNGKPRKEPPPQRSMEDFIVAMQRVSTQHEKSG"
     gene            <529908..>531719
                     /locus_tag="PAS_chr1-1_0003"
                     /db_xref="GeneID:8197520"
     mRNA            <529908..>531719
                     /locus_tag="PAS_chr1-1_0003"
                     /product="Probable transporter"
                     /transcript_id="XM_002489589.1"
                     /db_xref="GeneID:8197520"
     CDS             529908..531719
                     /locus_tag="PAS_chr1-1_0003"
                     /codon_start=1
                     /product="Probable transporter"
                     /protein_id="XP_002489634.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0003"
                     /db_xref="EnsemblGenomes-Tr:CAY67353"
                     /db_xref="GeneID:8197520"
                     /db_xref="GOA:C4QVT0"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C4QVT0"
                     /translation="MSDKLSDIATIDVSDTSSDLSQWLEPHWLLAPFKRLKWGFLPVR
                     RIVEDETELEGGVNIEAKEEELPIEYRDEKDRKWWRFFDDYEYRQNKYKRSKHKWYKW
                     FNPSDTPEERRVVIKVDILLTLYATMAYWIKFLDQTNINNAYVGGLREGIGMKGNDLV
                     NTQVMFTIGNIVFQIPFMYVLNGFPLSYAMPLLDIGWSIFTLGSYRVENVTQLKIMRF
                     FIGAFEAPAFIGFTYLMGSWYTVDEVARRQTVMYLGQFLGLLTSGLLSGAIVEGMDGK
                     SGLNSWRWIFIVDGLISLAVGVIGFYMIPGTPDNCYSIFLSDEDIQIARRRMKRNTTG
                     PTAPVDHKTLLRSLFKWSLWKRILSSWHIYVLTIWDAFMWNNNNGNSGTYVLWLDSLK
                     NSDGSRRYSPGKKQQMSALTPALGLIWVLLTGCFADLLHSRWGAIVFSQVFNITGNTI
                     LAVWHVNERAKWFAFCMQYFGWAMAPVLYSWVNDICRRDPQQRAITLVAMNAIAQITT
                     IFIPLLVWKTVEAPRFLKGFSFTAASATSLALMSFVVLYFYKRDEKRQSADNGIIIYN
                     SDVDGDIAAQFEQKNDSCKSSELALALRNHPSDHILR"
     gene            <531902..>532684
                     /locus_tag="PAS_chr1-1_0459"
                     /db_xref="GeneID:8197521"
     mRNA            <531902..>532684
                     /locus_tag="PAS_chr1-1_0459"
                     /product="Dolichol-phosphate mannosyltransferase"
                     /transcript_id="XM_002489590.1"
                     /db_xref="GeneID:8197521"
     CDS             531902..532684
                     /locus_tag="PAS_chr1-1_0459"
                     /codon_start=1
                     /product="Dolichol-phosphate mannosyltransferase"
                     /protein_id="XP_002489635.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0459"
                     /db_xref="EnsemblGenomes-Tr:CAY67354"
                     /db_xref="GeneID:8197521"
                     /db_xref="GOA:C4QVT1"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4QVT1"
                     /translation="MAINNSIIVPAYKEKNNIRPLVTRIFAGLGNEFSKDTEVIIVDD
                     NSKDGSVEEVDALVKEGYNVRIVVRTTERGLSSAVIRGFQEAKGERLVCMDADLQHPP
                     ESVPDVLNALKDASFALGTRYAPGVEIDKEWGAFRRFTSWFARLLALPLTPASDPMSG
                     FFGLQKKVFESINTNDLDVQGFKIALELLVKAKLPHGIKDVPFSFGLREEGESKLSNK
                     VIVQYLLQLKELYIYKFGVATLAAVALLLVFVVLFLFQYLVL"
     gene            <532864..>533487
                     /locus_tag="PAS_chr1-1_0461"
                     /db_xref="GeneID:8197900"
     mRNA            <532864..>533487
                     /locus_tag="PAS_chr1-1_0461"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489591.1"
                     /db_xref="GeneID:8197900"
     CDS             532864..533487
                     /locus_tag="PAS_chr1-1_0461"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489636.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0461"
                     /db_xref="EnsemblGenomes-Tr:CAY67355"
                     /db_xref="GeneID:8197900"
                     /db_xref="InterPro:IPR025124"
                     /db_xref="UniProtKB/TrEMBL:C4QVT2"
                     /translation="MTTLAERNRQVLCTSKREGVGTKVKQLLIRTTVKLDSFFSKLGK
                     YSPQYISSDEILEELFMSNNMSSDKVPLGSQIEQSSPKETRTDNEASVSGISAEQPQK
                     NDDLNFDELWEKQHAEWLTPLPEYQTLHGRLQLQKRMHEGDIKHIVSPKDHWIVYQTL
                     VVQSSALKRAISLSNVIEILHSGWVADKTWERGVTSAVSAPLPINLL"
     gene            <533971..>536490
                     /locus_tag="PAS_chr1-1_0460"
                     /db_xref="GeneID:8197902"
     mRNA            <533971..>536490
                     /locus_tag="PAS_chr1-1_0460"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489592.1"
                     /db_xref="GeneID:8197902"
     CDS             533971..536490
                     /locus_tag="PAS_chr1-1_0460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489637.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0460"
                     /db_xref="EnsemblGenomes-Tr:CAY67356"
                     /db_xref="GeneID:8197902"
                     /db_xref="InterPro:IPR019452"
                     /db_xref="InterPro:IPR019453"
                     /db_xref="UniProtKB/TrEMBL:C4QVT3"
                     /translation="MSLIQDGQRRPLSRAITSVGSTVVSEGLIPLINSNSVSFHRIVQ
                     DNIQVKEQLQLNYSSPVLDVFSIGDLTLVVTKSLVTLVDTKKSSTTFEFETPIETFDY
                     WHCSTNYKVIRDILEGITSQSSADVHLLLLRNSNSISLLDLVSLKVTHELQLQIKDAI
                     IVKESHILARTSSQLYLLNLNTSFKHFIHINLKPSKIFSPTIHMVSVNDEHFLVKVND
                     QVYIFHFANNKVNLLHKLKTIPSTKLLVWYTHLLILNNSTIQCYDIFNGSLVQEIDAS
                     YFISATLYKNTLILFSKEFSLSFHLKSPDSQLQEALSQLNHHNEHSLQTAINLILNSS
                     IDASFQSKFESLQKLTTCQGLIQLDQDIPSVISKFIGFFVSPLIVIPTVLSKDNPKSL
                     EYLIPYLTDIHRKLTFLERTGQLNLDSDIVLTTDNFLSIEDEDIQSFLPPEAPTFAKN
                     VQELLTLVDDTLVDAYLATNNMYLLESFLRRPNHCTIEKVEKRLAGNTDTLVEFYFNK
                     GSHAKSIALIHNNKERLIRYLTKLGNDELSTILHCFTDYLSDEDFPKVFMVDSTQCDS
                     YDFFRVLDLLKSSKPQLVTKYLEYLIGMKNLKPKDSEKLHTILISNYILDLNEENFEK
                     IYEFVAANKFYNPSTIVLEIKSRLDKKPSYQLFKLETLPLAKLQEHEKVVDILISIKE
                     PEEAVEYVLKLHGHQNLILKLLRIFLEQDSQTLLLQLLNSTSGDTSLFLDVLELLPDE
                     FPIQELNRFISTQLVNLTNKAEDTTLKMNLLTSLKNKSEYTLWHDVLTKHVVVSRETK
                     CIVCHKNIKFSVVNYYVQNNDLIHYGCSKQYEKNLSLLNSI"
     gene            complement(<536447..>539260)
                     /locus_tag="PAS_chr1-1_0004"
                     /db_xref="GeneID:8197901"
     mRNA            complement(<536447..>539260)
                     /locus_tag="PAS_chr1-1_0004"
                     /product="U3 small nucleolar RNA-associated protein"
                     /transcript_id="XM_002489593.1"
                     /db_xref="GeneID:8197901"
     CDS             complement(536447..539260)
                     /locus_tag="PAS_chr1-1_0004"
                     /codon_start=1
                     /product="U3 small nucleolar RNA-associated protein"
                     /protein_id="XP_002489638.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0004"
                     /db_xref="EnsemblGenomes-Tr:CAY67357"
                     /db_xref="GeneID:8197901"
                     /db_xref="GOA:C4QVT4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007319"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C4QVT4"
                     /translation="MPVPVNSSLKKRKSERKAEAVRPSKIFSPFRVLGKVSNEIPFAI
                     GTLGHTFYIVTSVDRAFQIYDANTLHLLFVSNTQTPSKINALAAHFHYVYAAWDNKIG
                     IYRRGILEHVLSCETENFIQQILVFGDFVICTTFTSNEIFVFKKKDSKDSYATEFYTR
                     LSVNSLQGKIVGIVHPATYLNKIVVATTNSLLVFNIKTGKLLFTSSDFNEFNITSIET
                     VPVLDLIAFGTSDGQVVLYNIKKGKRFRKIRTGIISKVTSVSFRTDGAPHFVASFVNG
                     DLFFYDLEHKARVHILQTVHKEDHGGVSKAAFLNGQPIFVTNGGDNMLKEYAFDPNLS
                     TTNSSIVPAPHYLRSRGGHSAPPTTVQFADPNSHFMLSASKDRSLWMFSLRKDAQAQE
                     MSQRPPKKSANNKRIGVIPSMKDKLPEIVCLAQSNSKEGDWENTITGHAGETIARTWD
                     TYNRRLGRWDLPTTDGGQVKSVAISACGNFGFVGSSSGGIGVYNMQSGIQRKLYRLHK
                     KAVTGVAVDSMNRKMVSCGLDGIVGFYDFNESKYLGKLQLDAPITQLVYHHSSDLVAL
                     VLDDLSIVVVDSVTQKVVRVLLGHTNRITALDFTPNGRWIISSALDNTIRTWDLPTGS
                     CIDGIFVPSTVTSLKMSPTGDTLATTHVNSVGIALWTNRAMFHAVSSRHVEESEFSKI
                     MLPNTTNDTQTTIIEGAFDENTVDDNEITGVYNTVDQINEKLVTLGIGPRSKFNTLLH
                     LDVIKQRNKPTEAPKKPENVPFFLELKGEKVGDRAIESEGKLDPNGTATQESGTEAQS
                     QLNSLRGDNRMTFENEFTKNLRLSSETKEYAEFLKYVHSLSPSQVDLEIRSLDITESV
                     KEVSCFIEALTQGLENNDNFDLIQAYMSMLMKCHGDIIFDSSDEELKTALRGWESINE
                     SKKANMDSLVKYCSGVINFFHTV"
     gene            <539539..>542739
                     /locus_tag="PAS_chr1-1_0005"
                     /db_xref="GeneID:8197522"
     mRNA            <539539..>542739
                     /locus_tag="PAS_chr1-1_0005"
                     /product="Inositol hexakisphosphate and inositol
                     heptakisphosphate kinase"
                     /transcript_id="XM_002489594.1"
                     /db_xref="GeneID:8197522"
     CDS             539539..542739
                     /locus_tag="PAS_chr1-1_0005"
                     /codon_start=1
                     /product="Inositol hexakisphosphate and inositol
                     heptakisphosphate kinase"
                     /protein_id="XP_002489639.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0005"
                     /db_xref="EnsemblGenomes-Tr:CAY67358"
                     /db_xref="GeneID:8197522"
                     /db_xref="GOA:C4QVT5"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR013651"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C4QVT5"
                     /translation="MANDSYSGSHSKSGSMSSLDSQVDLEWKDNTVGENPTPLSKEAL
                     ESHRKAMASIAPILESFTPKRSVDENTVSSSSHKLEKTTSNVSSLSIGANFNGAGPNA
                     SNSATGSQSGTTTGTHTPKNRAVSVSEVSGPELPKIGKIGVCAMDAKVLSKPCRQILN
                     RLIANGEFETVIFGDKVILDESVENWPTCDFLISFFSTGFPLDKAIEYVKLRKPYFIN
                     NLVMQKALWDRRLVLELLNTSGVPSPERLVISRDGGPIVDKELKAELEKHGVCVEEVK
                     EPNWEMIDEDTLCVDGKVLKKPFVEKPVDGEDHNVYIYYSSKNGGGGRRLFRKIGNKS
                     SEFDKDLTMIRTKGSYIYEKFMDTDHFEDVKAYTVGPNFCHAETRKSPVVDGIVRRNT
                     HGKEIRFITNLSTEEKLMASKVCTAFDQTICGFDLLRVSGKSYVIDVNGFSFVKDNDA
                     YYDSCSSILRELFLKEKTRRDSLKVRLPFPVVQEEKTQKWVFKGIVSVIRHADRTPKQ
                     KFKYSFRSPLFVSLLKGHKEEIIIRQVEDLKIVHETVLVAQREKAEDPAKLAQLAGAL
                     EKKMTFPGTKVQLKPSLDADNNVEKVQLIIKWGGEPTHSAQYQATDVGEQLRQDVRLL
                     NKDCLKNVKVFTSSERRVVASAKLFSSSFLGEQELPDDYLEVRKDLLDDSNAAKDLMD
                     KVKKKLKPLLRQGKDAPPQFAWPPKMPEPFVVIKRVVELMNYHHKLMEHNFATKDVAK
                     LQTRWCCGEDAFLFKERWDKLFQEFISVEKVHPSKISELYDTMKYDALHNRSFLQEIF
                     LPDDAVHEVDLEQSPCLVREYPINILAMNNFRITDSSSLDTSNSPNTVGSIGWILESD
                     KHSKSKVSGSSPGSPFDDPKFAMLRELYRLAKVLFDFICPQEYGIEDNEKLDIGLLTS
                     LPLAKQILSDISEMRDSGTAGSVIYFTKESHIYTLLNVIYESQLPMKIARNALPELDY
                     LSQIVFELYESEDKDGNKKHAIRLSLSPGCHTQDPLDVQLDAKHYISCIRRISLTRHL
                     DMDLVTQRLKSRFSRVRLPKRFTPVNISSPLTVARS"
     gene            complement(<542794..>544071)
                     /locus_tag="PAS_chr1-1_0006"
                     /db_xref="GeneID:8197523"
     mRNA            complement(<542794..>544071)
                     /locus_tag="PAS_chr1-1_0006"
                     /product="Ribose-phosphate pyrophosphokinase"
                     /transcript_id="XM_002489595.1"
                     /db_xref="GeneID:8197523"
     CDS             complement(542794..544071)
                     /locus_tag="PAS_chr1-1_0006"
                     /codon_start=1
                     /product="Ribose-phosphate pyrophosphokinase"
                     /protein_id="XP_002489640.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0006"
                     /db_xref="EnsemblGenomes-Tr:CAY67359"
                     /db_xref="GeneID:8197523"
                     /db_xref="GOA:C4QVT6"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:C4QVT6"
                     /translation="MRKCKVFVGNSHPELGKLVCERLGMEPAPVTLKKFANGETSVQI
                     GVSVRDEDVYIIQSGSPNINDDIMELLILISACKGGSAANITAVIPQFPYSKQSKMKK
                     HRGAITARMLANLLIMAGADHVVSMDLHASQMQGFFSKPVDNLFGGPTLAKWIRHNVP
                     DYKDAVVVSKNPGGTKRVTALADSLKINFAMIHTDRRRAKDGFEDKKKKKKIQKKVST
                     LKLNHNNEDAEEENIILSGESQTARVVQGHVVDDAYQSADEAAKPGMESVNSIANGTA
                     HFDQYALGGSYDADNSDDDDEPEAIAQEKLITLVGDVQNRPAIIVDDMIDKPNSFIAA
                     AEHLRLNCGANSCYLVATHGIFSDNCLEILNDCAYIDKIIVTNTYPIDIKKREACKKL
                     VYIDVSTIFAECIRRDHFGESISVLFDNLSSFA"
     gene            <544347..>545048
                     /locus_tag="PAS_chr1-1_0007"
                     /db_xref="GeneID:8197524"
     mRNA            <544347..>545048
                     /locus_tag="PAS_chr1-1_0007"
                     /product="SRR1 domain-containing protein"
                     /transcript_id="XM_002489596.1"
                     /db_xref="GeneID:8197524"
     CDS             544347..545048
                     /locus_tag="PAS_chr1-1_0007"
                     /codon_start=1
                     /product="SRR1 domain-containing protein"
                     /protein_id="XP_002489641.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0007"
                     /db_xref="EnsemblGenomes-Tr:CAY67360"
                     /db_xref="GeneID:8197524"
                     /db_xref="InterPro:IPR012942"
                     /db_xref="UniProtKB/TrEMBL:C4QVT7"
                     /translation="MEWEVQRSKRGKAVKGAANRIRFQAAEKSVDDFLEILEKFRRQL
                     VGFKDNIIVLDSAKKLRCVGLGSPTNSTAALYQLAFLLEIKDSLGIELISAFDPVFEP
                     KDVDLFAKLSIEVEETYEFDKDETTPTIYYMPHLPVGILERTLETVKPRMLLTNDVTL
                     YTLKMKNAEMKEKYPNITRLSNLVKDSSFVLPDDGFIIKKKKMATSTRAYHPLTVLSL
                     LTTLGTLNTYTLPGY"
     gene            complement(<545269..>551478)
                     /locus_tag="PAS_chr1-1_0008"
                     /db_xref="GeneID:8197525"
     mRNA            complement(<545269..>551478)
                     /locus_tag="PAS_chr1-1_0008"
                     /product="Beta subunit of fatty acid synthetase; catalyzes
                     the synthesis of long-chain saturated fatty acids"
                     /transcript_id="XM_002489597.1"
                     /db_xref="GeneID:8197525"
     CDS             complement(545269..551478)
                     /locus_tag="PAS_chr1-1_0008"
                     /codon_start=1
                     /product="Beta subunit of fatty acid synthetase; catalyzes
                     the synthesis of long-chain saturated fatty acids"
                     /protein_id="XP_002489642.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0008"
                     /db_xref="EnsemblGenomes-Tr:CAY67361"
                     /db_xref="GeneID:8197525"
                     /db_xref="GOA:C4QVT8"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR003965"
                     /db_xref="InterPro:IPR013565"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR016452"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:C4QVT8"
                     /translation="MSATSGVVNRPLVLNHGSIESTILIPTTEYHFYQTLLEGFRKSL
                     PQVTEGFADDDEPSSKAELLMKFLGYIVQSGVSNQQEQLAAAKLVLNEFESRFLQGLN
                     LHSYAAILLKSETFPTTLLKIKENLIKNYYLGRALVYLPGQRGLVYPPSALLNAGKSG
                     SAQIYAIFGGQGNTDDYFEELRDIYHIYQGLVSDFVTKAQLKLQELIRTTPETDRIYT
                     QGLDLINWLENKDKTPDQQQLLSIPMSCPLICVIQLCHYIVTCRILGITPGQLRDSLK
                     GTTGHSQGLVTAVVVSSADSWESFEKLALQAVEFMFYIGVRGLQTYPNTSLPPSIVQD
                     SEENAEGTPSPMLSVRDLSYDQLVKFVNETNQHLPEAKHIDISLINGPRNVVLTGPPQ
                     SLYGLNLNLRKAKAPSGLDQARIPFSERKLRFSNRFLPIMSPFHSHLLSPSTEKIVAD
                     LKKAGVEFSQSSMKLPVFDTYDGKDLRSYSGSIAARLVECITKLRVNWELSTEFNSTH
                     VLDFGPGGASGLGVLTHRNKEGTGSRVIVAGVLDAESEDSEFGYKQEIFESNEKAIKY
                     APNWLKEYKPKLVKTSAGKIFVDTKFSRLLGRAPLMVPGMTPTTVSPDFVAATLNAGF
                     HTEIAGGGYFAPSIMKAALQRVIDQVTPGTGVGINLIYVNPRMLQWGIPMIKELREQG
                     FPIQSLSIGAGVPSLEVATEYIETLGLAHLGLKPGSIDAVNQVITIAKAHPNFPIVLQ
                     WTGGRGGGHHSFEDFHQPILQMYSKIRKCKNIILIAGSGFGSAEDTYPYLTGSWSHQF
                     SYPSMPFDGVLFGSRVMTAKEAKTSPAAKQAIADCTGVDNSQWENTYKKPTGGIITVR
                     SEMGEPIHKIATRGVMLWKELDDTIFTLPKNKMLEAIAKKKDYIIKKLNADYQKPWFA
                     KNEKGTCDLEDMTYKQIAERLVELMYVRKSQRWIDVTLRNFTGKFLRRIEERFATKVG
                     TISLIQNFSQLEEPEKAIDSVFKAYPEAASQLINEEDCDWFLLEAQSPTQKPVPFIPV
                     LDERFEFFFKKDSLWQSEDLEAVVGEDVQRTCILHGPVAAQFSNKVDEPIKDILENIH
                     KGHIKSLVKEVYNGDESKIPVVEYFSSVDSFSDTAIEGVKIERSRNTETFTVTSGNVD
                     NQQWFDLLAGKELSWRRAFITAARLVQGTNFVSNPAHSVLAPSKDLVVKIENGSDAKK
                     TVLTAFQRVRGKYVPAVSLKSIGDLKIKLELIETRTADKSAVALELFYNYKPTDGFAP
                     ILEVMEGRNTSIKNFYWKLWFGSSVPVDLDFDANKPISGGEASVSSQAIAEFTHAVGN
                     SCEDFVPRAGRPQLAPMDFAIVLGWKAIMKAIFPKTVDGDILKLVHLSNGYKMFPGAD
                     PLKKGDVVSTVAHIRSVVNGETGKTVEVVGVISRDGKPVLEVNSQFFYRGKYQDFGNS
                     FKKTTETPVQVAFKSAKDIAVLKSKEWFHLEKDIDLLNQTLTFRCESYVKFKSSTVFA
                     SVKTTGQALLELPSKEIIQVAEINYESGSSYGNPVLDYLTRHGSTIEQPIMFENAIPL
                     AQGTELTSKAPGTNETYAAVSGDYNPIHVNKVFASYANLPGTITHGMYSSAAVRALVE
                     QWAAQNVATRVRAFKADFVGMVLPNDELVTHLEHVGMINGRKIIKVETKKVETEEVVL
                     IGEAEIEQPVSTFVFTGQGSQEQGMGMDLYNSSEVAKSVWDRADVHFINNYGFSILDI
                     VKNNPTELTVHFGGAKGRSIRNNYISMMFETVAADGQLKSEKIFKEINEDTISFTFKS
                     PTGLLSATQFTQPALTLMEKASFEDMKSKGLVPSESMFAGHSLGEYSALTSLGDVMPI
                     ESLVDVVFYRGMTMQVAVPRDEQGRSNYGMIAVNPSRVSSTFNDSALRFVVEHIAQQT
                     GWLLEIVNYNVENTQYVAAGDLRGLDTLSNVLNVFKIQKIDIVKLQETISLDEVKVHL
                     SEIVDEVSKKSSSKPQPIDLERGFACIPLKGISVPFHSSYLRSGVKPFQTFLCKKIPK
                     SAVKPANLIGKYIPNLTAKPFQLTKEYFEDVYELTKSEKIKHILDHWEEYESS"
     gene            <552345..>556775
                     /locus_tag="PAS_chr1-1_0009"
                     /db_xref="GeneID:8197526"
     mRNA            <552345..>556775
                     /locus_tag="PAS_chr1-1_0009"
                     /product="Serine esterase that deacylates exogenous
                     lysophospholipids"
                     /transcript_id="XM_002489598.1"
                     /db_xref="GeneID:8197526"
     CDS             552345..556775
                     /locus_tag="PAS_chr1-1_0009"
                     /codon_start=1
                     /product="Serine esterase that deacylates exogenous
                     lysophospholipids"
                     /protein_id="XP_002489643.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0009"
                     /db_xref="EnsemblGenomes-Tr:CAY67362"
                     /db_xref="GeneID:8197526"
                     /db_xref="GOA:C4QVT9"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR001423"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:C4QVT9"
                     /translation="MSNRLLIFLLIALIQGAWMLTDELPVLSVESSNPDLGLISVSPS
                     PLSPDVGTFSKDQLADNGLPSPRDSTSSISFVTATIWFISWCFFKVIRSVLVVLPSFI
                     VRILGFNYSVTLNFSSLLMIVSSTVVIVYAFIRYRYLNLYSRLPQEPKRQDPPMDVFI
                     ESTDDNSEVRFPSYLDQFLSAIKVFGYLEKTVFHELTKSMTTQKLELNESLVIDASKG
                     FSIVVEGRMSVYARVGRKMVSDDTLAAEYESANSDEKSFIFNGYKYQLLTDAKSGSPL
                     SSLISILKLFTENEEKLLQDNRTSSALNLNAVYEANSPFREEPTSSSPEEQADPDEFA
                     PELIAKAQGHASISTIPPESFRRLVVKYPQSASHIVQMVLTRLYRVTLQTAHSYLGLT
                     HKIMKAELELNMLAQYDIPVYLHDGIIDRLDEQFKAAEEEDNIETISVSKSTSNFKKN
                     NGLLQHHPERTSHDKRFFYYNPAGRISKSVSSKPSKRPVLSKRNSSHHVVLDTRITNT
                     NPGDLLSNVPLSRKNSSYNSLRNSDQSKDEQEIRARTFSAEEETADTALRTALVESIF
                     KLIGIDNSIVHNSANLFASYLSLNDPLNSPNFGLQKSYPSSQNLKWFSLDVGDDDDSS
                     CSSKSETPGAGSHKSSEPVLDLVSIRKSASEQIQFMFIKAGHVIIEENQPTPGIYYLV
                     SGLLESVFTAENGEEKMLNHIKPGGIAGYLGVVASFKSFITVRAKSNCYVGFLPKKVI
                     DSLCDKYSVIQLALAKTLIRVLDDNILLMDFAMDWVQTSAGQRLYNQGDPANGIYIVL
                     NGRFRSIVENPKGAVNDKQSSPVIHRKDAYSGENDSISVISEHGRGESLGEIEVLTAS
                     KRPTTLVAVRDSETARIPRSLFEMLCLTNPSIMIKVSRLVAERSQSTEANLVIGANSF
                     KNPVIKPKNSSFCNYSYRTITILPITKGLPVEEFAQKLVSSFEQLDRSVISLNQASIL
                     THLGKHAFDKLAKMKQSGYFADLEEQYQNVIYVTDTPVNSTWTSTCISQGDIILLLAD
                     AQSSTDIGEYERLLVRKKTTARTELILLHPERYVEAGSTSKFLKNRIWVHSHHHVQMN
                     VNRGHFVAKATELSSIAQLVKESYSQLKNKAHLDKMRHRLETLLVSYDVFKKVPNIGR
                     TGYYQPTQEHKNDFMRLARILSGQAIGLVFGGGGARGCAHIGVLKALEEYGIPVDLVG
                     GTSIGAFVGGLYAKDYNLVSTYGRTKSFAGRMSSLWRIITDLTYPVTSYMTGHEFNRG
                     IWKAFGDYRIEDFWVKYYCNSTNITNSVQEIHSSGYAWRYIRASMTLAGLLPPITDNG
                     SMLLDGGYVDNLPVEEMKNQGASVIFAIDVGSVDDRSPMDYGDSLSGFWVVLNRWNPF
                     SKHPNVPSIAEIQLRLAYVASVNALEQAKSQDAVVYLRPPIEMYGTLDFGKFEEISNV
                     GNAYGSSQLKELEEDNELPEVLKSRKKQTHKINIDRRNSI"
     gene            complement(<557993..>559849)
                     /locus_tag="PAS_chr1-1_0010"
                     /db_xref="GeneID:8197527"
     mRNA            complement(<557993..>559849)
                     /locus_tag="PAS_chr1-1_0010"
                     /product="Peptidase that deconjugates Smt3/SUMO-1 peptides
                     from proteins"
                     /transcript_id="XM_002489599.1"
                     /db_xref="GeneID:8197527"
     CDS             complement(557993..559849)
                     /locus_tag="PAS_chr1-1_0010"
                     /codon_start=1
                     /product="Peptidase that deconjugates Smt3/SUMO-1 peptides
                     from proteins"
                     /protein_id="XP_002489644.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0010"
                     /db_xref="EnsemblGenomes-Tr:CAY67363"
                     /db_xref="GeneID:8197527"
                     /db_xref="GOA:C4QVU0"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:C4QVU0"
                     /translation="MARGSVKSLGSKKMGSLSRFQRLPKNSLTQSDSLNTTADLQSHI
                     IDKISAPIVKRSKNGIEDKNAFEKKKEVLRIHLHHISIINKNISLPVPFLSIWPNSLY
                     LIVDLPSKTRFQIPFKSLSQIYMSEDEKNFVILFRKTEVLSKQIFGELLDEDTKTNRI
                     WLFLDPETDVQDVAKLKQLFRQLCKIYLVKLHLMNFADLQQYFKNEVNEPKVPKISTT
                     NFYSNLADEDSRITRARRKKINEEQPTEIDLATEDGEDLDTKLSSKLTHQPTKESKSK
                     TPLPVVADEEIGEGKQLVLTHQLCYQFKDSRKIVINNSDFKCLYNNNWINDNVIDFFL
                     KYYVQDFNEARVELFSCFLYSKLITPNHSVLSVYDNVKNWFRNNDTLFENDFVIIPIN
                     HNYHWFCIIIQNLKNIVNGKYLSKDIHNFERPYLYVLDSLKQSHGPATKAIRLFLAGY
                     AKEKLHLDINTQLIKTRTLNVLLQNNFNDCGLHLIFNICKFTTKHTLFMDLIKSRLSG
                     SSDTNRITTELFPVSGMRTIRKDLRDIILSLLKQNLHDRNFPQEDVEKVGQVMNGDLK
                     NGCIDSEGAASFSERVVDQTDDLEILDGDPAMIESQIPFLLQKEAELKNTEH"
     gene            <560545..>562128
                     /locus_tag="PAS_chr1-1_0011"
                     /db_xref="GeneID:8197528"
     mRNA            <560545..>562128
                     /locus_tag="PAS_chr1-1_0011"
                     /product="Thiol oxidase required for oxidative protein
                     folding in the endoplasmic reticulum"
                     /transcript_id="XM_002489600.1"
                     /db_xref="GeneID:8197528"
     CDS             560545..562128
                     /locus_tag="PAS_chr1-1_0011"
                     /codon_start=1
                     /product="Thiol oxidase required for oxidative protein
                     folding in the endoplasmic reticulum"
                     /protein_id="XP_002489645.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0011"
                     /db_xref="EnsemblGenomes-Tr:CAY67364"
                     /db_xref="GeneID:8197528"
                     /db_xref="GOA:C4QVU1"
                     /db_xref="InterPro:IPR007266"
                     /db_xref="UniProtKB/TrEMBL:C4QVU1"
                     /translation="MRIVRSVAIAIACHCITALANPQIPFDGNYTEIIVPDTEVNIGQ
                     IVDINHEIKPKLVELVNTDFFKYYKLNLWKPCPFWNGDEGFCKYKDCSVDFITDWSQV
                     PDIWQPDQLGKLGDNTVHKDKGQDENELSSNDYCALDKDDDEDLVYVNLIDNPERFTG
                     YGGQQSESIWTAVYDENCFQPNEGSQLGQVEDLCLEKQIFYRLVSGLHSSISTHLTNE
                     YLNLKNGAYEPNLKQFMIKVGYFTERIQNLHLNYVLVLKSLIKLQEYNVIDNLPLDDS
                     LKAGLSGLISQGAQGINQSSDDYLFNEKVLFQNDQNDDLKNEFRDKFRNVTRLMDCVH
                     CERCKLWGKLQTTGYGTALKILFDLKNPNDSINLKRVELVALVNTFHRLSKSVESIEN
                     FEKLYKIQPPTQDRASASSESLGLFDNEDEQNLLNSFSVDQAVISSKEAPEEIKSKPV
                     GKAAYKQNSCPSLGSKSIKEAFHEELHAFIDAIGFILNSYRTLPKLLYTLFLVKSSEL
                     WDIFIGTQRHRDTTYRVDL"
     gene            complement(<562179..>562598)
                     /locus_tag="PAS_chr1-1_0012"
                     /db_xref="GeneID:8197529"
     mRNA            complement(<562179..>562598)
                     /locus_tag="PAS_chr1-1_0012"
                     /product="TFIID subunit (19 kDa), involved in RNA
                     polymerase II transcription initiation"
                     /transcript_id="XM_002489601.1"
                     /db_xref="GeneID:8197529"
     CDS             complement(562179..562598)
                     /locus_tag="PAS_chr1-1_0012"
                     /codon_start=1
                     /product="TFIID subunit (19 kDa), involved in RNA
                     polymerase II transcription initiation"
                     /protein_id="XP_002489646.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0012"
                     /db_xref="EnsemblGenomes-Tr:CAY67365"
                     /db_xref="GeneID:8197529"
                     /db_xref="GOA:C4QVU2"
                     /db_xref="InterPro:IPR003195"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C4QVU2"
                     /translation="MSRKPERRRQPRLFSNDMRTLLFAYGDVQQPQLETIQALEDVMI
                     VFMTDLCHEAMTYATYQGRKHKLKMEDFKFALRKDRLKLGRVEELMNKQKEIQEARKL
                     FDSNEKETKDDDIEKKRRKEAKRAIKEAKKLKLSKGD"
     gene            <562948..>564576
                     /locus_tag="PAS_chr1-1_0013"
                     /db_xref="GeneID:8197530"
     mRNA            <562948..>564576
                     /locus_tag="PAS_chr1-1_0013"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489602.1"
                     /db_xref="GeneID:8197530"
     CDS             562948..564576
                     /locus_tag="PAS_chr1-1_0013"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489647.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0013"
                     /db_xref="EnsemblGenomes-Tr:CAY67366"
                     /db_xref="GeneID:8197530"
                     /db_xref="GOA:C4QVU3"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR012171"
                     /db_xref="UniProtKB/TrEMBL:C4QVU3"
                     /translation="MVVSREEVREIIGRGNAIVIYEDHLLNLNGWLERHPGGEKAIHH
                     MIGRDASDEMNAYHDPETVKTFKRWSIGRVKLPWDNLVPPIQGGNYSFDKVDQRVIYK
                     KLGIFPGVKIEPKVQENIVLTEKSASKLLPVGGVRDPKTIIEDFDNKLVYEDIKQIPS
                     LDHETQRNLSLQYNELHQTIINRGYYQCDYWQYFKEFCRISSLFLLFVLFLRSKWYTL
                     SAISIGLMWQQLVFIAHDAGHISITHNYQIDNIIGIIIANFIGGLSLGWWKRNHNVHH
                     LVTNDPVHDPDIQHLPFFAVSSRLLGNVFSTYYEKYLWFDKIAQKMLQIQHKLYYPIL
                     SFGRFNLYRLSWSHLIMGLGPRKGKAAWFRYLELIGLCFFSYWFFYKTMSYIPTKTLR
                     FWFLLISHWTTMIVHVQIVLSHFAMSTSDLGSTESFVSRQLRTTMDVDCPEWFDFFHG
                     GLQFQAIHHLFPRLPRHNFRKVQPLVIEFCKNTGLHYSIYGFVDGNGKVVNKMADVAS
                     QVVILNDCLHSIHLENTTGKNLYEAKVESVSIKG"
     gene            complement(<564668..>564922)
                     /locus_tag="PAS_chr1-1_0014"
                     /db_xref="GeneID:8197531"
     mRNA            complement(<564668..>564922)
                     /locus_tag="PAS_chr1-1_0014"
                     /product="Lsm (Like Sm) protein"
                     /transcript_id="XM_002489603.1"
                     /db_xref="GeneID:8197531"
     CDS             complement(564668..564922)
                     /locus_tag="PAS_chr1-1_0014"
                     /codon_start=1
                     /product="Lsm (Like Sm) protein"
                     /protein_id="XP_002489648.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0014"
                     /db_xref="EnsemblGenomes-Tr:CAY67367"
                     /db_xref="GeneID:8197531"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C4QVU4"
                     /translation="MSVSEPLNMIKLCLDEKVYVKLRGAREIVGKLHAYDNHCNLVLG
                     DAVETISTVDENNELKTQTKDRPMVYLRGDSVILVANASQ"
     gene            <565124..>567509
                     /locus_tag="PAS_chr1-1_0015"
                     /db_xref="GeneID:8197532"
     mRNA            join(<565124..566210,566242..>567509)
                     /locus_tag="PAS_chr1-1_0015"
                     /product="Putative endoribonuclease"
                     /transcript_id="XM_002489604.1"
                     /db_xref="GeneID:8197532"
     CDS             join(565124..566210,566242..567509)
                     /locus_tag="PAS_chr1-1_0015"
                     /codon_start=1
                     /product="Putative endoribonuclease"
                     /protein_id="XP_002489649.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0015"
                     /db_xref="EnsemblGenomes-Tr:CAY67368"
                     /db_xref="GeneID:8197532"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="InterPro:IPR021718"
                     /db_xref="InterPro:IPR022712"
                     /db_xref="UniProtKB/TrEMBL:C4QVU5"
                     /translation="MTKNQLSIPLQTMDQFRFFCLGGGNEVGRSSHIIQFKGKTVMLD
                     AGVHPAFQGMASLPFYDEFDLGTVDVLLISHFHLDHAASLPYVMQKTNFKGRVFMTHP
                     TKAIYRWLLNDFVRVTAIDDDSNQLYSDKDLKDSFDRIETIDFHSTIEIDGIRFTAYQ
                     AGHVLGAAMFFIEIAGIKVLFTGDFSREEDRHLSVAEVPPVRPDVLITESTFGTATHE
                     PREEKEKKLTTMIHSTLANGGRVLMPVFALGRAQELLLILDEYWSQHQDLENIKVYYA
                     SDLARKCLAVYQTYINMMNENIRKKFRDTNKNPFQFQYIKNIKNLSKFDDFQPSVVVA
                     SPGMLQNGVSRALLEKWAPDPRNTLIMTEILLEPTEIPSQQNPDVLIPRRMTVEEISF
                     AAHVDYEQNSKFIELVNPKTIVLVHGESNPMGRLKSALLSKYSKYKNTPDEVKVYNPR
                     NCEDLLVEFKGIKIAKAMGTITEDVNKVLKQDVKSAKSEINGVLVQKNFDLSLLKIQD
                     LREYTGLTTTMIKQRQTLRSHATSSLVHYHLLQMFGYLDILIDDAEEYEVKIMDSVLL
                     NMDKRGIVTVEWGSGVINDTIADSVIAIVLTAESSPLSVKLTSKSCNHSHSRTSEEKQ
                     EIREPEKTASPANNHEPGKVSELNEPNEPNKPNESPAISIKEEKNHVEEAVPDLASPS
                     SPKPDASEDKVKLMVEIQEKYSSASRVQNLRTLLRSHFGDALKFEIDEGEEDWKVVIG
                     KMEATIKLTDWTVESTSNVLKNRIQSIVRRGMTLVAPFSQPRKL"
     gene            complement(<567585..>569822)
                     /locus_tag="PAS_chr1-1_0016"
                     /db_xref="GeneID:8197533"
     mRNA            complement(<567585..>569822)
                     /locus_tag="PAS_chr1-1_0016"
                     /product="transcription factor"
                     /transcript_id="XM_002489605.1"
                     /db_xref="GeneID:8197533"
     CDS             complement(567585..569822)
                     /locus_tag="PAS_chr1-1_0016"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_002489650.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0016"
                     /db_xref="EnsemblGenomes-Tr:CAY67369"
                     /db_xref="GeneID:8197533"
                     /db_xref="GOA:C4QVU6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C4QVU6"
                     /translation="MDNTRKKLKHVSKACLRCRGRHMKCDGQQPVCGRCVDEEAECIY
                     VKSNRGGSRKKGVSRFNKDDSDSSHRLPDLEKQQLDDLMRLPCTKNPDGSLNFGKAAS
                     LTCDKDCLNHSTDEIPSCMSQSDTLHPTFNGKQAIDVNQVLFTDKPPRHKRSFTEPIT
                     IPSSMIEDLDLEKIIDNYYTLFHDVHPFLPHRVEITDYLNSIPNNYDLILAMKLIGDG
                     QATTIYAKDSESVNFTVLRILNYVKQIGKDFVTLQTLLLLSMVAHISSLHDLSAMLRK
                     NLVDLCLELQLNYLDDSNLIGSMKVDINEFPVNPEDGNHQVVETIVSTPRTSHINKDV
                     LIETIRRTFWECYFFDTISGTANGVSISRLTMIHALIQWPTQPRLEQFDYKSRSRACK
                     LVNDAIRLNVALQEDKEIDSHLTKMKAAIGNWEMQLENPELFETPYLINRSGFVNEGI
                     HQAMMLFNYARIFTHRPFSYLWRPEVELNCDTRSSYKDGKKFARKLEFDSRKIIETRK
                     TIESANSIAKTLLDTSPSNIRKRTPFYACSLAFACLIHLSAYAWVESSIKYFEENEDF
                     DLEDIVKSFDVSELSIYVEYIKLELGGIYSISTHWSLSSKLANHIKETIAKVSPALSA
                     TIDPTFIKLNRTSNRQLPVSLENSISTGSSSQLLDSSRPRTAMTTNSIPQSTSLTSNS
                     ISASHFQSQMVQPVQDSEFHQEMTSGFDRLISPIYFPSPDSAYSDTGCDWIDKNFLEL
                     DNFQV"
     gene            complement(<570347..>571063)
                     /locus_tag="PAS_chr1-1_0017"
                     /db_xref="GeneID:8197534"
     mRNA            complement(<570347..>571063)
                     /locus_tag="PAS_chr1-1_0017"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489606.1"
                     /db_xref="GeneID:8197534"
     CDS             complement(570347..571063)
                     /locus_tag="PAS_chr1-1_0017"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489651.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0017"
                     /db_xref="EnsemblGenomes-Tr:CAY67370"
                     /db_xref="GeneID:8197534"
                     /db_xref="UniProtKB/TrEMBL:C4QVU7"
                     /translation="MSGNCFKDTLNFWKNADSKSGTVDEAETTIEEPRIEVDENDFPG
                     VIIEDFIEEPLKFQRPVKVVVSKEGCISKSGTDPHCGRKLRNKPQSPDLTAFTDHSDV
                     QQSSDSPKESDSESDIELMNSPVKVVFKRELEPNSTFSNSEEESLEYLYQNFPDVLTP
                     EHIILVKTVIKEMDNALQPIIEEISLYATYYLALRKKGLNSTRKQQPDARRGGISKKT
                     ENLLQFIQQQSTLYAFLYGT"
     gene            complement(<571153..>572739)
                     /locus_tag="PAS_chr1-1_0018"
                     /db_xref="GeneID:8197535"
     mRNA            complement(<571153..>572739)
                     /locus_tag="PAS_chr1-1_0018"
                     /product="Subunit of the heterodimeric FACT complex
                     (Spt16p-Pob3p)"
                     /transcript_id="XM_002489607.1"
                     /db_xref="GeneID:8197535"
     CDS             complement(571153..572739)
                     /locus_tag="PAS_chr1-1_0018"
                     /codon_start=1
                     /product="Subunit of the heterodimeric FACT complex
                     (Spt16p-Pob3p)"
                     /protein_id="XP_002489652.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0018"
                     /db_xref="EnsemblGenomes-Tr:CAY67371"
                     /db_xref="GeneID:8197535"
                     /db_xref="GOA:C4QVU8"
                     /db_xref="InterPro:IPR000969"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR024954"
                     /db_xref="UniProtKB/TrEMBL:C4QVU8"
                     /translation="MSTVDFDTIFLNQSKAPGRFRITSSGLGWKPSSQVPTKGKTDPF
                     LLPSGDILSVSWSRGYRGWELRVYTRNDKVIMLDGFEQQDFQQLKNEIQRTFNVNLEH
                     KEHSLRGWNWGKTQLTRAELVFNVNNRPAWEIPYSEISNSNLTGRHEISMELNPKTVD
                     ENHYETLGDELVEVRLYVPGQIDKDEDSTEGQDTTEEAKSKSQLFYEQLKDKADFDTT
                     SEAIVSFEDILFLTPRGRFEISMYANNLRLRGQSYDYKIQNKNVLRIFSLPRLDDRHH
                     LVILQVDPPLRQGQTRYPFLVMQFDRNEELEVELNLSDEEYKSKYEGKLNRSYGTDST
                     YKILSHCLRGLTERRVITPGSFQSQHMQPGVNCSLKASEGQIYLLDKCLFFATKPCVY
                     LPYSGIISVVTSRGTGQSTSRTFDIEVQFSGGSHTFANINKDEQKPIEDFLKGQGVRV
                     KNEKPAEFLGNALVDDDDDSDDGDIAMGSAGEDDESVDEDFNAGSDSDVAEEYDSNAG
                     SEDEDSDASSGEPEKKKPKH"
     gene            <572961..>574425
                     /locus_tag="PAS_chr1-1_0019"
                     /db_xref="GeneID:8197536"
     mRNA            join(<572961..573189,573344..>574425)
                     /locus_tag="PAS_chr1-1_0019"
                     /product="Component of the TREX complex required for
                     nuclear mRNA export"
                     /transcript_id="XM_002489608.1"
                     /db_xref="GeneID:8197536"
     CDS             join(572961..573189,573344..574425)
                     /locus_tag="PAS_chr1-1_0019"
                     /codon_start=1
                     /product="Component of the TREX complex required for
                     nuclear mRNA export"
                     /protein_id="XP_002489653.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0019"
                     /db_xref="EnsemblGenomes-Tr:CAY67372"
                     /db_xref="GeneID:8197536"
                     /db_xref="GOA:C4QVU9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QVU9"
                     /translation="MSHEGEEELLDYSDSEEIAVAPSGTTTADKEAGEDGKEANKKGS
                     YVGVHATGFQDFLLRPELTRAIRDCGFEHPSEVQQVCIPQSILGNDVLCQAKSGLGKT
                     AVFVLSTLQQLDPSPGEVSVLVICNTRELAYQIKNEYARFSKYMPEVKTEVFYGGTQI
                     AKDEEILKNKDTCPHIVVATPGRLNALVRDKVMNVKNVKNFVIDECDKVLENLSMRRD
                     VQSIFRETPFQKQVMMFSATLSTEMRKICKKFMQNPLEIYVDNEAKLTLHGLQQYYIK
                     LTEADKNRKLSELLDSLDFNQVIIFVKSVKRAEYLNRLLNENNFPSISIHSGLPQQER
                     IERYKSFKEFNKRICVATDVLGRGIDVERINLAINYDLPNESAQYLHRVGRAGRFGTK
                     GLAISFISSDEDNTILEQIQDRFDVKIAEFPAEGVDASTYMSTA"
     gene            complement(<574516..>575778)
                     /locus_tag="PAS_chr1-1_0020"
                     /db_xref="GeneID:8197537"
     mRNA            complement(<574516..>575778)
                     /locus_tag="PAS_chr1-1_0020"
                     /product="Actin-like protein"
                     /transcript_id="XM_002489609.1"
                     /db_xref="GeneID:8197537"
     CDS             complement(574516..575778)
                     /locus_tag="PAS_chr1-1_0020"
                     /codon_start=1
                     /product="Actin-like protein"
                     /protein_id="XP_002489654.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0020"
                     /db_xref="EnsemblGenomes-Tr:CAY67373"
                     /db_xref="GeneID:8197537"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:C4QVV0"
                     /translation="MDSTLIIDNGSNTVKMGYASDENPLIVQNCICRSRDRKLHLANE
                     LNRLTDVSQLIIRRPLEQGQLTSWYLQKLIWDEGFNELVNGHNDINFNETELLYTETP
                     FSFPVLSSNTDQIVFEEYGFKSYYRTTNAALVPWNNDVPNNDYIPFQLVVDSGFECTW
                     VIPVINGCVYWKGVKKMSIGGKFLTGYLKELISFRYYNVMDETILVNNIKEKTSYVAT
                     DYDQSLKKVSQLRSLVKDPIRRHDFDAQNKSMGNVVLDYVLPDFKTTTTGYVLQDTTA
                     KLDSDVQLLRLYDERFAVPETFFYPELANINNKSGIIKTILESLANCPKLARPLLMAN
                     IKCVGGNFDIPGFKHRLFMELRKEIPETYVLKLDDEDDKNKSLTYSWKSGQIFVKKGG
                     FDKVKISKQEYFEKGLNYLQERCSFKAY"
     gene            complement(<575900..>578170)
                     /locus_tag="PAS_chr1-1_0462"
                     /db_xref="GeneID:8197538"
     mRNA            complement(<575900..>578170)
                     /locus_tag="PAS_chr1-1_0462"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489610.1"
                     /db_xref="GeneID:8197538"
     CDS             complement(575900..578170)
                     /locus_tag="PAS_chr1-1_0462"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489655.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0462"
                     /db_xref="EnsemblGenomes-Tr:CAY67374"
                     /db_xref="GeneID:8197538"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:C4QVV1"
                     /translation="MKFGVEFNKRTIQKWRLYNINYNELKRLVKEITSVQNSYTVDTL
                     PVSQKRRLQRLYNVFKEQVNYASLFVNNKVFELTKRLEILTSNLESISKLLPPRGNTV
                     PESTQRLISRKMLAISQRINELSADLFNLSRFILLQKIAVQKLFKKFLKHSKFEFSND
                     YLNKLYYDCLTNDSKSFLNVDLSKMTNQVARLLRLFNQDIDLNDFDTYYHMQSLFDTQ
                     PVTHSLTKKSSMVSLSDAEFSSQTQLFDLLAYQNSPLRSHYWIHNDNLNEVRLALYQN
                     FSSIQEPDSGNVTVYLLNNMENPQIVNFNCNHSPKIIDYGRDLSIILPGCGFKLIRFG
                     KLSSSHLPLLLKGDVDTVIKSLDSSSKLNQQTIAILKNIKENNLKIWSKYECDAVRFP
                     IQLNGNVIYLILLSNIVFDSLDPENSNKFPYIDLVLHYSDSALVSGCQTLQSILNSHL
                     CYKLVGNNNNFSISNYILYKFESDRVIKTLDEQQLQSLFGAWVGLLNSVQDIRKLPVF
                     LDIYQDDKPPKSILLNKNTEPAERYWNEFDYGSDVEDSYPNEQYSNGYEDARNSQGVL
                     FNLNDKRVNKFLKVSHKFLSYLGFQEADGNENLTLKSPKRKNNYSSINSHASSSTLYS
                     SSDDESSEEATYPNSSRVQFVNHNNHDTVVTFLYMVSLLLSFLLISTVAGIITALLLS
                     NDSTSFKDIFISPDNVPITVIIVIGLSFGLLLSILSIILLLSRYNFPPISHVILIWSW
                     FTILVLLLVISICLII"
     gene            complement(<578772..>579494)
                     /locus_tag="PAS_chr1-1_0021"
                     /db_xref="GeneID:8197903"
     mRNA            complement(<578772..>579494)
                     /locus_tag="PAS_chr1-1_0021"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489611.1"
                     /db_xref="GeneID:8197903"
     CDS             complement(578772..579494)
                     /locus_tag="PAS_chr1-1_0021"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489656.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0021"
                     /db_xref="EnsemblGenomes-Tr:CAY67375"
                     /db_xref="GeneID:8197903"
                     /db_xref="InterPro:IPR021715"
                     /db_xref="UniProtKB/TrEMBL:C4QVV2"
                     /translation="MSKQPDNTYVPKFIKDTPWYAGEHQREETTEKNIKDRFIKHKGV
                     GKECKNCGMPHNEKDCFEKPKRRKVNKQSDTIMVRDTDDWDSKRDKWFGYNADEEYQE
                     QLAKWNANEAKKQRAKLLKDLSAQVDLLYSWMIQGGEVNLTEAEQVELEKEILDEYCG
                     EGVKRCLQDTGDLANEGFVGESKVNEFEGSKVFAWGREKGSDTTVAMKGPGGSHGSDG
                     QTKNQDKSAIEEKRRKLLEKYK"
     gene            <579699..>580802
                     /locus_tag="PAS_chr1-1_0022"
                     /db_xref="GeneID:8197539"
     mRNA            <579699..>580802
                     /locus_tag="PAS_chr1-1_0022"
                     /product="Essential conserved nucleolar protein necessary
                     for biogenesis of 60S ribosomal subunits"
                     /transcript_id="XM_002489612.1"
                     /db_xref="GeneID:8197539"
     CDS             579699..580802
                     /locus_tag="PAS_chr1-1_0022"
                     /codon_start=1
                     /product="Essential conserved nucleolar protein necessary
                     for biogenesis of 60S ribosomal subunits"
                     /protein_id="XP_002489657.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0022"
                     /db_xref="EnsemblGenomes-Tr:CAY67376"
                     /db_xref="GeneID:8197539"
                     /db_xref="GOA:C4QVV3"
                     /db_xref="InterPro:IPR010301"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4QVV3"
                     /translation="MSTSAFIKQLATHDKPTRDDALEKLGSFLKHSKVLPELQYQKLW
                     KGLFYAMWHCDKPIPQQHLALQLGELYYNIPETKFIPFFRAFWVVITREWKDLDKWRV
                     DKFLMLIRKILNKSLAKLKSEDYDRDLLEKYIQVLSEYPLHINDIIVPRTITYHLCDI
                     YTDELEKVMFSGLPGFEEEEDYEEEDEVSAPIEKKTRDTDNSDDEASDTDPETSDEED
                     EGENTENESEEEPIKLSAEEETALWKTKMEIIHETPIDKLLSPFVSLKKDTSNKPLKL
                     KIQEAVLADPRLGKWKVKSYRKPKPKPKPLQVLQKQLYEQIKYKKGKAVTGEDDDELK
                     DEDEDDDDEVISESEADNSDEEEDEEWNGFGTI"
     gene            <580942..>581136
                     /locus_tag="PAS_chr1-1_0023"
                     /db_xref="GeneID:8197540"
     mRNA            <580942..>581136
                     /locus_tag="PAS_chr1-1_0023"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489613.1"
                     /db_xref="GeneID:8197540"
     CDS             580942..581136
                     /locus_tag="PAS_chr1-1_0023"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489658.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0023"
                     /db_xref="EnsemblGenomes-Tr:CAY67377"
                     /db_xref="GeneID:8197540"
                     /db_xref="GOA:C4QVV4"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR008158"
                     /db_xref="InterPro:IPR022943"
                     /db_xref="InterPro:IPR023391"
                     /db_xref="UniProtKB/TrEMBL:C4QVV4"
                     /translation="MSQKVTDVPLEFVKEGSKFISKCTKPSQKEYLKIVRAVGVGFLM
                     MGVVGYVVKLIHIPIRYLIV"
     gene            <581394..>582425
                     /locus_tag="PAS_chr1-1_0024"
                     /db_xref="GeneID:8197541"
     mRNA            <581394..>582425
                     /locus_tag="PAS_chr1-1_0024"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489614.1"
                     /db_xref="GeneID:8197541"
     CDS             581394..582425
                     /locus_tag="PAS_chr1-1_0024"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489659.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0024"
                     /db_xref="EnsemblGenomes-Tr:CAY67378"
                     /db_xref="GeneID:8197541"
                     /db_xref="InterPro:IPR013256"
                     /db_xref="UniProtKB/TrEMBL:C4QVV5"
                     /translation="MSTLSNLLSQLKGEGGGGSSGQNRPRTVDPAVARLKAERKMERE
                     KQALKEAQQAQEARERRRISHATQIGLRPTSKAPKINSQRPPLSTSRSRPTPPPSARQ
                     KVETKSCKPTKPLNFGDLMKKAETIDSSQFAIANKVVVTPKKTNEVPRKRIVRSQPQD
                     NLEASQRASKKPAQLYQEGGSQISRTAPRQTSTRDIQKSLKDNHARRSKPPVAMVPPP
                     IAKPSAKLAAKLAARRKKNASKAQRYDSDVESDLDGFIDDDEDDENQYNDQGYDRNEI
                     WSLFSRNGKRRYDYDDDESDDMEANLEDIEREERMALKSAVLEDKRELEREQRLKKEK
                     WQRLNQLKK"
     gene            complement(<582462..>585524)
                     /locus_tag="PAS_chr1-1_0025"
                     /db_xref="GeneID:8197542"
     mRNA            complement(<582462..>585524)
                     /locus_tag="PAS_chr1-1_0025"
                     /product="DNA repair protein"
                     /transcript_id="XM_002489615.1"
                     /db_xref="GeneID:8197542"
     CDS             complement(582462..585524)
                     /locus_tag="PAS_chr1-1_0025"
                     /codon_start=1
                     /product="DNA repair protein"
                     /protein_id="XP_002489660.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0025"
                     /db_xref="EnsemblGenomes-Tr:CAY67379"
                     /db_xref="GeneID:8197542"
                     /db_xref="GOA:C4QVV6"
                     /db_xref="InterPro:IPR004583"
                     /db_xref="InterPro:IPR018325"
                     /db_xref="InterPro:IPR018326"
                     /db_xref="InterPro:IPR018327"
                     /db_xref="InterPro:IPR018328"
                     /db_xref="UniProtKB/TrEMBL:C4QVV6"
                     /translation="MLGTVPAQFRELVREEARNSQHQERKRRRRNNRKQARKEKHKVS
                     TNTEVSESDERQKEGQEVIILDDELAQQLIDQEKSKSRIENEEEEEEDIDDEQFEEID
                     LNFQDFGDEVDPAEEMVLTYDKEPQESKSKKGKTRRVNMVSAEERKFRRDFHLLYLIV
                     MACYGRLRNAWCNDTSLQRFLRLSLPQKLTDEYKIVKQNWSDSKVTVSLKTRKFLDFL
                     RHLMWYWNSSYRITNSFMYQKRNWGELSKEFSHEEVSREKFKYLIRSHMGSSEICLEG
                     FVMLLRSLGLYTRLVISLQPPDFTNVAAVDFSVSEEKKSSSPSVPKTKKVTKDDYLSL
                     VRSGKPRSQSKSPGPINQEAPEYPVMWAEVWDKYSQKWISIDPVVQKTIDIVGRKSKF
                     EPPLNNKKNNCFYVIGYDQRNAVRDITRRYASNLNSKVRRKRVTRDPRYALWWERVLR
                     ELNTPRTRHASKIDALERVEFEERDLREGMPDSFEDFRNHPVYCLESQLKQNEILYPK
                     QSCGTVRKKSSNEVTPVYKRLNVHTVRSPKAWYLKGRMIKLGERCLATKDAPKTADDD
                     EDETRLYAEFQTELYIPPPIENGIVPKNAYGNIDVYVKTMLPKNGAHITGKRAIKAAK
                     LLGIDFAPAVVGFDFGGNNKGVANARIDGIVVAKEFEEAMSLTCQCLQEMHEEEELMR
                     KNIRLLKCWKIFLTKLRIKDRLNKTHGKLEETDETYEQGGFVASDRVFDTDKQDSKST
                     QDWDNYSDSSSNYVPSESSGNETDYGIGGFIPSDDVSDLGNVNERETKLGGSTSYENE
                     FDESGHSEVAQAGLTPRSGSELVDKNQDSLEGGFVKEDQQSAEEGGFLLEDAESGGFL
                     PEDAELDKAISEEIKKAKFPVETDTLSGQFVGDEEIIKQGEFSGEQDFDIGHFQNLRD
                     EERQGPQTHTSEELSNDEIMRSEGRCGGSSVSYATEVAESRDGDGNQETNLTEEAMVT
                     NIAKFQEEQQQKPVENNSTPIVIDSADEPEIATGQHLDEFDFEYSDSE"
     gene            <585851..>588076
                     /locus_tag="PAS_chr1-1_0026"
                     /db_xref="GeneID:8197543"
     mRNA            <585851..>588076
                     /locus_tag="PAS_chr1-1_0026"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489616.1"
                     /db_xref="GeneID:8197543"
     CDS             585851..588076
                     /locus_tag="PAS_chr1-1_0026"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489661.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0026"
                     /db_xref="EnsemblGenomes-Tr:CAY67380"
                     /db_xref="GeneID:8197543"
                     /db_xref="UniProtKB/TrEMBL:C4QVV7"
                     /translation="MWRRIRSSSLVPAFIDSLSKKFTYEKSNQRYSLNGPGHYNLEFR
                     KDSFNDVLISLIMGYETTKLDCAVKIPGRKLLLKLLHPSSLEGCFNLLLLALSRSSDE
                     NRTTRRIPLGKLLDRACNTGMLNNHEELKKDSDKLLACYWFKNSFYPIHVSEYTRNMI
                     GKSIYLLKNYGINTSTLHNWLVSVASESITQACFALEGETLPEFLVTDILLRTPRSNY
                     EFDLLIDLYLDPNYQINDSDKKSMLVLNNLIQNCHYRTSSRLLEIINKVLDQTSNEPF
                     LNHLVWSISKISSKVPRDDNLYFNILECQQKIIRHLNSKVSVEILLGLSNTLYHINHS
                     KGKEILQAARSLINRKDASPLVSQTPSIAHYLERSSLNVARTKAMLLGTEILYIDKPI
                     LFKAHQKLIASTEPTVLHQLGFSLWGLWLSKKAQFRLHSGTDIKLVKSLIPYLSTQFD
                     QEALSVFLTGISDIEMNKVIITNYSKAGHTLGNLVLNTYLKNLYRQCLFEECIKEKAP
                     HYLKYPEIVNQRIVEHKQFKSTLDYTRFVYANVEQRPLSLVGTMMFGEARIAPEKVWK
                     VYFNRQFETVNEKILTSLTISVITFYERSGKHLMWNGMTAVQQCIMEVEKWTAKSTKG
                     DNPNLVNPTNQLWLSYTQMLGMFGYTDLLMDLLEKWVNLRHIPNERTLLNVFGYLPDE
                     ISDNLLRHVTANITNKVPAIRTDDLSRKPELQFDNDSLVVKWPWPTKSQVENFKRKLL
                     I"
     gene            complement(<588069..>588815)
                     /locus_tag="PAS_chr1-1_0027"
                     /db_xref="GeneID:8197544"
     mRNA            complement(<588069..>588815)
                     /locus_tag="PAS_chr1-1_0027"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489617.1"
                     /db_xref="GeneID:8197544"
     CDS             complement(588069..588815)
                     /locus_tag="PAS_chr1-1_0027"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489662.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0027"
                     /db_xref="EnsemblGenomes-Tr:CAY67381"
                     /db_xref="GeneID:8197544"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:C4QVV8"
                     /translation="MAITEVVSIVTGTIGTILWCIQLIPQIIYNYRNKNCEGLPPLMM
                     FLWAASGIPFAIYFIVRDSYIPMQVQPVLFSALCAISWIQTLYYPPSQLKIVKIVSLV
                     SVFLVIALGMMMGFIMWLRPLYIDENLEWPSLIFGILASIMLLAGLVPPYIELAKRKG
                     RVLGINFVFLSMDSAGAAFSMISVLVDKIDIMGAILYAVVLIMELGIFTSHIMWWLRI
                     GQYVEIEGSISTDVETNHLEENKLFDSSVK"
     gene            <590598..>592190
                     /locus_tag="PAS_chr1-1_0028"
                     /db_xref="GeneID:8197545"
     mRNA            <590598..>592190
                     /locus_tag="PAS_chr1-1_0028"
                     /product="Glycerol proton symporter of the plasma
                     membrane, subject to glucose-induced inactivation"
                     /transcript_id="XM_002489618.1"
                     /db_xref="GeneID:8197545"
     CDS             590598..592190
                     /locus_tag="PAS_chr1-1_0028"
                     /codon_start=1
                     /product="Glycerol proton symporter of the plasma
                     membrane, subject to glucose-induced inactivation"
                     /protein_id="XP_002489663.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0028"
                     /db_xref="EnsemblGenomes-Tr:CAY67382"
                     /db_xref="GeneID:8197545"
                     /db_xref="GOA:C4QVV9"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4QVV9"
                     /translation="MAIYSQPVRTHLIYNRRIMLKLFQYQDFLRGKSFLWAITLCALQ
                     GFLLLGYDQGVMSCLISDPTFNKFFKYPNEDLQGDITGTYDLGCVAGSIFCYFFGEQL
                     GRRKALILGGTIMVIGTVFLGAANGVGIFIAGRVITGIGNGINSSTVPTLQAECSPAN
                     IRGALLTLQGTVTILGLVIAYWAGFGTSFVDSNFQWRFPVSFQAFFAVCLVIQAIGLP
                     DTPRWLVAHGRLNEARNVIACLLDKSEDDPEVESQLFDIKTTVDEEFAGGPFKFKEFL
                     QMGKTQNFRRLCITIGVNIMQQFTGSNMINYYAPTVYQKTMGFDNQMSMILGGCTSIT
                     YLVGSVLPVFLVDRFGRRTLLMVSAGGLCFCFMMVSILLSTEIQAAAYAAVAFIFIFQ
                     IFLAVGFLPVPWFLGSELNITRLRARACSIASGWNWMCVYAIVKITPIAMKNLGWKTF
                     IIFTVLNAMWIPIVYCFFPETNGLELEDIDLIFARGGFTGGVFSTRGKTVQKHAHLNQ
                     QLKTGDEKDTGDIEFVEDVSRA"
     gene            complement(<593578..>594291)
                     /locus_tag="PAS_chr1-1_0029"
                     /db_xref="GeneID:8197546"
     mRNA            complement(<593578..>594291)
                     /locus_tag="PAS_chr1-1_0029"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489619.1"
                     /db_xref="GeneID:8197546"
     CDS             complement(593578..594291)
                     /locus_tag="PAS_chr1-1_0029"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489664.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0029"
                     /db_xref="EnsemblGenomes-Tr:CAY67383"
                     /db_xref="GeneID:8197546"
                     /db_xref="InterPro:IPR006840"
                     /db_xref="InterPro:IPR013024"
                     /db_xref="UniProtKB/TrEMBL:C4QVW0"
                     /translation="MTNDAPLWVLGYGSLIFKPPPHATHKIPGKISGFVRRFWQSSTD
                     HRGTPESPGRVVTLIPYADIVRDHRFLESVHYFECNGDKKNIIGSDLQVWGCIYYIPA
                     QHREEVCSYLDVREQDGYTQHKVTFEVELDDEYFSQNPEIKEFVQSHTIVDTHTGKNV
                     IHSLVYIGTTSNESFIGPEHPTTTAKVIRSNEGPSGSNLDYLKRLHRSLMDLDKSGNK
                     RSHDRYLDELIQLVDKEDS"
     gene            complement(<594551..>596305)
                     /locus_tag="PAS_chr1-1_0030"
                     /db_xref="GeneID:8197547"
     mRNA            complement(<594551..>596305)
                     /locus_tag="PAS_chr1-1_0030"
                     /product="General amino acid permease"
                     /transcript_id="XM_002489620.1"
                     /db_xref="GeneID:8197547"
     CDS             complement(594551..596305)
                     /locus_tag="PAS_chr1-1_0030"
                     /codon_start=1
                     /product="General amino acid permease"
                     /protein_id="XP_002489665.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0030"
                     /db_xref="EnsemblGenomes-Tr:CAY67384"
                     /db_xref="GeneID:8197547"
                     /db_xref="GOA:C4QVW1"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C4QVW1"
                     /translation="MSDKKTSVEAVITEVDSSPAYEAGSIKSENKRNFVQNWFDGFKP
                     YEMEELDPNLSEVEKAAIATANAPLQRKLKNRHLQMIAIGGSIGTGLFVGSGKALAAA
                     GPAALLIAWGLTGIMIYFTVQALGELSVTMPVSGSFAVYSTRFIDPSWGCAMGFNYAM
                     QWLIVLPLELVAASITLSYWEGSKSVNADVWVLIFYLLIVVINLFGVKGYGEAEFVFS
                     LIKVITVIAFIFMGIILNCGGGPKGEYIGGRYWKNPGAFNTEYNPFKAVCSVFVTSAF
                     SFAGTELVGLAAAEATNPRKSLPTAIKQVFWRIMLFYIISLTLIGLLVPFNDPRLIGS
                     SSVDASASPFVIAIVSNGIHGLDSVMNVVIMIAVLSVGNSAVYGSSRILQSLAAQGQA
                     PKILGYIDREGRPLAAIGLTLLFGCLAFVAASPKQGEMFDWLLALSGLSSIFTWGSIC
                     LSHIRFRACLKSLGRGTNELVFTAQGGIIGSWIGLIINCLVLIVSFWVAAFPLGDKSS
                     AEGFFKAYLTVPVVIIVYVIHKIVKKNWCLYVKLNEMDVDSGRRDFDLELLKQEIVEE
                     KETLARKPFWYRTYKFWC"
     gene            <597186..>598031
                     /locus_tag="PAS_chr1-1_0464"
                     /db_xref="GeneID:8197548"
     mRNA            <597186..>598031
                     /locus_tag="PAS_chr1-1_0464"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489621.1"
                     /db_xref="GeneID:8197548"
     CDS             597186..598031
                     /locus_tag="PAS_chr1-1_0464"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489666.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0464"
                     /db_xref="EnsemblGenomes-Tr:CAY67385"
                     /db_xref="GeneID:8197548"
                     /db_xref="UniProtKB/TrEMBL:C4QVW2"
                     /translation="MFRQSASKLESVFRCKRPIHYIKPLKTHYRLKSDLNEKLLKENV
                     QEYYLAQQGFNFKNVFKAALTILVPITVSLSVYTAYNISKGEDVFIPLWYQSTVELTP
                     ENNTLLDMDKLKRKCKSALVTKLSLSSHVQQSFGLPIQVDEELETFQVFIKFHNVSFQ
                     GLQINANSKGKNEPRFQWANREISVTDKVLDMLEPFTTQNSDSIDFLYDTKSQLHADY
                     DIIIKGRLSLKDSKKSASNSIDPDSGDVHFTGLIQFDHTKTLLIDKATLTYKVDGKPV
                     IKKLW"
     gene            complement(<598051..>599640)
                     /locus_tag="PAS_chr1-1_0465"
                     /db_xref="GeneID:8197904"
     mRNA            complement(<598051..>599640)
                     /locus_tag="PAS_chr1-1_0465"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489622.1"
                     /db_xref="GeneID:8197904"
     CDS             complement(598051..599640)
                     /locus_tag="PAS_chr1-1_0465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489667.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0465"
                     /db_xref="EnsemblGenomes-Tr:CAY67386"
                     /db_xref="GeneID:8197904"
                     /db_xref="GOA:C4QVW3"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4QVW3"
                     /translation="MSPSVRTDNGTIIKWMVVLVLSLALLWECFVSFHFGSTPHDPLL
                     RLQHVAPIENKTRFRIRHIYHHNSGKNHRVHKRLDITDQFIARFDLDQPNISGLVNTD
                     GNEDGEFDDPETLMPYFSRESPWVSEFDMSGYIGSIRRMAERDPDFVESYLAYARESG
                     AEQVSKITLDWNDDRDILPNVTNNETIMNLALMSSNAYVRIPGEGDWKDVNKPWSVNK
                     TDEEGSTGFGWMEDGVRGHVFTNEDSSIVILSIKGTSAQGLPGGGGESDTIEEDKIND
                     NLLFSCCCARVSYMWTTVCDCYKSSYTCDEDCLEKELYREDRYYRAVLDVYRNVTNLY
                     PDSTVWVTGHSLGAALAGLLGRTYGLPAVTFEAPGDLLATKRLHLPQPPSLPSYLEHI
                     WHFGHTADPIFMGTCNGASSSCSVAGYAMETQCHSGKVCIYDVVNDYGWHVNLVNHRI
                     HTVIDSVLTAYNKTASCEIPLPCHDCYNWNFITRDRHKGRDGDDKNKPKEPKKPQKCL
                     RRSWYGRCLEWGDDDSDDVST"
     gene            complement(<599832..>601055)
                     /locus_tag="PAS_chr1-1_0031"
                     /db_xref="GeneID:8197905"
     mRNA            complement(<599832..>601055)
                     /locus_tag="PAS_chr1-1_0031"
                     /product="Cytoplasmic pre-60S factor"
                     /transcript_id="XM_002489623.1"
                     /db_xref="GeneID:8197905"
     CDS             complement(599832..601055)
                     /locus_tag="PAS_chr1-1_0031"
                     /codon_start=1
                     /product="Cytoplasmic pre-60S factor"
                     /protein_id="XP_002489668.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0031"
                     /db_xref="EnsemblGenomes-Tr:CAY67387"
                     /db_xref="GeneID:8197905"
                     /db_xref="GOA:C4QVW4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4QVW4"
                     /translation="MHFTCNTCGLAFHDAENQREHMKGDWHRYNLKRRVADLPPVDEQ
                     TFNSKVSVLNPKESTDTTKIRGRKGGKNEEDVQKTVTKKELRRKEKEAALLEKKMALL
                     EIARKRMTESQQPNDETVKETKPDAQEYVILDKDTNSSEQSTKGTIEEDSLTEEQLYE
                     EKVKNRVEIKPEECLFCGKLFSDQKEAITHMFHSHGLYIPERDYLVDEAGLIHYLAEK
                     IGFGNICLCCNFQGRSLESVRDHMLAKRHCRLPYESEDEQLEISEFYDFTSSYKAKEK
                     IVVVDGVGGTSIDTDDWEDVEGEENSDEEEAPKEVSYVVGSDLVLPTGLIVGHRSLQR
                     YYKQNLPAERGLKEGEGTVIAADARHLSVTYDKKLAQEQKRVWTKQQKDAYRNDRRSA
                     KFINNQPHFRDELLQ"
     gene            complement(<601199..>602920)
                     /locus_tag="PAS_chr1-1_0466"
                     /db_xref="GeneID:8197549"
     mRNA            complement(<601199..>602920)
                     /locus_tag="PAS_chr1-1_0466"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489624.1"
                     /db_xref="GeneID:8197549"
     CDS             complement(601199..602920)
                     /locus_tag="PAS_chr1-1_0466"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489669.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0466"
                     /db_xref="EnsemblGenomes-Tr:CAY67388"
                     /db_xref="GeneID:8197549"
                     /db_xref="UniProtKB/TrEMBL:C4QVW5"
                     /translation="MRRFYSQIARRKPLFDGLEKYLNSSKVPNTTKNKISTVLNSLKV
                     QLQSQDSKYSPYTVKVGIYSHDTQLSVKLTKAILVDPLDPKTYWSDYEQSLDIAKNNV
                     YQYGDQFQVDNNIESNYYRIPSPFLSSEYRPVVREKIKEDEVKEIDNTEIGYDKQYFN
                     DISIVQVNAEQPKLDDGSIPNVNSSTIDLNKNLNTNLKVSTFVPKILYDCHFIIHLKS
                     NLHDTLPPELSDTIPVFTIVNRNQPIANHITVDVDEAIKANELLMKSPSNSTQYLNLL
                     DESNIHQLLNLLNIETSKYNPIKCLSATIINDLYALFDTSIGGSKSPNEITLTPRLSV
                     SKSQKELEKVKEQLLASINDWRYNAHIALQTKVIPFVHNEVVNKFSKVHRNLAQLDDL
                     NVVISNKLFDENTDGFLGQEIIKFNQLVGRISALNTENSATLSSEIPLLDLKQLAKDD
                     KLLVLQNQISDYTIKQLFVINIPTILVSTGFFVKGFWSGQSLVAVVLLGLAISLNDIS
                     RTLFKSLSEFEKWYVNSLRERIDQSANQLTILLQQQVKSTNDTLIQSLNEVEELEATF
                     EDFWKDK"
     gene            complement(<603055..>604419)
                     /locus_tag="PAS_chr1-1_0032"
                     /db_xref="GeneID:8197906"
     mRNA            complement(<603055..>604419)
                     /locus_tag="PAS_chr1-1_0032"
                     /product="Component of the mitochondrial Tim54p-Tim22p
                     complex"
                     /transcript_id="XM_002489625.1"
                     /db_xref="GeneID:8197906"
     CDS             complement(603055..604419)
                     /locus_tag="PAS_chr1-1_0032"
                     /codon_start=1
                     /product="Component of the mitochondrial Tim54p-Tim22p
                     complex"
                     /protein_id="XP_002489670.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0032"
                     /db_xref="EnsemblGenomes-Tr:CAY67389"
                     /db_xref="GeneID:8197906"
                     /db_xref="InterPro:IPR021056"
                     /db_xref="UniProtKB/TrEMBL:C4QVW6"
                     /translation="MTKGNQNPAFKALGLPRLRLPSRNWCIFWSILGGTIGSIVYDKY
                     QQKHIRTLQMAKLDHLSHAQVPFNMMPRKITVFIAPPPSDYLEETLRVFRKYVKPLLN
                     SAGLDFEIYTEERQGDIRFKVAEDIRTLRREALNPNADDNKSEHSIWNKVSSKLSKSQ
                     NTQEDEPLVKMSEKISVKDIIGITLYNKNDEVVREDQLVRSPEDAGGVICIGRGAFKE
                     FMNGIHEGLLGPLEEPVRDEPVVLDSNELKGEKSSIVAQESEFINEEQSRDTSGESLI
                     DPSNELKVIPTATSDEPTKEGEEDDEKPKNKGPLPFIYPEDYANAQLAPELDLSRPIL
                     DKNGVPIIYHQPVLVLRQFNLPGFIRTPERLWRFFTKRSQAEYYCSKTENLVLSRKHP
                     MTIKDQELAVEEERDWPKKWVKSAKERNSEWVRPFEFDDRVIRHMWVVNDDVHDEDTL
                     PSVN"
     gene            complement(<604554..>605780)
                     /locus_tag="PAS_chr1-1_0467"
                     /db_xref="GeneID:8197550"
     mRNA            complement(<604554..>605780)
                     /locus_tag="PAS_chr1-1_0467"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489626.1"
                     /db_xref="GeneID:8197550"
     CDS             complement(604554..605780)
                     /locus_tag="PAS_chr1-1_0467"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489671.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0467"
                     /db_xref="EnsemblGenomes-Tr:CAY67390"
                     /db_xref="GeneID:8197550"
                     /db_xref="GOA:C4QVW7"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028884"
                     /db_xref="UniProtKB/TrEMBL:C4QVW7"
                     /translation="MKHPFQLILANREGSLLFASTKNVVQVFSTENGQLIAKWIDPID
                     TFHTLKKQQKEKIQALKEKTEGPVKIPKIPVPGKGAPPIFNYIRNMHLTGDESKLIVT
                     TDSDKAVVILELNLDNSDFESRIVVLSRQAFAKRPCAISIKEDDSRLVVADKFGDVYD
                     VSLDKNFLTLEQQAPKKSILGHVSMLTNVIFAKNHIITSDRDEHIRVTQYPKTYIIER
                     YLFGHSQFVSCLKLCPWNEDILISGGGDDFINIWNWTTGDLLFHLDLTSYVQPLITDR
                     HLAPMRFQNKEGNLTETNVSELLVHDHKLFVLIECTSAVLIFDFQSTDNLPLLHVIKT
                     QSPVVHISIALSKLYVALEDYTIDGFEIFDTNTFQPVLEDVSKNIYSNSTVEFESTTE
                     QYPLYHVAQLRKRGEH"
     gene            <606302..>607468
                     /locus_tag="PAS_chr1-1_0033"
                     /db_xref="GeneID:8197907"
     mRNA            <606302..>607468
                     /locus_tag="PAS_chr1-1_0033"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489627.1"
                     /db_xref="GeneID:8197907"
     CDS             606302..607468
                     /locus_tag="PAS_chr1-1_0033"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489672.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0033"
                     /db_xref="EnsemblGenomes-Tr:CAY67391"
                     /db_xref="GeneID:8197907"
                     /db_xref="InterPro:IPR013927"
                     /db_xref="UniProtKB/TrEMBL:C4QVW8"
                     /translation="MSKRKLTGEYSTDGDENREVIAIEALNQLRNNGSTSPSVGVEQD
                     LDSAQLPPMGKVDSTTTKLIDKVTSYPIISTGINYMWQRNLVIAGNYIKGESSKKEVV
                     TTKRQKTTTNDSKPEERSAPSYIRDNSRLRHLQDLKDIGMINFNLESRQKLQMLINFL
                     KLGNRQLNQRIEKLIVELRRQQRGDGDDDTETETIVPDAPSGKDSESNRSRSSSITSV
                     QTVYEDATSTGLASPNLNQVNHKLDQHFNNQPLNQVKNDIVTTVKRIVNVVSKFSGSA
                     LPEPARSNVREVLLKLPDNWANSVLPLVEGEGAGDSPATANTTERSLLSDPNGRVLVL
                     AQESLDMVTKVIKFCSDTLDRADQWNLNKQIEQKTHLIHKLERINKHKPGEKQE"
     gene            complement(<607555..>608285)
                     /locus_tag="PAS_chr1-1_0034"
                     /db_xref="GeneID:8197551"
     mRNA            complement(join(<607555..608184,608238..>608285))
                     /locus_tag="PAS_chr1-1_0034"
                     /product="vacuolar sorting protein"
                     /transcript_id="XM_002489628.1"
                     /db_xref="GeneID:8197551"
     CDS             complement(join(607555..608184,608238..608285))
                     /locus_tag="PAS_chr1-1_0034"
                     /codon_start=1
                     /product="vacuolar sorting protein"
                     /protein_id="XP_002489673.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0034"
                     /db_xref="EnsemblGenomes-Tr:CAY67392"
                     /db_xref="GeneID:8197551"
                     /db_xref="GOA:C4QVW9"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C4QVW9"
                     /translation="MDYVKKAIWGPDPKEQVRKCQQLVRKNKRQLDRYINDLRMVQKK
                     TQSMIKKAAKSGDKNAVRLYARELVNINKQSDRLHVNRATIDSIGMKLQEQQQMLKIQ
                     GSLSKSTEIMREVNSLVSLPQLRNSAQELERELMKSGIINEMVDDLVDEVDEDEELME
                     EEEVQAINEIIEQYTSDAVGKLPETGGTPIEVASPKVPEKEEEEVSEDNEEVLNAMRE
                     RLKALQD"
     gene            complement(<608498..>610612)
                     /locus_tag="PAS_chr1-1_0035"
                     /db_xref="GeneID:8197552"
     mRNA            complement(<608498..>610612)
                     /locus_tag="PAS_chr1-1_0035"
                     /product="Delta subunit of the coatomer complex (COPI),
                     which coats Golgi-derived transport vesicles"
                     /transcript_id="XM_002489629.1"
                     /db_xref="GeneID:8197552"
     CDS             complement(608498..610612)
                     /locus_tag="PAS_chr1-1_0035"
                     /codon_start=1
                     /product="Delta subunit of the coatomer complex (COPI),
                     which coats Golgi-derived transport vesicles"
                     /protein_id="XP_002489674.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0035"
                     /db_xref="EnsemblGenomes-Tr:CAY67393"
                     /db_xref="GeneID:8197552"
                     /db_xref="GOA:C4QVX0"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027059"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:C4QVX0"
                     /translation="MVELSTPVDNSAIEGLQVQFLSVSYFNFLACCLIILFSNDLPPN
                     HRAKKRYIAYDLVTTSKSLTHPFVSLVLPILPIPSVVLKEVSSPDYSDTSTFQNCRAL
                     TNIFLSYNQFVRDSMAVLASSITTRDGKTIISRQFKDLSKDRITALLAEFPSLLSENS
                     KYQHTSIEYEGVRFIYQPLENVYVVLITNRQSNVLQDIDTLHILSQSLSALLRSVEEK
                     EVLDNCFEIISAFDEVINLGYKENLSLNQVRAFLEMDSHEEKIQEIIERNKELEAAEE
                     RKRRAKEIQRKELARRNREDYANMIPQQHSSAFDQQPQQPIYSNFEAPSAPSEYESYN
                     PTTPSTRSAPPRGKGLKLGKKSGSSEAQQPLLVPQRHLESQFNSHQQQTPLQQNHPHQ
                     QPQRYQQSPPQQAHRSPVPESVSSIPPAHNVVSPHTGQNVQRQIPHEASTTRSPVSRP
                     QVGKPINNGIMVTIIEKVSGKVNRDGTVLSSELKGDLQLRINESSLAHGVIHLGLAKQ
                     PNTQFKTHPNVDKNLFNAESKIGLKDPRKSFPANDQSLGVLRWRSVGSGLLPLNVSSW
                     INSNDDGSVSVTIEYEVNEKLAFNEYSIDDAELVIPLSGLSFSIDNPENVSVDNKGDS
                     TSVFLTRLNEHPSGSFEFEVSNVDEENVFPIHVNIDLQNNFDNLSDVKVNSINSLDLE
                     TLNEELPYDLYYNLATESFTIE"
     gene            <611271..>612866
                     /locus_tag="PAS_chr1-1_0036"
                     /db_xref="GeneID:8197553"
     mRNA            <611271..>612866
                     /locus_tag="PAS_chr1-1_0036"
                     /product="Hsp70 protein that interacts with Zuo1p (a DnaJ
                     homolog) to form a ribosome-associated complex"
                     /transcript_id="XM_002489630.1"
                     /db_xref="GeneID:8197553"
     CDS             611271..612866
                     /locus_tag="PAS_chr1-1_0036"
                     /codon_start=1
                     /product="Hsp70 protein that interacts with Zuo1p (a DnaJ
                     homolog) to form a ribosome-associated complex"
                     /protein_id="XP_002489675.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0036"
                     /db_xref="EnsemblGenomes-Tr:CAY67394"
                     /db_xref="GeneID:8197553"
                     /db_xref="GOA:C4QVX1"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="UniProtKB/TrEMBL:C4QVX1"
                     /translation="MSFIGLHFGNTSTSIAVTKGDGKVDVIASPDGERAIPSALSYVG
                     TDEYHGGQALAQLIRNPQNTIINFRDFAGVSFDKAVLPEIVNSAKAINVDGKVGYEIE
                     EDGKTTKITVDEVIKRHFQQIKAAAEDYIGNKVEGVVLTTPTNFSDEQKKALKSATKE
                     AGLNVLQFINEPSAALLAHLTANNKLEEDRIYVVADFGGVRSDAAVITARGGIFTILA
                     TEHNFELGGDQLDAALSEFFAKEFEKKYKANPRKTQRSLAKLKSECITTKKTLSNVQS
                     STISIDSLSDGFDFHSSINRLRYEVVARDIFSKMAAFVEETVRKAGLETLDIDEVLLV
                     GGTSNTPRLASNVQFIFPESTVVVSPALDSKALDPSELICRGAALQAALIESYDEDEI
                     NQSLQPVVVNLEHIAKPIGLKNADGEFIQIISRETAYPIKRSLTFDTPGDVLIELYEG
                     ERTIEESTVEPEEGEEEYSDEEPEVLKKVVYVPGQLLAQIPFKGETANGKLEVIVRIT
                     VDGLLQATVRSGDKVERVDVHST"
     gene            complement(<612911..>614272)
                     /locus_tag="PAS_chr1-1_0037"
                     /db_xref="GeneID:8197554"
     mRNA            complement(<612911..>614272)
                     /locus_tag="PAS_chr1-1_0037"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489631.1"
                     /db_xref="GeneID:8197554"
     CDS             complement(612911..614272)
                     /locus_tag="PAS_chr1-1_0037"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489676.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0037"
                     /db_xref="EnsemblGenomes-Tr:CAY67395"
                     /db_xref="GeneID:8197554"
                     /db_xref="GOA:C4QVX2"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:C4QVX2"
                     /translation="MSFGNHYYFPVSTTSFPKWIDRIMTSNINGSLPQSANVVVIGSG
                     FAGTAVSYYLQNEIAGDQSIVMLEARAAVSGATSRNSGLIKPEYHRNHGEYVDKFGSK
                     VAGQLVNFEVDNMKELARILTLDSDLNEKADFQERIHLDAYSNPRSSETAINDFYAFM
                     ENEEVSVDLKRKVQILFGDLAKQLSNVPTTPFVIHYPNGSVNSYDFVTAMLTRAIQKG
                     LALYTNTLVEEVQQLDSGVWKVSTSRGELFADKVVFTTNAYTQGLLPEFSKSIIPIRG
                     VSSQVNVRNTGNEHSLSIGSDIYVPQSKNLLYSSLGELEKQTNFMANYNTVDDSTVSS
                     QSLEYLQKNLGKVNSLATATATSSSSGIMAYTDDHFPYVGQLSELGKLNAYILAGCNC
                     SGLSRMLLCAKELAKSVALGSELSDRVPAPYKVTRERMGLVDKLMQSVLNEREIRETR
                     ARL"
     gene            <614490..>616586
                     /locus_tag="PAS_chr1-1_0038"
                     /db_xref="GeneID:8197555"
     mRNA            <614490..>616586
                     /locus_tag="PAS_chr1-1_0038"
                     /product="Origin-binding F-box protein that forms an SCF
                     ubiquitin ligase complex with Skp1p and Cdc53p"
                     /transcript_id="XM_002489632.1"
                     /db_xref="GeneID:8197555"
     CDS             614490..616586
                     /locus_tag="PAS_chr1-1_0038"
                     /codon_start=1
                     /product="Origin-binding F-box protein that forms an SCF
                     ubiquitin ligase complex with Skp1p and Cdc53p"
                     /protein_id="XP_002489677.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0038"
                     /db_xref="EnsemblGenomes-Tr:CAY67396"
                     /db_xref="GeneID:8197555"
                     /db_xref="GOA:C4QVX3"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C4QVX3"
                     /translation="MDRQLVDQGLKTGIELFKQKEYRRCYKAFTSTINFIENDPELAA
                     SCVSQLISLLDCRAACLEKLDQLNMALKDGLKMIKRECHNCKGYLRTCKILDLQGKIS
                     EALSTAREGISIIETRRDQDNQFRYSKVLLEQLKELKNALKIKLDKKNQLHFKVLKFD
                     APVPCTKKLRLVTPRTIDPSIFLPIELVKLIFRLLNFSDMYACLLVSTKWNSIISSSP
                     ELFRKLQLKSQLSNKALNNCLNFLIKTMKSSSSKEIEYLHLKPKRSDERSSLNTLSSK
                     PLLINELEIYLQDLTLRDLLICRLSSKNGTRLFSSIVHLKLSVPLTRNYESFLIQQFS
                     GLETLEYSISDYKRVPGDRYLAPFTEQIESSAATSSLNTLSVIALPSYNSITKHIPFS
                     LAIQRNMLSNLTSLTLTGIDFSPVIDEPWLGQFFKSLSNLVTLNLQFNKGMNFAWLLR
                     NISNYQEVLQYNDLVNNSPDTNEPLIAPVNFHSCPLKVLVMRECSIPAVNVQSPTPSL
                     LAYDALKQLTHLDLYGSSISTRELSNLIFHCSHTLTSLSIGNCFNVFFTSDVFDSRSN
                     HFDVNIFFHVPYLKKLYLNQISTFNDYTLKCFGETILTRLEQYALPQLKWEVLDLSFN
                     KISNTGLYNLFQVSKRQQLKKTNQKAPKLVIELLIIDGCHGTDESTLTYLKSQGYIRK
                     YSCIYNKDTWNGVTVI"
     gene            complement(<616602..>618458)
                     /locus_tag="PAS_chr1-1_0039"
                     /db_xref="GeneID:8197556"
     mRNA            complement(<616602..>618458)
                     /locus_tag="PAS_chr1-1_0039"
                     /product="Myb-related transcription factor"
                     /transcript_id="XM_002489633.1"
                     /db_xref="GeneID:8197556"
     CDS             complement(616602..618458)
                     /locus_tag="PAS_chr1-1_0039"
                     /codon_start=1
                     /product="Myb-related transcription factor"
                     /protein_id="XP_002489678.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0039"
                     /db_xref="EnsemblGenomes-Tr:CAY67397"
                     /db_xref="GeneID:8197556"
                     /db_xref="GOA:C4QVX4"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:C4QVX4"
                     /translation="MEEAKLKPASRQQFDPLTVTQSLGYQTFRREARRPWTKDEDEHL
                     KRLVIEQYMDSHNDDNYKTKPIPLTSINWDTVAEKLPERKAFDCKKRWANSIDPTVKK
                     GKWTKEEDTLLLEAFQTYGTSWQKVSTWLVGRTKDQCAKRYVEVLDPNKDRFKPWNKE
                     EDLELIRLVQSVGTKWRTISMNLPGRPSLTCRNRWRKLVTTMVRGKADPDIHKEMEKV
                     QKKKEVLGSTIKSPEGIDSDKTPNPKAVQSAKNVSHPQSTSSASPPQPLQKASPNLVH
                     SHTEWTFNTTGVEGQILSTGSINSKEEVDRLVEQAKKYNIAITIHQHVHHHYGNPNSQ
                     KSVLDPETQLNRHQHFNYLGSLKNVPRLTSTSRNSSSTNLNQIDPHSNKVSGKESDLI
                     RLLNQPPETSQSPSNFNSRYWDFGSSSKRQRVHNPEDLKNDTTTQNYRAIPTNTFHPH
                     FAPDDIEEDIDFWDSLGKLADVNPVNTSASTPPVSQHHPLHYDNSQSKTQVATHYTNF
                     HPTHQQEVNEPRSTAPFGPLYGREYEEDEDYEQEIRKDEPKVMDRAHQDEEDIPNDAS
                     SFGVYYNVFPTKQLTNGIATEQARKNSHKTDSNSEKSVSHDDAFGFFPFNPS"
     gene            <618896..>621763
                     /locus_tag="PAS_chr1-1_0040"
                     /db_xref="GeneID:8197557"
     mRNA            <618896..>621763
                     /locus_tag="PAS_chr1-1_0040"
                     /product="Ubiquitin carboxyl-terminal hydrolase"
                     /transcript_id="XM_002489634.1"
                     /db_xref="GeneID:8197557"
     CDS             618896..621763
                     /locus_tag="PAS_chr1-1_0040"
                     /codon_start=1
                     /product="Ubiquitin carboxyl-terminal hydrolase"
                     /protein_id="XP_002489679.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0040"
                     /db_xref="EnsemblGenomes-Tr:CAY67398"
                     /db_xref="GeneID:8197557"
                     /db_xref="GOA:C4QVX5"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C4QVX5"
                     /translation="MLVETPMSTKMNGTKTPLHDTQSQLEIYYRQVALNELKNLEATI
                     QRDRSTLSLATKASTKINPRFSNSRYHKVIDLIDMSEHCYEKSYQSYKSHHNETGVAM
                     YLKGYIILTIIIPGIGSDCSMWKNDDVELFNTLKRLYEESLNTELMRKVVNDLKIQDG
                     NMDGKVVAMNESFSADQQLDRVPKPRSLSPIKRSTANVNLSEYSSQGESQNSTQAPTF
                     KGDQAPPDYTYTVTEFQAPTDLKSRERLDTKSISSAEADTGDVLDIYQYVDTNGGGVP
                     NSPEVESTLQSPSKVTETNSSMDEFVPHIDVATLNGILFSPSVQSKKILLLDLRSSVD
                     FEKSRIRYQNIVNIEAHVLRSSTSDQQIEKLLQMTNPTFYQLFSTRDQFSTIIYFDKD
                     SKVPSNDMTRLYNMLTSLNTSKMLSDLPIFLQGGMDEWLKYYSTEPMKVFYADRKLKG
                     PRKLPESAPPPIPNTDYLKPLTQTTSYLPRAETQINSSPHRPRQNTPPKLFSHNDRTS
                     TTPFNNGDQYNHTIPQYRAKQVLHPSHALSTIPPPIDQAQVTQTRKPVYEELSICGLK
                     NFGSTCYINSMVQCLFSFGEFKKIFLTDQFTRYLTRSPTNTLALSVAGLFRSMTANGG
                     MSISPTRFLSVCNYYRPDLRIPQEQQDTQEFLMFILDKIHEELNYPSIVKLDFPHSTA
                     PQLDDKQYRKWFSELTEKEGVSPISTMFQGQLKSTLICNQCGNQSGSFTQFQILSLPI
                     PPSHHNMVAVNDCINHFIQPEVLRGDNAWSCPECEKREKRRKEEMSQMNNSVFNDEEK
                     KRSRKLFKMLGSKEKHSPNSNHSKANLVKTSQKALSFISLPQYLVIHLSRFNGFSPQA
                     CKLDVTIAYPLILEIPIHKEDGSMNVARYKLCSLINHFGSLKSGHYTAVVNKSGHLHN
                     PYWCYFDDESVRPGISHGDLNLGINMLSSRDVYVLFYERIA"
     gene            <621975..>623366
                     /locus_tag="PAS_chr1-1_0041"
                     /db_xref="GeneID:8197558"
     mRNA            <621975..>623366
                     /locus_tag="PAS_chr1-1_0041"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489635.1"
                     /db_xref="GeneID:8197558"
     CDS             621975..623366
                     /locus_tag="PAS_chr1-1_0041"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489680.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0041"
                     /db_xref="EnsemblGenomes-Tr:CAY67399"
                     /db_xref="GeneID:8197558"
                     /db_xref="GOA:C4QVX6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR018527"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /translation="MEEVCSICLEVLVDKEAFTEPCLHYYHNECIKEWTKRANTCPKC
                     RRDYSQIRIGEEVISVKNRSLELHLVDETLEETRERLISYTNLCALCEDPSTSLIYCE
                     SCGGSFHFNCIGIGDELDSEWCCPLCGMFQNHLGEASNRNLISATPVGEGRRRVTSIV
                     NTRRTNSIYRSHSNRPAQRAHLMTDSDYTMIVDQHREKLLESQLQESNTQSSGEEESW
                     KLLDEALKSGTQNSQSSEFSTENNVVPLKNTHELGRKLKKPRRASGIKKNVVERSSSH
                     QSTQILKPSSSLISDLLLETRGNSRHPSFTNSTQKLTVEALQSHDPTLKLNIPKTETL
                     SLDQKIVIQKLFIKPRLRNLYDSNTLSKDNYIEINKIICRRLYDKFLQDQLALAYLKQ
                     VLEVKERLHGHDLKQFLAQFTHWSELNDFTDDKWQKQETEGSCNHKQTQILSMFDSII
                     DTMLQNELHKLLT"
     gene            complement(<623383..>625512)
                     /locus_tag="PAS_chr1-1_0042"
                     /db_xref="GeneID:8197559"
     mRNA            complement(<623383..>625512)
                     /locus_tag="PAS_chr1-1_0042"
                     /product="Multistep regulator of cAMP-PKA signaling"
                     /transcript_id="XM_002489636.1"
                     /db_xref="GeneID:8197559"
     CDS             complement(623383..625512)
                     /locus_tag="PAS_chr1-1_0042"
                     /codon_start=1
                     /product="Multistep regulator of cAMP-PKA signaling"
                     /protein_id="XP_002489681.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0042"
                     /db_xref="EnsemblGenomes-Tr:CAY67400"
                     /db_xref="GeneID:8197559"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:C4QVX7"
                     /translation="MFGEVGSFLTPIKKQLTYVNADSGTNYRKTTSFPVFEEGDTFNE
                     YIRKHKTWTAEKLYQAEEPTQPQLPLQEVTGSLQFLSYLYIPSILGECLPVCLIYHSS
                     VNVGGTIYYFGGLRLMTDEERDEYIEDITNNYLVALSHVSVDFNYDLPLPLNGQILKS
                     LFLVPNEDVYAYDTITKTYYKKQLQETYRLDGLGTSMKAELAKTANCTATSGGSLLFR
                     SEMLPPLCCPVTNSLSDRYVIIAGGFEILTQVNKKRSHVQVTKTMKVHDSIWIFDSLA
                     CIFRKHNMVLHPTVSLNVPDSYPRFGHQMVVHKYSTSSDPKYFKSFSDRRTDKQQCII
                     YAMGGYNMDSNNRFIASNDLWRLDMIDLWKGKNGFIVYSKDIVAYPIGGLETVINVTN
                     KSQCTTSSCWPSPRAFFGFAMVDNQDMLESDKSSDPSTCESSVTPRAGTPSPQDDTSS
                     ITLPTQFKSILERKLLVVHGGSRIVYKTVKTNDAAGSDGVETFQKHEILGDFWCFNMA
                     EEKWIPIDTYLQSTNNETPMAISPTLIPRCGHSLIYLAGSLMIAGGVHMFSSPSKSFV
                     FSNDDGDILPNQESMFESEEWKRIFKAENVYLDNLSTSSFPYRFFQLNLKTQVWKISP
                     IFIPLSLQSKGIVTTIGSTYTKVNSVIYVSGGEMRLLDVDISRKWLQNFDQGLYGGKA
                     NSSAISMNGCVLALTIPLSASDQFDSN"
     gene            <625745..>627434
                     /locus_tag="PAS_chr1-1_0043"
                     /db_xref="GeneID:8197560"
     mRNA            join(<625745..626183,626317..>627434)
                     /locus_tag="PAS_chr1-1_0043"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489637.1"
                     /db_xref="GeneID:8197560"
     CDS             join(625745..626183,626317..627434)
                     /locus_tag="PAS_chr1-1_0043"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489682.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0043"
                     /db_xref="EnsemblGenomes-Tr:CAY67401"
                     /db_xref="GeneID:8197560"
                     /db_xref="InterPro:IPR024319"
                     /db_xref="UniProtKB/TrEMBL:C4QVX8"
                     /translation="MRRQLCPNQGSSYKYFVIRKHGWGLSGLRRVSSVVGSTQIDEYF
                     LKEHTTRDANVQARPFKVAHLQKWELSDVINKSFGKPIGQVTTEVDPTTDDNVQKAVQ
                     FIRDLVTQKKYPELLQALLDIGDKMDVLKPGISVVEMSRILDNLYMLLSSRLLNEVGA
                     YSALRLIVANHEYKQAYDMLEKIESEISKGFLVWTVDLLNTKLALFTDALPYRWSFGQ
                     ESNRHLLRDKCLVSFISRSPKKLDSIENITSLLQENDITPTLETHNILLRSIAAMRNP
                     EMLQTYIRSIWGISLNEEHKPVDIRSHFYPDLHTLKAIVESSTLNGEFMMSLDYVNHF
                     LTSYPDMSIGRNMSFWTSLFKCAEIHSQESLVTLADGKIQVNRLFDDLWDLMNSFSRP
                     NFSLYLQRINFLHKQGRINNLKQLLVELHAKAISTKFGFNSEAHRRSIILLTTALNKL
                     SRKMISMGFYEQVLDLVKSFSISTAMEKESLEYVENLQEKYVVSMLRKRKAEVETMKN
                     YNSDDDDGMW"
     gene            complement(<627501..>628502)
                     /locus_tag="PAS_chr1-1_0044"
                     /db_xref="GeneID:8197561"
     mRNA            complement(<627501..>628502)
                     /locus_tag="PAS_chr1-1_0044"
                     /product="ER membrane protein,N-acetylglucosaminyl
                     phosphatidylinositol de-N-acetylase"
                     /transcript_id="XM_002489638.1"
                     /db_xref="GeneID:8197561"
     CDS             complement(627501..628502)
                     /locus_tag="PAS_chr1-1_0044"
                     /codon_start=1
                     /product="ER membrane protein,N-acetylglucosaminyl
                     phosphatidylinositol de-N-acetylase"
                     /protein_id="XP_002489683.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0044"
                     /db_xref="EnsemblGenomes-Tr:CAY67402"
                     /db_xref="GeneID:8197561"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="InterPro:IPR024078"
                     /db_xref="UniProtKB/TrEMBL:C4QVX9"
                     /translation="MLAAIKVLIFLYGIWLLLSSVIPSFERNPLLKLDDYHGVLGSDH
                     QALQYQLLNTSRYNLNSEAVVANGLVNTDVYLVIAHPDDEVMFFTPVVTELAKELYFN
                     KLHIFCFSNGNSEGLGQTRHNELLRSAEVIGIDKENVQILDKPQFRDSMDQIWETEDI
                     VKELENSIQPRKLDFFNLIRTGKAAHKISIITFDDLGVSKHPNHKSLYHGCVEFVKKR
                     QETQSIDLFVLRTQGMIPKYSATLLSIFGILKKRLDFAAEWLETKDLKVISDFCSTLR
                     QYNSIPDDTRLSIFGDITTLITALHSMNVAHDSQMVWFRWLWMFFSSYLSYNELTRL"
     gene            complement(<628674..>632351)
                     /locus_tag="PAS_chr1-1_0045"
                     /db_xref="GeneID:8197562"
     mRNA            complement(<628674..>632351)
                     /locus_tag="PAS_chr1-1_0045"
                     /product="Largest of six subunits of the RNA polymerase
                     III transcription initiation factor complex (TFIIIC)"
                     /transcript_id="XM_002489639.1"
                     /db_xref="GeneID:8197562"
     CDS             complement(628674..632351)
                     /locus_tag="PAS_chr1-1_0045"
                     /codon_start=1
                     /product="Largest of six subunits of the RNA polymerase
                     III transcription initiation factor complex (TFIIIC)"
                     /protein_id="XP_002489684.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0045"
                     /db_xref="EnsemblGenomes-Tr:CAY67403"
                     /db_xref="GeneID:8197562"
                     /db_xref="GOA:C4QVY0"
                     /db_xref="InterPro:IPR007309"
                     /db_xref="UniProtKB/TrEMBL:C4QVY0"
                     /translation="MVSTPKEIVEYTINELCLIGSNGASLEELWTIVVQKQPELDEFF
                     KSICWSWLIEDHDFEVYLKKNELLLIKTSYKDVKNTEGLIVKASENREWLFLTGMPKF
                     ENPVTPLLFELLHAIAQSREHGIRSTDLAKKTGQDLKSFTSRFKFLKDYNLIERISLR
                     EGKTMTNFIFHSKFYDKNKLRAHDTIYLKEKKLNTMSNIVSLVKQAPNQIRGVSDIAK
                     QLGLSGPKGRAKMYRYIDVILEQGSLKQVYLSGFGSQLLKAVEYVKDLEISNVPESDI
                     EDVPDNDEGEEPDDEGEPGAIEEEPITGSSNQLSEAKIEELMPNFTPGFSIFNCMGAA
                     IHNSGMNGLSSMQLDKMAVGEDAGRIMGRLSAYIVKTENQLRKGFKNGDLECVRVIDF
                     SGKMKFNKFYTASNLMKMKNLDPIPYGDEFSSLPEYLLKDKTLTQVSCAHFKDPSSAL
                     DIVTCKDGVRRLHWQGYPGTFLLGNKLPKEKRDYSLVTDNTATPVIEVPSLTKKGRPK
                     KGVLKVTKTSPLSQSETAEPETEPEPESEQFTEQTTRTSNFNINFDLLNKNTPFSEKI
                     LGLFDNPLTLAYRRRQGILDLLRKSDGAALLDVSFVHQLDKRISNTTASSDRRTIIRD
                     FEFLTKEGEAILESFEMECNNGRRKRKLLMLDLKNKPTPQAIEKAKLQAERVSYSMPS
                     GDLSVTEKDITFHFPFIRNRASKIKPEPVTSSESNALRSHESDNSTRVKILNEPPLRV
                     SRSKKRAEPENGNQIEKFVRKTKRRKKLSETENKSKHELQARRTRRLINLDKNIGLVL
                     LRAVIISKSLSQNGLFPLWDKIAKLFDDKASTQVLKRSWDRLRKLVGSKTIQRMTNIW
                     KKILISAIKDRRVTRDTVLNHDLRRFVELWRESDGVSFGHITSLYEDIEENYNEFEFV
                     KDPETEDPLFFFKSSISFVERENFVKGLSFGVPIDVNGDKIESKQVEDESSSIEKLKS
                     TLKAIFATPKEDFSSTIANNITSKYSESMIHEALTSLEKDRQIVFLGTDAPVKFALSE
                     KVISSMTSKLPYSFFQDSVEFVNVLSNLFKNQQGMLLSPITPDYTIPVILSFMIKKNI
                     HVIRVDNSIDNLFTGYTSRTIDRKKLESDFIITPGSRSLEAMKPRHVPVPVDVPCSML
                     WIGVNGNINTKIWTNLVCSIVSNVEKRPGVVLDIIHEPLRPCITKRELKLILDWLVAK
                     GIFREGLDNGYWATERWNIGI"
     gene            complement(<632519..>633376)
                     /locus_tag="PAS_chr1-1_0046"
                     /db_xref="GeneID:8197563"
     mRNA            complement(<632519..>633376)
                     /locus_tag="PAS_chr1-1_0046"
                     /product="Component of the SSU processome, which is
                     required for pre-18S rRNA processing"
                     /transcript_id="XM_002489640.1"
                     /db_xref="GeneID:8197563"
     CDS             complement(632519..633376)
                     /locus_tag="PAS_chr1-1_0046"
                     /codon_start=1
                     /product="Component of the SSU processome, which is
                     required for pre-18S rRNA processing"
                     /protein_id="XP_002489685.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0046"
                     /db_xref="EnsemblGenomes-Tr:CAY67404"
                     /db_xref="GeneID:8197563"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:C4QVY1"
                     /translation="MLRRQARERREYLFRKALELQEAQKTQRREQLKQALATGKPLAK
                     EVADDTQLHKDFAYDESIQDEVDDEYSALSGVIDPKVVVTTSRDPSSKLQQFSKEIRL
                     LFPTSVRINRGNYVMPNLVESCKGSAVNDLVVLHEHRGVPTTLTISHLPHGPTAIFTL
                     HNVVLRHDINDTSNQSEAYPHLIFENFSSKLGKRVETVLKHLFPPGVKKDSPRVISFI
                     NKDDFISVRQHVYVRTRDGVELSEVGPRFEMRLFELRLGTLDNKDADTEWQLRRFVRT
                     ANRKNYLAD"
     gene            complement(<633504..>635126)
                     /locus_tag="PAS_chr1-1_0047"
                     /db_xref="GeneID:8197564"
     mRNA            complement(<633504..>635126)
                     /locus_tag="PAS_chr1-1_0047"
                     /product="Mitochondrial lysine-tRNA synthetase"
                     /transcript_id="XM_002489641.1"
                     /db_xref="GeneID:8197564"
     CDS             complement(633504..635126)
                     /locus_tag="PAS_chr1-1_0047"
                     /codon_start=1
                     /product="Mitochondrial lysine-tRNA synthetase"
                     /protein_id="XP_002489686.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0047"
                     /db_xref="EnsemblGenomes-Tr:CAY67405"
                     /db_xref="GeneID:8197564"
                     /db_xref="GOA:C4QVY2"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:C4QVY2"
                     /translation="MFANLVYRRTSLVVTPSIRIRSYISITTETEFANRKARVQENHE
                     FYYPLVNDLRYGNGVQTLRIPEFRKKFEYYQFPNSSKKIDTLFSVCGKISSIRRAGKG
                     MIFMDIIQDFTKLQLVIHHKMLNLNKEEFSNIHSEFRIGDHVSVIGFPGKTDVGELSL
                     KANQRVKLAAPALHPLPPKLTDTAKINSLRVVDYLVNRKSQEIILARSKIISTIRKFL
                     EDRQFVEVSTPIIANSGTGANATPFVTSSEHIKNDMLQPEPLQLRVAPELWLKKLIIS
                     GFDKVFEIGKVFRNEGIDSTHNPEFSTCEFYQTFTSLEELMNLTTDLFRSISTELLNA
                     ESLKLTHIQAKALQHEEFETLEFIPAIEEATGKKLPENLGVAELENYFKSINLEFPKV
                     KSPAQFLDTLSSEYLEPQCAKPTFIYHQPAILSPLAKSTSIKYGDRQYDISRRFELFI
                     NGNEYVNAYEEENDPFSQNEKFKLQTRSKEKHQDEEALVPDYKYVTMMEWGMPPTGGW
                     GIGIDRLTMLLTDSARVENVLTFGKLNDVLKH"
     gene            <635291..>637595
                     /locus_tag="PAS_chr1-1_0048"
                     /db_xref="GeneID:8197565"
     mRNA            join(<635291..635293,635364..>637595)
                     /locus_tag="PAS_chr1-1_0048"
                     /product="GTPase-activating protein"
                     /transcript_id="XM_002489642.1"
                     /db_xref="GeneID:8197565"
     CDS             join(635291..635293,635364..637595)
                     /locus_tag="PAS_chr1-1_0048"
                     /codon_start=1
                     /product="GTPase-activating protein"
                     /protein_id="XP_002489687.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0048"
                     /db_xref="EnsemblGenomes-Tr:CAY67406"
                     /db_xref="GeneID:8197565"
                     /db_xref="GOA:C4QVY3"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C4QVY3"
                     /translation="MDQDAFETIEDIDGVRFTWNAFPRTKIEAARCCVPIACIYTPLK
                     QRENLAIIQEDPMICRACKAIFNPFVTVQAQHWICSFCATLNVLLPHYQNQIPYQASG
                     DCTTIEYVLSKRVSSPPAYVYLVDTSLEAQELESLKESILNSFQLLPKYALVSLITFG
                     RNVNVHELEDGLAHNYYTFNGSKTYDLTSIQRSLGLLSRDLRRKDASESVGGRFLKPL
                     GVCEFSLSEVVQSLKPDVWPKGKFQRSLRATGAALDVALHFMDTCLGKTGAHLMLFAG
                     GPCTLGPGIVVGSELKEPIRSHYEIQNGSAKHYKKSLKHYAALAKRATSQCHSVDVFA
                     ASYDQIGLSEMELLVDQTGGALVLTDAFSTAIFKQSFQRFLQLPMGINGTLEVKTSFD
                     LKINGLVGHAISLERKAKNVSDTEIGRGKTDAWKLCNLLPQSSFGIYFEMPATNSSQT
                     TTKPRSLIQFITYYQEIGGTLRLKVTTLAKPILQQSQESLIAEYFDQEAAVVLISRQM
                     IDKMVKDNSTEVIRELDKILVELCKKFGSYQKNDLQSFRLGAKFSLFPQFLYHLRRSQ
                     FMQVFNNSPDETTFYRHSILTEDTFNSLIMIQPTLTAYEINQEPQPIFLDSMSITADR
                     ILLLDTFFQIVIYHGETIVQWREAKYQEQEEFAYLKDFFQLPREDAADLLIDRFPLPR
                     FIDCDAGGSQARFLLSKVNPTTSYKDNQMASASQSGGAIVGSDDVSLQSFMEHVQMVV
                     VKSV"
     gene            <637787..>638731
                     /locus_tag="PAS_chr1-1_0049"
                     /db_xref="GeneID:8197566"
     mRNA            <637787..>638731
                     /locus_tag="PAS_chr1-1_0049"
                     /product="Ribonuclease H2 catalytic subunit, removes RNA
                     primers during Okazaki fragment synthesis"
                     /transcript_id="XM_002489643.1"
                     /db_xref="GeneID:8197566"
     CDS             637787..638731
                     /locus_tag="PAS_chr1-1_0049"
                     /codon_start=1
                     /product="Ribonuclease H2 catalytic subunit, removes RNA
                     primers during Okazaki fragment synthesis"
                     /protein_id="XP_002489688.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0049"
                     /db_xref="EnsemblGenomes-Tr:CAY67407"
                     /db_xref="GeneID:8197566"
                     /db_xref="GOA:C4QVY4"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR004649"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR023160"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:C4QVY4"
                     /translation="MTRIENRVCDSSPMTTTFIPPSVPEISTYRTTTYVSEIPESVLK
                     NPEKPCCLGVDEAGRGPVVGPMVYGVSYCLEEYEPRLKDFGFADSKTLTEQKRSELLE
                     SLCNGDHELRKNVGWATTSISACDISSAMLKPHNIGNYNLNEQAHDVTMELIDKVIQK
                     GVNLRHVYVDTVGPPASYQKKLQQRFPALLITVSKKADAIYPCVSSASVCAKVTRDVC
                     LRTSNGEENLLDCGSGYPSDPNTKKWLAQSIHPLFGWSRDVRFSWQTAKDCLERHNSI
                     KVVFGEEEPTPVNFGDLGLSKQKTDFKDLEISTSWWGH"
     gene            <639010..>640492
                     /locus_tag="PAS_chr1-1_0050"
                     /db_xref="GeneID:8197567"
     mRNA            join(<639010..639059,639121..>640492)
                     /locus_tag="PAS_chr1-1_0050"
                     /product="Dihydrolipoamide acetyltransferase component
                     (E2) of pyruvate dehydrogenase complex"
                     /transcript_id="XM_002489644.1"
                     /db_xref="GeneID:8197567"
     CDS             join(639010..639059,639121..640492)
                     /locus_tag="PAS_chr1-1_0050"
                     /codon_start=1
                     /product="Dihydrolipoamide acetyltransferase component
                     (E2) of pyruvate dehydrogenase complex"
                     /protein_id="XP_002489689.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0050"
                     /db_xref="EnsemblGenomes-Tr:CAY67408"
                     /db_xref="GeneID:8197567"
                     /db_xref="GOA:C4QVY5"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR006257"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:C4QVY5"
                     /translation="MSALTALRVTRPLLRFPAARVSLNLFARGYASKSWPEHTVIDMP
                     ALSPTMTQGNIVKWHKAVGDQLEPGESIAEVETDKASMDFEFQEDGYLAKILLGDGTQ
                     EIPVGKPIAVYVEDKADVEAFESFTIEDAGAPAAAAALAKEEPKEEPKEAATPAPSSE
                     ESKSEAKPSSSKQPRPAGSRIIASPLAKTIALEKGISLKEITGTGPNGRIVAKDVESY
                     KPKSTAAPAAPVSSPAPSTATAAYQDIPLTNMRKVISKRLTESKQSAPNYIISSSISV
                     SKLLKLRASLNASSNDRYKISVNDLLIKAIAVACKRVPEANAYYLEQEGVIRQFENVD
                     VSVAVATPTGLITPIVFNADSKGLETISKTVKDLGKRAKENKLKPEEFQGGTITISNL
                     GMNPSVSFFTSILNPPQSAIIAIGTTEKKAVPDKGSPHGFVFDDVIQITGTFDHRTVD
                     GAKGGEWVRALKQIVENPLELLL"
     gene            <640982..>642793
                     /locus_tag="PAS_chr1-1_0051"
                     /db_xref="GeneID:8197568"
     mRNA            <640982..>642793
                     /locus_tag="PAS_chr1-1_0051"
                     /product="Nonessential putative protein kinase of unknown
                     cellular role"
                     /transcript_id="XM_002489645.1"
                     /db_xref="GeneID:8197568"
     CDS             640982..642793
                     /locus_tag="PAS_chr1-1_0051"
                     /codon_start=1
                     /product="Nonessential putative protein kinase of unknown
                     cellular role"
                     /protein_id="XP_002489690.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0051"
                     /db_xref="EnsemblGenomes-Tr:CAY67409"
                     /db_xref="GeneID:8197568"
                     /db_xref="GOA:C4QVY6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4QVY6"
                     /translation="MVMLHLNRKRVRRLNKVPSGSTVPNTKSFTRNDDSDAIILSDSD
                     DHDLLNPFSDYSQIADHNDSNIFGDERMLQEDGMLHDLLFPQEQKKNRTYSLPQLPHC
                     KLSYTPTKPNITELVIKEKIKSVLPEKIPHLSKQSEDLLNYTFDSDTQLNGVRKLSID
                     SGHAQNPKKRTFSNVSQSSRNAIVIDVESSDGETEDECDDKNGHYIVKPNSFFANNRF
                     LIKKQIGQGTFGKVVSAYDYKLKQTVAIKIIKAVPKYREAAKVELRVLSTLRKYDPNN
                     NNHCIQIKECFDFRNHICIVTDLLRISLYDFMKSNQMLPFPGSHVQAICRQLLRSVAY
                     LHDLNLIHTDLKPENILLLDDSYHRKSLSESHLIANNPNLSRFSYEKQHVKILQDPSI
                     EIIDFGSAVFEDEFHPNMVSTRHYRAPEIVLGLGWSFPCDMWSVGCLLVELVTGDVFF
                     NSHEDREHLALMEKVFQKPVDSFMCHKYLQQYLRDSSKKPGSQLIHSNHKVNFPNSES
                     STKSINMVRNAKPMEQTIIEKVPVISQLDMTKSLASNFEIYDINDEDLRDQYTFWYSF
                     IDLVSKLLQFNPQDRISAKQALEHEWFKLGVLDDGTL"
     gene            <643162..>644382
                     /locus_tag="PAS_chr1-1_0052"
                     /db_xref="GeneID:8197569"
     mRNA            <643162..>644382
                     /locus_tag="PAS_chr1-1_0052"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489646.1"
                     /db_xref="GeneID:8197569"
     CDS             643162..644382
                     /locus_tag="PAS_chr1-1_0052"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489691.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0052"
                     /db_xref="EnsemblGenomes-Tr:CAY67410"
                     /db_xref="GeneID:8197569"
                     /db_xref="UniProtKB/TrEMBL:C4QVY7"
                     /translation="MLFKDKIQPKGDFDEIPGYYPGKAVNGHRKLFKRDHMGRMGILP
                     SLFLGLISLFFDIQTLETLILVIWLLGLWMPFFVHMLIILTLQHYSMVVKEILFFPVL
                     LFTFLYNRMAKRLNRRIYFKRKEIASEYHMNDPDLARFVELDFYEELDSQVLKELFWN
                     NQMIGVSSDFRRLKYPHELKRTSLEVKKMCSEDIPLKNSSELNIKAKRKSKRRESEKE
                     NLGANDPRYKIRIANDVTPKRSSSPLRIRRNLSTLINRENLTSNEVNSDSSVESIDST
                     ISVLGTSSPTRSKSFNWRKVTDHVPTPGRTPGRWKTYSGSPRKRDLFQNSVKGSSKFP
                     SKQQEINSYKKLLTNGVRLTTGTAGAKIGSEASSILKQSASSLVNGGTEMVAGLGSHA
                     VKLTASSVSSLVKP"
     gene            complement(<644709..>648005)
                     /locus_tag="PAS_chr1-1_0053"
                     /db_xref="GeneID:8197570"
     mRNA            complement(<644709..>648005)
                     /locus_tag="PAS_chr1-1_0053"
                     /product="Translation initiation factor eIF4G, subunit of
                     the mRNA cap-binding protein complex (eIF4F)"
                     /transcript_id="XM_002489647.1"
                     /db_xref="GeneID:8197570"
     CDS             complement(644709..648005)
                     /locus_tag="PAS_chr1-1_0053"
                     /codon_start=1
                     /product="Translation initiation factor eIF4G, subunit of
                     the mRNA cap-binding protein complex (eIF4F)"
                     /protein_id="XP_002489692.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0053"
                     /db_xref="EnsemblGenomes-Tr:CAY67411"
                     /db_xref="GeneID:8197570"
                     /db_xref="GOA:C4QVY8"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022745"
                     /db_xref="UniProtKB/TrEMBL:C4QVY8"
                     /translation="MSNKNVDTAPDNGSGGSNSPASVPHYPQQHRANYNPHKNHTNHG
                     GNNGGAQGYMQHQQQQQMYYNQMGYPMPYPNAGGNFNQNVYLVPYNTMVPGTPYGAGA
                     PGVPPSYPVSPSPAFASPQKTHVPVSLRTPSGEPINLVPAGQTSSSSSNASPHVKSTS
                     IPPSAVTSPAASIAPTVASPTKAAAGSEDAGKTRDAFKQMVQALAAKKKAAAAAKAEG
                     KTDDKKESVESKPKSAVQPETKPKVEVKLEPKPKVEVKLEPKPKVEIKLEPKPVSEAK
                     PETKTVPEVEEPSTVATIKSESTPIEELKPKVEVTPEVASKPEQVESAQEPANDVKPS
                     EVSAKEVQESKEESLKQPKEALNDIKSTEESNKKFSLPEEESNDHQTLSQIQGVKDTE
                     QSQEFEEPQGTQETQETQETQETAKPLEAQAPQEIQETQEPEEVQEQTPETSETVSSV
                     TEEVSPAPAPGLPLSKFLDRIRKAPAISNPFKHEYSGDFHGPDESLSGLKTIKYDPGF
                     LIQFATFNFHIDEDFINDVGSKVVIPVNTRRDNFSKSMSTSNFKGSGRNMGSNFRNDF
                     GSRNNSKQGSKKKNKSQKSQSRRGPKYSNEEEPAEPAVPAELPNRAASKWVPRSLRNK
                     EAEVKTAPDGSIIVSEEDIKRKTKSLLNKLTLEFFDDISNDIIALTKQAQWEDDVKTL
                     KQVIESIFAKACDEPYWSSMYAKLCAKMCKDTPPEIKETNEKGNTFTGGDLVRRVLIN
                     RCQTEYQKGWIDQLPTNEDGSPLEPELMSDEYYKQAAAKRRGLGLVKFIGQLYQLNLL
                     SDNVIFHCVLGQSKETDNPSEDTMENLVQLLEAVGYRMEMSSEPKIRRVLDLAFANIK
                     AIVDANKIPSRIRFMLMDLMDLRRNGWATTEENAGPKTIQEIHLEAEIKRSEEEREKE
                     RDRHSRRGRYNDSKPNSRQKSSWGSSVVSPNDIRNAGYVRNSDKSLGPVNSFSRGKSS
                     RQASKQSNSDFTSVPITSSGSRTALNHSGDSSTSLNEPQSREYSKKSESRPAPSNIFA
                     ALEDHDHDHEHGHEQEENKHSKDLQNGEAEAPEDDNVGEIAQADENVQGQEQEEEREE
                     EREQEEEQEV"
     gene            <649007..>650201
                     /locus_tag="PAS_chr1-1_0054"
                     /db_xref="GeneID:8197571"
     mRNA            join(<649007..649028,649066..>650201)
                     /locus_tag="PAS_chr1-1_0054"
                     /product="One of six ATPases of the 19S regulatory
                     particle of the 26S proteasome involved in the
                     degradation"
                     /transcript_id="XM_002489648.1"
                     /db_xref="GeneID:8197571"
     CDS             join(649007..649028,649066..650201)
                     /locus_tag="PAS_chr1-1_0054"
                     /codon_start=1
                     /product="One of six ATPases of the 19S regulatory
                     particle of the 26S proteasome involved in the
                     degradation"
                     /protein_id="XP_002489693.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0054"
                     /db_xref="EnsemblGenomes-Tr:CAY67412"
                     /db_xref="GeneID:8197571"
                     /db_xref="GOA:C4QVY9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QVY9"
                     /translation="MSAMTHQDTEIQIAAKTQNLRRLEAQRNSLNSKVRALKDELKLL
                     QEPGSYVGEVVKVMGKKKVLVKIHPEGKYIVNLAPDIDIKKISPSLRVCLKSDTYELH
                     QILPNKVDPLVSLMMVEKVPDSTYDMVGGLDQQIKEIKEVIELPVKHPELFESLGIAQ
                     PKGVILYGPPGTGKTLLARAVAHHTECKFIRVSGSELVQKYIGEGSRMVRELFIMARE
                     HAPSIIFMDEIDSIGSSRVESSSGGGDSEVQRTMLELLNQLDGFESSKDIKIIMATNR
                     LDILDPALLRPGRIDRKIEFPPPTIAARTDILKIHSRSMNLTRGIDLKKIAEKMNGCS
                     GADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMSKNDEGAVSLAKLFK"
     gene            complement(<650226..>652259)
                     /locus_tag="PAS_chr1-1_0055"
                     /db_xref="GeneID:8197572"
     mRNA            complement(<650226..>652259)
                     /locus_tag="PAS_chr1-1_0055"
                     /product="Protein that interacts with Cdc48p and Npl4p,
                     involved in recognition of polyubiquitinated proteins"
                     /transcript_id="XM_002489649.1"
                     /db_xref="GeneID:8197572"
     CDS             complement(650226..652259)
                     /locus_tag="PAS_chr1-1_0055"
                     /codon_start=1
                     /product="Protein that interacts with Cdc48p and Npl4p,
                     involved in recognition of polyubiquitinated proteins"
                     /protein_id="XP_002489694.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0055"
                     /db_xref="EnsemblGenomes-Tr:CAY67413"
                     /db_xref="GeneID:8197572"
                     /db_xref="GOA:C4QVZ0"
                     /db_xref="InterPro:IPR004854"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4QVZ0"
                     /translation="MSEEYSIYEHLEPELLKDADGNVVKYSDRVALPPSILESLVNQQ
                     QRLSIASLPHPLIFRLQAEKSNSAVNSFVGVKEFTSQEGTILLPEFIYDKLVSPDNND
                     STINITLASDIPKGTSIALKPLELYPEIKDWKYFLEAKLIKSYTTLSTNDTVCISEKD
                     KVYKLLVEQAEPTSAICLIDTDIDLSIVPLDDEMAREMSNQQDTETVLQYGTNAVTIA
                     DTEHSHAYKLQLDNSNDLCLSLSINSQDVNLVDLLISNNQFISKDSLQWSTIPFNENS
                     NINKNDGTISICIPKTDHWIEGKEFVYILPIVWSEGESFKSQLSISRIAEAHVTTSSL
                     QETLKADEAKCSNCGKHVPKQSISLHENFCHRNNIKCSCGQLFLKKIPDTHWHCQNDA
                     YFGATIEGRDIHQKLHHTEYECSLCSTTLPNYIQLALHKSTECPERLHICRYCQLTVP
                     QEVPSAEAMLSSMTQHEYQCGSKTTECHQCSKIVRQRDLQTHMQLHELDRKQQVAPIV
                     CANVNCCRILNEPTDLQLCSVCFGPLYSTDYDPNYVKLKNRLERKYILQLTRGCGTSW
                     CKNVECISSGINPSLKTTTLKEKISHISNDLLTSVPLINQNVVTAKYYLCVDNLVTKR
                     KFMADMIYEQGQYEYGWICEAVSKLSFDENGSEMGQVSSMEQWLHKHAVKVGE"
     gene            <652629..>654872
                     /locus_tag="PAS_chr1-1_0056"
                     /db_xref="GeneID:8197573"
     mRNA            <652629..>654872
                     /locus_tag="PAS_chr1-1_0056"
                     /product="Zinc-regulated transcription factor, binds to
                     zinc-responsive promoter elements"
                     /transcript_id="XM_002489650.1"
                     /db_xref="GeneID:8197573"
     CDS             652629..654872
                     /locus_tag="PAS_chr1-1_0056"
                     /codon_start=1
                     /product="Zinc-regulated transcription factor, binds to
                     zinc-responsive promoter elements"
                     /protein_id="XP_002489695.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0056"
                     /db_xref="EnsemblGenomes-Tr:CAY67414"
                     /db_xref="GeneID:8197573"
                     /db_xref="GOA:C4QVZ1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4QVZ1"
                     /translation="MKSPTTDPETHSHDQKPILHNQIRGYIHTIDNAHSHIHGHVHQH
                     IHHPNGPIVSERIQPILDPVHNDKSRSHIYPGNLCPTDSAKHQDEEILPISNSALLHL
                     MSKTKSESSGSASVWNLLDPKADFDSCDKCDPLKDISCPDPFVCADKGCSIGQNTLEF
                     QSTNSDAFLRCCFDSSHNEDENPYNGDSDYNGAVTSHAALCDLSAFSTCNDIEGFWKN
                     ENPALLNSNSVDSSSQIPCPKYSDCDLIQPSNNYESSPHDSTGTVSLSSNTPVSACST
                     GCVTLDKNVYPDMSFMVNSSKISDLREKRPHVESRDFSFKMQQQKRVKVEQDGTKPVY
                     WNDMDHLNPVNKQNHHHHLHQFQEFCVDWAKYGCGCPYNLENQSKQDKKMHLHYPPHQ
                     HGCNHYDTQFPTSGDPSEVQNQSVSDSLVCQWSDCKVDAFKDDVHLQNHVFSSHLLPW
                     VKDRGVDPSEINLDTLTIENFQNMDNFACKWKDCDFNSSDLESLLNHIPKNHFSEQTK
                     IVEEPVPKQETIDALPDIEENVCQWEMENNQICNLKFSNTTDLTDHITEDHVGSRKSK
                     YVCNWKGCTRNHKEFTQRQKVLRHLPVHTKHKPYKCDICGKAFSIDLMLEQHIRTHTG
                     EKPFKCSKCGKTFKTSSSLSIHLRIHTGERPLVCKYPGCGKTFNESSNLTKHHRTHQK
                     EFKCSFCCKTFNQLKQLESHERLYHGDQTRFDCDCCDEHRNKTLMSSTRKNFPITSGT
                     TNEMAFT"
     gene            <655205..>656683
                     /locus_tag="PAS_chr1-1_0057"
                     /db_xref="GeneID:8197574"
     mRNA            <655205..>656683
                     /locus_tag="PAS_chr1-1_0057"
                     /product="Putative protein serine/threonine kinase
                     expressed at the end of meiosis"
                     /transcript_id="XM_002489651.1"
                     /db_xref="GeneID:8197574"
     CDS             655205..656683
                     /locus_tag="PAS_chr1-1_0057"
                     /codon_start=1
                     /product="Putative protein serine/threonine kinase
                     expressed at the end of meiosis"
                     /protein_id="XP_002489696.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0057"
                     /db_xref="EnsemblGenomes-Tr:CAY67415"
                     /db_xref="GeneID:8197574"
                     /db_xref="GOA:C4QVZ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4QVZ2"
                     /translation="MREFNADQFELFERLGKGAFGVVYHGFDKVTNMHVAIKQIDLES
                     TDDSIEEIQNEITLLSNCSHPNIIQYHGSFVKGYKLWIVMEYLDGGSCNDLLEAGPFD
                     ETEISVICYNLLQGLAYLHKSGKIHRDIKAANIMIGRLGQVKIGDFGVATQLTNTLSR
                     RHTFVGTPNWMSPEVILRKDYDFRADIWSLGITLLEMAYGKPPLSQYSTYEILFMIPK
                     NQPPSLSSDFSEEFRNFVHQCLQKSPADRPSTGQLLKHRFIAKGRNVDQSCLQKLIDR
                     KIKHDLETGSKVTKYYKPTVNQSDDPQSVQFDLDTVNEGVVKFNLNSTSDEQGELKIQ
                     FPVDHDQFETIKDLSRAQSYDSSVVRDDVSSISSQKSTSEHELNIILNQSFNKITTKY
                     SLTTNQYDKLVHFKSHLLGKSLNSIAHNQDEQICRVFYKDITKNIMKSNNERLKQKLL
                     PHHYKTVERENTLLKKTYQYDRKRDRVEELLLARWAENITKS"
     gene            complement(<656720..>658222)
                     /locus_tag="PAS_chr1-1_0058"
                     /db_xref="GeneID:8197575"
     mRNA            complement(<656720..>658222)
                     /locus_tag="PAS_chr1-1_0058"
                     /product="GTPase that associates with nuclear 60S
                     pre-ribosomes, required for export of 60S ribosomal
                     subunits"
                     /transcript_id="XM_002489652.1"
                     /db_xref="GeneID:8197575"
     CDS             complement(656720..658222)
                     /locus_tag="PAS_chr1-1_0058"
                     /codon_start=1
                     /product="GTPase that associates with nuclear 60S
                     pre-ribosomes, required for export of 60S ribosomal
                     subunits"
                     /protein_id="XP_002489697.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0058"
                     /db_xref="EnsemblGenomes-Tr:CAY67416"
                     /db_xref="GeneID:8197575"
                     /db_xref="GOA:C4QVZ3"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR014813"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QVZ3"
                     /translation="MRVTKRASKRRSTRMREGLKKKVAAHGRKQRKLEKKDPTWKSRV
                     RKDPGIPASFPYKEAILAEIEQKRREDEEEKLALKEKRRAEAAAARSALPDDENLMDD
                     ESDEDNDGANGLAALLQSAQQAAKAYDGTESNDEMEEDDLEVNEYEIDFEEDERLGNE
                     WEKSRKAFDKIFKTVVEASDVILYVLDARDPEGTRSKKIEEAILQSQGKRLIFVLNKI
                     DLVPDNVLKMWLDFLQSSFPTVPLKANGAASTTFNKKMTQAVTSKQLLESLKSYAHKS
                     NLKRAIIVGVVGYPNVGKSSIINALTSRHGGNGKACPVGNQAGVTTSMREVKVDNKLK
                     ILDSPGIVFPSSKKSSKESMEAKLALLSAIPSKQIKDPEAAIQLLLKRLAKNTEMADG
                     FKKYYDIPPLVSSDLESFTKGVLIHIARKQGKLGKGGIPKLNDAALVILNDWRDGKIV
                     GWTLPNSSKAAQVTDNEVSSKVPPLTPSSEQTTIVKEWAKEFDLDGLLNI"
     gene            <658387..>659415
                     /locus_tag="PAS_chr1-1_0059"
                     /db_xref="GeneID:8197576"
     mRNA            <658387..>659415
                     /locus_tag="PAS_chr1-1_0059"
                     /product="Transcription factor TFIIB, a general
                     transcription factor"
                     /transcript_id="XM_002489653.1"
                     /db_xref="GeneID:8197576"
     CDS             658387..659415
                     /locus_tag="PAS_chr1-1_0059"
                     /codon_start=1
                     /product="Transcription factor TFIIB, a general
                     transcription factor"
                     /protein_id="XP_002489698.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0059"
                     /db_xref="EnsemblGenomes-Tr:CAY67417"
                     /db_xref="GeneID:8197576"
                     /db_xref="GOA:C4QVZ4"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR013150"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR023486"
                     /db_xref="UniProtKB/TrEMBL:C4QVZ4"
                     /translation="MTALTEEGSFKGPDLNVALICRDCKVDPPELIERFSEGDVICGL
                     CGLVLSEHIVDMRSEWRTFNNDDQNGDDPSRVGEAQNPLLDGDQLSTIIAYNTDNTRM
                     GRELSRAQNSTVADRKDSALQAAFAKISQLCEGFQLPNIVQNGAKEVYKLVYNERSLK
                     GKSQESIMAAAIGLACRKANVPRSFKELWALTDVPKNEIGKVFKIIHKLIQQKHALAG
                     GLLNVQNESIATTQTNAEALIGRFCSNLGLSRQITNAAEYIARRTKEVGVLAGRSPVT
                     VAATVIYMAASIFDASISPAQIAQRAGVSDGTIKTSYKYLYDKREELVDPQWIESGKV
                     KLENIPKN"
     gene            complement(<659502..>659846)
                     /locus_tag="PAS_chr1-1_0060"
                     /db_xref="GeneID:8197577"
     mRNA            complement(<659502..>659846)
                     /locus_tag="PAS_chr1-1_0060"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489654.1"
                     /db_xref="GeneID:8197577"
     CDS             complement(659502..659846)
                     /locus_tag="PAS_chr1-1_0060"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489699.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0060"
                     /db_xref="EnsemblGenomes-Tr:CAY67418"
                     /db_xref="GeneID:8197577"
                     /db_xref="GOA:C4QVZ5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QVZ5"
                     /translation="MSKDFPIVLVKNLPYTTTGDDLYEVFGKYGNIMQVRLGNQADTR
                     GSGLIVFKNLKSAQTCVDKANGYNFNGRYLVVLHYMVDLSKIQDEMLEVRRKEVAKID
                     AQQRSLTDKETQ"
     gene            <660014..>661654
                     /locus_tag="PAS_chr1-1_0061"
                     /db_xref="GeneID:8197578"
     mRNA            <660014..>661654
                     /locus_tag="PAS_chr1-1_0061"
                     /product="ATP-dependent RNA helicase"
                     /transcript_id="XM_002489655.1"
                     /db_xref="GeneID:8197578"
     CDS             660014..661654
                     /locus_tag="PAS_chr1-1_0061"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_002489700.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0061"
                     /db_xref="EnsemblGenomes-Tr:CAY67419"
                     /db_xref="GeneID:8197578"
                     /db_xref="GOA:C4QVZ6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QVZ6"
                     /translation="MAKLTGTKSAKKNKITTAKKSKDMSPEVENLDSEVDGGSTSADR
                     KREHQSEDDENSKAQASGSEAVEEIDDVKSSKDYSSTVYENFTDLKLSEPTLKAIGNM
                     GFTKMTAVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIEMLYSLKFKPRNGTGAI
                     VITPTRELALQIFGVARELMESHSQTFGILIGGANRRAEAEKLMKGVNIIIATPGRLL
                     DHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIKILPNENRQTMLFSATQTTK
                     VEDLARVSLRKGPLYINVDSENETSTVDGLEQGYVVCDSDKRFLLLFSFLKRNQKKKI
                     IVFLSSCNSVKYYSELLNYIDLPVLDLHGKQKQQKRTNTFFEFCNATQGVLICTDVAA
                     RGLDIPSVDWIIQFDPPDDPRDYIHRVGRTARGSNGKGKSLMFLIPSELGFLRYLKAA
                     KVPLNEFEFPTNKIANVQSQLEKLIKSNYWLNQSARDGYTAYLQAYASHHLKTVYQID
                     KLDLNKVAQSFGFSVPPRVNITIGSSGKSSKPKKQRRN"
     gene            <661847..>662602
                     /locus_tag="PAS_chr1-1_0062"
                     /db_xref="GeneID:8197660"
     mRNA            <661847..>662602
                     /locus_tag="PAS_chr1-1_0062"
                     /product="GTP-cyclohydrolase I, catalyzes the first step
                     in the folic acid biosynthetic pathway"
                     /transcript_id="XM_002489656.1"
                     /db_xref="GeneID:8197660"
     CDS             661847..662602
                     /locus_tag="PAS_chr1-1_0062"
                     /codon_start=1
                     /product="GTP-cyclohydrolase I, catalyzes the first step
                     in the folic acid biosynthetic pathway"
                     /protein_id="XP_002489701.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0062"
                     /db_xref="EnsemblGenomes-Tr:CAY67420"
                     /db_xref="GeneID:8197660"
                     /db_xref="GOA:C4QVZ7"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="InterPro:IPR018234"
                     /db_xref="InterPro:IPR020602"
                     /db_xref="UniProtKB/TrEMBL:C4QVZ7"
                     /translation="MDDHKTLTQPQPQKRTGHEPFYKRLDTPLNTRPASPYTLNPPID
                     NDGLSWPSLGARNRLEATPEEAEAREKRIASAVKTILTELGEDVEREGLLETPERYAR
                     AMLFFTKGYEDNIKDVIKRAVFEEDHDEMVIVKDIDVYSLCEHHLVPFFGKVHIGYIP
                     NKKVLGLSKLARLAEMYSRRFQVQERLTKQIAMAVYEILKPRGVAVVMEATHMCMVSR
                     GVQKVGATTTTSCMLGCFRSQQKTRDEFLTLIK"
     gene            complement(<662715..>664763)
                     /locus_tag="PAS_chr1-1_0063"
                     /db_xref="GeneID:8197191"
     mRNA            complement(<662715..>664763)
                     /locus_tag="PAS_chr1-1_0063"
                     /product="Apyrase with wide substrate specificity"
                     /transcript_id="XM_002489657.1"
                     /db_xref="GeneID:8197191"
     CDS             complement(662715..664763)
                     /locus_tag="PAS_chr1-1_0063"
                     /codon_start=1
                     /product="Apyrase with wide substrate specificity"
                     /protein_id="XP_002489702.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0063"
                     /db_xref="EnsemblGenomes-Tr:CAY67421"
                     /db_xref="GeneID:8197191"
                     /db_xref="GOA:C4QVZ8"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:C4QVZ8"
                     /translation="MVQENYGIIVDSGSSGSRLQVYKWQDPNELRVNTDDESILKSVP
                     RMEQEESWPMKVSPGMSSFADDMDDLWDDHFKPLIKHAQSIIPESKHEETPIFVYATA
                     GMRLVSEKERNKMFKTVCKSIRKHSKFILNNCDDHVKLIDGETEGIYGWLGLNYLLRQ
                     FDNYYPDRHSHSSFGFMDMGGASTQIAFFPSNETEVERHSDDMFSVTLKNVNGDVQEW
                     PVFVSSWLGFGANQARKRYLKSLAKTLVDDVDYDPDGDGIIQLNDVCSPRGLKLQEKY
                     DGKVYQIQGTGDYASCMKSIYPLLLKHLPCQGYPCLFNGVHAPMIDFQRDKFVGISEY
                     WYTANDVFQMGGEYNFMLFNEKVINFCSSSWEEIERNYKENLYGENINLELLQDSCFK
                     ASWVINVLHEGFGLPRIDLDENVSEDTLESNDQEFKHIPFQSANLIEGAELSWTLGAM
                     LLFAASQINTGYSEAKQVGIKPSKTAANVAGKTFISPVPNSLFYQEDEFSGLGLHTLL
                     LFLTLFVVLFFLVYFNKVSLMRFKHNGFVDSISSIFFRTYHFLQNKSAQLYHSKIRKE
                     KNYFTEQEIDIQKAHLEEGLLSYSNARISSPNHLRTRPSLYNLQDISDINDNGKQVQN
                     SSSSPNLYKNLVSSRSNISLPNLNTYNNTIRKSSSNLTDFKKYHQLAGSFTDLSDKEV
                     "
     gene            <665542..>666084
                     /locus_tag="PAS_chr1-1_0064"
                     /db_xref="GeneID:8197192"
     mRNA            <665542..>666084
                     /locus_tag="PAS_chr1-1_0064"
                     /product="Protein of unknown function that associates with
                     ribosomes and has a putative RNA binding domain"
                     /transcript_id="XM_002489658.1"
                     /db_xref="GeneID:8197192"
     CDS             665542..666084
                     /locus_tag="PAS_chr1-1_0064"
                     /codon_start=1
                     /product="Protein of unknown function that associates with
                     ribosomes and has a putative RNA binding domain"
                     /protein_id="XP_002489703.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0064"
                     /db_xref="EnsemblGenomes-Tr:CAY67422"
                     /db_xref="GeneID:8197192"
                     /db_xref="GOA:C4QVZ9"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR016437"
                     /db_xref="UniProtKB/TrEMBL:C4QVZ9"
                     /translation="MFKKFTKEDIHSRSNIKSSQQRNLKAKWVRQFPALESVIDDIIP
                     KKSQVILIKCEDKIQLYCVDNKVVAFQQFDDLIPSLEIVHKYPDCFPKVQVDRGAIKF
                     VLSGANIMCPGLTSPGAQLPEENLEKGTIVTIYAEGKEHALAVGALEMSTDDIKSLNK
                     NVGVELFHHLGDCLWNFSFN"
     gene            complement(<666156..>666783)
                     /locus_tag="PAS_chr1-1_0468"
                     /db_xref="GeneID:8197193"
     mRNA            complement(join(<666156..666729,666779..>666783))
                     /locus_tag="PAS_chr1-1_0468"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489659.1"
                     /db_xref="GeneID:8197193"
     CDS             complement(join(666156..666729,666779..666783))
                     /locus_tag="PAS_chr1-1_0468"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489704.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0468"
                     /db_xref="EnsemblGenomes-Tr:CAY67423"
                     /db_xref="GeneID:8197193"
                     /db_xref="GOA:C4QW00"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QW00"
                     /translation="MNKVKQIEKLNQQELDQNIQFEASWHQEYRDSAYIYIGSLPYEI
                     TETDLLTIFSQYGVPTHVKLARDYANGGKSKGFAFLKYEDWRSTALAVDNLNGIKIKD
                     RTISVDHTTYRPAVYQDEDDERMDKEWEAMVRKEMEKDFAEGVKNQEQPPAQHHLISE
                     GQKEQSKQQTQNDDNEDDADLEDPMKNFLSKG"
     gene            complement(<667300..>669432)
                     /locus_tag="PAS_chr1-1_0065"
                     /db_xref="GeneID:8197908"
     mRNA            complement(<667300..>669432)
                     /locus_tag="PAS_chr1-1_0065"
                     /product="Component of the U2 snRNP"
                     /transcript_id="XM_002489660.1"
                     /db_xref="GeneID:8197908"
     CDS             complement(667300..669432)
                     /locus_tag="PAS_chr1-1_0065"
                     /codon_start=1
                     /product="Component of the U2 snRNP"
                     /protein_id="XP_002489705.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0065"
                     /db_xref="EnsemblGenomes-Tr:CAY67424"
                     /db_xref="GeneID:8197908"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018843"
                     /db_xref="UniProtKB/TrEMBL:C4QW01"
                     /translation="MVAETKISDPYTISYLPRLGVEVEGGQNYKVANIESKDNNFIDI
                     AISGSFVGTYILKPTPKLIWSHGLSPSTKVNSINVVQNQDISEGSKNYLVGLSEKKKH
                     SLSLFKYQESTNEQMLEVATDDAVVEIEELYRNSNIVFGLEQSGKVVLYDISVNITPI
                     ATLKPTIGSEVRVVFHKFIPDGKGFLLIVERVNQSLSVRLVGLDTTSAFNASTHQLDG
                     LNAEIFEYNDGNLLALDAKSKELSFFSLPELQKVKTISLSNVLESASSDNLLWSLKSV
                     APNRVLLSFKNDIYLLDTKYQSLLATFSTTSHKSITLLNSPSQVSGDTPTTRETFVVA
                     AVKNSKENLSKLKHYTVDVGTGKLSDSVGKSLNSKPSELFTAIPFLSPSFNPSNETRV
                     LNAELKKVYEHLVTASASKDVKAWEKICVPFLRNTPLDKILKGKANTKSIKTDNEFHV
                     HEPKTDRVVDYTFIGLICSLIFDDLDLDAFNPERSLTYLLTHPLFPKEFTEGLLEKLK
                     PHPRLFRQAIVTCPNIACIDLIYQLHGVENDEIVKDLLVRLSDEFKSETITQETAKLA
                     NTKNKDEFDLNIVISKIMRLNFGYEVLNAFVDSNGLALSLNLSSTESNLSKLIDQVNG
                     RIETLIENSEILTLVNQSLIHYSKIKQSKKEMNGSIVESNGPVSVVIDESRSKIDNML
                     DISGKSTKAIKVASPSFIPSYQYEQLKL"
     gene            <669837..>671249
                     /locus_tag="PAS_chr1-1_0066"
                     /db_xref="GeneID:8197194"
     mRNA            <669837..>671249
                     /locus_tag="PAS_chr1-1_0066"
                     /product="Putative X-Pro aminopeptidase"
                     /transcript_id="XM_002489661.1"
                     /db_xref="GeneID:8197194"
     CDS             669837..671249
                     /locus_tag="PAS_chr1-1_0066"
                     /codon_start=1
                     /product="Putative X-Pro aminopeptidase"
                     /protein_id="XP_002489706.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0066"
                     /db_xref="EnsemblGenomes-Tr:CAY67425"
                     /db_xref="GeneID:8197194"
                     /db_xref="GOA:C4QW02"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:C4QW02"
                     /translation="MNKGPKELEGRKYPARAHALTVKNHFIQKKADISSRSAIFISGE
                     DLKLYPYCDQTAPLRQNRYFFYLSGCNIPGSHVLFDLDAELLILVLPEIDWDDVMWSG
                     MPLSIEDAYKTFDVDKVVYLKDLQGFLSSFGKIYTTDINDENSKFGNLLTEKDPDLFW
                     ALDESRLIKDDYELTLMRHASKISDNSHYAVMSALPIETDEGHIHAEFVYHSLRQGSK
                     FQSYDPICCSGPNCSTLHYVKNDDSMENKHTVLIDAGAEWNNYASDVTRCFPINGDWT
                     KEHLEIYNAVLDMQDQVMKKIKPEAHWDELHLLAHRVLIKHFLSLGIFHNGTEDEIFE
                     SGVSVSFFPHGLGHLLGMDTHDVGGHPNYDDPNPLLRYLRLRRVLKENMVVTNEPGIY
                     FSPYLVELGLKDDNKAKYVNKDVLEKYWYVGGVRIEDDILVTKDGYENFTKITSDPEE
                     ISKIVKKGLEKGKDGFHNVV"
     gene            complement(<671278..>672870)
                     /locus_tag="PAS_chr1-1_0067"
                     /db_xref="GeneID:8197195"
     mRNA            complement(<671278..>672870)
                     /locus_tag="PAS_chr1-1_0067"
                     /product="Essential N-acetylglucosamine-phosphate mutase"
                     /transcript_id="XM_002489662.1"
                     /db_xref="GeneID:8197195"
     CDS             complement(671278..672870)
                     /locus_tag="PAS_chr1-1_0067"
                     /codon_start=1
                     /product="Essential N-acetylglucosamine-phosphate mutase"
                     /protein_id="XP_002489707.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0067"
                     /db_xref="EnsemblGenomes-Tr:CAY67426"
                     /db_xref="GeneID:8197195"
                     /db_xref="GOA:C4QW03"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="InterPro:IPR016657"
                     /db_xref="UniProtKB/TrEMBL:C4QW03"
                     /translation="MPQLEAHSDHLKDSKVNYTYGTAGFRMHSSKLDPVMYTVGILAA
                     LRSKKLGKTIGVMITASHNPPKDNGVKVVDPLGEMLEQSWESWATKFANSNSTESLEQ
                     NIKQLVKSESIDLSAPAHVVIGRDSRESGPALLSSLIEGIDAIEISRPSDFGLLTTPQ
                     LHYLVRAYNDPSFGKPTEEGYYEKLSSTLRRIWELCGSSEEVIDVTIDAANGIGANKI
                     EKLSSYVKDILSLKLVNDNCDIPNLLNVDCGADFVKTNQKLPHGLNNPTPLKPYCSFD
                     GDADRIVFYYINQENQFRLLDGDKIATLLTQFVNSLLSQLQDVQLSIGVVQTAYANGS
                     SSQFIKESLQVPVEVTPTGVKHLHHKAVDFDAGIYFEANGHGTVVFSQLFIETLQKYR
                     PRGEQDKKAVSALLLLVDLINQAVGDAISDLLAVLVALKYTNKSALDWDQDYTDLPNR
                     LIKVLVPDRNIFKTTNAERTLVEPKGLQSRIDEIVLQYERGRSFVRASGTEDAVRVYA
                     ECKDSDKIQEFVDRVGKLVAEV"
     gene            <673016..>673702
                     /locus_tag="PAS_chr1-1_0068"
                     /db_xref="GeneID:8197196"
     mRNA            <673016..>673702
                     /locus_tag="PAS_chr1-1_0068"
                     /product="Putative protein of unknown function, has
                     homology to Staphylococcus aureus nuclease"
                     /transcript_id="XM_002489663.1"
                     /db_xref="GeneID:8197196"
     CDS             673016..673702
                     /locus_tag="PAS_chr1-1_0068"
                     /codon_start=1
                     /product="Putative protein of unknown function, has
                     homology to Staphylococcus aureus nuclease"
                     /protein_id="XP_002489708.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0068"
                     /db_xref="EnsemblGenomes-Tr:CAY67427"
                     /db_xref="GeneID:8197196"
                     /db_xref="GOA:C4QW04"
                     /db_xref="InterPro:IPR016071"
                     /translation="MAQSNQHVSIYNPKVIVYSIGLTTAILASMSIYRSHFVRFSTSL
                     DVPKTLFRTKHLHGKVTSVGDGDNFHFYHLPGGIFAGWGWIRETPEINKFRKLKNKTI
                     HVRLCGVDAPERSHFGKPSQPYSEEALQWLRQFILGKKVKVKPLSVDQYNRIVGRVFI
                     FRWNGWNDVSEEMLRNGVAIVYENKSSAEFDGMKERYLKVENKAKKKKKGLWGIERGL
                     TPGEYKRLYK"
     gene            complement(<673772..>675481)
                     /locus_tag="PAS_chr1-1_0069"
                     /db_xref="GeneID:8197197"
     mRNA            complement(<673772..>675481)
                     /locus_tag="PAS_chr1-1_0069"
                     /product="Plasma membrane protein involved in remodeling
                     GPI anchors"
                     /transcript_id="XM_002489664.1"
                     /db_xref="GeneID:8197197"
     CDS             complement(673772..675481)
                     /locus_tag="PAS_chr1-1_0069"
                     /codon_start=1
                     /product="Plasma membrane protein involved in remodeling
                     GPI anchors"
                     /protein_id="XP_002489709.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0069"
                     /db_xref="EnsemblGenomes-Tr:CAY67428"
                     /db_xref="GeneID:8197197"
                     /db_xref="GOA:C4QW05"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:C4QW05"
                     /translation="MHPILEFFSLQVLDDRLLPDSKRKQQVISKSHISRWNTWEFRIY
                     LLVFLFIVPLMYKTCMDASNETNPNYNRFQHLLSQGWMFGRKVDNSDSQYRFFRDNLP
                     MLVGLIVLHSGLRKLVGLGFTIQRTTFDFVFGIVFLFGAHGYNCLRIHFHVFVTYLLA
                     RLIPNPKYATLACWIWAVSTLFINDNYRTVQFGSLLPSLSFMDQFHGIIARWDVFYNF
                     TLLRMLSFNLDYLNAKAEAAAFKPKKDDNDSGTETHNILEKQNPSTTPILSDKERMNN
                     SLPLNEYNVFNYISYITYTPLYIAGPVITFNDYFYQSFNPLPTINFKKTAIYGLRLLF
                     CILVMEFLLHFMYVVAVSKTKAWQGNTPFQISMIGLFNLNIVWLKLLIPWRMFRFWSL
                     VDGIDPPENMIRCMDNNYSAMAFWRAWHRSFNRWTIKYIYVPLGGSRYRILTSLAVFS
                     FVAIWHDIELKLLMWGWIIVLFLLPEITLTNMFKPYSECWWFRHVCAVGAIINIWMMM
                     FANLYGFVLGGDGMKLLITEIFTSSDGLKFLVSSCVCLFVAAQVMFELREAEKRRGID
                     VRC"
     gene            <675818..>676507
                     /locus_tag="PAS_chr1-1_0469"
                     /db_xref="GeneID:8197198"
     mRNA            <675818..>676507
                     /locus_tag="PAS_chr1-1_0469"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489665.1"
                     /db_xref="GeneID:8197198"
     CDS             675818..676507
                     /locus_tag="PAS_chr1-1_0469"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489710.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0469"
                     /db_xref="EnsemblGenomes-Tr:CAY67429"
                     /db_xref="GeneID:8197198"
                     /db_xref="UniProtKB/TrEMBL:C4QW06"
                     /translation="MDRRPNPPGWVPPKAPYNPYDPNDIRPPEGYPSEFLPPGKQKSF
                     SDIPKDATEYEQIRHSMNQLKYTPRPPSELYPGQNKVLKRINTKARFQNGLKITSRLL
                     MFGVTVYGVFFYRWNEGYDNVFSPFYRFRLKCKKFISGELSDKEEFDLSGNSKPLPFK
                     VIREETVPADIATVESAAGLQRPTQKHLMEVERILQEREEKMLRAVDIAEETLKKQGS
                     TKETKPFWKIW"
     gene            <676694..>678022
                     /locus_tag="PAS_chr1-1_0070"
                     /db_xref="GeneID:8197909"
     mRNA            <676694..>678022
                     /locus_tag="PAS_chr1-1_0070"
                     /product="Steryl ester hydrolase, one of three gene
                     products (Yeh1p, Yeh2p, Tgl1p)"
                     /transcript_id="XM_002489666.1"
                     /db_xref="GeneID:8197909"
     CDS             676694..678022
                     /locus_tag="PAS_chr1-1_0070"
                     /codon_start=1
                     /product="Steryl ester hydrolase, one of three gene
                     products (Yeh1p, Yeh2p, Tgl1p)"
                     /protein_id="XP_002489711.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0070"
                     /db_xref="EnsemblGenomes-Tr:CAY67430"
                     /db_xref="GeneID:8197909"
                     /db_xref="GOA:C4QW07"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4QW07"
                     /translation="MIIQQMTKAFIGIFRAIVYLWRLLFPPFIQNSSQDARIADARDI
                     KDIVQFHGYQCKEYVVTTRDGYLLTVHRIYKDKIHDNPVVYLQHGLLTNSELFVLNDS
                     PDKIIPFRLVDNGYDVWLGNNRGNKYSRNHTSISTKSKRFWNFSLNEYAIYNIPDSIR
                     TILHITNKHKILAYIGFSQGTAQGLASLSLNPYLNDKIQLMIGLSPAFIPPNLRHPVA
                     SFAVNAYHYLPLVLGNRAIMPSVHFWKWAMGQEYYQRVVDLSLIYLFNWQGDNISSQQ
                     KQIGYPHLFSNSSVKSILHWFQIIKNQRFEMFDEKDHDSSPLNVIFGLKGHLPTPFPT
                     NNISTKLLLMYGTNDTLMNIPTMLPYLPHENVLDIVPVQDYEHMDLLWGKNVDKLVIP
                     TILKTLAEQVPLAEQVETVEKRFSKLLAPYMKQPVFEIEGPQRYATIQIS"
     gene            complement(<678030..>679184)
                     /locus_tag="PAS_chr1-1_0071"
                     /db_xref="GeneID:8197199"
     mRNA            complement(<678030..>679184)
                     /locus_tag="PAS_chr1-1_0071"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489667.1"
                     /db_xref="GeneID:8197199"
     CDS             complement(678030..679184)
                     /locus_tag="PAS_chr1-1_0071"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489712.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0071"
                     /db_xref="EnsemblGenomes-Tr:CAY67431"
                     /db_xref="GeneID:8197199"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C4QW08"
                     /translation="MKNLAKPKINYPFLILLPFLLFFIWFPNFKPFNREMPEVQAPSK
                     SLIRLQTWNLRFDSQPNGESVQDTISRMERKVPQDNKISYYETSGEVPWSKRRISIAN
                     HVVFNGAGIFAVQEALYRQVQDLNELLNLFDSSSWDWIGLGRDDGKLGGEFEAIFYDT
                     ERFELIEWDNFWLSKTPFEPSRYPGAGSLRTVTIGLFKFKGEESKNPFIIMNTHYDEQ
                     SENQRRLASSLIKYRASYEFERLKNEYGVENPSIILCGDLNSHSFNENSGGYRIITGN
                     QPLETDEISSEFAERFRSANLSKFNFRDLMEETPPQFRFGHLSTFTGFSKIGDTSKFS
                     RIDFQFGATWEEDGKTNHGWKALKYKVDEIFYDNEYPLSDHRPVVTELLL"
     gene            <680765..>681850
                     /locus_tag="PAS_chr1-1_0072"
                     /db_xref="GeneID:8197200"
     mRNA            <680765..>681850
                     /locus_tag="PAS_chr1-1_0072"
                     /product="Fructose 1,6-bisphosphate aldolase, required for
                     glycolysis and gluconeogenesis"
                     /transcript_id="XM_002489668.1"
                     /db_xref="GeneID:8197200"
     CDS             680765..681850
                     /locus_tag="PAS_chr1-1_0072"
                     /codon_start=1
                     /product="Fructose 1,6-bisphosphate aldolase, required for
                     glycolysis and gluconeogenesis"
                     /protein_id="XP_002489713.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0072"
                     /db_xref="EnsemblGenomes-Tr:CAY67432"
                     /db_xref="GeneID:8197200"
                     /db_xref="GOA:C4QW09"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="InterPro:IPR006411"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C4QW09"
                     /translation="MPDQLSFLKRKTGVIVGDDVRNLFLHAQKKGFAIPAINVTSSST
                     AVAALEAARDNNSPIILQTSQGGAAYFAGKGVKNSNQEASIGGAVAAAHYIRSVAPLY
                     GIPVILHTDHCAKKLLPWFEGFLAADEAYYKEHGEPLFSSHMLDLSEESDDENIATCV
                     KYFKRMAKMNQWLEMEIGITGGEEDGVNNENADKELLYTKPETVFAVHKALAPISPNF
                     SIAAAFGNVHGVYKPGNVVLRPSLLGDHQKYAKEQLKSESDKPLFLVFHGGSGSTQEE
                     FDTGIRNGVVKVNLDTDCQYAYLIGIRDYVLKKKDYIMSQVGNPEGDDKPNKKYFDPR
                     VWVREGEKTMSARVTEALNIFHTANQL"
     gene            <682104..>684002
                     /locus_tag="PAS_chr1-1_0470"
                     /db_xref="GeneID:8197201"
     mRNA            <682104..>684002
                     /locus_tag="PAS_chr1-1_0470"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489669.1"
                     /db_xref="GeneID:8197201"
     CDS             682104..684002
                     /locus_tag="PAS_chr1-1_0470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489714.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0470"
                     /db_xref="EnsemblGenomes-Tr:CAY67433"
                     /db_xref="GeneID:8197201"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:C4QW10"
                     /translation="MSERSSKKGPKGGAKRSSQGSSQGLESTKLATLTELFPDWTAQD
                     LEPVLEEYPDEDLNVIIENIISGKINKWTDPSAKKEKKKREESFNASEELSTPSYHQT
                     PNSAKKEYPKKEVKAKSKKSQPRSTTSTTTASTKAQLTPSSNPSTKSSWAAALHQKQE
                     DKPSSTVTPTTETETPNGENASQSPVAETKSEQEESFAPAAVVETSAKPKSWAAMVAQ
                     SAKPKKKILKRPEQAAKPSSNEELSQQNGEIQDEQQSLQTQAETQAEQPIQSIELQQT
                     NEQISQQEQKPVQEPKPLERKQQQQQQQQPVVLPSAVNLDSIGGISFGSLSLNEKEAS
                     SAQQAQQASQPTSQVQAQTQNQQYQRYENQYYNNNRQFYQDGKQVNYDSFVRQQQQQQ
                     QHQQQQYWAHPQAQAQGVASAGGSDLNSASPAASNALPQGQPQGTPSASNANPVNAYN
                     NPQFYTPYVYYPYGQYYQNPQLYSGYMGYGAGQPQTQPHQPQVPPTASPSQQTQQVQP
                     TSGQVPNQQLAGFQGYQQPYQQAYLNKNGYPLYQQYPQQQQQQVGGQGQSQPQGKEVE
                     EPKPQQQGQQAGQHQGQQAQLPQQYPGHPGQYFGQQALGAQQTPYTEYPVYPNSNDYN
                     NTNAKGWI"
     gene            complement(<685383..>685727)
                     /locus_tag="PAS_chr1-1_0074"
                     /db_xref="GeneID:8197910"
     mRNA            complement(<685383..>685727)
                     /locus_tag="PAS_chr1-1_0074"
                     /product="Essential protein of the inner mitochondrial
                     membrane, peripherally localized"
                     /transcript_id="XM_002489670.1"
                     /db_xref="GeneID:8197910"
     CDS             complement(685383..685727)
                     /locus_tag="PAS_chr1-1_0074"
                     /codon_start=1
                     /product="Essential protein of the inner mitochondrial
                     membrane, peripherally localized"
                     /protein_id="XP_002489715.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0074"
                     /db_xref="EnsemblGenomes-Tr:CAY67434"
                     /db_xref="GeneID:8197910"
                     /db_xref="GOA:C4QW11"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="InterPro:IPR027102"
                     /db_xref="InterPro:IPR027247"
                     /db_xref="UniProtKB/TrEMBL:C4QW11"
                     /translation="MSLFLNKNTIYDHLEVDPQRVKMAEIQYEAMQTTFNTLIRTCRT
                     KCIAEEYGEIDLSKGESSCVDRCVAKFMKANVQIGFLAHAAGLEPNSLRVHQGIVETY
                     CSDAPKEDGINK"
     gene            complement(<690342..>691027)
                     /locus_tag="PAS_chr1-1_0076"
                     /db_xref="GeneID:8197202"
     mRNA            complement(join(<690342..690601,690895..>691027))
                     /locus_tag="PAS_chr1-1_0076"
                     /product="40S ribosomal protein S22"
                     /transcript_id="XM_002489671.1"
                     /db_xref="GeneID:8197202"
     CDS             complement(join(690342..690601,690895..691027))
                     /locus_tag="PAS_chr1-1_0076"
                     /codon_start=1
                     /product="40S ribosomal protein S22"
                     /protein_id="XP_002489716.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0076"
                     /db_xref="EnsemblGenomes-Tr:CAY67435"
                     /db_xref="GeneID:8197202"
                     /db_xref="GOA:C4QW12"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:C4QW12"
                     /translation="MTRTSVLADALNSINNAEKTGKRQVLIRPSSKVIVKFLTVMQSH
                     GYIGEFEFIDDHRAGKIVIQLNGRLNKCGVISPRFNVKIGDIERWTDNLLPARQFGYV
                     ILTTSAGIMDHEEARKKHVSGKILGFVY"
     gene            <691405..>694458
                     /locus_tag="PAS_chr1-1_0077"
                     /db_xref="GeneID:8197203"
     mRNA            join(<691405..691440,691495..>694458)
                     /locus_tag="PAS_chr1-1_0077"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489672.1"
                     /db_xref="GeneID:8197203"
     CDS             join(691405..691440,691495..694458)
                     /locus_tag="PAS_chr1-1_0077"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489717.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0077"
                     /db_xref="EnsemblGenomes-Tr:CAY67436"
                     /db_xref="GeneID:8197203"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4QW13"
                     /translation="MNIDQTRKVFRELKPCCVELSKVAFLSQEALVNHDPKSLTKLLE
                     NVYNELDNQQNLYPNLELSAQLTDYIFQPIGVLLGHDDRALQEVHLQMIFKILEILVR
                     RGWSTDRSDGMNEKIATLILFVIGKDPLLYKGKITRDDELLLSAYNCLSTCLDNMINL
                     NDDSLLHNVGKLSHLILVSLDALNQKHSNSQLSVTILISLNKICVLVYQGDQLARILP
                     GIVSSLVKTIKSPVHYEVLLECLNLLSFLVERTFNDLNLHVTHPLDNLKLQDLEGFDN
                     KLVVNQMGEGNRNTDWLEVTVKQLYQSLKTISPVILTHHKPQVTLAWLEFVQAVIEKC
                     PISLGTLIPFLIDSLLQLFPTHYETCSRILSLNRYLVQDTLNDLILSKIQEIPSKLNT
                     VDEQQKRIFLKQLSSLIHYVDQPPPALLQGLQNEFFKYLIGQRKKFSAPVKTIQEISV
                     SLTLEADSSQLASLVPYEHDLKSLLLSLGQILPDSAVQSLITEFTPMNNINHVLDKSV
                     SVWMTSEMLLGRSMQDEVSELVKFDESSRDDSMKYLILETANELIDSCDLNTPITQSK
                     KNTLLLNLKAINNIIDIMGSEFTEELVGSLYPIFELLTAQDIAVRTSARYVVENIASK
                     CYNGSLVDLVYKNIDYLIDGVSSRLNSEITPYTSSILMVLIEIGGVDILDQLGDLIST
                     MFTLLDYYHGYTVLCEQFFEVFHKLVDQSSVLMRGYTFSEEKQTNTIWRMKDREAMGE
                     FLTKYWATVQRTKIDIPDTLEELTSHPNKPFGDLDSDKDSDDEEELDINGIQSEPEVE
                     AREVVKEWKSPFTPDVYFMFQTMLQYGDRLVMHDSVRLRIQIISLWNKIFPILSTSID
                     DMYPVISDLWPKVAEFILQEKEMRLMIPTLELATTIIQYGGQFCCKRFIDLWESLSKK
                     KLLAQIHKKHTLPEFEEKIYYRLMEFLVFSLERLGTGVPSEISMNIIKYTITRIDDES
                     KYGSVHDDIVWYLKQDASVVGDNLLTS"
     gene            <694901..>696895
                     /locus_tag="PAS_chr1-1_0078"
                     /db_xref="GeneID:8197204"
     mRNA            <694901..>696895
                     /locus_tag="PAS_chr1-1_0078"
                     /product="Regulatory subunit of type 1 protein phosphatase
                     Glc7p"
                     /transcript_id="XM_002489673.1"
                     /db_xref="GeneID:8197204"
     CDS             694901..696895
                     /locus_tag="PAS_chr1-1_0078"
                     /codon_start=1
                     /product="Regulatory subunit of type 1 protein phosphatase
                     Glc7p"
                     /protein_id="XP_002489718.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0078"
                     /db_xref="EnsemblGenomes-Tr:CAY67437"
                     /db_xref="GeneID:8197204"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:C4QW14"
                     /translation="MASQTNLSEVFQGGATTSQHVDAKDEDHFEQTSFKLKRTRSLGL
                     LDDFIQPTQKLVTQSDFVSDDTVSKINTGTKCDSTTGSKTYMDLGSDLGSTDIVDGNG
                     NDSAYKQTQDGSAENEEQKLTEPDNQSEKNEAPNSAYAAFDNLVLTHDDNDLEYEPSK
                     HVDYLSHNWKESDIFKSWRYVVLKRKDVANSSRLENASWRTWAQAKYGLKTISPESVN
                     WYKDSDVTWLYGPLYKEPHKQDLLREDSSSNLSMMKNKRSSSGTNLRSLPKTNSFHDS
                     IDLDKINNNKGKRSSAHDDNTNDKKHNDTTPIDDDQPKSILKKKTIGEIMLEQATFYA
                     NKNRFRGSPVLDAHQQPESPISLSNNTSRDHIGDSFSVDSPTPSIEEKKDRHIHFNDR
                     VEQCMAVDLSFDEEDDEEYYQEPSLVNKFLDTESNQKEPQHLEYAEDSTHNDSYDENN
                     DDYDDEDEEDDDDDDDEEGGFFLRARSPSNSSLHHQGLAQLSMSNSGETQGKINSDNS
                     SSCSTTTRRSIIEILPATTLKYGSDDDEEYALSHNVNTSRGYDYHYDYNTVYEAQTVN
                     DDNLEVYDVPSNIDLASSIPVPKELATNIPETAIGLPKTVGNSRPVPPETTTVKANRF
                     MLADSDSDTDNSNDDDRPMVNSRSSGSYASLSDIVSKMGM"
     gene            <697016..>698269
                     /locus_tag="PAS_chr1-1_0079"
                     /db_xref="GeneID:8197205"
     mRNA            <697016..>698269
                     /locus_tag="PAS_chr1-1_0079"
                     /product="Non-ATPase regulatory subunit of the 26S
                     proteasome"
                     /transcript_id="XM_002489674.1"
                     /db_xref="GeneID:8197205"
     CDS             697016..698269
                     /locus_tag="PAS_chr1-1_0079"
                     /codon_start=1
                     /product="Non-ATPase regulatory subunit of the 26S
                     proteasome"
                     /protein_id="XP_002489719.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0079"
                     /db_xref="EnsemblGenomes-Tr:CAY67438"
                     /db_xref="GeneID:8197205"
                     /db_xref="GOA:C4QW15"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:C4QW15"
                     /translation="MDNDVSTILTTLRLEADEESSPVFYTLEDLYERKLWYQLTTTLD
                     EEFYQSNNIIHGLKLRLFDRFITKFWDKLNRLKLVEFLLLSLSDDQDLTDDEALEILS
                     SWKAKIKDAFTKESRRSGTSEDEEGVSNLEYVQSLIYIDSEIAKLKLGFEDQKEDAKT
                     MIDEISEKLESLNSVDNKINASYYNTLGEYYKINRDYNNFYYTSLLYLACVDEDFKKE
                     KIPSSVQEAFCFDLAVSALLGDKIYNFGELIMHEHLFEVFNSHKNLKWLYGLVQTISE
                     GDLKAFESLIETNKGYITEQCPVLLENINFLQQKICIMALIELVFSRPSNETMLPFSE
                     IISNISLLTTDDEVEYLVMKCLSLKLIKGSIDQVNSQVNVTWIQPRIMSKSQISKLQQ
                     KLKDWNVKIGELTTILDNAGKEIWV"
     gene            <698538..>700914
                     /locus_tag="PAS_chr1-1_0080"
                     /db_xref="GeneID:8197206"
     mRNA            join(<698538..699775,699801..>700914)
                     /locus_tag="PAS_chr1-1_0080"
                     /product="Protein of unknown function, deletion causes
                     multi-budding phenotype"
                     /transcript_id="XM_002489675.1"
                     /db_xref="GeneID:8197206"
     CDS             join(698538..699775,699801..700914)
                     /locus_tag="PAS_chr1-1_0080"
                     /codon_start=1
                     /product="Protein of unknown function, deletion causes
                     multi-budding phenotype"
                     /protein_id="XP_002489720.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0080"
                     /db_xref="EnsemblGenomes-Tr:CAY67439"
                     /db_xref="GeneID:8197206"
                     /db_xref="GOA:C4QW16"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:C4QW16"
                     /translation="MRDSNYKSVSSNRAAVSITTSLYDRRALDCTSDKPLVNSLNHLT
                     FLLSTSGKVRETVSTDGGLERLIDILQECQQPESPKHWALVGWKWTLTFQSLVFIGTR
                     GTEKIRRKVVQAGIIPILATILDNYLYQASKGNSNGNSNVTSTSKTPMIESGPVGNVS
                     PADAVMEDHTIVSTGNEMNINDLPLELNSIDDIGENKSSVSILNNNNDENPLNSPTND
                     LLDDKLSFASFLTDLNEGAGNTTQELLDYVNLSDLNDNIISEVVKTPAINNILSNMNR
                     KSILKEFRHSTQLRLIRILYPNVSVQFPRVFKNGILVPTADDVLWSLQLLAFISKYSS
                     LRHELSNTFIIKGMSLRAKEEGTKQKNSPLHNNITLPALEMDDDIRSVSYEEDIEQKD
                     HIMMDVDAAFDDTNPLSDIHHQGLAKSTDYIKCKVNLDCLIQHELVRLKKRNSDLLKE
                     EHDALTSQWCYDTYDFWQEDGRKSQDLDPAVLPYMQLNIFPLVEKFTIKSEYLKDISY
                     WSGVIMRNSCRKDETRGGVRQCACISCGKWETMPKQFAKCRRCKRTKYCSKECQSKAW
                     EYHKHWCVAVQSGSSASSSVNQCSSQTEQTSSQTETETQSQLSTQTQEIPRDDSVNIN
                     TQQTSDEHQLDHGSMFLRRRLTQAPRFSSRPLTPASGLQRIQAYSGESSDESQTNEQT
                     LALTNLLRNYNLQLEEIERRMSEVESNLVSTQREQEAEDSTDQDLQQDLQNEAQSLQR
                     ELNELLRAHQQVQSSFVFQRTALTRSINFSQENNTSSNDESNS"
     gene            complement(<700965..>701930)
                     /locus_tag="PAS_chr1-1_0081"
                     /db_xref="GeneID:8197207"
     mRNA            complement(<700965..>701930)
                     /locus_tag="PAS_chr1-1_0081"
                     /product="Mitochondrial inner membrane transporter,
                     transports oxaloacetate, sulfate, and thiosulfate"
                     /transcript_id="XM_002489676.1"
                     /db_xref="GeneID:8197207"
     CDS             complement(700965..701930)
                     /locus_tag="PAS_chr1-1_0081"
                     /codon_start=1
                     /product="Mitochondrial inner membrane transporter,
                     transports oxaloacetate, sulfate, and thiosulfate"
                     /protein_id="XP_002489721.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0081"
                     /db_xref="EnsemblGenomes-Tr:CAY67440"
                     /db_xref="GeneID:8197207"
                     /db_xref="GOA:C4QW17"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4QW17"
                     /translation="MSARPHKKSASQEVSVIGGFFGGGIAACGAVTITNPIEVVKTRM
                     QLQGELSAKNAHVPRPYKNPIQGVLVVYRNEGIKGCQRGLVSAWIYQLGLNGCRLGLY
                     EPIRNTLNRLMYPSRDPHTVQNTAINVISGAVSGAAGATVGSPLFLVKTRMQSYSNSI
                     QIGQQTHYRGVWNGLSTIYRQSGFMGLFQGVDAAIIRTAAGSSVQLPIYNFAKHELLK
                     NQIMEEGTGLHLTSSLFAGIGVSVVMNPWDVILTRIYNQKTKLYSGPLDCLIKIVKVE
                     GIMALYKGFEAQILRVAPHTILCLVFMEQTMKLVKGVEMTLFSAF"
     gene            complement(<702026..>704648)
                     /locus_tag="PAS_chr1-1_0471"
                     /db_xref="GeneID:8197208"
     mRNA            complement(join(<702026..703925,703957..>704648))
                     /locus_tag="PAS_chr1-1_0471"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489677.1"
                     /db_xref="GeneID:8197208"
     CDS             complement(join(702026..703925,703957..704648))
                     /locus_tag="PAS_chr1-1_0471"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489722.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0471"
                     /db_xref="EnsemblGenomes-Tr:CAY67441"
                     /db_xref="GeneID:8197208"
                     /db_xref="GOA:C4QW18"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4QW18"
                     /translation="MDLKYGEHNRQSVRVYQPPNKDKISACCIFIHGGAWRDPSNTAA
                     DFDAFGNELSKTGIICYSVDYRLSPEIKHPEHLNDVLKALKFIHSEINDFPCCLSGHS
                     VGATLVLQSLQHSLPLNIMLVVLLDGIYDLPQLVLEYPDYLSFVTEAHKDRDWETVTF
                     EAEELPQTNFFFVHSTADELLSPRQTKLLVNKLERKFPSSVLSVIADFGSHNSVYQDT
                     KVRALLLEQLNFNNRPMPPLDEKAYSLTTDSSASDSYLRYNEKDRNPNIILDTDQHLE
                     GTDDTTLLPVEQTTLKTVSIKIEQLLQNCDNFDTLDPNAKSEVSNQLRQLLVEPKYLN
                     GFRKNAAAPKAFKRLFRAQEIKDSNEPITNIEFSPDGKYMASSGDDGVLRVYKVISNL
                     IERINTEYLDHREHSSTNQQIASDNESLKNGSSIHMAPVFYSKPYRVFEGHSAKILSL
                     NWSQNNFILTGSMDRTVNLWHVDRDQVLDSYELDDFVTSVKFHPTDDRFFLSATLSKT
                     LSFWSILDREALYKTTVSDLITATCFSPNGEHLLVGTFSGKCICLVTRGLDVAYEFDL
                     KNYTKRRHASSTGESGSKITGITIHLAKNYSPIVVPSPAPVPHIPNGMDWKVIIARND
                     STIRMFSFNSRSLEVKYTGYTNSSSQIKPHLSEDTRYLISGSEDHWFRIWHFIDRKKL
                     TQAYKDRYKDKSGTKKYLLSQPKEAEKKRRFSISSTLDTFKDGYCLYKEKNCISFHAH
                     HSQCNDAVFAPIESSRILERSNDSIFLLYYAIDPKRPPPDLASSIIVSTDNHGLISVF
                     RRDFAYNIKRELHSKYSNVLNYNNSTTCPKEGSVIASLIRKVGPSSSRHGRSRSVSQE
                     RSTFSIT"
     gene            <705086..>706075
                     /locus_tag="PAS_chr1-1_0082"
                     /db_xref="GeneID:8197911"
     mRNA            <705086..>706075
                     /locus_tag="PAS_chr1-1_0082"
                     /product="RNA-binding protein that carries poly(A)+ mRNA
                     from the nucleus into the cytoplasm"
                     /transcript_id="XM_002489678.1"
                     /db_xref="GeneID:8197911"
     CDS             705086..706075
                     /locus_tag="PAS_chr1-1_0082"
                     /codon_start=1
                     /product="RNA-binding protein that carries poly(A)+ mRNA
                     from the nucleus into the cytoplasm"
                     /protein_id="XP_002489723.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0082"
                     /db_xref="EnsemblGenomes-Tr:CAY67442"
                     /db_xref="GeneID:8197911"
                     /db_xref="GOA:C4QW19"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QW19"
                     /translation="MSDLSTSQLFVRPLPGDVRPEELQDLFGKFGPIKEVKIMRGYAF
                     VEYEEGADASAALENLNNTPFGDQDLQIEFAKEKPSYAKRGENRVKVTNIPESIAWQD
                     LKDFIAKEIDILPTFARLNRHDEPPTATLEFNNREELEAAVEKINGIVLEEHTLTAEE
                     DTSPFIPMPGRGGFRGGPRGGRGGFRGGRGGFRDDYRGGFRDDYRDEFRGGRGGFRDD
                     FRGGFRGGRGGYPPRDDFRGGFRGGRGGFRDEPRGGFRGGRGGYPARESFRDEFRPPP
                     RDDYRDEYRAPRDDYGPPPPRDDYRDGYRDDYRRDAPPPPRDYPPRDRSPSRA"
     gene            complement(<706450..>707946)
                     /locus_tag="PAS_chr1-1_0083"
                     /db_xref="GeneID:8197209"
     mRNA            complement(<706450..>707946)
                     /locus_tag="PAS_chr1-1_0083"
                     /product="Kinesin-related motor protein involved in
                     mitotic spindle positioning"
                     /transcript_id="XM_002489679.1"
                     /db_xref="GeneID:8197209"
     CDS             complement(706450..707946)
                     /locus_tag="PAS_chr1-1_0083"
                     /codon_start=1
                     /product="Kinesin-related motor protein involved in
                     mitotic spindle positioning"
                     /protein_id="XP_002489724.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0083"
                     /db_xref="EnsemblGenomes-Tr:CAY67443"
                     /db_xref="GeneID:8197209"
                     /db_xref="GOA:C4QW20"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C4QW20"
                     /translation="MTDSSSGLARIKVFTRVRPLIGREIENGNNSCIVEMPDQHTTVW
                     TSRHSTQESKRFQFHRSLWSFEESDPHYVSQDALYQLIGQDMLNNCLNGYNSCIFAYG
                     QTGSGKTYTMMGNKLDGLVPSLGRELFILKQSMLEKQNALLHLKISFCEIYNEVVYDL
                     LSNDNVKLRVRETKNHTPYVENLQEFPLKDFEELMSYLKRGSMKRKTASTIANKTSSR
                     SHSIFTIILQQERYLDENLTKHEKLESHLRLVDLAGSERTNVHNEARFKEGSHINKSL
                     TTLGRILTILSNSSSRRGTKGIPYRESVLTWLLKESIGGNSQTAMISCLSPTEHEETL
                     STLRYSETASKITNVVTQNKSKVELEGDLQQLVSKQEEENMKLLQFIEKLQKGDSGLS
                     TKKYQVLRNRIKYEQKYIDSLMYKTNLTKKLYFERMSAMEEYSNELLKLIEVHNKDII
                     RKNRKIHEIFEQGDETKLEQVPINEKEVWDPQVSSMIEKYLDEDVYAL"
     gene            <708135..>709724
                     /locus_tag="PAS_chr1-1_0084"
                     /db_xref="GeneID:8197210"
     mRNA            <708135..>709724
                     /locus_tag="PAS_chr1-1_0084"
                     /product="Protein involved in ER-associated protein
                     degradation"
                     /transcript_id="XM_002489680.1"
                     /db_xref="GeneID:8197210"
     CDS             708135..709724
                     /locus_tag="PAS_chr1-1_0084"
                     /codon_start=1
                     /product="Protein involved in ER-associated protein
                     degradation"
                     /protein_id="XP_002489725.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0084"
                     /db_xref="EnsemblGenomes-Tr:CAY67444"
                     /db_xref="GeneID:8197210"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C4QW21"
                     /translation="MLTPEQEEKLAQFQEVTSFEDEQTDKIVRLLEHTSWNLDLAISR
                     FFDGNIDVPEPIPIEPPHTVEPDFDFTSFSSENVLLSDIMPKFPKAVPISDTWKFHGG
                     LISDQIPQSTQVRKPFKTVIFVFMLLPRAFFLLGTGIANLLNWIFPGFLKALEGIKNP
                     DEIPSEPKYQYIKQEEGDGSKEASYLEDTQPPAKFEDYFQSVIGEPSDLNIFSGEFNQ
                     ALEYAKTELKWLLIILVKSGTVSTTKFLKRVLNSPEFCRFIDENDIVLWLGDVNYAEA
                     FEVGKTYGVHTLPHISLAAKVSALSNTIPLMSIVHKSHHTHIQSSTPERICNRLKTFI
                     DHYEPQLVSQRYDKQEQDFARLIRQQQDEAYEASLQKDRERERIKVELIQQELAKELF
                     LKSNCLKIEDHPSLIKDSYTTIQFRNHQGMRVIQNFSQSSTLFDVYAFVDSKIHLREE
                     SEKKGITQEELLAEFKRDISQLSEIDLSNYDHYFEFELISPLPRYKLTPSKDICLKDV
                     KELWPNGSVLIESLGDNSDSD"
     gene            complement(<709895..>710554)
                     /locus_tag="PAS_chr1-1_0085"
                     /db_xref="GeneID:8197211"
     mRNA            complement(<709895..>710554)
                     /locus_tag="PAS_chr1-1_0085"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489681.1"
                     /db_xref="GeneID:8197211"
     CDS             complement(709895..710554)
                     /locus_tag="PAS_chr1-1_0085"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489726.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0085"
                     /db_xref="EnsemblGenomes-Tr:CAY67445"
                     /db_xref="GeneID:8197211"
                     /db_xref="GOA:C4QW22"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:C4QW22"
                     /translation="MSVLSTLSSRLSAIIIRSVTFLFVIITLGLSAASINNMSYSRGN
                     FLVATSVFSLVHLGYVGPYLFFTDYSTQIPPFFVAIFEYILNIFWFAGWIAMADLWGD
                     IHCSRRTSYGWGYYQFGSRCHVSKAAVAFGAFSWVMYTLSAVLVTINIVIPIVRSGSY
                     LSQVRAPVGFLTLDQSPATVAPTVGDFESSPADKEEATGDSVASPVAPAPVAAPPAQN
                     A"
     gene            <711683..>712639
                     /locus_tag="PAS_chr1-1_0086"
                     /db_xref="GeneID:8197212"
     mRNA            <711683..>712639
                     /locus_tag="PAS_chr1-1_0086"
                     /product="Co-chaperone for Hsp40p, anchored in the ER
                     membrane"
                     /transcript_id="XM_002489682.1"
                     /db_xref="GeneID:8197212"
     CDS             711683..712639
                     /locus_tag="PAS_chr1-1_0086"
                     /codon_start=1
                     /product="Co-chaperone for Hsp40p, anchored in the ER
                     membrane"
                     /protein_id="XP_002489727.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0086"
                     /db_xref="EnsemblGenomes-Tr:CAY67446"
                     /db_xref="GeneID:8197212"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR015399"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C4QW23"
                     /translation="MSEKEYTKDQEELVVKLLRIDRTDYYKILFVEKNATDVEIKKSY
                     RKLAIKLHPDKNKHPNSAEAFKKIAKAFEVLSDEGKRRIYDQTGQDPDSRGGGGGGAA
                     PTANGFPAGFGSGQFRGAQMPQGFEDDIFRMFFGNGMGRAGGPQPRVFTFGGNGFFPF
                     EEVPRRRPRAQQQQQQQRQQQPFFEQIKQLLPILLVFVLPMLSNLLTQRDSTSYPNFK
                     MQRKDPYTVQRATPNFHIPFYITKDSYKSLKEGHKLSKFDKFVENYHISSLRDSCERE
                     QNHKNRLIDESRGFFFTNYEQLEQAEKFPLPHCDRLHEMGLL"
     gene            complement(<712713..>716423)
                     /locus_tag="PAS_chr1-1_0087"
                     /db_xref="GeneID:8197213"
     mRNA            complement(<712713..>716423)
                     /locus_tag="PAS_chr1-1_0087"
                     /product="ATPase that forms a large complex, containing
                     actin and several actin-related proteins"
                     /transcript_id="XM_002489683.1"
                     /db_xref="GeneID:8197213"
     CDS             complement(712713..716423)
                     /locus_tag="PAS_chr1-1_0087"
                     /codon_start=1
                     /product="ATPase that forms a large complex, containing
                     actin and several actin-related proteins"
                     /protein_id="XP_002489728.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0087"
                     /db_xref="EnsemblGenomes-Tr:CAY67447"
                     /db_xref="GeneID:8197213"
                     /db_xref="GOA:C4QW24"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR020838"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QW24"
                     /translation="MASNDSTEVPHRNKSSISMLLNESSDTPPPSYLEAFENRVASLV
                     ALDGLATQDSNMLKYLYNELALVREQDLKSEATLISKIKDNLLEFDPNIAEKLIKRAT
                     GANHDQVDEEIEPIDDGTTTEITNAKSKRGAAHSKADTEAPAKPKSRRRKNISASADS
                     EDKPKGKGAQKQDNSKNGKSHNGDEELTNQGWDEDEIPDENSHPPRKRRTAASTNAEE
                     GRPKRRRKAAIMASSKARELQEDPAAFEEEDSPKRSNVSVKEQKSIDKQYDNTYMSIW
                     RDLSRKDGPRNYRLFQTYTQTKAINLKKTALLAAREARRWQIRTNKSQKDLQTKARRS
                     MREMLNFWKKNEREERELRKKAEKEALDSARKEEEDREAKRQSRKLNFLLTQTELYSH
                     FIGNKIKTDELEGNMGDKALTPSNGTDRSHLEGIDLSHAKADFNNIDFDQLNDENLEQ
                     TAAANAQSALQETQRKAQAFNNVDPDEEMNFQNPTSLGEITITQPKLLNCTLKEYQVK
                     GLNWLANLYDQGINGILADEMGLGKTVQSISVLAYLAETHNIWGPFLVVTPSSTLHNW
                     QQEISKFLPDFKVLPYWGSAKDRKVLRKFWDRKNIIYNKNSPFHVLVTSYQLVVQDAQ
                     YFQKVKWQYMILDEAQAIKSSQSSRWKVLLSFQCRNRLLLTGTPIQNSMQELWALLHF
                     IMPSLFDSHDEFSEWFSKDIESHAQSNTQLNEQQLKRLHMILKPFMLRRIKKNVQSEL
                     GDKIEIDVYCKLTNRQKKLYRTLKSQISLIDLMDNKFFANNNSTESDSLMNLVMQFRK
                     VCNHPDLFERADTKSAFHFGTFSDTASFSRENLLPVLDVFYSSANVINYRLPTLLYDE
                     ILSPNFEDNAQFLKQHLLYNGKLNIWNAKHLHRDEFKDHGWLSLLELTPDQVVRKAKQ
                     TLWQNLLDESDRFEAEQELRPLYSIQRAVHQDMYINTLDPAAFPLASAPPIEVSCSRQ
                     SFNFKRTDSLFNAKFMKSLFPLSLNEEYDLLVKKVEPKNYPPSNLYPKPVNNLIGYSS
                     IRLPSMERFVIESGKLAKLDKMLVRLKKEGHKVLVYFQMTKMMDLMEEFLTYRQYKYI
                     RLDGSSKLSDRRDLVHDWQTKPELFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTID
                     SQAMDRAHRLGQTRQVTVYRLLVRGTIEEKMRNRAKQKEHVQQVVMEGKSGNNPAFDD
                     KKDKREVAMMLMGSDDELNTSADEVVVSSTVA"
     gene            <716722..>717321
                     /locus_tag="PAS_chr1-1_0088"
                     /db_xref="GeneID:8197214"
     mRNA            <716722..>717321
                     /locus_tag="PAS_chr1-1_0088"
                     /product="Essential protein that binds ribosomal protein
                     L11"
                     /transcript_id="XM_002489684.1"
                     /db_xref="GeneID:8197214"
     CDS             716722..717321
                     /locus_tag="PAS_chr1-1_0088"
                     /codon_start=1
                     /product="Essential protein that binds ribosomal protein
                     L11"
                     /protein_id="XP_002489729.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0088"
                     /db_xref="EnsemblGenomes-Tr:CAY67448"
                     /db_xref="GeneID:8197214"
                     /db_xref="GOA:C4QW25"
                     /db_xref="InterPro:IPR007023"
                     /db_xref="UniProtKB/TrEMBL:C4QW25"
                     /translation="MSGKSATVDKPIPVAYDLGNLAVFDSNPLESNKLSDASQVNEYL
                     EQVTRDNTQLLINQILSQPVRNTTDSVSEGQEASIALITLPDPSTPLPREKSVPKPRE
                     MTRWEKFAAKKGIQAKGKTGKMIYDEESGEWVPKWGYKGNNKQLDNQWLVEMNEKTEE
                     KDKDTLIDPRTLARAERKKLVKKYELQQKKNLKAQGKGK"
     gene            <717463..>718425
                     /locus_tag="PAS_chr1-1_0089"
                     /db_xref="GeneID:8197215"
     mRNA            <717463..>718425
                     /locus_tag="PAS_chr1-1_0089"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489685.1"
                     /db_xref="GeneID:8197215"
     CDS             717463..718425
                     /locus_tag="PAS_chr1-1_0089"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489730.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0089"
                     /db_xref="EnsemblGenomes-Tr:CAY67449"
                     /db_xref="GeneID:8197215"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="UniProtKB/TrEMBL:C4QW26"
                     /translation="MLQYKVVIDSMIQCCDLDSVSVNDIASRTQELFGHRFGKQERKK
                     LESLIESRFLYFLQRDHLRTPGDAQIEKENLSLALKINFQPITDDPEFQPTRISKKKK
                     PVGLRLIGKLARFCNTEFLSAEAAIERIQNYAKFHEILDYQKNEIHCDEPLKKLLESD
                     IVPVDKIGEIIFKYTRPLSKNEILDVQTQRSTDQLIPRYKQIPPLLVDVLGKGPLLLL
                     DIHQRIRSYVVKKGLLDGNYVLPDGLLSQVVGQSKISYPSFRRNVVRWIDENGRLATP
                     NEENTTTEHISSTNESDSSNSDGESSNTGDSSGSSTSDSELDSE"
     gene            <718642..>722394
                     /locus_tag="PAS_chr1-1_0090"
                     /db_xref="GeneID:8197216"
     mRNA            <718642..>722394
                     /locus_tag="PAS_chr1-1_0090"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489686.1"
                     /db_xref="GeneID:8197216"
     CDS             718642..722394
                     /locus_tag="PAS_chr1-1_0090"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489731.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0090"
                     /db_xref="EnsemblGenomes-Tr:CAY67450"
                     /db_xref="GeneID:8197216"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR014770"
                     /db_xref="InterPro:IPR014772"
                     /db_xref="InterPro:IPR019558"
                     /db_xref="UniProtKB/TrEMBL:C4QW27"
                     /translation="MYNRYSPFTHLSQMSVDISSLSISGTGFDEIAMDQYHQILKVAI
                     ASYRVEPRFRKRVLPRHVSNDENSDSHFKKPKVIKVSSRTISDLRKYLNPLKKGKPVK
                     LISTSLSTQVFNALLTYLTKLDKSKQLETIEKPENFLRQFMLIATRELKTLKGQMFMD
                     SLDTQTTIFLSIMQEVVKNDKEGDSIMKKLQEARFTLSSSSNNVNDFEYIMPSFKLSE
                     MSLAQHVGAIFQIDDKELQNDILSLKNNITPDKIIHDQKTYLVNCLKQQHLVYQKRDF
                     LDSSSFTNWLKVESLNTENYISQIDSKPVNLCEPSAFFNLVPRSSALYYQTLLEKCMR
                     YDSRMNASSNTPLLSTSSRELIEECVKIWRIDAFTAMIYFFKTSCSTVLSTSDGSINS
                     DLFFLVLNLMKKYLTDLKLSIDKSTWPSKTRLEWIDCLEICYLKTMKGIQTCISQVLT
                     SKPPFSQYLNVLAEIEQDSLFRNIVAKHVPDKLEKQLIHKLNDTILLRYKDLLTEIPT
                     DNTIDLIHIADLSRKIVEDTKMLQKRYKHPLLGKIPIAPTYAKRIITDFAVDAKYMLK
                     SIKQNSADISFADALDIYKTLSEIRDIFTQVTDTPFKFDLEKGFYKYLKNWAINASEQ
                     IVAVTNTAVAQDDLGCASPENDILYSTSVKDIFMMINQNVSFLKDLNWKNEYHLAKVS
                     TLLFQYISMALITYCDKMYDTIVADLDEEDQKNVATTLPGETNSYDSLLSGTSAWIAD
                     MKAAVTRSQKLTPPEPYAFKNRTCVALNNIVQCLQNLDELEDILDPEYVSNVMNRENP
                     SIFKEYTNHFFTIKVVQAEGIKSPVGKDAPDANVWLSNNNTKKVFARTRTIPSSDRPE
                     WDEEFEVVLFPGASVSILATLWDKSFKRFSSDAVIGRTLFHLSPKEFNNNGIPRDLIL
                     NLDTEGTLVLQVSLESEREDALFCMGKTRRSLIHARDRVIKLMVGKFSPFIQFAFSRD
                     VLKNACGSNGLLLISEEQRIDVILPLFDYLNSNLDILARILPESLLQKVILQMWNVVL
                     ASAEHLILPLLSTVKMAKNSNKLWSNINFNSGMNIAGFGRPLTPLEVKTVFEWLHVLC
                     YEQFYNEGEGASLEKLQNYQYKLLLKVSEHYEKPVGEILSKVRECEPMTIEHIRERNY
                     FYITVDSKEKKLTRAATIARQKTIGAQGSKKQMHKAAEDVKIAQETDSNANAAAFEDM
                     LLRILLTKGEMGFVAERLEQREKFTQSVSAESFARAAAAGAFNGIR"
     gene            <722604..>724754
                     /locus_tag="PAS_chr1-1_0091"
                     /db_xref="GeneID:8197217"
     mRNA            <722604..>724754
                     /locus_tag="PAS_chr1-1_0091"
                     /product="Protein involved in programmed cell death"
                     /transcript_id="XM_002489687.1"
                     /db_xref="GeneID:8197217"
     CDS             722604..724754
                     /locus_tag="PAS_chr1-1_0091"
                     /codon_start=1
                     /product="Protein involved in programmed cell death"
                     /protein_id="XP_002489732.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0091"
                     /db_xref="EnsemblGenomes-Tr:CAY67451"
                     /db_xref="GeneID:8197217"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:C4QW28"
                     /translation="MSKEIIYDENEDGWSYSFPSSLDNLQDTLIDSKAPDEISIPSDT
                     EEDKEKNHAEVPPVDIKESSILLEVTDDSFAKNSVKVTKRNGSNGHRRLARLNEKNGS
                     YSSSTSSLAPSFLVKPSPAADPFLSKPPIQLQRYDDIDFEERSIIEDDEHSINSPSIR
                     TGTTLTSPTTPKSRNSNGEPEKSVAKEQLKSLNIDQPIPEESTVENNGITATSPDMLS
                     YRKSSRKKTVTSISSVDDVAPPSPNDTRTSTRDSFDRSLYADELYLDTRYRYATPERN
                     TAFHDLFKNIPLDDRFLDDFSCALSREILVQGRIYVSERHICFNANILGWVTNLEIPH
                     QDIVSFEKRTTAGIFPNGIVINLKDTKHSFLSFISRDSIFNFFETIWSKSVSKIQLEN
                     ENSDVIPHALTHYSRDMASEDQERINNIILSIDTDEEAENQQLQKVRVVRAKEKSEYK
                     SDGPETHVPTSADIDLSNETVLCEDILNAPIGLTFNILFGENIKFHQFLMDKSDGFDF
                     TSYGEFVNNKRGFEYQKSLGYSIGPKSTKCVVKESIEHFDYDSYIMVLTETKSPDVPS
                     GGSFSVNTRYIFTWAKGNKTKLTLSYFINWTGSSWIKSMIEKSTAQGQKSFSELLFKQ
                     LKLVIAENTLVVAGDEEVPVTFSQEQVEEPEKATEKVQHSEKSVTETTESSKFDVWHL
                     LVLLLIVLQILTYRELLATKQEMKLLAQSLSTKK"
     gene            complement(<724789..>726603)
                     /locus_tag="PAS_chr1-1_0092"
                     /db_xref="GeneID:8197218"
     mRNA            complement(<724789..>726603)
                     /locus_tag="PAS_chr1-1_0092"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489688.1"
                     /db_xref="GeneID:8197218"
     CDS             complement(724789..726603)
                     /locus_tag="PAS_chr1-1_0092"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489733.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0092"
                     /db_xref="EnsemblGenomes-Tr:CAY67452"
                     /db_xref="GeneID:8197218"
                     /db_xref="GOA:C4QW29"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="UniProtKB/TrEMBL:C4QW29"
                     /translation="MISVFDSGDATVPDLPDFSSNFSDDLVHEYKINARKEDDFNTSD
                     FSHTDEDDDSSDSTQPTTTVGKKKKKFYQIYQEPPAHKPRRPKAKNFRNYGNSNTSSS
                     EARKRANWEPGIDVLTTDVVLNTIGSSITVTDYSQSRYRIQHLEVPPDSDSTSNLPLI
                     QALSSKHEWGKVRWINVNGLSWNAISTISAHFKIHRLAIEDMVDIPQRTKIDQYPEHT
                     FCCLPLVKLVKIKQSQDTKRRWFKLPKRKKSNNKATVPTRAELNSSDDSDSETITERL
                     AKTEMRKISVKLPSNTQIYRRLQQLQPLSYRKLAIGIEQVSLFLFPDNVIVTFFEHSA
                     HDIENAIFTRLTPDGSTILQKSCNPYILMQSIIDAIVDLSYPIMTAYRRKLSEMELQI
                     LDAPKIVHTRQLHLMISELSLLKQAISPTTSLLGSLRDYSNKHSIVISSKQQPKEFFE
                     DCSLYLDDVKDHTLTYTNDIDMMTSQIENLVDLIFNTISVDTNSSMQQLSLVTVIFLP
                     LSFWTGYYGMNFESFGDLEHNVSYYWKIAVPFCIVLLVLIMWMPLKSLLNIWTNKVRL
                     SKSHLYIPTKIQSTSRPREQTNKTSEMSTGHPTTNNIV"
     gene            <727061..>727720
                     /locus_tag="PAS_chr1-1_0093"
                     /db_xref="GeneID:8197219"
     mRNA            <727061..>727720
                     /locus_tag="PAS_chr1-1_0093"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489689.1"
                     /db_xref="GeneID:8197219"
     CDS             727061..727720
                     /locus_tag="PAS_chr1-1_0093"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489734.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0093"
                     /db_xref="EnsemblGenomes-Tr:CAY67453"
                     /db_xref="GeneID:8197219"
                     /db_xref="UniProtKB/TrEMBL:C4QW30"
                     /translation="MINIAKCRLPKYSRIATLSSMLSPHSYLKATVATRCYSSLNNEI
                     DLERQKRKTNIGTMIQYLETKVPNLLHETIDRELLDEKIKLRILPNSFHFFPTIQGPV
                     KYISLWETVTSFLTRFIIEKKNTKLVITNICVNEKNPDGDKSSDSSSDSKNDSIDAYG
                     LYGSTSKIVIRFKSDNKDKFITGIFVFELNRDNDRILVHTIDNVEIVNDKKVDMLLAM
                     D"
     gene            <728325..>728690
                     /locus_tag="PAS_chr1-1_0094"
                     /db_xref="GeneID:8197220"
     mRNA            <728325..>728690
                     /locus_tag="PAS_chr1-1_0094"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489690.1"
                     /db_xref="GeneID:8197220"
     CDS             728325..728690
                     /locus_tag="PAS_chr1-1_0094"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489735.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0094"
                     /db_xref="EnsemblGenomes-Tr:CAY67454"
                     /db_xref="GeneID:8197220"
                     /db_xref="UniProtKB/TrEMBL:C4QW31"
                     /translation="MMSGFVHRLSCGLLDFPLPILGKRTFERNPDKKKVINRADLIEL
                     ILEERQKEKPGRKRRSAGRRRHSTENFSRSSNSMNDDLVQKDPLSNQRTRDSLSPRTE
                     VMFDDSNLSHPGVGYEQVR"
     gene            <729044..>730765
                     /locus_tag="PAS_chr1-1_0472"
                     /db_xref="GeneID:8197221"
     mRNA            <729044..>730765
                     /locus_tag="PAS_chr1-1_0472"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489691.1"
                     /db_xref="GeneID:8197221"
     CDS             729044..730765
                     /locus_tag="PAS_chr1-1_0472"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489736.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0472"
                     /db_xref="EnsemblGenomes-Tr:CAY67455"
                     /db_xref="GeneID:8197221"
                     /db_xref="InterPro:IPR013948"
                     /db_xref="UniProtKB/TrEMBL:C4QW32"
                     /translation="MLRFQISPVPGSRRVPMTVELVRQAPSLHSFLNSSHILMKDLVS
                     FNTTGSHKSFITIHLDSSEIQLDSMQNFYIKLYLGNITLSKSFQYGLLTRVYKKLWCI
                     IFIEELDLQHNDHQFSKNDCTIEPTLEDESSLTFDVVPENESLVDLLHIEPEALPSYD
                     ELQVSELLTSRYFKSLYLDTSSLQIFIKSSLIKYRNISSVDKLAKLAQLSSLVIDPST
                     FDQRHLDENITSPEKLIIHRDEPSYRTHAFKENSHSLDDLTALKLREIQLQVLLLLEI
                     LNLQEFDHIPAQKPAHIPFKSRIRSKRQLVPTLIGTVIEKENTSAPPSSFVNISTSSA
                     SSNETLISKYLAYIDKLLVYDAINSQKVTYTFYKLIYPYYIKQLPTLLKHLYTKIKGV
                     SPEKISLKRKKPPRPAQVQRSQSQPSGDQPIPVSLKRTGSALSDMQRKMFDMSTHHKE
                     KEKSTAPPALPQQVDSFIFSKSKKSLSLASQIEIQETPKKSRIQVKETPIKQLKTSPE
                     EEYITSLSPTKPFRKLQTVTPTPSPKKTRPGEQIAIESSPFFQTTAGEYEEDRLVSSP
                     VFSDANE"
     gene            complement(<730793..>732250)
                     /locus_tag="PAS_chr1-1_0095"
                     /db_xref="GeneID:8197912"
     mRNA            complement(<730793..>732250)
                     /locus_tag="PAS_chr1-1_0095"
                     /product="Subunit (60 kDa) of TFIID and SAGA complexes"
                     /transcript_id="XM_002489692.1"
                     /db_xref="GeneID:8197912"
     CDS             complement(730793..732250)
                     /locus_tag="PAS_chr1-1_0095"
                     /codon_start=1
                     /product="Subunit (60 kDa) of TFIID and SAGA complexes"
                     /protein_id="XP_002489737.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0095"
                     /db_xref="EnsemblGenomes-Tr:CAY67456"
                     /db_xref="GeneID:8197912"
                     /db_xref="GOA:C4QW33"
                     /db_xref="InterPro:IPR004823"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR011442"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4QW33"
                     /translation="MSKNSQRSSIPTSHTLWSPSDTVKDAAESLGIFNLNEEAAKNLA
                     MDIEYRIHEILDQASKFMRHGKRRTLHTSDIDRALKVLNLEPLYGYDVSRPLVFKEAL
                     VGAGQNLYYVDDDEVDFEKLINEPLPKVPRFSTFTAHWLAIEGVQPAIPQNPSPNDIK
                     NILPINRGSMENMFSLINDEVKEDTNEEFTSTGPSVSSNISNQKQGLEVKPLVKHVLS
                     RELQLYFDKIVEVLLNQEETKEAELLRNSALQSVRADPGLHQLVPYFIQFISETITKN
                     LKNISLLSTMLELIYSLLMNESLFLEPYVHAIIPCILTLLLAKKIGNVDDELQKQQQL
                     ALRELSASLLERVIEDFGSSYSTLKPRITRTLLRAFVSVNNTTPGTQYGALLGLRGLG
                     SEVIRIVVLGNVINWSSTFLEKLQQEDQVFLIDTLIETLRVLTKEGKLVKDMKTENGI
                     DNERLKQRVGDLIADRIQACDDAQDIYWGIFFGEV"
     gene            <732675..>734528
                     /locus_tag="PAS_chr1-1_0473"
                     /db_xref="GeneID:8197222"
     mRNA            <732675..>734528
                     /locus_tag="PAS_chr1-1_0473"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489693.1"
                     /db_xref="GeneID:8197222"
     CDS             732675..734528
                     /locus_tag="PAS_chr1-1_0473"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489738.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0473"
                     /db_xref="EnsemblGenomes-Tr:CAY67457"
                     /db_xref="GeneID:8197222"
                     /db_xref="UniProtKB/TrEMBL:C4QW34"
                     /translation="MFRILANSSTKQGQRVSSKLVQHNSPSGRLFNTQSPASASKNAN
                     SSASTILHDEEPPRPLRDFNQKKNKKNFRPYFQVQTPEDSAFKNELLAFDNYSSQNTT
                     YDLSSESVTYVSPTFWDAIIGIMPIYRQLLESGELTSSRVQNLVSFLRNGLRMNRLEL
                     KKLKNKPDFDSSSKNNQMYEFLLSSVREVSNDLLDEKFSPNVSLTSLLIDCFRDMQLP
                     EEAISFWSNGKQIPNLTEIFEGQMVLGAVLPILADAHEANFDELYPKYLELQKNVAAE
                     HKVLHPKFLLGMIRVCLSNNKVDESLQIFKSLVNNLYQNNDGKTPLPHQKSNVTMAHL
                     SFIGYCKNIDTADVFFNDAMDNKLPYHTPLQLNFINSYMNNTWEVTRDFERVKTIWIK
                     TWNNYASKKYLPRMISSSFNNVFFNIFFQKYPQYSAESIKELKQLIVSYSQIRPLDEP
                     FLNVLTSKCQQWRSLEVIDSIQEAYKTYNIEPTLVAHRCLLKALGSVDVPPQRIQQTF
                     ENLLLLHDANREAFLAPADLTSLKSATIRSPILDELPGGRDERVKLFFQLFKVYGPYL
                     KSTKALDRWIASDIEQDPSLAVWYKSLGSLDVSKVNRLNLPRMKRNEQFRV"
     gene            <734684..>735997
                     /locus_tag="PAS_chr1-1_0096"
                     /db_xref="GeneID:8197913"
     mRNA            <734684..>735997
                     /locus_tag="PAS_chr1-1_0096"
                     /product="GTP-binding alpha subunit of the heterotrimeric
                     G protein that couples to pheromone receptors"
                     /transcript_id="XM_002489694.1"
                     /db_xref="GeneID:8197913"
     CDS             734684..735997
                     /locus_tag="PAS_chr1-1_0096"
                     /codon_start=1
                     /product="GTP-binding alpha subunit of the heterotrimeric
                     G protein that couples to pheromone receptors"
                     /protein_id="XP_002489739.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0096"
                     /db_xref="EnsemblGenomes-Tr:CAY67458"
                     /db_xref="GeneID:8197913"
                     /db_xref="GOA:C4QW35"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR002975"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QW35"
                     /translation="MGCGASTMEMDERYYEQKRINDAIEKSLKSHQKVERSQLKMILL
                     GAGESGKSTVLKQLRLLHKDGFQYQERLQYAQIIWVDAVQSMKLLMIHARRLHIPLKC
                     DEPDSPFSQAKKLILRYRCLDVGTIGDESFLKDYVMKYSDGGESRRKRMGTGQADALW
                     DRNLEQSERLLGDSAETELENQELEELKESRPTGDFAARKQQRQQLANAIQLLWAHDP
                     GIQQCYNRAHEFQLEASTRYYFENIQKFADPDYICSDTDILKGRIKTTGITETDFNIG
                     STRLKVLDAGGQRSERRKWIHCFEDITAVVFVLAVSEFNQTLFEDERVNRVHEAILLF
                     ESLCNSRWFVDTPFILFLNKIDLLEEKLQQTNFKEYFPDYPGDVHNVDSVVTYLERTF
                     LSVNRTSKPVYVHRTCATDTQSMEFVLNATTDILLQNHLKKSGLI"
     gene            <736360..>737103
                     /locus_tag="PAS_chr1-1_0097"
                     /db_xref="GeneID:8197223"
     mRNA            <736360..>737103
                     /locus_tag="PAS_chr1-1_0097"
                     /product="Cyclin, interacts with Pho85p cyclin-dependent
                     kinase (Cdk), induced by Gcn4p at level of transcript"
                     /transcript_id="XM_002489695.1"
                     /db_xref="GeneID:8197223"
     CDS             736360..737103
                     /locus_tag="PAS_chr1-1_0097"
                     /codon_start=1
                     /product="Cyclin, interacts with Pho85p cyclin-dependent
                     kinase (Cdk), induced by Gcn4p at level of transcript"
                     /protein_id="XP_002489740.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0097"
                     /db_xref="EnsemblGenomes-Tr:CAY67459"
                     /db_xref="GeneID:8197223"
                     /db_xref="GOA:C4QW36"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:C4QW36"
                     /translation="MIFNDYQATSSTTVVTVKTGNDNLGVHVKALKAPIADKVQKSEQ
                     IQSVDSVSLVHAAAIMLQLNWPWQVYQSYDSKLRGLQFFITEVLKRTKAKIGVLEVAL
                     YYIHKLSLRSTKVRCAKRIFLSCLMLSYKFTQDKNYTANTWSRVSGLSVQELMQNEIA
                     ILVDLEYKLFIDLETFSKWKESLQALAYGAPKSRMISLASAMARPNIPPSLSCSDDES
                     DSTMEPISLKRRVHDRSLPVQTTKRVHLS"
     gene            complement(<737148..>737888)
                     /locus_tag="PAS_chr1-1_0098"
                     /db_xref="GeneID:8197224"
     mRNA            complement(<737148..>737888)
                     /locus_tag="PAS_chr1-1_0098"
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /transcript_id="XM_002489696.1"
                     /db_xref="GeneID:8197224"
     CDS             complement(737148..737888)
                     /locus_tag="PAS_chr1-1_0098"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /protein_id="XP_002489741.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0098"
                     /db_xref="EnsemblGenomes-Tr:CAY67460"
                     /db_xref="GeneID:8197224"
                     /db_xref="GOA:C4QW37"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:C4QW37"
                     /translation="MLRVSNLSRRLGVGSLGRFVTSPLLQKTPVQIFRFNSSQNKDVY
                     DLWIQSIQELRKELNDKPWIPEVSLAPPGQARADMRDTSHLQWQPTQEQLEQIAELKS
                     KPIPLKNDPLIEHCTNLIMKDGLKYKANQYLSKALYLVFLQKRKDPVELLRGCLDSLG
                     PLCSTKTMKTGFAKNVTVPVPLSTRQRNRLAFKWILEGSDKRASKDFSVRLAEEIISV
                     IDGKSSGFEKRSLMHKQAALHRAYLKLK"
     gene            complement(<738072..>739382)
                     /locus_tag="PAS_chr1-1_0099"
                     /db_xref="GeneID:8197225"
     mRNA            complement(<738072..>739382)
                     /locus_tag="PAS_chr1-1_0099"
                     /product="Core subunit of the ubiquinol-cytochrome c
                     reductase complex (bc1 complex)"
                     /transcript_id="XM_002489697.1"
                     /db_xref="GeneID:8197225"
     CDS             complement(738072..739382)
                     /locus_tag="PAS_chr1-1_0099"
                     /codon_start=1
                     /product="Core subunit of the ubiquinol-cytochrome c
                     reductase complex (bc1 complex)"
                     /protein_id="XP_002489742.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0099"
                     /db_xref="EnsemblGenomes-Tr:CAY67461"
                     /db_xref="GeneID:8197225"
                     /db_xref="GOA:C4QW38"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:C4QW38"
                     /translation="MLSKRFLSTAAGKARFTQLTNGLVIASKKVPSTYTTIGVYTGAG
                     SRAENPYNSGVSSLLVQSLANASKDAAAKEGVIVDSENYREVSSISTTIAKGNEAAAF
                     KTLESILTNSLKSLEDASFIREQANIAGEKSDAVELNPEQTVIEHLYSTAYQGTSLAL
                     PVYGKGEVVSTLEPADLISFFKKSFVASNTALVATGDVDHEKLVEFASKLNITEGLKP
                     HVQPAQFLGSEVRFRDDNLPSAYVAIAAEGESLLSRDYFVAKVAAQVNGSYLNSDPTS
                     ALQGSKLSTIVKENHLADSYYHFSTSLTDSGLWGFYTQSSNIINLDDLIHFTLKDWNR
                     FSTTISEVEVERAKAQLKVLLLSKDDTVEKLNASLGINAIVSGYEQSSEEIISRIDKV
                     SVADVTRWAGSKLWDQDIAISATGQIEALFDYNRLRNDMSQMRW"
     gene            <739779..>740126
                     /locus_tag="PAS_chr1-1_0100"
                     /db_xref="GeneID:8197226"
     mRNA            <739779..>740126
                     /locus_tag="PAS_chr1-1_0100"
                     /product="mitochondrial 37S ribosomal protein MRP2"
                     /transcript_id="XM_002489698.1"
                     /db_xref="GeneID:8197226"
     CDS             739779..740126
                     /locus_tag="PAS_chr1-1_0100"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP2"
                     /protein_id="XP_002489743.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0100"
                     /db_xref="EnsemblGenomes-Tr:CAY67462"
                     /db_xref="GeneID:8197226"
                     /db_xref="GOA:C4QW39"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="InterPro:IPR018271"
                     /db_xref="UniProtKB/TrEMBL:C4QW39"
                     /translation="MTMKRFPIPTKIPSTYINGRVLRDHFKRQQAAANEVTVQALKFI
                     ARNTLLPKRTRVEAQLQLTSMPYYTYMNQVSNRCVDSGRGKGVFRDFRLCRTQFREQA
                     LAGELPGVMKGVW"
     gene            <740817..>742283
                     /locus_tag="PAS_chr1-1_0101"
                     /db_xref="GeneID:8197227"
     mRNA            <740817..>742283
                     /locus_tag="PAS_chr1-1_0101"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489699.1"
                     /db_xref="GeneID:8197227"
     CDS             740817..742283
                     /locus_tag="PAS_chr1-1_0101"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489744.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0101"
                     /db_xref="EnsemblGenomes-Tr:CAY67463"
                     /db_xref="GeneID:8197227"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C4QW40"
                     /translation="MFSISSVSIHIDPLYRKQVYASGDIIKGTIQLNVPKDISLKGID
                     VKLEGISKATAKFRKRHTHENNKYIWITETHRFLFHDDKVFPPKNIQAVTHATEFDLI
                     AGEYSYPFEFVLPDTSNCYRKPLVELADSYGRACNKHYYGFVAHKNCYLPPSFSYRDA
                     NIKYFIKVTARRSALLKANLREIVPFVFLPDDSLISRDVPVGTPVYAKKVIDFPNKRV
                     GQIFQKSGGVQTRKECTTGTTRRKRSIFGFGKGSDDADFPSSPLEIDFDIVLLNGATL
                     TPGHPLDLQIILGTSNPSQFFMDNGESNLLGRVCFTHFEIELERDTFYSVGHKHINHA
                     NKVKVFESKELNMWLDMADAQPVSETEAKLRIPTDFLESVVVPRHLPPTFYSCNIYTK
                     YSLHITARFGDSDHRPKKTFAIFPITLLSGIDRRMGPPPPPPQDGIPVEIPPTPSKEA
                     KTSAPAPVYSPQEPEQLPSYQSALTDATTETHGQSNHT"
     gene            <743021..>744790
                     /locus_tag="PAS_chr1-1_0102"
                     /db_xref="GeneID:8197228"
     mRNA            <743021..>744790
                     /locus_tag="PAS_chr1-1_0102"
                     /product="Histone methyltransferase with a role in
                     transcriptional elongation"
                     /transcript_id="XM_002489700.1"
                     /db_xref="GeneID:8197228"
     CDS             743021..744790
                     /locus_tag="PAS_chr1-1_0102"
                     /codon_start=1
                     /product="Histone methyltransferase with a role in
                     transcriptional elongation"
                     /protein_id="XP_002489745.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0102"
                     /db_xref="EnsemblGenomes-Tr:CAY67464"
                     /db_xref="GeneID:8197228"
                     /db_xref="GOA:C4QW41"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR006560"
                     /db_xref="UniProtKB/TrEMBL:C4QW41"
                     /translation="MLASQSEEEPFSFYMWCDMPSRPSRNSLKDSTYLPLSELLEHGE
                     APTTRPSRKLTRSIEQCKKWVACIDHSNFPGHWSVGKRGCRTKVQLQMQLILSAATGS
                     PLKLWIFSQRGLEVVSFLLIPKPEALQFVSPTRKQKRKIVSLPNSNFRATTAEWANLA
                     KNIWRSSKEHDKVIKNSRSLRDYNSCNCRVNCGDLCLNRILQIECDSTICKLSETRSC
                     GNTQFTTLELGISSLFREGTRVCRIDDKKGYGLVAIREFAPYELICEYTGEVINQEVV
                     KERLSKKKVFHYYHLSLEQGLSIDSTVKGSVARFVNHSCAPNAEVQKWYVQDEPRIGL
                     FAGSKGIIPGDEITYDYNFIWLENAEPQLCYCQSANCRGVIGKKHSPSPVSQPTKSSK
                     RTPQEGSQPSRKRGQHKIKDNQLLKTEKDTDARRLRRSIRHKGLAPDVGNTLQRLPLH
                     VRKQLSIDMAPPGKADDISRQLLAVLLPTEGRTRSSRQRKVVEACIKTGIPLKYTGLD
                     IKEPFPKKRVNKRNSARKLRSSSKSSSTSKKSASETLILKEEPKNHPPPPRVSEKLKI
                     AHIIHSSEESLSSIPFHPINQIN"
     gene            <745240..>746157
                     /locus_tag="PAS_chr1-1_0103"
                     /db_xref="GeneID:8197229"
     mRNA            <745240..>746157
                     /locus_tag="PAS_chr1-1_0103"
                     /product="Chitin deacetylase, together with Cda1p involved
                     in the biosynthesis ascospore wall component"
                     /transcript_id="XM_002489701.1"
                     /db_xref="GeneID:8197229"
     CDS             745240..746157
                     /locus_tag="PAS_chr1-1_0103"
                     /codon_start=1
                     /product="Chitin deacetylase, together with Cda1p involved
                     in the biosynthesis ascospore wall component"
                     /protein_id="XP_002489746.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0103"
                     /db_xref="EnsemblGenomes-Tr:CAY67465"
                     /db_xref="GeneID:8197229"
                     /db_xref="GOA:C4QW42"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="UniProtKB/TrEMBL:C4QW42"
                     /translation="MTQKTQYIIILLTLIVSAFSESSGQNADGALPSDSTEIFKTQPF
                     PDWLHAFTGLNAWPDENPPYIPLEFIDFENIVSDPRREFGTCPPDRSTCSFDCYKCIS
                     FDDAYTCPKLSQTFDDGPSPSTPKLLAALTHNTTFFTVGLNVVKYPEVYQQIQQKGHL
                     LGLHTWSHKFLPSLSNEEIIAQFQWSIWAMNATGHHLPKWYRPPYGGIDNRVRSIARQ
                     FGMQAVLWDYDSFDWKLESVPPQRTESEIYSDVQRWRHKTWSPAGLILEHDGMPKTVD
                     AGIEISKIIGPDQLTVAECVGGIDYIRTF"
     gene            complement(<746154..>746834)
                     /locus_tag="PAS_chr1-1_0104"
                     /db_xref="GeneID:8197230"
     mRNA            complement(<746154..>746834)
                     /locus_tag="PAS_chr1-1_0104"
                     /product="Putative protein proposed to be involved in the
                     metabolism of purine and pyrimidine base analogues"
                     /transcript_id="XM_002489702.1"
                     /db_xref="GeneID:8197230"
     CDS             complement(746154..746834)
                     /locus_tag="PAS_chr1-1_0104"
                     /codon_start=1
                     /product="Putative protein proposed to be involved in the
                     metabolism of purine and pyrimidine base analogues"
                     /protein_id="XP_002489747.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0104"
                     /db_xref="EnsemblGenomes-Tr:CAY67466"
                     /db_xref="GeneID:8197230"
                     /db_xref="InterPro:IPR005269"
                     /db_xref="UniProtKB/TrEMBL:C4QW43"
                     /translation="MTQHEKTICVFCGSSYGNSELYAKLAYELGVKLAEKRYGIVYGG
                     GTTGLMGAVANGCASNGGYVHGVIPEALITRERIDSKQFNESIKSTVDNHTGVTPIPE
                     EKEYGKTTIVKDMHTRKRLMSTEANAFIALPGGYGTLEELMEIVTWSQLGIHDQPIVL
                     FNIDGFYDGFIEFIKTAIQSGFISERNGDIIVVANTIDEVLVGIDDYKVPEGRFKLKW
                     NDECGEAH"
     gene            complement(<747000..>748916)
                     /locus_tag="PAS_chr1-1_0105"
                     /db_xref="GeneID:8197231"
     mRNA            complement(<747000..>748916)
                     /locus_tag="PAS_chr1-1_0105"
                     /product="MAP kinase kinase that plays a pivotal role in
                     the osmosensing signal-transduction pathway"
                     /transcript_id="XM_002489703.1"
                     /db_xref="GeneID:8197231"
     CDS             complement(747000..748916)
                     /locus_tag="PAS_chr1-1_0105"
                     /codon_start=1
                     /product="MAP kinase kinase that plays a pivotal role in
                     the osmosensing signal-transduction pathway"
                     /protein_id="XP_002489748.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0105"
                     /db_xref="EnsemblGenomes-Tr:CAY67467"
                     /db_xref="GeneID:8197231"
                     /db_xref="GOA:C4QW44"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4QW44"
                     /translation="MTDSVSSSFNNLNLLDDFDEETAELEKLQEEQKPSISRNSSTNR
                     RQQQNGGVNDALRARVRAFQEKRRTQQDKNETSDDTSSPNSLAESPFSSPGVAPAHAD
                     SPKTTWNVKPSPQSPVEFEPDRYTLPKIKPKVVLPQQPKKSLSEPNTLHRTKPKPNLS
                     LSQLKSYNEVDESKKSQLAQQSLRGTPIQPARALPNQQNARVPKTKLSLSERKGLNLN
                     CNLGTNSLKDNSRSMTVGEVLSKRGQLPRQNKQPPKAQVKPPPPQQQQQPAGGMFANY
                     TKYIDVESGSLNFSGKASVHSKGIDFSSGSSFRISLDDLEYIEELGRGNYGTVSKVLH
                     KPTNVIMAMKEVRLELDESKFRQILMELEILHNCVSNCIVDFYGAFLVEGAVYMCIEY
                     MNGGSLDKIYADVGIPEPQLAYITKCVVSGLKTLKDKHNIIHRDVKPTNILVNDQGKV
                     KLCDFGVSGNLVASMARTNIGCQSYMAPERIKSVNPDDISYTVQSDIWSLGLSILEMA
                     KGCYPYPPETYDNIFSQLSAIVDGEAPTLPEGKFSLEAQDFVAQCLQKDAKLRPTYAL
                     LEKHPWLQRYDDDEKNVEDMKIFVTQRLQDIESAKLVAVDTEKQPNSAPATSAASVFE
                     YKKVPALHRGGLPK"
     gene            complement(<749263..>752181)
                     /locus_tag="PAS_chr1-1_0106"
                     /db_xref="GeneID:8197232"
     mRNA            complement(<749263..>752181)
                     /locus_tag="PAS_chr1-1_0106"
                     /product="Subunit of the RNA polymerase II mediator
                     complex"
                     /transcript_id="XM_002489704.1"
                     /db_xref="GeneID:8197232"
     CDS             complement(749263..752181)
                     /locus_tag="PAS_chr1-1_0106"
                     /codon_start=1
                     /product="Subunit of the RNA polymerase II mediator
                     complex"
                     /protein_id="XP_002489749.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0106"
                     /db_xref="EnsemblGenomes-Tr:CAY67468"
                     /db_xref="GeneID:8197232"
                     /db_xref="InterPro:IPR021665"
                     /db_xref="UniProtKB/TrEMBL:C4QW45"
                     /translation="MTKISWSKNGFIAYTDVKSPFMLCMSYLECLDGRRWQMAPPIMI
                     DVGASINQFHTNALSNNKVNGRSVSGLQIQKVTWNGTGTDLAIADSLGNISIFIAGVE
                     LTNSPNSSTPSFAMTLLTNMEIIYYDEQGVSQVNSLKWLNLNKPIIANVPAVKVETTK
                     DTTVSSGCAARQGAFVEDANWNAYSYGVHQYKPYGTSHPIGAKHALFVVRDHGDITLY
                     YQGEHGLAYYRCSAVLPECSYVNCSSIGFTRDGDIIVAVYSKLEKTIQVYRCTIDWGY
                     LIDAAEQQKRNPSYTTPGEVKQSKLPSLSVELLQVEPVLEIDESGRLQTLKHMSIVSP
                     NYNSNTELDFLIGYESTTNDDEEVSTKIYRYQMANDQKIHILSAFLKIGESDKQFQDS
                     LPRDYSIRLKQVATYKGSILNIEFYNSDLFVVLTFTNGEIKVVNRINFKELLSPEQLV
                     VDGAIKFPSTALMLNDAGFQFPKLDMEKDDIIETSFSPNLTSLVSLNRNTNQLHFYNM
                     KRKLDCSLKGFMFITCVAMAFRYSYSCFTNTSCEDLFCCIHEEVARIAPHCDVDKLNL
                     GIIQETHRSINFNIDFGREHVDKLLGSPPLQRLLSLQFSLSLYHGWKSSKSAAIANVI
                     LNIRTVGFALMYATRSMVMYANKVSKRGTMFATEDSKFQAESVVSCLGPIKWFMDFCV
                     ALTQQFIELDSQLKLKKSTSGDEFVAVPIVLGKIPRYFMMYCVSYIRRLYDFTKQSIE
                     KIEPNATLYKIENNTLELSQVKPFTKPLLEVFYSLKSILEESPVSLEAIDKFLNHVDE
                     ELKTEYYTRFGTGETRSLGTEQSLVFSGEIPSIFLNSPSILEMLNNKYSKFLCDNLSD
                     TYFYDTEWLRLEFVKKQLQNPSGPTVHCRTDLTRTEQTQENNHSIPNDNSRVDDLRKL
                     VFPYEVNVKKCTRCCSVSQLHEPISFGVSPVSIWLMAFQRSCICGGYWVHRNGPSASE
                     "
     gene            complement(<752478..>753851)
                     /locus_tag="PAS_chr1-1_0107"
                     /db_xref="GeneID:8197233"
     mRNA            complement(<752478..>753851)
                     /locus_tag="PAS_chr1-1_0107"
                     /product="NADP(+)-dependent glutamate dehydrogenase"
                     /transcript_id="XM_002489705.1"
                     /db_xref="GeneID:8197233"
     CDS             complement(752478..753851)
                     /locus_tag="PAS_chr1-1_0107"
                     /codon_start=1
                     /product="NADP(+)-dependent glutamate dehydrogenase"
                     /protein_id="XP_002489750.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0107"
                     /db_xref="EnsemblGenomes-Tr:CAY67469"
                     /db_xref="GeneID:8197233"
                     /db_xref="GOA:C4QW46"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR006097"
                     /db_xref="InterPro:IPR014362"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4QW46"
                     /translation="MVQPQEPEFEQAYNELLSTIQDSTLFEKKPEYKKVIDVVSIPER
                     VVQFRVVWENDKGELEVNRGYRVQFNSALGPYKGGLRFHPTVNLSILKFLGYEQIFKN
                     ALTGLNIGGGKGGADFNPKGRSDNEIRRFCYAFMSELSRHIGQFTDVPAGDIGVGGRE
                     VGFLFGAYKKIKNSWEGVLTGKGLTWGGSLIRPEATGYGLVYYVEKMIEHATQGKESF
                     KGKKVAISGSGNVAQYAALKVIELGGIVVSLSDSKGSIIAPNGITTQQISAIAEAKLK
                     FKSLEEITGSYSAFSDSPVKYIPGARPWVHVGDIDVALPSATQNEISGEEAKALVAAG
                     CKYVAEGSNMGSTLEAIDVFEGERASSSGTAVWYAPGKAANCGGVAVSGLEMGQNSQR
                     VQWTEEEVDQKLKDIMINCFDNCLNTAIAYSSETNKDSLPSLVKGANIAGFVKVADAM
                     YAQGDVF"
     gene            complement(<754663..>755049)
                     /locus_tag="PAS_chr1-1_0108"
                     /db_xref="GeneID:8197234"
     mRNA            complement(<754663..>755049)
                     /locus_tag="PAS_chr1-1_0108"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489706.1"
                     /db_xref="GeneID:8197234"
     CDS             complement(754663..755049)
                     /locus_tag="PAS_chr1-1_0108"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489751.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0108"
                     /db_xref="EnsemblGenomes-Tr:CAY67470"
                     /db_xref="GeneID:8197234"
                     /db_xref="InterPro:IPR003033"
                     /db_xref="UniProtKB/TrEMBL:C4QW47"
                     /translation="MSFKSEPLLQGIADTLSKNEALKERTLQKTRAIFVFNVKNKEGK
                     AKAWALDLKKAGTLTELKSTEELEELKPDATITIKDGDLRSLIRGKSNPQKLFMSGKL
                     KIKGNVAKAASIETVLKSTRPAKSKL"
     gene            complement(<755309..>756232)
                     /locus_tag="PAS_chr1-1_0109"
                     /db_xref="GeneID:8197235"
     mRNA            complement(<755309..>756232)
                     /locus_tag="PAS_chr1-1_0109"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489707.1"
                     /db_xref="GeneID:8197235"
     CDS             complement(755309..756232)
                     /locus_tag="PAS_chr1-1_0109"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489752.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0109"
                     /db_xref="EnsemblGenomes-Tr:CAY67471"
                     /db_xref="GeneID:8197235"
                     /db_xref="GOA:C4QW48"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="UniProtKB/TrEMBL:C4QW48"
                     /translation="MKLQLFTLTLSLMASSTLAAKAPKNKDSPSGAVARADFDDDKLH
                     GIIEFSTAKNKSVEVHVDITGLPETGGPFYYHIHKKPLKSGASCESTSTHFNPYNAPA
                     DCLKTKDDSYCQVGDLSGKHGYINTTCFEDSYYDPYISLNPKNKAYPVGLAINLHYAN
                     QERFACANIELVDKKVKREFDDVDAEFVGQIPESDNVVSAESVKEDTKVKSSKKDGSS
                     TSKPHVSKLSSKKNVTNGTSPLLSKGKYYTNSTSKYGNFTNGTSYPTDDDYDDDETIE
                     VSSSYANAAGYLLNGNTVYGATLAAIISYLV"
     gene            complement(<756510..>757226)
                     /locus_tag="PAS_chr1-1_0110"
                     /db_xref="GeneID:8197236"
     mRNA            complement(<756510..>757226)
                     /locus_tag="PAS_chr1-1_0110"
                     /product="Mitochondrial matrix protein involved in
                     biogenesis of iron-sulfur (Fe/S) cluster of Fe/S proteins"
                     /transcript_id="XM_002489708.1"
                     /db_xref="GeneID:8197236"
     CDS             complement(756510..757226)
                     /locus_tag="PAS_chr1-1_0110"
                     /codon_start=1
                     /product="Mitochondrial matrix protein involved in
                     biogenesis of iron-sulfur (Fe/S) cluster of Fe/S proteins"
                     /protein_id="XP_002489753.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0110"
                     /db_xref="EnsemblGenomes-Tr:CAY67472"
                     /db_xref="GeneID:8197236"
                     /db_xref="GOA:C4QW49"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="InterPro:IPR016092"
                     /db_xref="InterPro:IPR017870"
                     /db_xref="UniProtKB/TrEMBL:C4QW49"
                     /translation="MYRLLPRSYNSALSRTLCSSSIARSTYKTLRPTVAGDRQDDFFN
                     SLQFGEASKWSKHSLPRSRRLKDKNSNEEKDVSAASEDSSKPASVTSNSTSSPKLSTS
                     TATSTLTTSNNTVPPTQKTQKKRRALRPRKALITLSPSAVSHLRALSDLPEPKLTRIG
                     VRNRGCSGLTYHLEYVSEPGKFDELVEQDGVKVLIDSKALFSIVGSEMDWVDDKLSSK
                     FVFKNPNSKGTCGCGESFMV"
     gene            complement(<757456..>759591)
                     /locus_tag="PAS_chr1-1_0111"
                     /db_xref="GeneID:8197237"
     mRNA            complement(<757456..>759591)
                     /locus_tag="PAS_chr1-1_0111"
                     /product="Protein involved in negative regulation of
                     transcription of iron regulon"
                     /transcript_id="XM_002489709.1"
                     /db_xref="GeneID:8197237"
     CDS             complement(757456..759591)
                     /locus_tag="PAS_chr1-1_0111"
                     /codon_start=1
                     /product="Protein involved in negative regulation of
                     transcription of iron regulon"
                     /protein_id="XP_002489754.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0111"
                     /db_xref="EnsemblGenomes-Tr:CAY67473"
                     /db_xref="GeneID:8197237"
                     /db_xref="GOA:C4QW50"
                     /db_xref="InterPro:IPR000587"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:C4QW50"
                     /translation="MSTHGVQAKLSTYSLRQVHTTPATAPVAGRAPRSCNNCTCSPGL
                     LTRQGRMGSYYAKRLANRSKSVALGSASGVSRKTSSVLTVDSSCSEGLKEINTSRRLL
                     ELRKKMTEYDLGVYIVPSEDSHQSEYTGLADQRREFISGFTGSAGVAIITRNVQCMND
                     DPEGTSYLATDGRYFTQAANELDFNWNLFKLNIPGEISWEEFTVQLAVKMADESGFNV
                     KIGVDPQLITYSEAHLLQGLVDDVASGEKKGLGIQFVPVTENLIDAIWTKFEPRPVRA
                     LMPITLLDEKYSGLDTKEKLAQVKEALLVLNGQTLVISALDDIAWLLNLRGSEFRYSP
                     LFYAHLIIHDDQVSLYTDDHERFENISDYLKERSVTLRPYDKFYDGIKSLPANTVLVT
                     KDCSWEVARQVISPHRVRVIDSPVAIIKAKKNEVELANAREAHIKDAIALVKYYEWLW
                     QEVGIKGELVDELEAAQKLEFFQSEQDNFIGQSFQTVSASGSNSAVVHYTPKKEACAV
                     IDPSKVYLCDSGAQYLEGTTDVTRTYHFSNPTNEQKRNYTLVLKGHIALAKLKFPPGT
                     AGLAIDAIARQHLWTNGLDYTHGTGHGVGSYLNVHEGPVAIGVRGTVPLEAGHLVTNE
                     PGVYFPGDYGVRLENVMEVKETSDKFLELVPLTLVPFCRQLIDRKLLTKEEVDWVNHY
                     HAKVYQTLVPRLVRHSPHATWLKRATSSL"
     gene            <760070..>762994
                     /locus_tag="PAS_chr1-1_0112"
                     /db_xref="GeneID:8197238"
     mRNA            <760070..>762994
                     /locus_tag="PAS_chr1-1_0112"
                     /product="Karyopherin beta, responsible for the import of
                     the Toa1p-Toa2p complex into the nucleus"
                     /transcript_id="XM_002489710.1"
                     /db_xref="GeneID:8197238"
     CDS             760070..762994
                     /locus_tag="PAS_chr1-1_0112"
                     /codon_start=1
                     /product="Karyopherin beta, responsible for the import of
                     the Toa1p-Toa2p complex into the nucleus"
                     /protein_id="XP_002489755.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0112"
                     /db_xref="EnsemblGenomes-Tr:CAY67474"
                     /db_xref="GeneID:8197238"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4QW51"
                     /translation="MDLRSVIDLVEALYAPNDPSSIVLIQKQLQDVQRSENGWLIADS
                     LLEQESINCQFFGALTYTVNLYLHRESLAKNQDNISYETVTQKLLFHFNSICKNPNYS
                     SKQLVVLKKLMSNLAIIYINTYQQWEDPVSTFRMTLYNNSEAPIGNEFYDYLTLLFTT
                     LLLEEIHRKLTIDLTDSTEFHKSIHSHLYPRISLLIQSFQNTTNETIIIQWLSLLAAL
                     VQYVTQAEIQSTIRYGSLGELFSPLFNFATGRSIEISNKTIEVITLILDTNPSIFPAE
                     INAELEQLIFAGWGGKYLDHILQDKDLNEDAINKYAMMINSFIEPQLLKLLHQLGSNT
                     NDASRKLDSLVELSTVLCKEFIFFWNQFADIYLDEEDILKQKPAWSETQSKVQTILSK
                     LAEVYWRDSHISEDLDFDDDDEIQDFVSYRRDIGDFYETIYPILKMPLLEHLVSNIVS
                     NLSNANNNSLQTIADIESSLFLIQTLACNFNEDNATSEIYSLLKSILDSGLFETVIQS
                     NNKLLVKTSIQFLTSLDFFYSSQLGEPYLESTLRFLLSTPNEHQIIASKAISSICNDC
                     RISLAPVLPTFKILIDQIVVDPEVKPIIRERIIYSYSSIVQGIRSPSDQANLIHSLLN
                     GIISKAIEVQSQPEFVDYLQSLLSSIEEIGKAMRLPSDVNDWYTPEERDAVYAYWIED
                     PLHIKKQITEVVKQFMILNPLTSDNYMMNEVCTGILKAGLTEAIPGPFVFDTYSIIDL
                     LNAKILQCFSKNSLNVVPLQYSLLESLIKSSSIGSNLLTTTLQQSCVEYLAIIQQDPD
                     LALCFLNILVVILEKKPGILIKGYLLHNILPFVLESLGSKEKFVLRSGCKFWIKLVTL
                     RKGDKEDSVIIRDMIEHTELGPSLIFKLVASFLMASRSDLENFMELFKVILVKYPLNF
                     KKWFNLAFETINNNQLLKKQIPTNDTVRLGQQLMLTRGSRKVNDLLKKFWLQVNELIE
                     YS"
     gene            complement(<763054..>764919)
                     /locus_tag="PAS_chr1-1_0113"
                     /db_xref="GeneID:8197239"
     mRNA            complement(<763054..>764919)
                     /locus_tag="PAS_chr1-1_0113"
                     /product="Subunit of heterotrimeric Replication Protein A
                     (RPA)"
                     /transcript_id="XM_002489711.1"
                     /db_xref="GeneID:8197239"
     CDS             complement(763054..764919)
                     /locus_tag="PAS_chr1-1_0113"
                     /codon_start=1
                     /product="Subunit of heterotrimeric Replication Protein A
                     (RPA)"
                     /protein_id="XP_002489756.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0113"
                     /db_xref="EnsemblGenomes-Tr:CAY67475"
                     /db_xref="GeneID:8197239"
                     /db_xref="GOA:C4QW52"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004591"
                     /db_xref="InterPro:IPR007199"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013955"
                     /db_xref="UniProtKB/TrEMBL:C4QW52"
                     /translation="MTEFSKGSLVEIFQKGYKGGLKPLTVQVLNLKAIPNNTGKRLRL
                     ALCDGLYNANAVIRPESVEKAEAQGIKKGSIVQLLEYKASMISPVKHVLIIDNLQVLG
                     FQEEKINPSPTSVDQYFSNHSGESNEDLLGTSMNSPAPQEPAQKAQSHHQEDAKPKLS
                     AQVTSKPQQTNSSTAKFPNIHAIDQLNPYQNNWTIKARVSYKSDMRKWSNQRGEGQLF
                     NVNLLDETNEIRATAFNDVADKYYDLLQEGKVYYISKARIQPAKPQFSNLTHTYELAL
                     DRDTQIIEAEDASDVPSLHFNFVKLNKVQDLDANAIIDVIGVIKVVNPAFQIVAKSTG
                     RPFDRRDIEVVDNTGFAITVGLWNNTALEFDIPVGSVVAFKGAKVQDFGGRSLSLTQS
                     ATIITNPDSPEAYQLKAWYDQQGGSNQEFKSLKNEVSSNSGLNTKQDIQSRKTILQAQ
                     SEELGKNDKPDYFSIKAYISYIRTENFSYPACASEGCNRKVIQQSDDTWRCEKCDVNH
                     PKPNHRYILTLSVVDHTGQLWVTLFDDQAQQLLGQSAGELIDLKENDMSENNHAFQQV
                     FNRIQMKEFSFRVKASPDSYKGQTRIRYNAVSLAKLDFALEADALADYFEGVKVN"
     gene            <765099..>766246
                     /locus_tag="PAS_chr1-1_0114"
                     /db_xref="GeneID:8197240"
     mRNA            join(<765099..765630,765672..>766246)
                     /locus_tag="PAS_chr1-1_0114"
                     /product="Putative non-ATPase subunit of the 19S
                     regulatory particle of the 26S proteasome"
                     /transcript_id="XM_002489712.1"
                     /db_xref="GeneID:8197240"
     CDS             join(765099..765630,765672..766246)
                     /locus_tag="PAS_chr1-1_0114"
                     /codon_start=1
                     /product="Putative non-ATPase subunit of the 19S
                     regulatory particle of the 26S proteasome"
                     /protein_id="XP_002489757.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0114"
                     /db_xref="EnsemblGenomes-Tr:CAY67476"
                     /db_xref="GeneID:8197240"
                     /db_xref="GOA:C4QW53"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C4QW53"
                     /translation="MKLVRIQDSFLDVISDVESGRVNHEDVWAEIIDGKTKPSKFRVY
                     KDKLEPLSPGLTLRKLDHWKYQLSDEESTLKCVFPVEKYDFISHKLTSVNVTAKCNFV
                     VGDRNGRLLYGKLGSKRDELKEVMAHDGGIVKVLYFPSDKVLLSAGLDMMLKIWDCET
                     GDNARTFSGHQASITDFNAQLKLWECSSGMSVASMDCLCGITAVKIHEDRSQANSVVN
                     TRIENLFEVEGKIAICGLENGDVKFWRIADQALIKHLDTSNKTAVTDLAIAGDAAYVG
                     YSNGKLLEIGLTDFKIKELVDVAERIDNVKVIGSYIVISFGFGNLVGYNIKDTESPIY
                     FTGLENDVPVADICIQNKSIYAVGKYGLFQEFLL"
     gene            <766329..>767240
                     /locus_tag="PAS_chr1-1_0116"
                     /db_xref="GeneID:8197241"
     mRNA            <766329..>767240
                     /locus_tag="PAS_chr1-1_0116"
                     /product="Component of the conserved oligomeric Golgi
                     complex (Cog1p through Cog8p)"
                     /transcript_id="XM_002489713.1"
                     /db_xref="GeneID:8197241"
     CDS             766329..767240
                     /locus_tag="PAS_chr1-1_0116"
                     /codon_start=1
                     /product="Component of the conserved oligomeric Golgi
                     complex (Cog1p through Cog8p)"
                     /protein_id="XP_002489758.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0116"
                     /db_xref="EnsemblGenomes-Tr:CAY67477"
                     /db_xref="GeneID:8197241"
                     /db_xref="UniProtKB/TrEMBL:C4QW54"
                     /translation="MNITFHTFEMAETNGNEVLSMFFDEEFVPHAYVDAVLVKSLPTN
                     TTSQKVIPRGSLQPNTQLKGPSFLPVKQLQSLQSNISSLLSHVDFYSNELTKDLEQQL
                     DKLRSTATVLSYTSIGDDTSSVTRLEYYLDSLFNSIDTLQEDLVEINEKITNLHLNTD
                     PLDRKIMDELKQYMVIKQRMNAVVKVFQTAQTVATTSLVVDDALDYQTAPTSANTHDR
                     VPQTVTVSVFSSSLSMLQEAILEEMQRDKPKKEINHKLVSKCDSMIQLLPVFKGLYKF
                     YTPYNEFVKFLEAQKERYLYSKDMKYK"
     gene            complement(<767249..>770914)
                     /locus_tag="PAS_chr1-1_0117"
                     /db_xref="GeneID:8197242"
     mRNA            complement(<767249..>770914)
                     /locus_tag="PAS_chr1-1_0117"
                     /product="Calcium-transporting ATPase"
                     /transcript_id="XM_002489714.1"
                     /db_xref="GeneID:8197242"
     CDS             complement(767249..770914)
                     /locus_tag="PAS_chr1-1_0117"
                     /codon_start=1
                     /product="Calcium-transporting ATPase"
                     /protein_id="XP_002489759.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0117"
                     /db_xref="EnsemblGenomes-Tr:CAY67478"
                     /db_xref="GeneID:8197242"
                     /db_xref="GOA:C4QW55"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006408"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C4QW55"
                     /translation="MPSKFDIEPSTLSSLHDPKSLRVLQRECGGIDALVDSLASNESL
                     GLDPLLPDEDERIERYGENILPLKKTASLLRLLFEAFKDKILILLSVAAVISLALGLY
                     ETFGQDPEHDAEGREIPKVEWIEGVAIIVAIAVVVVVSALNDWQKERQFSKLNAMKDE
                     REVVVFRGGAKTVISIYDVLVGDILSVETGDVVPVDCVLIHGSCETDESALTGETHTI
                     RKVAADQALKWYNENIPEDSEIDIGDQKHIPDPFLLSGSKLLSGMGRALVTSVGPNSI
                     HGKILASLQVDTEETPLQMRLSNLADGISKFGFLAALILFIILLIKFLANLAPGRRFH
                     DISAALKGSHVVDILITAITVIVVAVPEGLPLAVTLALAFATTRMAKDYNLVRVLRSC
                     ETMGTATAICSDKTGTLTENRMRVVRGLMGNISFDSLEGCHKEVSQLSDKLSKNIKTN
                     ILINSTAFENVHEDGDVATLTSHSTLRHQSFWSKLPFFKKKPNFGMFGSSEHFIGSKT
                     ECAMLLFAKDDLRALDDCSLEVIRQMQEPSIVQVIPFDSARKWSGVVVKQKEGLYTFY
                     IKGASEIVLSRCVSRCTVDGTVTRISTSIKSSLESLITDYASDALRTISLAHRDFEVT
                     NWPPQKYVTVDETVADPDLLFGDVVDDSSRNFASNGKTDTVPAIVIQNDESSSSDSGL
                     TLDGIVGIQDPLRPGVPEAVLQCKKAGVTVRMVTGDNLITAKAISSNCNILPKNRLDD
                     PTAVMEGPAFRKLSVAERHAIVPSLCVLARSSPDDKRLLVETLKDQREVVAVTGDGTN
                     DAPALKLADVGFSMGRSGTEVAREASDIILMTDDFTAIVNAIKWGRTVSTSIRKFIQF
                     QLTVNVTAVVLTFVSAVVSEEGKSVLTAVQLLWVNLIMDTLAALALATDKPDDSFLDQ
                     KPAGRHAPLISVSMWKMIIGQSTLQLIITFTIYFAGERIFFDSEPTDHQVSQIHALTF
                     NTFVWLQFFKLWVTRKLDEADDLTTVRSRITARNLNFFQHFFRNWYFLSIAAIIGGLQ
                     ILIMFVGGAAFSVTRQTGAQWATALICGALALPWGILIRIIPDVWVVKLFPTRAFHFL
                     VRIISLGMFNLGKNKRQEPLSFGGQNTELQYLSPFERAKDGLSKLSLGSHESLPLNPF
                     KWRSRSSSSANSTLINLSSRGSSASDIEHTTATGLATMVPTVVGGAVAGWHPDVWKAS
                     PKESFREDENEISDSSR"
     gene            <771452..>772678
                     /locus_tag="PAS_chr1-1_0118"
                     /db_xref="GeneID:8197243"
     mRNA            <771452..>772678
                     /locus_tag="PAS_chr1-1_0118"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489715.1"
                     /db_xref="GeneID:8197243"
     CDS             771452..772678
                     /locus_tag="PAS_chr1-1_0118"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489760.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0118"
                     /db_xref="EnsemblGenomes-Tr:CAY67479"
                     /db_xref="GeneID:8197243"
                     /db_xref="UniProtKB/TrEMBL:C4QW56"
                     /translation="MTESAFSISHLHVITPTFMHVLKYKYPEYSTPKSSFLLFFQSLL
                     YIESMVSKTAQILAGAAVVGTGLILYQQKKQEKLQTPISSGRSGNNPVTVGSGIAPAV
                     DNHTRWSQSPESKFISTKSLGGPPAKQDAYNDARYQFEQAQQKFEDTKASWWQWGQQK
                     SDEVSRESEKQYEIAKAKLEDATQSLREQGQDALDTADSQYQTWKSQWQSKLNDAKEK
                     TDDLVSQAKEQTKSFSSEARSKLDKFRQEFNSKKEELRKKYAHLSEEELDGKAFESLR
                     GWGESAEAFAREEYLESKRNAAETRSTLQRGYDLSQQKLKEAQDEFNRTKKAWFSWGK
                     DQNEEAHNLASRKLAEAQKSFDDASKQLDQFTSSVAKSAKDNSDFVVQKTKEGLDVAN
                     DKAQDGLSSVSNWIRK"
     gene            <773188..>774231
                     /locus_tag="PAS_chr1-1_0474"
                     /db_xref="GeneID:8197244"
     mRNA            <773188..>774231
                     /locus_tag="PAS_chr1-1_0474"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489716.1"
                     /db_xref="GeneID:8197244"
     CDS             773188..774231
                     /locus_tag="PAS_chr1-1_0474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489761.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0474"
                     /db_xref="EnsemblGenomes-Tr:CAY67480"
                     /db_xref="GeneID:8197244"
                     /db_xref="GOA:C4QW57"
                     /db_xref="InterPro:IPR019024"
                     /db_xref="UniProtKB/TrEMBL:C4QW57"
                     /translation="MTYPTIENQPVKTFKVLFVNQDSSEKLKFVQLDHPRLNERCDYL
                     YDEQNNQLYELKRFNGEHDNPHSKKHRAVYDHRGFMIRSLIFAEKESIDGYVVENSEI
                     LVATKFNVIYLLLKYFIMTELRGMNINELDESNQSGRFLNFDDLIEQLQENSVFQGLP
                     EEFFGSLEPSLSEICKVIREGDENYYRVSPAAIFQFLNRKVEALQKNLLETENTVKQF
                     LSSKLSKPIDQGSTKEEEVPLEILDLATKRAAVQLISTYLPQSLGNCLLGQFEKDWET
                     LSNHQLLVEKAFQERQIAEENLAKLNESIGNSSSYFGKRKNQKTLAAPKPKVKKVAVG
                     KGALDGFFRAKAK"
     gene            <774318..>776147
                     /locus_tag="PAS_chr1-1_0119"
                     /db_xref="GeneID:8197914"
     mRNA            <774318..>776147
                     /locus_tag="PAS_chr1-1_0119"
                     /product="Zinc finger protein"
                     /transcript_id="XM_002489717.1"
                     /db_xref="GeneID:8197914"
     CDS             774318..776147
                     /locus_tag="PAS_chr1-1_0119"
                     /codon_start=1
                     /product="Zinc finger protein"
                     /protein_id="XP_002489762.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0119"
                     /db_xref="EnsemblGenomes-Tr:CAY67481"
                     /db_xref="GeneID:8197914"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C4QW58"
                     /translation="MFKKHELYVYDLPVKILDSIKVLYFDSFSTISKAPEAKELQSNE
                     PKVDSNICRVCQKELNKNDSEQFRSHVQSDLHRLNLKRQAANLPIVNEEEFERLVQDD
                     DNVSISGSDYDSEDDLGKDEFASEKSRLETITEDYGDLSLNDVSFLNTKSPYICFSSD
                     LLPAEKCFGIYKTIFTDLDNSKDPRKLLQDLNSQKDKDSHISALFMIGGGHFAGAIIS
                     HKRRNVKGNKGSEDQLLEQSVELVEHKTFHRYTTRRKQGGSQSASDNGKGKANSAGAS
                     LRRYNEAELQKDVRELLGNWAHYLKDCQSVFIRANGSSNRNILVGYESAPLQNNDPRV
                     KSFPFTTKRATSSALKKAWVQLTHLTILDTPKSDEKLKQKLLKQQENITKSRSGGRKD
                     SQKDSKLDPEEIHTAEIVSLIEKSRAPALIAYFRKNKLATDFTLKPEQKFSSVSTPLH
                     YAAAHGSPHICQVLLVNLKADPTITNSTGRTPCEISASTQIRRAFQVARKTLGESAWD
                     WEKANVGPPKSKDEFDQEDAEVSKAEDERKRMIIEEKLAETRQKFENQYQERYGSGTK
                     LQQFNTVTQQTNLSSLSDDQKLRLMREQRARAAEARMKSLQNK"
     gene            complement(<776543..>780752)
                     /locus_tag="PAS_chr1-1_0120"
                     /db_xref="GeneID:8197245"
     mRNA            complement(join(<776543..779380,779424..>780752))
                     /locus_tag="PAS_chr1-1_0120"
                     /product="Lipid-binding protein, localized to the bud via
                     specific mRNA transport"
                     /transcript_id="XM_002489718.1"
                     /db_xref="GeneID:8197245"
     CDS             complement(join(776543..779380,779424..780752))
                     /locus_tag="PAS_chr1-1_0120"
                     /codon_start=1
                     /product="Lipid-binding protein, localized to the bud via
                     specific mRNA transport"
                     /protein_id="XP_002489763.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0120"
                     /db_xref="EnsemblGenomes-Tr:CAY67482"
                     /db_xref="GeneID:8197245"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR017147"
                     /db_xref="UniProtKB/TrEMBL:C4QW59"
                     /translation="MSRLRIWFHSIGKQATNYLQDLKKKKTPSTPSDELNQRLGLSHL
                     DSEAKMKAARQDARRQMVKDFPWERIGCFRDPSSEDSSTFSARDLQKENRFIEHFVID
                     RYYSDWYWNTSLMIGTCLWAYFVARIGLGLWSLILVVFYAIQVYRLEVSRFNRNIHDD
                     MNRVQSVQLLENGTETMQWLNSFLAKFWIIYMPVLSEQVKKAANDVLKDAAPGFGIDA
                     LSLDQFTLGSKSPTINSVKSYPKLGKDVYQMDWDFSFAPNDTDDMTKNEIKKKIDPKV
                     ALGVRVGKAFVSKNLPILVENMQFVGKMRVTIKIGDHFPNIKLVSVSFLEPPEIAYSL
                     KPVGGDTFGLDIMSLIPGLSSFVNTLIHSNLRPMLYAPNSLDIDVEQLLEEQVQDTIG
                     VLAVTINRADDLKSTKDCDPFVSLFTEKQEYRKVHHRHQDQHHFSLLERNEVYHHDSN
                     KGPKLIGSTSYSLDNVVQQEVILGQTSKLKMGGKTRGSLSYDIRWFPVLEGEELADGS
                     KEEPPDTESGVLKLLLQGATDLSLVSSVTGKLSAYSELYLNGELVTKTRIIQNTIEPN
                     WEESLEKFIFAKSKSRVELIVRTKSGLVEDPVVGSFKGNLDELIATSLDDSATIKLKP
                     QGEYKLTAQWKGLALSGADASTNFVPPFGVARLHIRNADDVLNTKTVGKVDPYVRVMV
                     NGRLKYRTTVRETTTTPVWEECMYFPVTSMNQVFSLDVMDAEKRSKDKLLGSAKVQLS
                     SFVKKSDDGKFMAYDGAKKVLSQPLEIKKSKKKKGTIYYSMSFIPMLPVYTNTELEEL
                     ERTKEERKEKELQEQKKLEQMEELFKKNPKKYEWVEVDDDLDEIPKQKLSLEQLLEYN
                     SGSMGVQIKKGKFTKPDVYVQLLFDELAFPSYISARSQGRSITSPDVAQVFVRDLENS
                     QTIIRISKRAIAKEQDDIIGEQSFATRDLLQRGYGKDIDLTFAGQKLQVELDFLPLSV
                     ELPQSELMADSGFLTLEILDAANLLSADSNGKSDPMAKVLLDGQEIYCTDKIKRTLDP
                     TWDESTRFYVPSRSRSKVTIAVYDWDFAGDNDFLGEKNLPLENLAVDETQEFKVELDT
                     QGSVRLRGTFHPEYVRPPIEIMGQSGIEKVATAPVKVIGGAANIIGGTVGVVGGGVFK
                     GVKNVLVPSKKKQEKHDETADLTSLRSVKSGASSTFSRNSHHPKDTFIPLGAPPLPRA
                     SRAQNTDSSATSNLGSDVQSLRNGGRTPVQNGSPVKVIQSRPRSIVSSEQASVSGASK
                     QNVSKGSVEIVSLSGMDAKNSLLVRVLVTSPSRRKEVLRTASHKTKDGNIIWNEGTTF
                     NAAADSSLTFEIKASHTFSKNITLATGSLELSDVIEKTNEDEIKVSLTSGGELVVKVD
                     YSDQYPKEDS"
     gene            complement(<781446..>782855)
                     /locus_tag="PAS_chr1-1_0475"
                     /db_xref="GeneID:8197246"
     mRNA            complement(<781446..>782855)
                     /locus_tag="PAS_chr1-1_0475"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489719.1"
                     /db_xref="GeneID:8197246"
     CDS             complement(781446..782855)
                     /locus_tag="PAS_chr1-1_0475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489764.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0475"
                     /db_xref="EnsemblGenomes-Tr:CAY67483"
                     /db_xref="GeneID:8197246"
                     /db_xref="GOA:C4QW60"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR010109"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="UniProtKB/TrEMBL:C4QW60"
                     /translation="MSAIRSIAQRTLRTQAQISRVSFLGARAYSTKEPTLKERFAELL
                     PEKIEQIKQLKAEHGKTVIGEVLLEQAYGGMRGIKGLVWEGSVLDPIEGIRFRGRTIP
                     DIQKELPKAPGGNEPLPEALFWLLLTGEVPTESQTKAFSEELAARSALPKHVEELIDR
                     SPATLHPMAQFSIAVTALESESQFAKAYAKGVNKKEYWVYTYEDSIDLIAKLPNIAAR
                     IYKNVFKDGKVGSVDPSKDYSANLASLLGFGENAEFVELMRLYLSIHSDHEGGNVSAH
                     TTHLVGSALSSPFLSFAAGLNGLAGPLHGRANQEVLEWLFQIKKELGGDFSKEKIEKY
                     LWDTLKAGRVVPGYGHAVLRKTDPRYTAQREFALKHLPDFDLFKLVSAVYEVAPVVLT
                     EHGKTKNPWPNVDSHSGVLLQYYGLTEESFYTVLFGVSRALGVLPQLIIDRGVGAPIE
                     RPKSFSTEKYIELVKGLGK"
     gene            <785194..>786018
                     /locus_tag="PAS_chr1-1_0122"
                     /db_xref="GeneID:8197915"
     mRNA            <785194..>786018
                     /locus_tag="PAS_chr1-1_0122"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489720.1"
                     /db_xref="GeneID:8197915"
     CDS             785194..786018
                     /locus_tag="PAS_chr1-1_0122"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489765.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0122"
                     /db_xref="EnsemblGenomes-Tr:CAY67484"
                     /db_xref="GeneID:8197915"
                     /db_xref="GOA:C4QW61"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C4QW61"
                     /translation="MSKNSSVQEKFPVGDGSQSSQIPEASTESTRSSSPLRRKLHIRS
                     EQRRREKITDGFQRLKRCVPSVKPDHDSKALILKKSAEYIEMLEYELTTLKQENAKIS
                     QQLAAASLPHQEHHTHAQHSHPQHYVHHQSEFQHQRPPNQTQSQVHQSPTQPQAQAPH
                     QNRQPPHYHHQQQQHLIQQPSQHQQPQIQYAQIPPVSIAPSSFPSSYPSYAPHQVLPA
                     FPYGSPQLPRNPTLGPNPLASTATIKFDPFFPPTAPTSRHISDEKDSKSPKSPPRS"
     gene            complement(<786144..>789047)
                     /locus_tag="PAS_chr1-1_0123"
                     /db_xref="GeneID:8197247"
     mRNA            complement(<786144..>789047)
                     /locus_tag="PAS_chr1-1_0123"
                     /product="Putative sensor/transporter protein involved in
                     cell wall biogenesis"
                     /transcript_id="XM_002489721.1"
                     /db_xref="GeneID:8197247"
     CDS             complement(786144..789047)
                     /locus_tag="PAS_chr1-1_0123"
                     /codon_start=1
                     /product="Putative sensor/transporter protein involved in
                     cell wall biogenesis"
                     /protein_id="XP_002489766.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0123"
                     /db_xref="EnsemblGenomes-Tr:CAY67485"
                     /db_xref="GeneID:8197247"
                     /db_xref="GOA:C4QW62"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="InterPro:IPR027317"
                     /db_xref="UniProtKB/TrEMBL:C4QW62"
                     /translation="MNLDSKHQNQQQHVLKLNGVWVAYAHTFCALAAFLSALIVGVTL
                     HYHKIVQNGYYGYPDEWFPSVSATIGDRYPERSIFQIMIALTAGPRFLLLFLSYLRLN
                     KTGSYLPLIGLVSGILRTFTCGGWVYITSTDDHDAHDIFMISYIVLTIPWTVCVTKLT
                     DKSNKFLKNGRRFTAVAFFGLLVPLVYLFIQHKVHRVAGAYSYYAYVEWSLIFLDVGF
                     DTWSVVDFEDLEFELSAAENAPPTVLNLSYFSQDETSSTDEKEAVKEKLVPGQYPVDS
                     LVGLTFIHSIVQIINSFIFWSVFTALFLCIWHFPLWNMGISGYEAAALSLMAPILLVV
                     PPLRNLFARFPQIPRLLTALFGVGSYKFEAPADRLLILSVGTCFGFISLSNEIWTLGQ
                     IRDSLALSWYSTTFTLGLITSSIAKFAFYTNNPIWPIMHTDNGGLNIYGVIIGVVSAL
                     LTPSYLTQLNPTEISSGVSKGYLFPAAVGVGGLIFSLDAMLTDTSTLILWCWEGYPVR
                     GPLPVPHGVFTFVAMAIGTYLGFTKPSLVSSSSFFIAGSAGAAVLYASSGWIGYIGGL
                     VYSIFLTGIVPVIFASASQFNVGLVFGLGFFLAILISLAHVWVVAYAFVPAGWILRER
                     TDIVLGISVAMVGLGIVAGKKANLIVRAKNHGVGTSLRKRLTKIAGVLLVLSAVISFR
                     RLNFEKPQPYHPEDKLLTAGIWTIHFGLDNDMWASEGRMRDLIGELELDVVGLLESDT
                     QRIIMGNRDLTQKLAEELGMYADFGPGPNKHTWGCALLSKFPILNSTHHLLPSPVGEL
                     APAIHATLNVYGELVDVVVFHSGQEEDVEDRRLQSLGVADIMGSTDRPMVLLSYLVTK
                     PLKGNYHTYVSETNGMHDIDSSDSDRWCEYILYKNLRRTGYARVSRSTITDTELQVGK
                     FQLLDEGEKVNYSEKRIRESKVPKGLQFPRQFRKNGVRGHRYHVFDEPRYYDS"
     gene            <789405..>789747
                     /locus_tag="PAS_chr1-1_0124"
                     /db_xref="GeneID:8197248"
     mRNA            join(<789405..789411,789476..>789747)
                     /locus_tag="PAS_chr1-1_0124"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489722.1"
                     /db_xref="GeneID:8197248"
     CDS             join(789405..789411,789476..789747)
                     /locus_tag="PAS_chr1-1_0124"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489767.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0124"
                     /db_xref="EnsemblGenomes-Tr:CAY67486"
                     /db_xref="GeneID:8197248"
                     /db_xref="InterPro:IPR020163"
                     /db_xref="UniProtKB/TrEMBL:C4QW63"
                     /translation="MVDHVRSPNVSFDDIDYNNSQDLHNAQESLLREQWIRVSALKVC
                     RKALESCYKTSGPNHYEDCREIAEKYLNMLPDHRIQGFLGYQKNDPSK"
     gene            complement(<790739..>791632)
                     /locus_tag="PAS_chr1-1_0126"
                     /db_xref="GeneID:8197249"
     mRNA            complement(<790739..>791632)
                     /locus_tag="PAS_chr1-1_0126"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489723.1"
                     /db_xref="GeneID:8197249"
     CDS             complement(790739..791632)
                     /locus_tag="PAS_chr1-1_0126"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489768.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0126"
                     /db_xref="EnsemblGenomes-Tr:CAY67487"
                     /db_xref="GeneID:8197249"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4QW64"
                     /translation="MGQLMRAEKLIKKMLNRTELQGVILDWDETITDRDSLDLIFRIA
                     FRVKPEFPYKLNHFVGIYKDRFRDYVDHEVKGSECEARDTVKKEIQYQRGMKPVELSS
                     VYEARRLGLFKGISREKFVNYEQTLGQNSDQLLPLKPGVVEFLKMLYRKVPITILSVN
                     WTSLMMKQRLKEFGFEEDKEWLHFLVNELVFDEHGMSTGNNTGEEEDIRTGYDKMMKT
                     RQIVKDCPNGKHFVYFGDSSTDVLAMIETGKAVALGTGARDQLKRMGFKVEGPEEEKN
                     MHDLSEEAAYIFAKDFTIVAS"
     gene            <791819..>792985
                     /locus_tag="PAS_chr1-1_0127"
                     /db_xref="GeneID:8197250"
     mRNA            <791819..>792985
                     /locus_tag="PAS_chr1-1_0127"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489724.1"
                     /db_xref="GeneID:8197250"
     CDS             791819..792985
                     /locus_tag="PAS_chr1-1_0127"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489769.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0127"
                     /db_xref="EnsemblGenomes-Tr:CAY67488"
                     /db_xref="GeneID:8197250"
                     /db_xref="GOA:C4QW65"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:C4QW65"
                     /translation="MKFHSIVFTFSLVLSSLALSIPWVSDHMVQHLFADPSISKGPDV
                     DLVGLHKHLVSIKSLSGYEQEVVSWLADYLASRGLTVELNKVEDETERYNLYAYLGTT
                     RNTKVVLTSHLDTVPPYLPYKVEEGGYIFGRGSCDAKGSVAAQVIAFLNLLEEGSIKE
                     GDVSLLYVVGEEIGGDGMRTASKTLGAKWDTAIFGEPTENKLAIGHKGIALFDLKITG
                     KSCHSGYPELGIDADAMLVQILHKLLFETSWPVSDLLGNSTVNAGQINGGVAANVISS
                     EAHAKVLIRVAKDIDAVEKLIYEAIAPFEEYTDITFHSKEDATFLDYKVEGFENYIAA
                     YSTDVPFLVTGSNLTRYLYGPGSIMVAHGPDEMVKVSDLQDSVDGYKRLVSVSL"
     gene            <793399..>794463
                     /locus_tag="PAS_chr1-1_0476"
                     /db_xref="GeneID:8197251"
     mRNA            <793399..>794463
                     /locus_tag="PAS_chr1-1_0476"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489725.1"
                     /db_xref="GeneID:8197251"
     CDS             793399..794463
                     /locus_tag="PAS_chr1-1_0476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489770.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0476"
                     /db_xref="EnsemblGenomes-Tr:CAY67489"
                     /db_xref="GeneID:8197251"
                     /db_xref="InterPro:IPR019327"
                     /db_xref="UniProtKB/TrEMBL:C4QW66"
                     /translation="MPPKTPAWKKIGLKVQNEILNDPFSVEHLEGAIKTTKKRTREPV
                     KSEPEGSKKAPKRKKLPKSERPPPPEKDQLAYLRQFHEDRDNWKFSKQKQNWVLRHLS
                     VIPSEYEAALSSYLEGMQGQSRDRLVGEFKTVVERWNAFCEQAEQKLIKQLEENVKNG
                     QTKEEAEEKEGEDEEKETKEEIKAPEYDYVIRASRLFNVLTGEKIYVKNVEMEEEKEE
                     EKEGEEKDLVEEEKQENDEKVEEIDHKHKSKDREDAEDVRDEGLSNLIVEKVEVTEFI
                     DDTDYLDKDEKDAEESEATNEDKQDEETEKKEKKEKKEKKEKKEKKEKEKKEKKEKKE
                     KKEKKEKKEKKKEKKERKST"
     gene            <794749..>798483
                     /locus_tag="PAS_chr1-1_0128"
                     /db_xref="GeneID:8197916"
     mRNA            <794749..>798483
                     /locus_tag="PAS_chr1-1_0128"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489726.1"
                     /db_xref="GeneID:8197916"
     CDS             794749..798483
                     /locus_tag="PAS_chr1-1_0128"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489771.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0128"
                     /db_xref="EnsemblGenomes-Tr:CAY67490"
                     /db_xref="GeneID:8197916"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013932"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4QW67"
                     /translation="MSASVSDSQINNLFQKTNELDQDLRFMALSDLYKIISETPSVFT
                     NSPRLSSQLITVLIKALKDVQSEIKNQAVKCFKPLMPTLSSENAIQLVLSLDVKPKKT
                     TITSTVYTMAMHNVLENLVVDQKTAHTIVSKLLPGYLNYKEVISKIDYIEIISDLIRY
                     LGIAMDDSEKDKTWRLLIDVCFQNDTLIARKAVVALCSLIKVLNTSQVEQVLEGIEEA
                     FQSQNSKSTSYADLPSQSTRLALLSGFFKVDSLKLHPFINRIVEVIISELQIDKLSKV
                     DDDYDKQISTDQVRSEALVALSVVVSNTTYEQISLHISEIINYCRLFLSYNPLAIEDD
                     DDYQMDNDVDADDYADFSDDDEELNQSDDDTDDISWKLRRDSARLIRTILKHQPSTLL
                     TIYQVVFDSLINQLDDSIDSVVDECLITLTTIIEFTSLDSQYYNIDNYRPTDSDSQEA
                     ESPLLLLTKALPKLSDRISAILTPKHRSETNLFLKFFSSLFDVTDGLGAQVGPILGKL
                     EVLTDLNNTINLDLLNFYASLLKNNRLTDFEDYLPKILTNIQFAISSHDSTLEGLNAF
                     DAFLQAYVQVTPSNVSLEELEELICSKALTKNLSSEIRQRSLMVLTNYIVIVKVSEDH
                     FLKIVKVYSECLHFESLSMCCIFNIGKAVEQSYANDSFSPILGQQLAEPVLNLITRSE
                     FRSAVLTTLLQFSKSKTIELSQDTKLNIINSLRRVSKTEYSNFSKKQHANLVDIITHL
                     LENTDIDSDIAQTLSEIIIQYSDSDLIDPVLIVRLTKDTTEKIFNTREFFQHLNSKVG
                     KESKHGARIIATVSCYISDDDSLINQNLENLNSQLDLLYSVQFLTQIIRNRGQKFKVP
                     LEVFLQQLDNEDVAIRQSATEALGVLVKYHINEYLPVVLEQLLKVDSKLRPLYLESLV
                     IVSESVDKKHANDIWDTVFQLLANIEDDSEFEENTCTIASKVLFNIGHTYHERLMTLA
                     DKLAMSELIHTKYTTATLIKQFYSDELLIKIHSGLFRDLLGRCSLMVFNNNLHLKQIS
                     VNLLVSALHSAPFIALQIVAKVLGNIIDKELLPKREYIKVIQIGPFKHKIDNGLELRK
                     SVYEMIYNLLLSVEHSNRFVSVEYIINYEDIMMSLINKGFRDDNAIVLLSSIILSKLV
                     TIKPGLLSTGDILSSLIASFNKILSKQLKETATKQQVENQQEAIKAVIRSSKKIDRDI
                     VSNRSFHNETGLNTVQLSDWQNYIKEMKTNFPSYYAEVYE"
     gene            <798624..>799526
                     /locus_tag="PAS_chr1-1_0477"
                     /db_xref="GeneID:8197252"
     mRNA            <798624..>799526
                     /locus_tag="PAS_chr1-1_0477"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489727.1"
                     /db_xref="GeneID:8197252"
     CDS             798624..799526
                     /locus_tag="PAS_chr1-1_0477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489772.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0477"
                     /db_xref="EnsemblGenomes-Tr:CAY67491"
                     /db_xref="GeneID:8197252"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4QW68"
                     /translation="MEQQSELFRQFLEPDSLSLVLSDWDGTITKEDTIPLVFEALRLD
                     KPEGYPWDFKYFQKLYMDRFKKLFEVHLPNHEFKHRDTMEKEIEFQKYFGEFVEMKTK
                     IDVIKLNCFHGVHVNSFNKQVENLVIHEGFPEVLQKLRDRNIGFGVISVNWTQKIIEA
                     YLRSIGFDPVPNEIMMIGNDFEFDEDGYCLGTLRDDGITTGYDKMVKVVEIKSRLNGG
                     KVLYVGDSSVDCLAMLKADKGVVIRGGSASEALRKLGQEVLEIKQLDSDNIKDIRFVA
                     VDNWTDLEKCLDIQDSIVFQGDRP"
     gene            complement(<799498..>800832)
                     /locus_tag="PAS_chr1-1_0129"
                     /db_xref="GeneID:8197917"
     mRNA            complement(join(<799498..800535,800595..800679,
                     800750..>800832))
                     /locus_tag="PAS_chr1-1_0129"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489728.1"
                     /db_xref="GeneID:8197917"
     CDS             complement(join(799498..800535,800595..800679,
                     800750..800832))
                     /locus_tag="PAS_chr1-1_0129"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489773.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0129"
                     /db_xref="EnsemblGenomes-Tr:CAY67492"
                     /db_xref="GeneID:8197917"
                     /db_xref="GOA:C4QW69"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="InterPro:IPR012776"
                     /db_xref="UniProtKB/TrEMBL:C4QW69"
                     /translation="MIRKHFLQMFIQKDKYLVVDLPQGQTKFHYIWLRDHCRCKQCYD
                     HLTIQRLVNSPEIPLEISPHHVSASEDGLSVNVVWPDEHQSKYDLKFLANNSYWPPLN
                     PESGAKIHSGNGKLDKVPWNVEFLKENLPQVEYSKVMDTSTDDGIAEWCLKIWKYGFC
                     FVNNTPVDPESTKKLIERIAFIRPTHYGGFWDFTSDLSTHDNAYSDVAIPLHIDNTYF
                     TDPAGLQLFHLLKHTGEGGITTLCDSLHAANILKQQNPEYYEILSKIPVPAHSAGEEN
                     VFIQPSHAKPIINHDNEGNVIQVRWNTSDRSVMNGLSFKNPETEVPLFYAAIKKWNDI
                     IESKDNEFFHQLKPGQCLIFDNWRVFHSRRTSFTGERRMCGAYINHDDYVSRVKLLNL
                     SRDDLLETL"
     gene            <801087..>801668
                     /locus_tag="PAS_chr1-1_0478"
                     /db_xref="GeneID:8197253"
     mRNA            <801087..>801668
                     /locus_tag="PAS_chr1-1_0478"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489729.1"
                     /db_xref="GeneID:8197253"
     CDS             801087..801668
                     /locus_tag="PAS_chr1-1_0478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489774.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0478"
                     /db_xref="EnsemblGenomes-Tr:CAY67493"
                     /db_xref="GeneID:8197253"
                     /db_xref="UniProtKB/TrEMBL:C4QW70"
                     /translation="MNEDSTLHFTPPLKPVSRANSMDPIPQPVKVPVEDFFIPPPGLV
                     RRSTSNYKNEMSKAKLRRQGSAGSKEEEKAIFDHMSPQNLKRRCSTELNSALPNMDPS
                     STTIAERNGVEFTGHTKNNSLLDQVKEKGEHMYNKIHDKWENRFEFGLKSCDESSASV
                     NAPNSDEEEDPLTSRKGSFDFNEYKGVMYKKGK"
     gene            <802100..>805153
                     /locus_tag="PAS_chr1-1_0130"
                     /db_xref="GeneID:8197918"
     mRNA            <802100..>805153
                     /locus_tag="PAS_chr1-1_0130"
                     /product="Daughter cell-specific secreted protein with
                     similarity to glucanases, endo-1,3-beta-glucanase"
                     /transcript_id="XM_002489730.1"
                     /db_xref="GeneID:8197918"
     CDS             802100..805153
                     /locus_tag="PAS_chr1-1_0130"
                     /codon_start=1
                     /product="Daughter cell-specific secreted protein with
                     similarity to glucanases, endo-1,3-beta-glucanase"
                     /protein_id="XP_002489775.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0130"
                     /db_xref="EnsemblGenomes-Tr:CAY67494"
                     /db_xref="GeneID:8197918"
                     /db_xref="GOA:C4QW71"
                     /db_xref="InterPro:IPR005200"
                     /db_xref="UniProtKB/TrEMBL:C4QW71"
                     /translation="MSFSSNVPQLFLLLVLLTNIVSGAVISVWSTSKVTKTFTAAPRT
                     VTVYADGDGVVPSKSADGDSTKAATGEISNGNSNEGSNPNELPAFSTIYGPSGRYELY
                     LSTSYSTYATTLYYTSTATYGTIRSSAAPAKETQSVSETEKIISVNPIEASTAPTTTS
                     TVFSATTSIPTSSLGRISTGLETSISSNPLVTEPVATSSASRTIETATLTESVQISTG
                     LVNGTRSTSTYETLKTVYSSFNSSTIIGTATATQTSLGSTFTTLSTLYSSFNSSSAIG
                     TETATETSKVSPTQTTVPSPDVGVVDLFETIDTAPPPSVFSRQDLPLPLLSSVSNNGK
                     PYQTNKFYQNIVIGDQKGAVITYPYSVFYTSENHLGLGISHYTESDKVFGPTNSNGAS
                     SYFLNPTLVGHLVLSAKEFTSSGLSLQVSELKELSVLATLQSSSGSVHAPLVEGMGFV
                     SGVYEGSLTLRLSSQVGFKTLTQETSKTLPSGVLKFRVTLFSDIEWLVYVTLPEGTSS
                     DYKLEITDNYTLQGTESVDGLIVQVAKAAEKEESEIYYDYAAGMYPESAVVTGSTDIS
                     TNVASYSIVYDTKGKSSSGSTLVFALPHQVDSIDESTNARDTGVQLESTTKGKLRAYL
                     TNVLGLQETVTSQIQFLPWASFMSKTLSYTAQQLQELAQIANDEISQDIKNAVTGLDS
                     NYFSGKVLDKYAYILLVISDIIQDDEVALSLLETLKETIGVFTSNQQYYPLMYDTRYG
                     GVTSTGSQSGDTGVDFGSAYYNDHHFHYGYFIHAAAVIGHVDNKIGNGTWAQANKDWV
                     NSLVRDVANPSDGDSYFPVSRSFDWYQGHSWASGLFSAYDGRNQESSSEDYNFAYGMK
                     LWGAVIGDTSMEQRGNLMLSIMSRAIGTYFLFEDSNAVVPSEIIPNRVAGILFENKMD
                     YTTYFGTNKEYIHGIHMLPITPASSLIRTPQFVSQEWSSVISNILPDVNSGWTGILRL
                     NQALSDPVSAFSFFSNDDVWNNNYLDNGQSRTWAYAFSAGLANSV"
     gene            <806430..>808640
                     /locus_tag="PAS_chr1-1_0131"
                     /db_xref="GeneID:8197254"
     mRNA            <806430..>808640
                     /locus_tag="PAS_chr1-1_0131"
                     /product="General transcriptional co-repressor, acts
                     together with Tup1p"
                     /transcript_id="XM_002489731.1"
                     /db_xref="GeneID:8197254"
     CDS             806430..808640
                     /locus_tag="PAS_chr1-1_0131"
                     /codon_start=1
                     /product="General transcriptional co-repressor, acts
                     together with Tup1p"
                     /protein_id="XP_002489776.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0131"
                     /db_xref="EnsemblGenomes-Tr:CAY67495"
                     /db_xref="GeneID:8197254"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C4QW72"
                     /translation="MNEPSQPPPVTLEVRHDPVPTSQADSQQRKVVYDKQLEFRKIAV
                     STWLALGSMAHEVHLYQLAIDSFDFALQNDPFNEKALCGLAAALRAMDLVKDQTDGTA
                     AALDVINDLLSRSSELYKDPSIWREAAECYLLLNNTTNAMEALQRCIQLTPNNSALWL
                     LKGQTLMAAGSKHEAVDALNTALVKLPNDVADYTKEEIDVARSTHSEFASVLAAEGNI
                     EAARDELEATLALPPPSSSRFTEYSSLWCALISANERLGDMAKAVRVCEEASGLLGFE
                     PCIYICHAYLLLLPNSHVFNPQSACVLLRQVVNSESNDFLPWFLLGEAYQMLRQPSEA
                     YEAFQLALKRAPNHTIVWLAVGNLYAELGQLADALSAYMFVIKRETEQEQESKILLSF
                     AWEGLSSVYEKCHGQLADSIEACMKSSSYASQAGDSSRANFLNSRLETLRRVVSGEIP
                     LSDYRPSTCCQSPLYLLRDLTSLSISERENLANASLDDIASAPEIKSSSKKRTDTSRP
                     MPPYPSHSANNYNLPSEDSQPQRQNLPVHSLPNVPLAQQQRVHAPANKNLSPSADQRF
                     SIATHPPVAPPQISPRPASPQLQQQQQQQQQQFQPQNYQHYAPSPMYPPSQQSPFPEH
                     QKSLTSFNQMPPIPPPPPPPQHQQHPQQMHIVQQQHEQQHHQQQHLHPQHLMPLPPLH
                     QGPPIPKIESPSYRNQQSFMVGVPYSGVGPDGRPIYEPSQFYGSHPPARFVVNE"
     gene            complement(<808686..>809609)
                     /locus_tag="PAS_chr1-1_0132"
                     /db_xref="GeneID:8197255"
     mRNA            complement(<808686..>809609)
                     /locus_tag="PAS_chr1-1_0132"
                     /product="Purine nucleoside phosphorylase, specifically
                     metabolizes inosine & guanosine nucleosides"
                     /transcript_id="XM_002489732.1"
                     /db_xref="GeneID:8197255"
     CDS             complement(808686..809609)
                     /locus_tag="PAS_chr1-1_0132"
                     /codon_start=1
                     /product="Purine nucleoside phosphorylase, specifically
                     metabolizes inosine & guanosine nucleosides"
                     /protein_id="XP_002489777.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0132"
                     /db_xref="EnsemblGenomes-Tr:CAY67496"
                     /db_xref="GeneID:8197255"
                     /db_xref="GOA:C4QW73"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR011268"
                     /db_xref="InterPro:IPR018099"
                     /db_xref="UniProtKB/TrEMBL:C4QW73"
                     /translation="MSSTQDYYDLIADATASIRDRVPAHLASPKVLIICGSGLGGIAS
                     RIKGDAEVILHYETIPGFQKSTVAGHAGHLQFGLMGIDPNQDNLVPVICMVGRLHFYE
                     GYSFQAATFPVRVATELGVETVIITNAAGGVNPRYVPGDLMIMNDHINFPGLSGQHPL
                     KGPNLEKFGPRFPATSDAYDLELRKALIHQAEAANLSRTIHEGVYAFVSGPTFESRAE
                     VRMLRLMGADAVGMSSVPEVVVARHSGLKVLGLSLITNSGVSDPPTSAFIDDSQTPDS
                     KGHASHEEVLLHAQEAAQDVETLVERLVGLL"
     gene            <809955..>810749
                     /locus_tag="PAS_chr1-1_0133"
                     /db_xref="GeneID:8197256"
     mRNA            <809955..>810749
                     /locus_tag="PAS_chr1-1_0133"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489733.1"
                     /db_xref="GeneID:8197256"
     CDS             809955..810749
                     /locus_tag="PAS_chr1-1_0133"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489778.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0133"
                     /db_xref="EnsemblGenomes-Tr:CAY67497"
                     /db_xref="GeneID:8197256"
                     /db_xref="UniProtKB/TrEMBL:C4QW74"
                     /translation="MSKKSANTVWSSLKQTPKESKPSQSDFNGDPSGFGIPNNSQIPH
                     SPSLNSTTTRRTRPRKTNDSKRFSMYIPQGNLNHLESLERIHDISEDSSSEMSYSFDI
                     VSLKTPTEEQGQKNNQSDKIGHAHKSSLASAFEDYQLAVSAMESSSPTRSLDHLDLAL
                     EEKRDEEREINSQLQVTDTTHMDSDLDSSLYDIKHFQSCIWVGPASTENERLFDSNIK
                     DTAIMDQSYYSENGIFNDTQEIFNEPNHTHHNRTAKKLQRTSLHFF"
     gene            complement(<810830..>812179)
                     /locus_tag="PAS_chr1-1_0134"
                     /db_xref="GeneID:8197257"
     mRNA            complement(<810830..>812179)
                     /locus_tag="PAS_chr1-1_0134"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489734.1"
                     /db_xref="GeneID:8197257"
     CDS             complement(810830..812179)
                     /locus_tag="PAS_chr1-1_0134"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489779.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0134"
                     /db_xref="EnsemblGenomes-Tr:CAY67498"
                     /db_xref="GeneID:8197257"
                     /db_xref="InterPro:IPR028000"
                     /db_xref="UniProtKB/TrEMBL:C4QW75"
                     /translation="MELGKLSFCVAILFSQCCHCLPTEHPTAAKVATAFHPLVTGEAV
                     PPLAKREPMRDYIINKDYAEAQAAKTRSSTSSEAPEPWLRTIYSTVPEIVTPTVIGGI
                     TFGAKPPKTTDGLEPWVSLKKDGSPNTIRPKMKDGKIKDGRPNYSTYFESVVTMTYSK
                     EELKAHNMKEDEIFVHKESIPEDQTYVSLNPLIRCTPQFYHKKGLAKHESSEPICFPH
                     EDQKIKLGKVHFLSWYTHYFTEGDDDQEQTVVEKVKIHFAYLKPSAQKKDMRKREIPN
                     VPKVIPAENYETFQGDIPGTFFSSEWIPNTDGYFPIEVKEEWLKGKQFRLVFIGIQPE
                     SVSDEDYDLLNGSGVMVQFAKGAVVSKTTKQDMAIQESPRTGDDMYYIIMTMPTVVVL
                     AVCFMYLFLYLKRNQRDVSKIKKPKRSRFGLHKNVPPEYDRLPRFNGDVRMNNMKSS"
     gene            complement(<812397..>813197)
                     /locus_tag="PAS_chr1-1_0135"
                     /db_xref="GeneID:8197258"
     mRNA            complement(<812397..>813197)
                     /locus_tag="PAS_chr1-1_0135"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489735.1"
                     /db_xref="GeneID:8197258"
     CDS             complement(812397..813197)
                     /locus_tag="PAS_chr1-1_0135"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489780.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0135"
                     /db_xref="EnsemblGenomes-Tr:CAY67499"
                     /db_xref="GeneID:8197258"
                     /db_xref="UniProtKB/TrEMBL:C4QW76"
                     /translation="MLTKFLIPVVASIAAVSAAPKASPFALAEAGAIPYEFAQALETP
                     EVFKRAEDYNCHLNCGLMIYAAWDCGPEAGPFDADCLCSDGSAFNTRKDYCLECGWCL
                     YQSYFGYLSGPLATCGYPTTPTGQTCIETATGLTPTIGPFTNGGGATSSSSSSSSAAP
                     TSSSSASSSAAPSSSEVSSSAAPSSSEVSSSAAPSSSEVSSSASSVAPTSSAVSSSGS
                     SVAPTVSSASTSHSSSVAPSVSPIAGGAAANGVGISAMFGAVMGYLFI"
     gene            complement(<813744..>814484)
                     /locus_tag="PAS_chr1-1_0136"
                     /db_xref="GeneID:8197259"
     mRNA            complement(<813744..>814484)
                     /locus_tag="PAS_chr1-1_0136"
                     /product="Protein of unknown function, mutant sensitive to
                     6-azauracil (6AU) and mycophenolic acid (MPA)"
                     /transcript_id="XM_002489736.1"
                     /db_xref="GeneID:8197259"
     CDS             complement(813744..814484)
                     /locus_tag="PAS_chr1-1_0136"
                     /codon_start=1
                     /product="Protein of unknown function, mutant sensitive to
                     6-azauracil (6AU) and mycophenolic acid (MPA)"
                     /protein_id="XP_002489781.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0136"
                     /db_xref="EnsemblGenomes-Tr:CAY67500"
                     /db_xref="GeneID:8197259"
                     /db_xref="UniProtKB/TrEMBL:C4QW77"
                     /translation="MMRKTEKVFKAPKMLLKWFYSASFALFFILLLAFNVITPIDTIV
                     QSKVANNLAFNAIVIIMSCVVFAVFSLIAYSTRIFVLRVHIQDIPKKYIPTHDKDLPV
                     VALREIRKAFKESETIRNNSLPNQDIQHPGMFYRKEDSSNTQMGLLNGLIYEDIINTF
                     GARVREGGFMLLDSETKKRFGDKLTLREYIHQMKVHHLLPPTSEASTKTFIDHYEKLR
                     FSGKTISERDFFMFLNFFGEHTMDSFAS"
     gene            <814798..>815118
                     /locus_tag="PAS_chr1-1_0137"
                     /db_xref="GeneID:8197260"
     mRNA            <814798..>815118
                     /locus_tag="PAS_chr1-1_0137"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489737.1"
                     /db_xref="GeneID:8197260"
     CDS             814798..815118
                     /locus_tag="PAS_chr1-1_0137"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489782.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0137"
                     /db_xref="EnsemblGenomes-Tr:CAY67501"
                     /db_xref="GeneID:8197260"
                     /db_xref="GOA:C4QW78"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR018593"
                     /db_xref="UniProtKB/TrEMBL:C4QW78"
                     /translation="MSLLDVVQTNLEHFHFWTHVNILDDFVIQGYPKESLTKNTAQDT
                     LEFVYPAHISQNLSLSDIEGIFNRIDRLLGVRPKRIVIGVVTDDGSVVYYFAHEGLIK
                     PSKV"
     gene            complement(<815145..>816233)
                     /locus_tag="PAS_chr1-1_0138"
                     /db_xref="GeneID:8197261"
     mRNA            complement(<815145..>816233)
                     /locus_tag="PAS_chr1-1_0138"
                     /product="Component of the mitochondrial outer membrane
                     sorting and assembly machinery (SAM) complex"
                     /transcript_id="XM_002489738.1"
                     /db_xref="GeneID:8197261"
     CDS             complement(815145..816233)
                     /locus_tag="PAS_chr1-1_0138"
                     /codon_start=1
                     /product="Component of the mitochondrial outer membrane
                     sorting and assembly machinery (SAM) complex"
                     /protein_id="XP_002489783.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0138"
                     /db_xref="EnsemblGenomes-Tr:CAY67502"
                     /db_xref="GeneID:8197261"
                     /db_xref="GOA:C4QW79"
                     /db_xref="InterPro:IPR019564"
                     /db_xref="UniProtKB/TrEMBL:C4QW79"
                     /translation="MDPNRILEVHIWGKNNQVAKIDAQCLAIAWYLSLTCSKLNNVKL
                     VASCNGSISPTGRLPVLVDYDRQQTQLKHKVVGYLDIVRYLETQYELTLDELSPENHL
                     INEGAIEYILKTIETTTMYTLFVNKENYEGYSRSIFSQYLPFPMQYSAPLFFRKLSYE
                     RCQGIGLLKGNTTVEEDLDDDNEEYYIQELKEMNKKLSQTGIRMGGLYERQQRDKLNE
                     LMVRENTLTNMRCIYLLGQYIETVLSMQGENIVSDDSVGNSEKETDDSTSSHIHLPNE
                     TYSFGSKLSSCDILLFACVSILTFDELPNKSVHGFVTNNFPKLVSTVEDFELAINHRL
                     LDFEKVVSPAPSQVPTLTNTIKSYVVDL"
     gene            <816454..>820704
                     /locus_tag="PAS_chr1-1_0139"
                     /db_xref="GeneID:8197262"
     mRNA            <816454..>820704
                     /locus_tag="PAS_chr1-1_0139"
                     /product="Protein required for accurate chromosome
                     segregation"
                     /transcript_id="XM_002489739.1"
                     /db_xref="GeneID:8197262"
     CDS             816454..820704
                     /locus_tag="PAS_chr1-1_0139"
                     /codon_start=1
                     /product="Protein required for accurate chromosome
                     segregation"
                     /protein_id="XP_002489784.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0139"
                     /db_xref="EnsemblGenomes-Tr:CAY67503"
                     /db_xref="GeneID:8197262"
                     /db_xref="InterPro:IPR013253"
                     /db_xref="UniProtKB/TrEMBL:C4QW80"
                     /translation="MGPPSDEENARVENKKPIPYRRHSLASTTSVRSILKQVSSNVIH
                     DDTKDENKTITVMQQSFLDGTTNALSTLRMGSFSKMKPRPSRRVTFAPEVTLHKIDLI
                     PQYIQPEKGPRRRESFQGFSAAQILRDGPFPDEDELREDDDEAIGREMLNDSSEDEAS
                     AAESENLVGDLQDQGITGTQEDELRESESLSPIVPEEFDSLFDEAPDQAFSMELTQIQ
                     LPKPYQRLSNDLEGKQVSSSEFLGGDLEKSSVEVVSQANDNQVPKQLPQTILDIQESQ
                     TDDILPVEVGDNTSQADCQINLEDNVPMELTTTVSQVDQSIDIEDEVPMELTQTVSQT
                     ERQFDIQNEVPMELTQTASQAEHYFHAEDGVPMELTQTVSQTQQLTHKEQDMEESSMK
                     LNPDFVSRDDEHSKTDAEIDGENAKELGQTQSAYQLQIQEESRMTQLQLEGQSHTHIF
                     SQPDQRPQCELQSTTQDSFRTGTEFDNGEVQTKETITLELADNELQTDPGTLRAEPNI
                     AVELSNHNFQAETEPQHSKEQLPTGNIQTLPGLQSAQDVPGILSSASPQICKDVQDDD
                     CPVLTENEQIKTQFENDTMPEDEIIPMEVTQYISQESTDLKLQRGELAADVETAQQDQ
                     ALQSKDGQMLMVPTQVAPQTVAEGQICMENLNSISQPIEETESGENLQPMEITEQVFT
                     SILSAPVELAHGLLPEENEPLNDSIRQASIEGDTVPREISEKSFTEHSKNAPLRQKDA
                     DFNHISDQPLELRADQERSSRPSSKTKKGSRIKPVCVQELEDEDQEFAASTETPRPSS
                     SRDSCTAPVMSHSPKKAPSSSSKIRTTSNGSPVSEKKGHKRRKLNNDSPLMDQRLPII
                     EKITLVEPQTSTALAINSSNCKRTPSPTVDNYPKRRASLSGPLTPQKESPLSLQEKIL
                     SLTPRNRKHKKRFSLDISRLEKQVQAKDSPQHLQDPFKLGSPMQFKCQTATSIVPLAE
                     TSFLDDSEQALLNSQDDYINVSLSEFLSSINVTFYDDLDVDCVPYKNGKTFDTKPSLQ
                     DFLYAFNRLNFLQLLEFSCKELSSNIDEGKIIFSNLEAEILDDNPPLIREYMELQHNS
                     QLKKEMQRDFHLVKNYSRQQARGIWYNWRLQLLKGIEESVTKKVQTSREANLQLKKQL
                     EQLTMEYDEQYKNRFVVLKDKLTHLRRCKQLSEAVDKTELENFRKLFDEVHNEIEVKQ
                     QEIKSLQSQLDSLNKDIALLNENVLKANKVLENKKDIKEQQLDKSMDRLKKICDGLDI
                     RFIELDQKSWELKFEMYQAINVSYSLHQNRSVAVSWLLGKKSLLAPSLVESYLTGLKF
                     LSLSEKCRRIVNIDKVLTKLDLRFLIRRGKDDILTMTSIELIENCKVSFEINVRKWIM
                     KENFLKISTRYYENEERAQNKEDAELLEKFNQQTFQIC"
     gene            complement(<820723..>822195)
                     /locus_tag="PAS_chr1-1_0140"
                     /db_xref="GeneID:8197263"
     mRNA            complement(<820723..>822195)
                     /locus_tag="PAS_chr1-1_0140"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489740.1"
                     /db_xref="GeneID:8197263"
     CDS             complement(820723..822195)
                     /locus_tag="PAS_chr1-1_0140"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489785.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0140"
                     /db_xref="EnsemblGenomes-Tr:CAY67504"
                     /db_xref="GeneID:8197263"
                     /db_xref="InterPro:IPR006828"
                     /db_xref="UniProtKB/TrEMBL:C4QW81"
                     /translation="MGNSTSTDSARLKSRLNHEIVPNRKQHLNFVDYKDKPSTSTATI
                     LSTQEKASRKQSPNLSGIPTVNDQLITIHDTYIDQLASTTTEEDDAEGNLSLVTTISS
                     SNYSLSDADEELNDNALHNDNDSHPKPKAKTLNVFLKWKPLHFKYSDDVYIIANFLDN
                     WSTKCYPKVIKDDKNKNIVYLCFEFQKLRIGSIYKFQLIVNDNLTIIEHDILPKATTS
                     SGNIVNWFEISTANFDYHDDHVYIKPLTVTCEEKDQGKIHNIARAKSPHFSSVSSTRN
                     NSVTSFSKAASRSSKYSSEIPYYFNSDEIIYPQDKHPANTNLNRNHSFYLKLLSLPEP
                     PLLPPYLDSILLNDRHKTKSKKQSSKPQALHGKNSNINADRRYSLPINNLNIADKYSR
                     PQEFVEDEQSIASGQKNKEADHSMFKRGFKDNSMHNITESMVAKSQTTENQQREIVPT
                     HVMLNHLITSNISNDIIHVSVIHRYQGKYITTILYTPVDS"
     gene            complement(<822741..>823988)
                     /locus_tag="PAS_chr1-1_0141"
                     /db_xref="GeneID:8197264"
     mRNA            complement(<822741..>823988)
                     /locus_tag="PAS_chr1-1_0141"
                     /product="Non-essential protein of unknown function"
                     /transcript_id="XM_002489741.1"
                     /db_xref="GeneID:8197264"
     CDS             complement(822741..823988)
                     /locus_tag="PAS_chr1-1_0141"
                     /codon_start=1
                     /product="Non-essential protein of unknown function"
                     /protein_id="XP_002489786.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0141"
                     /db_xref="EnsemblGenomes-Tr:CAY67505"
                     /db_xref="GeneID:8197264"
                     /db_xref="UniProtKB/TrEMBL:C4QW82"
                     /translation="MSAYNSELIDIEFNRKSDSHNLTHFNTNFYYQYENSGNFRDELY
                     SEYFVPEEPIVLDDMGPPPSLSSASVMSSPMSDVSRQFTVGGAPSLNSEPSSLDLSEL
                     FSGMGKEETVQCISPMSIENGRNAVVNGVLAEGRENSDLSLRVTESSVGQGLSGPLEE
                     DTIGNEFITNVFNLDHVATNQRLNTASVYELSNRFEHPASSSISVISPSSVPSSVSSM
                     ESIKPPTSVSSFSSFSSASSSSSYISPASTTTNNSTTPTSAASSAGDIISTTNLQPAV
                     LRNSIAESKKKNHTIDIVTETGERKKISDSRLSLPELSKILNLANNQKEASVREKNIL
                     NILQTTLGFPLGLKTWIRDTSSQERDALIDQLYVNVQENYNYGYSKEILEIIIRRASY
                     YMMQGRLRRERRAMRKKMQGRSS"
     gene            <825477..>827111
                     /locus_tag="PAS_chr1-1_0142"
                     /db_xref="GeneID:8197265"
     mRNA            <825477..>827111
                     /locus_tag="PAS_chr1-1_0142"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489742.1"
                     /db_xref="GeneID:8197265"
     CDS             825477..827111
                     /locus_tag="PAS_chr1-1_0142"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489787.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0142"
                     /db_xref="EnsemblGenomes-Tr:CAY67506"
                     /db_xref="GeneID:8197265"
                     /db_xref="InterPro:IPR018626"
                     /db_xref="InterPro:IPR028115"
                     /db_xref="UniProtKB/TrEMBL:C4QW83"
                     /translation="MPSQSLANFPIHTLFLTKFDVRRGYDLIWIKSVDQSLTQNESFI
                     TDLEYKSFPSGLHSVSKDSLQFVMFQPNNTLLYGISIFRQNGLFSEQISHDRSKVLMY
                     SLGILIDPSELNDSYISTVTSSRYHTWIPHIYSSCWNYYDVLESLFDEIVPSDDLNDE
                     IDSLLLESTFEKYHYKSSSDKFKEAIKSLNKKPSIITLEDEESVPPNPDHMILSMQDT
                     VATLGPLIFPLWKLSLLREPVLIYGGSSVEKMNKISYHMSILSIIPLELQNELIKSMQ
                     RLTNADTDHHDSVNQFQNLQYYQLLYNICLKDVSSIPSFVAVRKTGFIASTRDVILLE
                     NPLFTSTVKLPDNSLDIASISTSADNNNEFSFCTRRDSRKFDILQNFIALQQGEPENR
                     KDYSKCVEKQSWSEYLYKIFKWWASAGEDIELQDVELLKEDLLKIFRYTDEPDSVTNS
                     SDVTSPSIYIVEYFQQQTRKIFEVLIQLINCHIQDHKSDHLIIEYNDIYEMGLDPYSS
                     QDSEFVVALIHKIWCRNDPELIDKLNVKIGYFFTLC"
     gene            complement(<827139..>830495)
                     /locus_tag="PAS_chr1-1_0143"
                     /db_xref="GeneID:8197266"
     mRNA            complement(<827139..>830495)
                     /locus_tag="PAS_chr1-1_0143"
                     /product="Essential subunit of the Pan2p-Pan3p
                     poly(A)-ribonuclease comple"
                     /transcript_id="XM_002489743.1"
                     /db_xref="GeneID:8197266"
     CDS             complement(827139..830495)
                     /locus_tag="PAS_chr1-1_0143"
                     /codon_start=1
                     /product="Essential subunit of the Pan2p-Pan3p
                     poly(A)-ribonuclease comple"
                     /protein_id="XP_002489788.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0143"
                     /db_xref="EnsemblGenomes-Tr:CAY67507"
                     /db_xref="GeneID:8197266"
                     /db_xref="GOA:C4QW84"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028881"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C4QW84"
                     /translation="MEGWNEINRVPCMRPSFRISDPTRQSVPSALLFDDSHDLTWIGS
                     EDGFVKSLADQMLTPYTSFRCHSSKVLQLLNNKRGILSLSENSIKLTSRTGLCRMNLH
                     DISVNHSRSMAYTSNTENEVLLGGFQGKLVKLNLMRGEISDTIPYDAPVYTMSANLSQ
                     ICLGRVDGTVDILDPRSNDIIASFSGHMRTLSSMDCRGNTLITTGYSVRNGTFYADPI
                     ANLYDLRTKSLMPPVTFPAGASFVKLHPKLPNVAILASSAGLIHFVNLYSPMNVSLYQ
                     ADVGSYMNNFEVSPSGDFMGFTDSFQNVHLWSNAPDLSSAHIPNLASSLEQATMLPPP
                     ANSDIIPADSDSTVPLSSIGMPYYDQPLLSNWPFDMKFSLGHVPKKINPELINSSKSV
                     VENYNAHAFGQNNLPSGMGVNMNIPGVFKTDTDTRIAVYSREKYGPRNVAQPYYRLHD
                     RSNQKNKFVPKFISERLDVDEKSSSTAENTNSDFKDTLYEQLFDCKPHSSQEVPYCFT
                     KLDIHYSKFGVHDFDFEFFNKTNLSGLESHVQSAYCNSLLQLYRFAPLMFNYAVGSLA
                     EESVDNNSLLTELGFLFDMMVKASGQHIAPSNFQKMLSKIPEASRILDIYNNGYNRDE
                     HSQRVLIQSFNNFLLERISLDEMNQAKSNAPHIFNTIMGIPVECEFIGVGCGLRKIGN
                     TTLYSLDVRHPKTNNVVLNKKLNHSIIPYIELALSRNLSVNMACDNCNETHAFDTLYT
                     VKDLPPILSLNLELTNQELSELKASKTNWLASEFYASMNKGRICLKSITTGFRHLKYE
                     LLGYVAQVTDKEGNSNLVTFVKVGKDEWFLFNDFLVMPISEHEVLNLNYWWKKPVIVI
                     YKNSESTNMFDYEGWRQNLNQDILYRDHFSRGTREGKIIEYELLTKEEAPQPGTLVAI
                     DAEFVVIEPELVEFNSDGTKKVIRPLKNSLARVSVLRGDTGPKEGIPFIDDYVIIEEP
                     INDYLTSWSGIEPDDLNLEKSKRSLTTLQAVYRKLWLLLNLGCIFVGHGLINDFRTIN
                     LSVPKQQVRDTAELYFLKKEKRKLSLKFLTYAVLRREVQKGNHDSIEDAKAALMLYRK
                     YIQLNNTGELQHTLEEVYMEGQMLSFKVPT"
     gene            <830704..>830946
                     /locus_tag="PAS_chr1-1_0144"
                     /db_xref="GeneID:8197267"
     mRNA            <830704..>830946
                     /locus_tag="PAS_chr1-1_0144"
                     /product="Homolog of the prokaryotic ribosomal protein
                     L36"
                     /transcript_id="XM_002489744.1"
                     /db_xref="GeneID:8197267"
     CDS             830704..830946
                     /locus_tag="PAS_chr1-1_0144"
                     /codon_start=1
                     /product="Homolog of the prokaryotic ribosomal protein
                     L36"
                     /protein_id="XP_002489789.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0144"
                     /db_xref="EnsemblGenomes-Tr:CAY67508"
                     /db_xref="GeneID:8197267"
                     /db_xref="GOA:C4QW85"
                     /db_xref="InterPro:IPR000473"
                     /db_xref="UniProtKB/TrEMBL:C4QW85"
                     /translation="MLKFINTFMRFGRTSFCRSGLNYTGPQMVGPANNMTLQSIRNYK
                     VRTSVKKFCPHCYIAKRKGRVYVLCKVNGKHKQRQG"
     gene            complement(<831016..>834081)
                     /locus_tag="PAS_chr1-1_0145"
                     /db_xref="GeneID:8197580"
     mRNA            complement(<831016..>834081)
                     /locus_tag="PAS_chr1-1_0145"
                     /product="Cytoplasmic protein with a role in regulation of
                     Ty1 transposition"
                     /transcript_id="XM_002489745.1"
                     /db_xref="GeneID:8197580"
     CDS             complement(831016..834081)
                     /locus_tag="PAS_chr1-1_0145"
                     /codon_start=1
                     /product="Cytoplasmic protein with a role in regulation of
                     Ty1 transposition"
                     /protein_id="XP_002489790.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0145"
                     /db_xref="EnsemblGenomes-Tr:CAY67509"
                     /db_xref="GeneID:8197580"
                     /db_xref="GOA:C4QW86"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011041"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C4QW86"
                     /translation="MEDFGPVVRYGPITALQFKDGKLYSGNGPSIEVYDYVTGEMVGQ
                     RTVFKDNRVHGLQGSNDGSSVAIHGAKSLLISRWDHLFDEERTLDEFFVSDWIISTSF
                     SYDNSLLYVLTAHNAVLVICLNSLQIIETLHCNERSILYSGSIRVLPDKVIVCAGTVM
                     SGILLWDLSSRSVIHNLKGHEGSIFGVQADTNGELVVSCSDDRSVKVWDLESGECLMS
                     GWGHGARIWSLQFYDNNTKVFSASEDCTARSWAVDREKGELKCLKVFDTHYGKHIWGA
                     AISQDELIAATGGADGRIRLVDLNSKLARKGFQELEFSVDSISKSTGSPFAKDEILKG
                     VAEFDNLIVAVTSKGKILQKTGQDNWILIEQDPSLENFVIMKSQKERRLVLLSNNKGY
                     IRLLQFDRLLIQDILIPNSVFEHSKSNISNVLIADYDEHSVLICTETPNPKEPFLLTI
                     IDLEENIKFTQHTLIKPDMRFVSSCISFDIVNKWLLIGSRYTTIALYDISTLKNDLEP
                     FKVWKKYVPGDTISSLKVLSSIEDESLIILTTRDGWFYYIQLSKSNNSITDLIVQENR
                     VQKGFVEGCFIHPSSGDLLLYGFKSSLFFLWNETKQLEVFNEICGGPHRLWQFNIRDA
                     NTNDYSFIYTRASVLNVRHTGSSLWKGDSILRQGTHGREVRDISISSSSVNGKRLLLT
                     GSEDTTLKLSSIDENSLEITQYWTLRKHVSGLQKAKIIHQDKELGLQYALSSAAREEF
                     FVWLISESIQGSVPLISNYATLPPSSEIHPDLRIMDFDVMKRADESGKVTGFLISTVY
                     SDSTIKVWDFSITKREFRLVIDGKYTTICIWNVKFLQLGGNLYILTAGTDGHVCIWDI
                     THSLNDSGYSLLSGGQIQGHCIGGSKLGELLVKQQIHQSGIKAMDFVQASSTELLIIT
                     GGDDNALGLLNLTFTPEKSTLNLSIVDFKDSAATSTITGLNVIDSSTFFTTSVDQVVR
                     IWKIDQDKLVLQAQKRTAVADTGCSDVCNISGKNYAVIGGAGLSLWGVN"
     gene            <834752..>835702
                     /locus_tag="PAS_chr1-1_0146"
                     /db_xref="GeneID:8196650"
     mRNA            <834752..>835702
                     /locus_tag="PAS_chr1-1_0146"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489746.1"
                     /db_xref="GeneID:8196650"
     CDS             834752..835702
                     /locus_tag="PAS_chr1-1_0146"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489791.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0146"
                     /db_xref="EnsemblGenomes-Tr:CAY67510"
                     /db_xref="GeneID:8196650"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4QW87"
                     /translation="MPTIPAYKTVNTTKFTRLVNQIGKNISKSPLMDSASPQPSELNV
                     RPVKVVKPLVVSFDAYDTIYEPVAPVHQQYHAIVTRYKGNWPSEEEISTRYRQHYSQL
                     CQEYPNYGKSAGWPIEIFWKTLLNRVFYDGEPTIMDAVVSEIASHFSSHAAYHVFEDV
                     EPLLQALAKNGVIPAVASNADEQVTHLVLHTFGLIDYFGKENIFLSYHLELSKPDPAF
                     FEKIGTKLLELKNGEHSLKGLSKAEIKDHWWHVGDDYKKDVLCSQRAGIRSVLLDRKG
                     QYGFLKEGEDSVIVHDRFIVARSLLALIDLFGMNESGKGA"
     gene            <836042..>837370
                     /locus_tag="PAS_chr1-1_0147"
                     /db_xref="GeneID:8196651"
     mRNA            <836042..>837370
                     /locus_tag="PAS_chr1-1_0147"
                     /product="Putative mannosidase, essential
                     glycosylphosphatidylinositol (GPI)-anchored membrane
                     protein"
                     /transcript_id="XM_002489747.1"
                     /db_xref="GeneID:8196651"
     CDS             836042..837370
                     /locus_tag="PAS_chr1-1_0147"
                     /codon_start=1
                     /product="Putative mannosidase, essential
                     glycosylphosphatidylinositol (GPI)-anchored membrane
                     protein"
                     /protein_id="XP_002489792.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0147"
                     /db_xref="EnsemblGenomes-Tr:CAY67511"
                     /db_xref="GeneID:8196651"
                     /db_xref="GOA:C4QW88"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR014480"
                     /db_xref="UniProtKB/TrEMBL:C4QW88"
                     /translation="MWILWLLTTVSALSLDVDSKDSICEATTHIINGMMDYYEGTRYG
                     GTVGMFQTPYYWWQAGEAFGGMIENWFMCDNNTYEEIIYDALLHQTGDNFNYIPANQS
                     TTEGNDDQGFWGFAAMGAAERNFTDPPEDYPSWVALTQAVYNTMWARWDNATCSGGLR
                     WQIFTWNSGYDYKNTISNGCLLHIAARLARFTQNETYGETAEQVWQWLDDVGFINDQG
                     GTYLIYDGANIVSGECTDITTIEWTYNYGVLMAGCAYMYDFTHDEVWLTRTTTLLSSI
                     SIFLNDNVIYEQQCQAAMNCNNDQRSFKSIFSRCLGYTAKLVPSLTDQIMTILTASAE
                     GAAKSCSGGTDGVTCGLNWNIGAYDNMYGLGEQMSALEVITQLLVLDSPAPYSQNESS
                     SKSDPEAGIGSSTRINMNDLDITGKDKAGAAILTVLVLGVFIGGLVWIVL"
     gene            complement(<837377..>838339)
                     /locus_tag="PAS_chr1-1_0148"
                     /db_xref="GeneID:8196652"
     mRNA            complement(<837377..>838339)
                     /locus_tag="PAS_chr1-1_0148"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489748.1"
                     /db_xref="GeneID:8196652"
     CDS             complement(837377..838339)
                     /locus_tag="PAS_chr1-1_0148"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489793.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0148"
                     /db_xref="EnsemblGenomes-Tr:CAY67512"
                     /db_xref="GeneID:8196652"
                     /db_xref="InterPro:IPR018857"
                     /db_xref="UniProtKB/TrEMBL:C4QW89"
                     /translation="MSPTNPPPVQRGRSLNSIHDKKRHGTPKKTQFTAGGGKKLVRNG
                     SHGKNLNKLPRITSYEAVNALDHTIRPDFNRSKSTDGILDRMALKSLTKNETRSPELS
                     EEEVEEFDDDVKVVESNSGATLEDSLPRLYGGDVLLSQSTGIERSIAPVASLRGSLIS
                     IPSQLLAQTMGEFRTTSPQGPPLVTSAPQNTQDTPSRNASLIFNPSNVHIAGTGYEDT
                     RTQQKLWLQRESSLRDVKMPVKQPQTNGFFSTSQFRTEFERYSKEYLNVRRYVNPVAE
                     SLKRLDAANKVPKDIQNRPSTISVKEIQAKAEAIKAQIWNEEVK"
     gene            <838579..>839787
                     /locus_tag="PAS_chr1-1_0149"
                     /db_xref="GeneID:8196653"
     mRNA            <838579..>839787
                     /locus_tag="PAS_chr1-1_0149"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489749.1"
                     /db_xref="GeneID:8196653"
     CDS             838579..839787
                     /locus_tag="PAS_chr1-1_0149"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489794.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0149"
                     /db_xref="EnsemblGenomes-Tr:CAY67513"
                     /db_xref="GeneID:8196653"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:C4QW90"
                     /translation="MNASSIQRKNPYQSKQTAYLNWCHNEGKKFIPGPPKLREIVTPK
                     RLFLFLKTHIEPAKVREIPLSFASFDAYVSAIVDLYHRQRTEFKVRPVLDDPNEPDAD
                     WVTPRDDRVKEYLKQIKKERQNVHRVTQSHEMAQERTVTPTSTNSSNMLIPTTFTGNS
                     DPSLLSNEFGGIEPPTGYSIVSSQGLRGSSSSTSSSGTDISYLNQQLAKTNDKVNRLS
                     MDVQQLKELLTNTNNKVTQIVEMLTLVSKAGQVGAHRTPSQSEPVSNSMEPPQPANGQ
                     YGIAPVSVPFSNPTGAPPAPTTTVIPEIILNNKAKTISAIWREYKIGYKGQPSLAEME
                     RKYGTSWRRGRIRKTVQRRRRIAQAIETYINQGLTEEEALFRLEKYRQERSKSLFWLY
                     SNVPENSYDL"
     gene            <839979..>841685
                     /locus_tag="PAS_chr1-1_0150"
                     /db_xref="GeneID:8196654"
     mRNA            <839979..>841685
                     /locus_tag="PAS_chr1-1_0150"
                     /product="Protein of the Sec1p/Munc-18 family, essential
                     for vacuolar protein sorting"
                     /transcript_id="XM_002489750.1"
                     /db_xref="GeneID:8196654"
     CDS             839979..841685
                     /locus_tag="PAS_chr1-1_0150"
                     /codon_start=1
                     /product="Protein of the Sec1p/Munc-18 family, essential
                     for vacuolar protein sorting"
                     /protein_id="XP_002489795.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0150"
                     /db_xref="EnsemblGenomes-Tr:CAY67514"
                     /db_xref="GeneID:8196654"
                     /db_xref="GOA:C4QW91"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:C4QW91"
                     /translation="MDLVKVGQSYVDKIVTDTGIKVLLLDDITSSIISLVSTQSELLN
                     HQVYLIDKLENENRDTIKQLDCVCFLSVSEKTINLLVEELGAPKYKSYKLYFNNVVPN
                     SFLERLAERDDLEMVDKVMELFLDYDILNKNLFSFKQLNIFNSIDAWNQQQFLLTLAS
                     LKSLCFSLQTNPIIRYESNSRMCSKLASDLSYEFGQSSKIMEKFPVNDIPPVLLILDR
                     KNDPITPLLNPWTYQSMVHELLGIFNNTVDLTGTPSDLPPDLIKLVLNPSQDPFYAQS
                     LYLNFGDLSDSIKTYVNEYKEKTVKHNSNELTDLNDMKHFLESFPEFKKLSNNISKHM
                     GLITELDRKINENHLWQVSELEQSIAVNDNHNADLQELEKLLTSQEFKIANNLKVKLV
                     CLYAIRYELHPNNQLPKMLSILLQQGVPEFEINTVNRMLKYSGSTKRLNDDSESSIFN
                     QATNNLLQGFKQSHENDNIYMQHIPRLERVISKLVKNKLPTAHYPTLINDFLKKQRPV
                     SDLNGARLQDIIIFFVGGVTYEEARIINNFNLVNKSTRIVIGGTTVHNTNSFMTQVLE
                     LE"
     gene            complement(<841716..>842888)
                     /locus_tag="PAS_chr1-1_0151"
                     /db_xref="GeneID:8196655"
     mRNA            complement(<841716..>842888)
                     /locus_tag="PAS_chr1-1_0151"
                     /product="Protein that relieves transcriptional repression
                     by binding to the Cyc8p-Tup1p corepressor"
                     /transcript_id="XM_002489751.1"
                     /db_xref="GeneID:8196655"
     CDS             complement(841716..842888)
                     /locus_tag="PAS_chr1-1_0151"
                     /codon_start=1
                     /product="Protein that relieves transcriptional repression
                     by binding to the Cyc8p-Tup1p corepressor"
                     /protein_id="XP_002489796.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0151"
                     /db_xref="EnsemblGenomes-Tr:CAY67515"
                     /db_xref="GeneID:8196655"
                     /db_xref="GOA:C4QW92"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C4QW92"
                     /translation="MPLRRTRGRSQDYSLKKSPDQEDLDIDEDLDEEVTRCICGNEEL
                     NTDDSSVDTGFFIQCENCSVWQHGYCVGIKDTADSPEKYWCEQCKPELHALIEHGTKS
                     LYIPVNGEVKVEDDPPESLKETEPANQSAPEESDSRDQIETKDTKDAKEIKKNRDVKG
                     SKDGKHSKESKETKDSKDAKEKLSVKQEEARSRLSVRESRQLQQALELSAKESGVKPE
                     TIEVLERPRRTANSNGTEHTSDESEPSSNKRKNDTVVSNKKGKELKSKRLKSASSSSS
                     SKESKKEDKKILQLNSEKPFKPKTHSSKISMIEMRKRIAGILEFIGRTQIEMANEENE
                     RAQLTKHLKDDADDEDTALKLKIETNLITSSKNTLTMMDSLTRKLLRWEQRFGAPG"
     gene            <843051..>844325
                     /locus_tag="PAS_chr1-1_0152"
                     /db_xref="GeneID:8196656"
     mRNA            <843051..>844325
                     /locus_tag="PAS_chr1-1_0152"
                     /product="Cytochrome c lysine methyltransferase,
                     trimethylates residue 72 of apo-cytochrome c (Cyc1p)"
                     /transcript_id="XM_002489752.1"
                     /db_xref="GeneID:8196656"
     CDS             843051..844325
                     /locus_tag="PAS_chr1-1_0152"
                     /codon_start=1
                     /product="Cytochrome c lysine methyltransferase,
                     trimethylates residue 72 of apo-cytochrome c (Cyc1p)"
                     /protein_id="XP_002489797.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0152"
                     /db_xref="EnsemblGenomes-Tr:CAY67516"
                     /db_xref="GeneID:8196656"
                     /db_xref="GOA:C4QW93"
                     /db_xref="UniProtKB/TrEMBL:C4QW93"
                     /translation="MGEMELSLDVEYPNNLVEIGQSSIDGGGSGIFVNLEKLRQLPPS
                     KTYSLIVVKRSSTISLEECQRVLQSLSETSKSSEIIRHCLLFVHQHLGDQLTETLIVF
                     FYVVGYHCIIELGLDVPQISKFKSYLQVLLNTEVNSIQKDSLEELNAIEPYMSRDFLF
                     QVNLKALKSDYAIYELFIESVEKYGITQDKLSIEQFLQFKAAVKSRTLEIPGKVLDDD
                     QFSISITMVPILDYINHSNSLTNSFFDVNEDNDIVLKFEYSSEAFDGQSSQELFISYL
                     PLEDVGKLFFNSGFIPTDDGYKIIQFPINEIDRQLLIENELPTSYIFLLQIKDNEIVQ
                     VTFPFDHLMKEVTNSDLTTYHAIVAQDCTKALEKLPSNVKGNISAYVSFIRKVLQFVS
                     RQKPETFSQFTGPRDESLIQELCSLIWPSTNI"
     gene            complement(<844397..>845878)
                     /locus_tag="PAS_chr1-1_0153"
                     /db_xref="GeneID:8196657"
     mRNA            complement(<844397..>845878)
                     /locus_tag="PAS_chr1-1_0153"
                     /product="Serine/threonine protein phosphatase Z, isoform
                     of Ppz2p"
                     /transcript_id="XM_002489753.1"
                     /db_xref="GeneID:8196657"
     CDS             complement(844397..845878)
                     /locus_tag="PAS_chr1-1_0153"
                     /codon_start=1
                     /product="Serine/threonine protein phosphatase Z, isoform
                     of Ppz2p"
                     /protein_id="XP_002489798.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0153"
                     /db_xref="EnsemblGenomes-Tr:CAY67517"
                     /db_xref="GeneID:8196657"
                     /db_xref="GOA:C4QW94"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C4QW94"
                     /translation="MGNSPSKNELNAAITTNSHANSNSSNGVAGDELNGELDEKSAAA
                     ATSLSTNLNHKHKQRSHNINVNALPQPTKTSRSSPLTGVSPYDLEISAQMARCLSNFT
                     NNSDDLLFSSSLGSECSLSSSTTPPTSNATGKVSQENQSRMSLDPIFEISQESTPTPA
                     TPTLPTAFPLKEEHLISKRGRKESTLSSGSSQGDPLDVDIDEVINNLIEAGLSRSFSK
                     KICVSNHDMKIICAKAREVFLSQPTLLELAAPVKIVGDIHGQFYDLLRIFKLCGSPPS
                     SNFLFLGDYVDRGKQSLETMILLLCFKIKYPENFFLLRGNHECANITKQYGFYDECKR
                     RTSSSKIWKAFVDVFNTLPIAATIGNKIFCVHGGLSPHLTNLAQINSIQRPTDVPESG
                     ILSDLLWSDPDADILAWKENDRGVSYCFGKRVINKFCKHFQFDLIVRAHMVVEDGYEF
                     FNNRKLVTVFSAPNYCGEFDNYGAVMSVDKGLMCSFDLLKPDK"
     gene            <846328..>847173
                     /locus_tag="PAS_chr1-1_0154"
                     /db_xref="GeneID:8196658"
     mRNA            <846328..>847173
                     /locus_tag="PAS_chr1-1_0154"
                     /product="Small subunit of the heterodimeric cap binding
                     complex that also contains Sto1p"
                     /transcript_id="XM_002489754.1"
                     /db_xref="GeneID:8196658"
     CDS             846328..847173
                     /locus_tag="PAS_chr1-1_0154"
                     /codon_start=1
                     /product="Small subunit of the heterodimeric cap binding
                     complex that also contains Sto1p"
                     /protein_id="XP_002489799.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0154"
                     /db_xref="EnsemblGenomes-Tr:CAY67518"
                     /db_xref="GeneID:8196658"
                     /db_xref="GOA:C4QW95"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR027157"
                     /db_xref="UniProtKB/TrEMBL:C4QW95"
                     /translation="MSSDLGEFDTPDFDSTASRLDRPSSYLIHKARRNPNGYEELKKS
                     LQSATVYVGRIGVYVTEEQIHELFSRCGKIREIIMGLNAKTQSPAGFCFVIFSSPTSA
                     LNAVKYLNGTMIFNNKMEIDLDPGFEDGRQFGRATDGSQKQYNSYQSRTRPSGGYGRS
                     RQSNYRGGRRGGGGERGGYRSYNRNYENSENPRFTTGQLPPPPHQAQGYNNSYDNQYQ
                     GEYQNGYQGSHQSNQGGYQGGYQKDHQQHSYDNSQSNQGERTYDNSDRESYQSHQQDL
                     PPHMK"
     gene            complement(<847178..>847840)
                     /locus_tag="PAS_chr1-1_0155"
                     /db_xref="GeneID:8196659"
     mRNA            complement(<847178..>847840)
                     /locus_tag="PAS_chr1-1_0155"
                     /product="Nuclear thiol peroxidase, functions as an
                     alkyl-hydroperoxide reductase during post-diauxic growth"
                     /transcript_id="XM_002489755.1"
                     /db_xref="GeneID:8196659"
     CDS             complement(847178..847840)
                     /locus_tag="PAS_chr1-1_0155"
                     /codon_start=1
                     /product="Nuclear thiol peroxidase, functions as an
                     alkyl-hydroperoxide reductase during post-diauxic growth"
                     /protein_id="XP_002489800.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0155"
                     /db_xref="EnsemblGenomes-Tr:CAY67519"
                     /db_xref="GeneID:8196659"
                     /db_xref="GOA:C4QW96"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C4QW96"
                     /translation="MVRRSTRLAGKRELEAEEEVKQEEKPNKKVTKQTKKVKIPKGDE
                     EEHDVKQSNGSSKSSEKAAVPVSAPSTKLEVGDKISDLELLNQDSEPVKLTDLAAKKP
                     ILVIFAYPKASTPGCTRQAKGFGKNYEELKKYATVVGLSADSPNAQKNFISKQSLPYD
                     LLTDPSREFIGLLGAKKQPKGVVRSHWIFVDGKLKVSQVGISPEKSVQSAYDQVLELA
                     GK"
     gene            <848045..>850900
                     /locus_tag="PAS_chr1-1_0156"
                     /db_xref="GeneID:8196660"
     mRNA            <848045..>850900
                     /locus_tag="PAS_chr1-1_0156"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489756.1"
                     /db_xref="GeneID:8196660"
     CDS             848045..850900
                     /locus_tag="PAS_chr1-1_0156"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489801.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0156"
                     /db_xref="EnsemblGenomes-Tr:CAY67520"
                     /db_xref="GeneID:8196660"
                     /db_xref="InterPro:IPR022031"
                     /db_xref="UniProtKB/TrEMBL:C4QW97"
                     /translation="MSETETLRDGHFHTSGPTYNIERFSPLPVASGLDQSPNRKGVKF
                     SEDVQLSPPKIMSSPRRRHTATKPILKSSSPASSANSSPLRKPNGSGCLPTDLSFWSS
                     GSIIATAPGTERAISVLIGSCKVLRDPNFKYKFEAYATMNGILRENKINFIKAPLSEY
                     SEYLIQETLEDICHYEAYLTNTTNSELDPFLLRTTIQSIKVSSFILSNPDLSFKLSNT
                     LCSKIMVKCCELLTNQSLGKSLSAALLQLIKEESVDHKVISLNPYFAETLLSSVLNMK
                     YFHSATLLMEKLFIIKCFLIKFKRTMIKSFNSWFPFVFACLTDTSHPTFFKIIQSATN
                     TLRECSSQFQYNRSMNELTNIFLTSPMTSSMQSIHSDTSRSNAKGIEVLVQNLIKLSS
                     ISSMECATAINIWTQFTLLFNVFTATNSFDLWSFNQLWLSPLAYFEENGPQDSKSLLE
                     VFKCWKIITQYCFFSEKLNSFPSNSNPEKLNKMTLLIGQPLAVFRRKKIEIGSKLFKE
                     ITSYQDWVFFTITKASKSINDPICKQQLFQNSFVAVLNQAFTGTGSKLDEAGSELAVN
                     YVPCFIDCSWAPLLPLLSVSAMLEILQRNITLEKGNAKLLESYLTSALSEMDPSTRID
                     FNVFYSCWVKLTGGPENMIRSFPLVEVIHYHRTSKLPIKELLRSWYSIERMQVIFLQR
                     LLDYSTRENDLEVISDVVVPILSDGEGIDSGLIEGTINIVTRFSEELFFGTDKRIITK
                     LFKEFARENPLPVKNESLGKLLAAEFVSSNALPRCLFQLLENGEIDLNQYYNAIDNLT
                     PYNPRVSGYVYQLAMKNLFLVKQLHLSYTQFSQVDITESYVVPDLSKYATVSLDSLPQ
                     SSLPDTVKISQITSKDLVLTDGEDEEEITNSTVSPKRKRVGNDQQLKKIKVDDNFKVH
                     EIMRNLQRTIDEGLEKSQREELIDQLLSTIVMLRNLG"
     gene            complement(<850897..>851604)
                     /locus_tag="PAS_chr1-1_0157"
                     /db_xref="GeneID:8196661"
     mRNA            complement(<850897..>851604)
                     /locus_tag="PAS_chr1-1_0157"
                     /product="Protein of unknown function, expression is
                     sensitive to nitrogen catabolite repression"
                     /transcript_id="XM_002489757.1"
                     /db_xref="GeneID:8196661"
     CDS             complement(850897..851604)
                     /locus_tag="PAS_chr1-1_0157"
                     /codon_start=1
                     /product="Protein of unknown function, expression is
                     sensitive to nitrogen catabolite repression"
                     /protein_id="XP_002489802.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0157"
                     /db_xref="EnsemblGenomes-Tr:CAY67521"
                     /db_xref="GeneID:8196661"
                     /db_xref="GOA:C4QW98"
                     /db_xref="InterPro:IPR015942"
                     /db_xref="UniProtKB/TrEMBL:C4QW98"
                     /translation="MAPKKILVVNPNSSKSITDNLEQLVSVPHSYELQFYTAPPEAPK
                     SINNEDDALVSAEICFPALKKRIDESPVDGVLVCCFSDHPLVPMLTKEFPSIKALGIF
                     QGSLLYSLGLATDDHKFAILTSNNQWERILDDSLLDFFYGKGSTIEKREKKLPSYCLP
                     TIAANVEVLELQDPKKFKKLQEKVQKLVDEGAKIILLGCAGLSGLDLKFKDVFPQVKF
                     VDTVKVGVQFLVPLIEY"
     gene            <852641..>853432
                     /locus_tag="PAS_chr1-1_0158"
                     /db_xref="GeneID:8196662"
     mRNA            <852641..>853432
                     /locus_tag="PAS_chr1-1_0158"
                     /product="Putative transmembrane protein involved in
                     export of ammonia, a starvation signal"
                     /transcript_id="XM_002489758.1"
                     /db_xref="GeneID:8196662"
     CDS             852641..853432
                     /locus_tag="PAS_chr1-1_0158"
                     /codon_start=1
                     /product="Putative transmembrane protein involved in
                     export of ammonia, a starvation signal"
                     /protein_id="XP_002489803.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0158"
                     /db_xref="EnsemblGenomes-Tr:CAY67522"
                     /db_xref="GeneID:8196662"
                     /db_xref="GOA:C4QW99"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:C4QW99"
                     /translation="MSEQDFEKQISEDSYRHNDVQQVATSGANNEFIHIGNQKFRRSE
                     LAEAFGGTLNPGLTAPSVHKFANPAPLGLSAFALTTFVLSLINAHAMGVTTPNVVVGA
                     AFFYGGFIQLLAGMWEMAIENTFGALALSSYGGFWMSWGVINTPWFGVAEAYGDNARD
                     FEVGVGFFLLGWAIFTIMLTVCTLKSTVTFCGMFAILSLTFVMLAVGHLAPSVNCNRA
                     GGVLGVVCAFFAWYNAYAGVATKQNSYLTVTALHLPGSDHYKKRN"
     gene            <854395..>855006
                     /locus_tag="PAS_chr1-1_0479"
                     /db_xref="GeneID:8196663"
     mRNA            <854395..>855006
                     /locus_tag="PAS_chr1-1_0479"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489759.1"
                     /db_xref="GeneID:8196663"
     CDS             854395..855006
                     /locus_tag="PAS_chr1-1_0479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489804.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0479"
                     /db_xref="EnsemblGenomes-Tr:CAY67523"
                     /db_xref="GeneID:8196663"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="UniProtKB/TrEMBL:C4QWA0"
                     /translation="MQYRSLFLGSALLAAANAAVYNTTVTDVVSELETTVLTITSCAE
                     DKCITSKSTGLITTSTLTKHGVVTVVTTVCDLPSTTKSYVPPAKTTTIPPPEKTTTTV
                     PPPAKTTTTVPPPAKTTSTVPPPAKTSSHHESTITVTVPSSTSTKKIETESTTYHFVT
                     QTTTARNITPPAITTQSHGAAGMNAANFVGLGAAAVAAAALVL"
     gene            <855244..>856164
                     /locus_tag="PAS_chr1-1_0159"
                     /db_xref="GeneID:8197919"
     mRNA            <855244..>856164
                     /locus_tag="PAS_chr1-1_0159"
                     /product="Protein of unknown function, required for normal
                     localization of actin patches"
                     /transcript_id="XM_002489760.1"
                     /db_xref="GeneID:8197919"
     CDS             855244..856164
                     /locus_tag="PAS_chr1-1_0159"
                     /codon_start=1
                     /product="Protein of unknown function, required for normal
                     localization of actin patches"
                     /protein_id="XP_002489805.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0159"
                     /db_xref="EnsemblGenomes-Tr:CAY67524"
                     /db_xref="GeneID:8197919"
                     /db_xref="InterPro:IPR009737"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C4QWA1"
                     /translation="MAFLSKFLGGKSGEAQAAEEISEIVPLSQCPATCSAAECFTRYP
                     NSYKDDPGSKNDLLWKSTKPYSLHIIIPTGKSDWKRDATDVDGTILKSISHWASSTKL
                     VPKAVKVSTSSIPQSNAKDPRIAEQTAGDILILPYFVWVKQLCMEDVDAVLDELVPIL
                     FSNFSIETTQVEPIDIPAEIKGYEIVKDTNKSYVFLCSHKTRDKRCGITAPIIKKEMC
                     IHLRDHDLYRDLGDDRPGGVQVHFINHVGGHKYAANVLIYLKSGANIWLARCNPFNVK
                     PIIEETILGGGKVWPEHVRLVQKSTKPLQW"
     gene            complement(<856216..>857325)
                     /locus_tag="PAS_chr1-1_0160"
                     /db_xref="GeneID:8196664"
     mRNA            complement(<856216..>857325)
                     /locus_tag="PAS_chr1-1_0160"
                     /product="Protein disulfide isomerase, multifunctional
                     protein resident in the endoplasmic reticulum lumen"
                     /transcript_id="XM_002489761.1"
                     /db_xref="GeneID:8196664"
     CDS             complement(856216..857325)
                     /locus_tag="PAS_chr1-1_0160"
                     /codon_start=1
                     /product="Protein disulfide isomerase, multifunctional
                     protein resident in the endoplasmic reticulum lumen"
                     /protein_id="XP_002489806.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0160"
                     /db_xref="EnsemblGenomes-Tr:CAY67525"
                     /db_xref="GeneID:8196664"
                     /db_xref="GOA:C4QWA2"
                     /db_xref="InterPro:IPR011679"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:C4QWA2"
                     /translation="MKILSALLLLFTLAFAEVIELTNKNFDDVVLKSGKYTLVKFYAD
                     WCSHCKRMNPEYEKLAEELKPKSDLIQIAAIDANKYSKYMKVYDIDGFPTMKLFTPKD
                     ISHPIEFSGSRDSESFLNFLESTTGLKLKKKAEVNEPSLVQSIDDSTIDDLVGKDRFI
                     AVTASWCGYCKRLHPEWEKLAKAFGNDDIVIGNVVTDVVEGENIKAKYKVQSFPTILY
                     FTAGSDEPIRYESPDRTVEGLVKFVNEQAGLFRDPDGTLNFNAGLIPGVSDKLTNYIK
                     EKDQSLLESTLDLLSNHEHIKDKFSVKYHKKVIEKLLKGENEFLNNEVERLSKMLNTK
                     LSANNSDSVIKRLNILRNFIEAKTESKPQLLHQEL"
     gene            <858046..>861792
                     /locus_tag="PAS_chr1-1_0161"
                     /db_xref="GeneID:8196665"
     mRNA            <858046..>861792
                     /locus_tag="PAS_chr1-1_0161"
                     /product="N-glycosylated protein involved in the
                     maintenance of bud site selection during bipolar budding"
                     /transcript_id="XM_002489762.1"
                     /db_xref="GeneID:8196665"
     CDS             858046..861792
                     /locus_tag="PAS_chr1-1_0161"
                     /codon_start=1
                     /product="N-glycosylated protein involved in the
                     maintenance of bud site selection during bipolar budding"
                     /protein_id="XP_002489807.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0161"
                     /db_xref="EnsemblGenomes-Tr:CAY67526"
                     /db_xref="GeneID:8196665"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR024982"
                     /db_xref="UniProtKB/TrEMBL:C4QWA3"
                     /translation="MAALLFLLVSIIVSCQAINFSNDISLLGRFNGLSTPNNTNQYRT
                     SVRNEDSKSLGIFKLGQDESLSFISTFNGTIKQSYSLGNNFVLVIPIEENEAPLILEV
                     NEEASQVSISNLTENWSNQVQGSIQTVFVNQTSKLIYFGGNLTLNSSIFGLVCFNYES
                     SSFESIPFQGFNENASVNAIVSIDDENLIFGGNFYSLGNQSLLHHNVSTNSSNSTELT
                     IYDVSPDQLTSFNIADVSTAGTNEALSPDPKSITCPDQDNEWILSGSQGTWLAMLHHT
                     IIPSKLRLFQSTSAEGYGVEYFRLITGPSNSIMNLTYVNPQTNEYEYCDAWCPLLSKS
                     QLEDALQNANSSDVYEDTVFNDKTRTAGYLTWSGDYQEFEFHNELDVTQVTIQVLSAY
                     NEIGALKGLQIYQSGIYVYGNESFNEPTCDDFEFHSSSVSVEAPGSWTPHEDGSITTT
                     ISLINGEIPDSTVGVTFYPNISFPGDYEFYVYTPGCLATDSCSTRGIVNATLHNGIDN
                     EQLASILIYQNNDFDKYDILYNGRINATLEDHPYVTLEVESTIPGNSETELEFAAYQL
                     YVDILYIDADAAINSTNSTRSLNLTVPLNGIFEYSLNNFTDFDTLRLSNNTFVGNSSI
                     NLLGSSLLENATVNGLVFQDGKLYVGGKLSANDEGNLLEVAIQNINNTDNSFNTEGMR
                     LLQFNGTVDSLTSTVGEDITVISNSSIFLLRDSNVLSLADTNFTVSDTSSFKMNNSTF
                     FLFTNEEGQSVVWNNGSRSWVENNSSFFLNLTSSVSLDELNDTLLFGDLVYSEYSINN
                     LARFVDGEFFESPFQFNSSFDNSLLTSYYINESAALFGGRFKTTDGLSNVAIVTSLRN
                     GSVQISGLNGIEWDDDSVVTTFLISQKDDYLFIGYNGTAELNNTSVQGLLIYDLSQNE
                     PLVHQPAPLNRESDEPGIVHALSYNTEESYLLVGGDFESAGSLSCEAFCRYEISGSRW
                     VKPSISNSLAGEIHDMSYVSNTKLVVAGNLSVDGQNDGFVVFDSSKNEVNVSSALSVS
                     NIINYENQTISQFILVDSSLNGRALALGNNFIIGSNGTNWTRLDGDSFFEGTIFTNMA
                     LLDMDSRTQNNRPASNNFFDLDEILLVSGFLNFGSDIGNYSTAFYNGSSWIPYTVTTN
                     DLALRNSTINNIYANSTSSRSLKNDILLQAPQLGTGPVVGIGFALALGTTLLLGSLFA
                     LYAISNKRKNSFLEKQDARVGELEMMEKVPPDQVLDAMDQAKFR"
     gene            complement(<861891..>863927)
                     /locus_tag="PAS_chr1-1_0162"
                     /db_xref="GeneID:8196666"
     mRNA            complement(<861891..>863927)
                     /locus_tag="PAS_chr1-1_0162"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489763.1"
                     /db_xref="GeneID:8196666"
     CDS             complement(861891..863927)
                     /locus_tag="PAS_chr1-1_0162"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489808.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0162"
                     /db_xref="EnsemblGenomes-Tr:CAY67527"
                     /db_xref="GeneID:8196666"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR024761"
                     /db_xref="InterPro:IPR024764"
                     /db_xref="UniProtKB/TrEMBL:C4QWA4"
                     /translation="MAQEIVLTRFQPYRVPNLFQWSNDGDIAIINNNNNVVVLESTPV
                     SLNPDIHKIHALTDLLVLKRNVLNPSPLLYLQRHQTYDDDVNITDTVMEPQPVSIRWS
                     SKGFSKDQRSQLAVLYNNLQLYIFETGNWNCSLHVNSAIHQLDLEHVTRLPDIQRSRI
                     TGFSWAPLVDDVRLDDHHFMAISNGKGEIKLFELFSDKIDVKITIELPSVAGTLEWSP
                     WIQSQGRLVSYLTAITRDNSIHVIKVCLETDGRLISDGQLKQISKKYRGLHANSKWYN
                     WDGKLTFFIVFTKSLKAFVFDSDQISHFELDLQSPLFFHDFELYRMDGLLKLILVESS
                     GDYIRTEFSPAEGFANFEHLNFMINEPTAEDPLYKQLYKIQKMLVQSADPQKLLIAGI
                     SMDPTSNVFGILYTKHKLASPVFAKSLAYWKVYFNIVPLRSVKTMELGKLVDYFSGSV
                     INELLPLQYSGSLITQIISMYSLRNKNLYKEFESRIQNLTPFLKNKSNDKSLTTFSQH
                     LRYHLFKDTYVQSLRFLNWFKMDKNNELIQIAARLIITFITDNKITLSNPVDEFILQS
                     FNLISGLNLLPQKDNVVLHNFQHNIDESFDFTNHTSCSSLYSITSKEGHVWSRCAITL
                     LPILSTNIIKDPISGLVALNDFSDYIQSEHQCILVPILQQVCSVSLFTGGTFVS"
     gene            <864097..>865023
                     /locus_tag="PAS_chr1-1_0163"
                     /db_xref="GeneID:8196667"
     mRNA            <864097..>865023
                     /locus_tag="PAS_chr1-1_0163"
                     /product="Deoxycytidine monophosphate (dCMP) deaminase
                     required for dCTP and dTTP synthesis"
                     /transcript_id="XM_002489764.1"
                     /db_xref="GeneID:8196667"
     CDS             864097..865023
                     /locus_tag="PAS_chr1-1_0163"
                     /codon_start=1
                     /product="Deoxycytidine monophosphate (dCMP) deaminase
                     required for dCTP and dTTP synthesis"
                     /protein_id="XP_002489809.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0163"
                     /db_xref="EnsemblGenomes-Tr:CAY67528"
                     /db_xref="GeneID:8196667"
                     /db_xref="GOA:C4QWA5"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR015517"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QWA5"
                     /translation="MLIGISGTKCSGRTTVARYLTYQGFKHISLEPSILNIDHKFEDE
                     DELVDFVTKNYSENFVLSHIDNPVLLSKLSKRPFFLHISLESSILKRHQRRCSKAGDI
                     SLEEFVIDCDKYTFDHKLIEISNLADITIINNHDSINQLYSHLSNVNLLNPTRLRPSW
                     DAYFMRLADLAALRSNCMKRRVGCVVVRDNRIISTGYNGTPRNMPNCNQGGCARCNSG
                     NSSGNGLSTCLCLHAEENALLEAGRDRISTNSILYCNTCPCLTCSIKIIQSGIQEVVY
                     SQSYSMDTLSYQALNAAGVKLRQYSPPQGGVM"
     gene            complement(<865053..>865757)
                     /locus_tag="PAS_chr1-1_0164"
                     /db_xref="GeneID:8196668"
     mRNA            complement(<865053..>865757)
                     /locus_tag="PAS_chr1-1_0164"
                     /product="Putative protein of fumarylacetoacetate
                     hydrolase family protein"
                     /transcript_id="XM_002489765.1"
                     /db_xref="GeneID:8196668"
     CDS             complement(865053..865757)
                     /locus_tag="PAS_chr1-1_0164"
                     /codon_start=1
                     /product="Putative protein of fumarylacetoacetate
                     hydrolase family protein"
                     /protein_id="XP_002489810.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0164"
                     /db_xref="EnsemblGenomes-Tr:CAY67529"
                     /db_xref="GeneID:8196668"
                     /db_xref="GOA:C4QWA6"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="UniProtKB/TrEMBL:C4QWA6"
                     /translation="MSFNFVKEAGKFLCIGRNYVAHIKELNNRTPSQPFFFLKPSSSV
                     LLPKDGPILVPKGVVVHHEVELAVVLNKQLKNLDPETFTAEDALDAIAGYSLAIDLTA
                     RNVQDEAKKKGLPWSIGKGFDTFLPLSPFISKSQIPDPYNVQLHLKVNGETRQDDLTN
                     LMIFPVHQIFATMSSIMTLEKGDVILTGTPKGVGKLVPGDHVEAFISVDGKVIPESVI
                     DVEVDQKPGPYEYKET"
     gene            complement(<865942..>867216)
                     /locus_tag="PAS_chr1-1_0165"
                     /db_xref="GeneID:8196669"
     mRNA            complement(<865942..>867216)
                     /locus_tag="PAS_chr1-1_0165"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489766.1"
                     /db_xref="GeneID:8196669"
     CDS             complement(865942..867216)
                     /locus_tag="PAS_chr1-1_0165"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489811.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0165"
                     /db_xref="EnsemblGenomes-Tr:CAY67530"
                     /db_xref="GeneID:8196669"
                     /db_xref="GOA:C4QWA7"
                     /db_xref="InterPro:IPR002112"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR020956"
                     /db_xref="UniProtKB/TrEMBL:C4QWA7"
                     /translation="MNSVSPPNDLGKTTKSGLELEPNPFEQSFASKPSSDTKDKKIAL
                     NPKQQPNLTTEGASPTVLTPGGSKKNILPPLTGLSPGGSGLSITPGAMWNVNYNSNTF
                     PGLTNHHSSQSLMQQFVLNARRSGLTPNESYLRTGLTPIPQVPVSQVPVHQVPVMQGQ
                     VLQGPLPQAPPPPQGVGSQVPPNVNNPYPVPPALISNLSSLLAFPSAAEPPQSLKKEE
                     TQLPTPVTSLNSTDCDSAKDLKVKKEGSKSKKRTASVATTDEKSAEPDSKKTPADEEG
                     KRKSFLERNRVAASKCRQRKKQKVQRMEEELNFYSQNYNALNFQVNMLREQVLTLRTI
                     LYSHHNCPTLIDQLGGVENLNAILNSTQYVDQGRKPVGPEEQMELGSTMMGKPANQIQ
                     LNGLNTLSNQNSQTENTALMASNNTSLGERKS"
     gene            complement(<867713..>867934)
                     /locus_tag="PAS_chr1-1_0166"
                     /db_xref="GeneID:8196670"
     mRNA            complement(<867713..>867934)
                     /locus_tag="PAS_chr1-1_0166"
                     /product="RNA polymerase subunit, found in RNA polymerase
                     complexes I, II, and III"
                     /transcript_id="XM_002489767.1"
                     /db_xref="GeneID:8196670"
     CDS             complement(867713..867934)
                     /locus_tag="PAS_chr1-1_0166"
                     /codon_start=1
                     /product="RNA polymerase subunit, found in RNA polymerase
                     complexes I, II, and III"
                     /protein_id="XP_002489812.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0166"
                     /db_xref="EnsemblGenomes-Tr:CAY67531"
                     /db_xref="GeneID:8196670"
                     /db_xref="GOA:C4QWA8"
                     /db_xref="InterPro:IPR006591"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:C4QWA8"
                     /translation="MSREGFVAPSGTDLAAAASGVAPNKHYGVKYTCGACAHNFSLNK
                     SDPVRCKECGHRVIYKARTKRMSKFLTTY"
     gene            <868096..>869874
                     /locus_tag="PAS_chr1-1_0167"
                     /db_xref="GeneID:8196671"
     mRNA            <868096..>869874
                     /locus_tag="PAS_chr1-1_0167"
                     /product="Peripheral mitochondrial inner membrane protein,
                     located on the matrix face of the membrane"
                     /transcript_id="XM_002489768.1"
                     /db_xref="GeneID:8196671"
     CDS             868096..869874
                     /locus_tag="PAS_chr1-1_0167"
                     /codon_start=1
                     /product="Peripheral mitochondrial inner membrane protein,
                     located on the matrix face of the membrane"
                     /protein_id="XP_002489813.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0167"
                     /db_xref="EnsemblGenomes-Tr:CAY67532"
                     /db_xref="GeneID:8196671"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:C4QWA9"
                     /translation="MLQSLGSSNRWRTVQTCTYVWDRCFAQMATACNNQEYLQFLPYV
                     GKGSKFKTHYINSFNSVSNSNQSHDDHELRSRQQKLTNYKKISKYLSQDELFQLNQEF
                     IQQIFSLITSFRYDSKILDPGTVQEFYRQPRVLSRAPKLPESLNIEVFTEYVDQITNN
                     RYVHNHASNEENVIPMLLRQFFHKDNRHCMKLRGIHSYNNVIRFFLSKNDLPYAKSLL
                     AQMRTEGIRPNRLTYNLFIGHLRNMPVHYTNPLITVLKYLGLMRKEYISPDSTTWHLI
                     YQILPDKISKQMLLDKMDQLGFSRTALLTRFELESLSCSNEMTKLLQSTPPPSKDINC
                     FNILFSQLVIEKKYQKCWELLHETTLTPNLSTLNSILNSLRNNSRVDLCFVFYNYMLD
                     KFKISPNTTTFHYLIAAAVKQGFHNNWRQVLRILYHEMLVVTGTTNNFSGYYLQRAKA
                     RSLIDLKNNQAPLNLKTPLSTAELDIRHQLFNDLSINTETKKFPTIPNTQKHGPKFVK
                     AALTSGYHRAKPSKNGEQKGNYIHLANRAKSVKSAIQKDFKQKDKMHNLSRRYRDRIS
                     IIKEGYTSNLKQKLVDNNMVSVPYLK"
     gene            complement(<869930..>873784)
                     /locus_tag="PAS_chr1-1_0168"
                     /db_xref="GeneID:8196672"
     mRNA            complement(<869930..>873784)
                     /locus_tag="PAS_chr1-1_0168"
                     /product="Vacuolar membrane protein that transits through
                     the biosynthetic vacuolar protein sorting pathway"
                     /transcript_id="XM_002489769.1"
                     /db_xref="GeneID:8196672"
     CDS             complement(869930..873784)
                     /locus_tag="PAS_chr1-1_0168"
                     /codon_start=1
                     /product="Vacuolar membrane protein that transits through
                     the biosynthetic vacuolar protein sorting pathway"
                     /protein_id="XP_002489814.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0168"
                     /db_xref="EnsemblGenomes-Tr:CAY67533"
                     /db_xref="GeneID:8196672"
                     /db_xref="GOA:C4QWB0"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR003392"
                     /db_xref="UniProtKB/TrEMBL:C4QWB0"
                     /translation="MIILLPLLFLFVAGLVQATKVHEAGICALRGNCGKKNFFGSELP
                     CPDNTFSTPSSPDDFDLLEQICGKEFADINTYTCCDTSQLLNLQKQLKKVDPIIASCP
                     ACRSNFYTLFCSFTCSPDQSQFVNVTDTVKSTTGEDAVSELDYYIQSSWAEEFFNSCK
                     DIKFGASNGYAMDLIGGGAKNYSDFLKFLGDEKPLLGGSPFQINFQYPSNSTPQWVEY
                     PDNPVRACNDSNPDYKCACSDCPGSCPVLPSRHAPKQCRVGILPCFSFAVVVLYAIVL
                     LGYIAYKTSRYTKSRTSLLLHDDLALDESRYDYSSEDEQFFNNEFEYNSSYYPINSKL
                     EEWFCKLGFFCSTSPKTVIFVSLVVSLTLTSFMRFIELEEDPVKLWVSPQAEAFQQKQ
                     VFDEKFGPFYRTQQIFVINETGPVLSYDTLKWWFDKESTILSLQANASDYQRETITLQ
                     DLCLKPINDACVVESFTQYFGGDSSSLTEDNWEKKLSSCANSPVNCLPSFQQPLKKSL
                     LFGTEQLEDFDILKSNALVITLVMNNSNDVNSTQFQNSLAWEKVLESHLLDLKEESAQ
                     RGLKLSFSTESSLQKELNKSTNTDINIIVISYLLMFLYAAVALGSNAITREWNLTSLV
                     HTRFTLGLSGIIIVLLSVSSSAGFWSIFGLKSTLIIAEVIPFLVLAIGVDNIFLISHE
                     LNTVNMNYSTESIPLRVSKAMGKIGPSILLSSSSQVFCFALATVVSMPAVRNFAAYCT
                     MAVLFNCILQTTAFVSLLTLDQIRLEDNRLDVFPFVKVDRGVQFGNNNSQEGLIIDEL
                     LDTSNDNVFSELIKKYYAPFIFNKNIKPCILAIFGTFTIFCLSLLPDVQFGLDQRIAL
                     PRDSFLIDYFDSIYNYLGVGPPTYFVVDGMNVTERSNQQKLCGRFSTCDEFSLVNVLE
                     QERKRSEISTIYEPTSSWIDDFFLWLNPDLTDCCRFRKGTNQTEMCPIYAPSRQCEVC
                     YENHEPGWNITMEGLPQGEEFMKYFDIWIESPSDPCPLGGKAPYSSSVFTDVNGTNVE
                     SFVFRTSHVPLRSQNDFIKAYKESLRITNEVKEYTGIENLFAYSPFYIFFVQYASIVK
                     LTFSLIAAALLVIFLFAVTLLGSFASALILILTVVMILIDMGGIMALWGINLNAVSLV
                     NILICVGLSVEFCTHIVRGFTIGDPAINFNTSLDTTYAFSSKQSRAFKSLTTIGGSVF
                     GGITLTKIVGVTVLAFTRSQIFEVYYFRMWFSLVVLASLHSLMFLPVILSYVGGRGYI
                     SSSYASLVSDELIDRLQEQTLD"
     gene            <873979..>874668
                     /locus_tag="PAS_chr1-1_0169"
                     /db_xref="GeneID:8196673"
     mRNA            <873979..>874668
                     /locus_tag="PAS_chr1-1_0169"
                     /product="Protein required for the ubiquinone (Coenzyme Q)
                     biosynthesis"
                     /transcript_id="XM_002489770.1"
                     /db_xref="GeneID:8196673"
     CDS             873979..874668
                     /locus_tag="PAS_chr1-1_0169"
                     /codon_start=1
                     /product="Protein required for the ubiquinone (Coenzyme Q)
                     biosynthesis"
                     /protein_id="XP_002489815.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0169"
                     /db_xref="EnsemblGenomes-Tr:CAY67534"
                     /db_xref="GeneID:8196673"
                     /db_xref="GOA:C4QWB1"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR011566"
                     /db_xref="UniProtKB/TrEMBL:C4QWB1"
                     /translation="MIRHSRNLIKLQSVRYASTKGKENSATENLRLGYLSDAQNAYMD
                     RVIRVDQAGELGANFIYNGQYLALSHKRPDLKPILKHMWEQEIHHHNTFNNLQVERRV
                     RPSLLTPLWKVGAMGLGIATGLMGKEAAMACTEAVETVIGGHYNQQLRVLTNQFHVDV
                     VNEETGVNTPTVPEEIKDMQKLVSQFRDEELEHLDTAVEHDAHGARPYWLLTEAIKLT
                     CRGAIWTAERV"
     gene            complement(<874716..>875288)
                     /locus_tag="PAS_chr1-1_0170"
                     /db_xref="GeneID:8196674"
     mRNA            complement(<874716..>875288)
                     /locus_tag="PAS_chr1-1_0170"
                     /product="N-myristoylated calcium-binding protein that may
                     have a role in intracellular signaling"
                     /transcript_id="XM_002489771.1"
                     /db_xref="GeneID:8196674"
     CDS             complement(874716..875288)
                     /locus_tag="PAS_chr1-1_0170"
                     /codon_start=1
                     /product="N-myristoylated calcium-binding protein that may
                     have a role in intracellular signaling"
                     /protein_id="XP_002489816.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0170"
                     /db_xref="EnsemblGenomes-Tr:CAY67535"
                     /db_xref="GeneID:8196674"
                     /db_xref="GOA:C4QWB2"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR028846"
                     /db_xref="UniProtKB/TrEMBL:C4QWB2"
                     /translation="MGKVASKLSSDDIHELRQTTKFDRRELQQWYKGFLRDCPSGTMT
                     KDDFIKIYKQFFPFGDPTEFSAYTFKVLDTDNSGEIDFKEFITALSVTSRGSMEEKLL
                     WSFKLYDLNNDGFIDHDEMLAIVTSIYQMIGSMVELSEDEKTPELRVEKIFNLMDKNE
                     DGKISLQEFQERCKLDPSIINALTLYDGLV"
     gene            complement(<875528..>876658)
                     /locus_tag="PAS_chr1-1_0171"
                     /db_xref="GeneID:8196675"
     mRNA            complement(<875528..>876658)
                     /locus_tag="PAS_chr1-1_0171"
                     /product="Negative regulator of the glucose-sensing signal
                     transduction pathway"
                     /transcript_id="XM_002489772.1"
                     /db_xref="GeneID:8196675"
     CDS             complement(875528..876658)
                     /locus_tag="PAS_chr1-1_0171"
                     /codon_start=1
                     /product="Negative regulator of the glucose-sensing signal
                     transduction pathway"
                     /protein_id="XP_002489817.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0171"
                     /db_xref="EnsemblGenomes-Tr:CAY67536"
                     /db_xref="GeneID:8196675"
                     /db_xref="UniProtKB/TrEMBL:C4QWB3"
                     /translation="MYIPPTSFNRKQFKYSGDNYNTPSEFKEQARLDIHRKLAQAQSN
                     LRHGSSPLATKSITASSSQFSGSDVESLASVASDGSEMTIDESKRKRKAYLGFLKKPE
                     SKLSRTTTRRSSLFSNNLTQQPTNQTEATSLFTNYFSDNGFVTEVDLNEVLPKNFDDM
                     YDPDLTVERFYNGRPVFTKRNLVNWELNDLRSLLIVSELKPEWGGYIPRIRDNPDFHI
                     VLLPLTSSDNEFIEILMRSDIYKESKFSKEFKMKTAAYIVQSARYRHNLAIQARYSDM
                     PTKDPTLQYFSKVEWRNIIENYLLNLGVETQCRLDFQHRCSILKGHPAQKNDLLSKAI
                     LNNTQKQFNGNGLSKEEKARIWSQAQSEIYKRLGLDWTPDKI"
     gene            <877062..>877409
                     /locus_tag="PAS_chr1-1_0172"
                     /db_xref="GeneID:8196676"
     mRNA            <877062..>877409
                     /locus_tag="PAS_chr1-1_0172"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489773.1"
                     /db_xref="GeneID:8196676"
     CDS             877062..877409
                     /locus_tag="PAS_chr1-1_0172"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489818.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0172"
                     /db_xref="EnsemblGenomes-Tr:CAY67537"
                     /db_xref="GeneID:8196676"
                     /db_xref="GOA:C4QWB4"
                     /db_xref="InterPro:IPR008698"
                     /db_xref="UniProtKB/TrEMBL:C4QWB4"
                     /translation="MSGEESAKDIGQLREGKLYPLNYSHSHTNETIKLTLIVSHEEMK
                     QNKIPLAYRDRCARLLVPLNKCRKEGWYMPWNCVQERHDYEQCQYLDFKRRVKELEEI
                     KKQRDAADASADL"
     gene            <877907..>878257
                     /locus_tag="PAS_chr1-1_0173"
                     /db_xref="GeneID:8196677"
     mRNA            <877907..>878257
                     /locus_tag="PAS_chr1-1_0173"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489774.1"
                     /db_xref="GeneID:8196677"
     CDS             877907..878257
                     /locus_tag="PAS_chr1-1_0173"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489819.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0173"
                     /db_xref="EnsemblGenomes-Tr:CAY67538"
                     /db_xref="GeneID:8196677"
                     /db_xref="UniProtKB/TrEMBL:C4QWB5"
                     /translation="MTGSLGDIFASLFKKKDEEELLWPNMTSSRQSEETCCPAQHVRI
                     EHERKHRGSIDNKGHRNQFLSSASSTFPPAEDVQFEKLSQSIYTMLDEPLHIQPNNQN
                     CISYRNSGFRTKYR"
     gene            <878491..>881691
                     /locus_tag="PAS_chr1-1_0174"
                     /db_xref="GeneID:8196678"
     mRNA            <878491..>881691
                     /locus_tag="PAS_chr1-1_0174"
                     /product="ATP-dependent Lon protease involved in
                     degradation of misfolded proteins in mitochondria"
                     /transcript_id="XM_002489775.1"
                     /db_xref="GeneID:8196678"
     CDS             878491..881691
                     /locus_tag="PAS_chr1-1_0174"
                     /codon_start=1
                     /product="ATP-dependent Lon protease involved in
                     degradation of misfolded proteins in mitochondria"
                     /protein_id="XP_002489820.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0174"
                     /db_xref="EnsemblGenomes-Tr:CAY67539"
                     /db_xref="GeneID:8196678"
                     /db_xref="GOA:C4QWB6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027065"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027501"
                     /db_xref="UniProtKB/TrEMBL:C4QWB6"
                     /translation="MSMGATVSKESTVDLTLPLLQLSPRLLFLPGVVYKTTFKFQEGV
                     NILLRFRDLFDESFSERNDVLGDIARSQKEQQENDYDHIPFLSSNAKKSIGVLKDQLE
                     LGGSDDKSLPWVIACLPGFDQSDQDSIATTICQITEVSVVNQDIVLSFEALTRGSLKS
                     KKTISMNESTISVEVDIPFTEVDQTISNKLILTNIDKGLQLLENIKQFLVTYQNDMMN
                     LEDTTMEKNSRLKSAMMILAPLSHLIYATVSSQESTHAYTRLSNQYKSAKKELDSTKN
                     RKSLLKKILKTNDILTSVFPFSMVQKVDVLGAISSSTDRIQTTIDALDFANPLFETYL
                     NVDYVLETWKDFDTKNGKIAANLTRSQLVSNHLKGLRVLIEDIQGTSRRRVSPSQRTR
                     LAPSPNTNSANQAPKAGESDDENKELRDFINNLSKLKISEDGKRLVTKDFNRMTQMQP
                     SSSEYQLLRTYLEIIMDIPWETKNIVKQQIFDLDKAKETLDQDHYGMDSVKDRILEYL
                     AVLKLHDHIKTSNPKQEDEEIKARAPILLLTGPPGVGKTSLGKSIAKALNKKFQRVSL
                     GGLKDESEIKGHRRTYVGAMPGLLTQALRKSQSFDPVILLDEIDKVVDGSQGPGSRVN
                     GDPAAALLEVLDPEQNSNFSDHYIGFPLDLSRVVFICTSNDMSMISAPLRDRMEVIEL
                     NGYNYFEKVEIVKQFLLPKQIKRNGLPTNAESPSVVIPDEVIMYIAVNYTREPGIRNL
                     ERLIGSICRGKAIEYSSLMSSTQAPGEIPKGYVSKVTVDNLSKYIGIPPELSTGKNMR
                     NDSAISKKYGIVNGLSYNSSGHGSTLVFEMTGIPNSTNTNMITTGRLGDVLTESVKIA
                     RTIIRSMFSHNLLQLKDDETSTSGDLLKRFDTTQVHMHVPAGAIQKDGPSAGITITLC
                     LLSVMLEKPVPRDLAMTGEITLRGMVLPIGGVHEKLLGAHLTGTVKRVILPRSNRRDV
                     IQDFISNLEANNRSSRDKLLVDLIKEEESLLSNSNKSERIGVFGLPEKWVQEKLGLQV
                     SYVEEFWDVIQIVWNDQVEIDSTKLHELATKEFARL"
     gene            complement(<882178..>883015)
                     /locus_tag="PAS_chr1-1_0175"
                     /db_xref="GeneID:8196679"
     mRNA            complement(join(<882178..882824,882919..>883015))
                     /locus_tag="PAS_chr1-1_0175"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489776.1"
                     /db_xref="GeneID:8196679"
     CDS             complement(join(882178..882824,882919..883015))
                     /locus_tag="PAS_chr1-1_0175"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489821.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0175"
                     /db_xref="EnsemblGenomes-Tr:CAY67540"
                     /db_xref="GeneID:8196679"
                     /db_xref="GOA:C4QWB7"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR020625"
                     /db_xref="UniProtKB/TrEMBL:C4QWB7"
                     /translation="MNSVKEDFHIAVPTAFHADESLNIEETLKHIDHSLDQEARFAPD
                     LEILVGVSGIRQKEVLRLAERVERSNAIKAVLLGYPPYLVPSQAEAVCYTEKVLEKLS
                     KPVILYNNPLRTGFDLAVESILHLFDNHQIIGIKEAGDPEKIQAVQKRLDRTVYYYAG
                     GEQDLEKKISLGFNRLSSIAGNVWPQEISNWFFNLLEGKNDDTDKISLLLENLYNDSF
                     LVQLKKLIIATSDVQMGNCRAPLGNLEKE"
     gene            <883990..>886440
                     /locus_tag="PAS_chr1-1_0176"
                     /db_xref="GeneID:8196680"
     mRNA            <883990..>886440
                     /locus_tag="PAS_chr1-1_0176"
                     /product="Putative FAD transporter"
                     /transcript_id="XM_002489777.1"
                     /db_xref="GeneID:8196680"
     CDS             883990..886440
                     /locus_tag="PAS_chr1-1_0176"
                     /codon_start=1
                     /product="Putative FAD transporter"
                     /protein_id="XP_002489822.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0176"
                     /db_xref="EnsemblGenomes-Tr:CAY67541"
                     /db_xref="GeneID:8196680"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="UniProtKB/TrEMBL:C4QWB8"
                     /translation="MRPGWIFVALGALFCAADARRALSATSLVTCQDNSLIDPSYFNV
                     TFSPDTGALTYDISMTSEISDNVIANVRVYAYGFAVIEREIDMCTIGWKQFCPLYPGT
                     LEIDSVEYIDRDFADMVPSIAYVVPDIDAVVRVVLHNANGTQLGCLQASFSNGRTVSH
                     IAAQWATAVIAGIGLLAGALLSAFGNSISASHISANSISLFLYFQSVVVVCMQAVEEV
                     PPIAGAWSENLAWSMGLIRVEFMQKIFRWFVQATGGTPTLYLTSTTISILVQRSIDFI
                     ADYVPFANSFVTTPADTLEELVAGRYQTRDFDLYALRSTAHLRILRGIERVGLKAGIE
                     PTSIVCTGFTFFFLCGYVLAIIIVLFRSSVALGKRMGWIKNSKLLAFKFSWRQILKGA
                     LLRYIYIGFTQLTILSFWEFTRNDSPAVVVLAVLFLLLALIIMGWASYRTMYFGSKSI
                     REHNNPAALLYGNPQVLRKYGFFYSLFKAQKYWFGIVVLIHTFIRCIFIGLGQGSGVA
                     QALAFFIIDLFYTAFVIHQMPYLDKLTNIANIMICVVMTINSFLFLFFSQLFNQNVSV
                     APIMGWVFFILNAAFTVILLILIIVYTCMAIFTNNPDARFAPAKDDRTSFQRHGADDK
                     NDDYPPDGTAELAALGQVAQNHQENWASEMYKLKDMVDSSPSQSELTEKDELLAEPEE
                     KPSLGAMFTRKLTRGKSFKNAFKRGGNTGDVTKGDDSTTEVKRVSDTLLNFGDDGHKR
                     TDSTTPIVNSQAARVGNDSSFPDLIPQPVMTSDFTSDNVGDPRGFVFQNSPSLSGNSI
                     RNPSGGDKEDKDSLYKYI"
     gene            complement(<886481..>887704)
                     /locus_tag="PAS_chr1-1_0177"
                     /db_xref="GeneID:8196681"
     mRNA            complement(<886481..>887704)
                     /locus_tag="PAS_chr1-1_0177"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489778.1"
                     /db_xref="GeneID:8196681"
     CDS             complement(886481..887704)
                     /locus_tag="PAS_chr1-1_0177"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489823.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0177"
                     /db_xref="EnsemblGenomes-Tr:CAY67542"
                     /db_xref="GeneID:8196681"
                     /db_xref="UniProtKB/TrEMBL:C4QWB9"
                     /translation="MPLKLYISFALYLIALVHCLILPATSPICELPYAKSFPYWGYRI
                     QREYSLRSIRGPLFHYSVFIRCRQSSLDYEHLVRLGREEDIPWNTTLCFSNRLTKKSK
                     STVNNKSKESRNTTDSAANEKPTFSPLNRVYKKLFKRFDYVLTKMARSRFLQYASHRQ
                     DDKVDGIRHLPSKEVLSVSLEDLKCYKLVRRKKYVTRQLSLYTPYRFIGGLFECPLSK
                     ETKKDMLKSASALDFISPYQIPCDSNTAVPIAPLISDDISQQLVNHNIFSSRITDFRI
                     NIIQRIPYLFTPSFLDPRFYSSGVFKGRYSNWFDELDINEDYDLSSLDESVMSKSNTL
                     FANYIAKHFRFKNTNPLLVWERNTSNTHDDDNEQYLNRKSDLLNQVLSQLVEWPWDVA
                     KQHLTNIHQILDVDS"
     gene            complement(<887824..>888912)
                     /locus_tag="PAS_chr1-1_0178"
                     /db_xref="GeneID:8196682"
     mRNA            complement(<887824..>888912)
                     /locus_tag="PAS_chr1-1_0178"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489779.1"
                     /db_xref="GeneID:8196682"
     CDS             complement(887824..888912)
                     /locus_tag="PAS_chr1-1_0178"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489824.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0178"
                     /db_xref="EnsemblGenomes-Tr:CAY67543"
                     /db_xref="GeneID:8196682"
                     /db_xref="GOA:C4QWC0"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:C4QWC0"
                     /translation="MIDISSKLRRDSLSDTDLNQDPNQKKINSEPTKLLLSEIALDPI
                     IQSLPHVKDLNVIQPAEALALLNKLATELLSLYAEYEQHGSMDLAPLLYDSSKYAKPG
                     SDSQEESPTPVSGFLERKLSMIDHSDIDKMSDSSQADQFKIRTISSDSFDIPLKSESK
                     LGYNFDDLEEGSSTNESSLSTLNNTYVDNSVEQTFQNEVSFETCTNIVKIFNLKAIPS
                     LSITAYLERIHSLLSPSTAVYLTACLYLYNCAFHFKTVRLKQRSHFRPSQHTNITMLP
                     INELNIFRLVSAIIRIASKLIEDKNFKQTYYCKVAGLQSMKELQNLELSFLFLFNFNL
                     FVSREILLSHLDQLYVFFNRRTQLNVSV"
     gene            <889222..>892794
                     /locus_tag="PAS_chr1-1_0179"
                     /db_xref="GeneID:8196683"
     mRNA            <889222..>892794
                     /locus_tag="PAS_chr1-1_0179"
                     /product="Essential conserved nucleolar GTP-binding
                     protein required for synthesis of 40S ribosomal subunits"
                     /transcript_id="XM_002489780.1"
                     /db_xref="GeneID:8196683"
     CDS             889222..892794
                     /locus_tag="PAS_chr1-1_0179"
                     /codon_start=1
                     /product="Essential conserved nucleolar GTP-binding
                     protein required for synthesis of 40S ribosomal subunits"
                     /protein_id="XP_002489825.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0179"
                     /db_xref="EnsemblGenomes-Tr:CAY67544"
                     /db_xref="GeneID:8196683"
                     /db_xref="GOA:C4QWC1"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR007034"
                     /db_xref="InterPro:IPR012948"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QWC1"
                     /translation="MDPQQSNKSHRGAAKKDGHKKKLHTQGYNAKAFAVSAPGKLQKM
                     AMRSSEMNEKRLHVPMVNRTPDDDPPPVIIAVVGPPGTGKSTLIRSLVKRLSKTTMTD
                     ITGPVTLVSGKRRRVTFIEISNDMNSMIDIAKVADLVLLMVDGNFGLEMETMEFLNIA
                     QHHGMPRVIGIATHLDLFKSQSTLRTSKKKLKHRFWSEVYPGAKLFYLSGVLNGRYPD
                     RETLNLTRFISVMKFRPLKWRNEHPYLMVDRMIDLTHPREIEKNRKIDRTVALYGYLH
                     GTPLQPTNARVHIPGAGDFTVAAVEKLPDPCPTPYYEQKLDEIEREAVKEAAANGETV
                     LPRRRGRKRLEDKQKIIYAPMSDVHGVLIDRDAVYIDMGNQESFKKGEESGLGEQLVT
                     DLQSVDKDFQDQLNGAAGVQLFSSSTALEKVENKENEEEDEDDISEDEEEFDPKSKSN
                     TGRSQLRKPRVYKSANNEDEGLDLDNIDEDAYDPKVYDQDNENGTFEFEFDKNYLQDD
                     EKPEFASDSELEDNEDWQGMASKLTGSVQRKWDINKLIYLNNIDPADVIARWKSEEAE
                     LDNEDSSEADIEQEEAFFQKKDVQGSSEDLDTSQLEFAPLDELKSKWVKPDPLDTLKK
                     RFFKSPKQKISEKNKNGDIDDDEDEAYGDFEDLEAENTHNEDENESKEVNGSVNGDDF
                     ADFEAEEEKDEDDEDSSQEESEVEGTEELTLEEKRQLNAKKKEKLRQQFEDEEGENFL
                     EEGQEDHDTWYEFQKAKMAKQLEINKSELEELDEQTRLHIEGYRAGSYVKLTFKNVPM
                     EFVENFNPIYPVIVGGLLQTEEKFGYLNVRIRRHRWHKKILKTNDPLVLSLGWRRFQT
                     LPIYTTTDSRTRTRMLKYTPEHAYCGATFYGPLVAPNTTFCGVQVVSNSATTGSFRIA
                     ATGVVEDLNADVEIVKKLKLVGYPYKVFKNTAFIKDMFSSALEVAKFEGASIKTVSGI
                     RGEIKRALSKPDGYFRAAFEDKIQMSDIVFLRTWYPVQAKKFYNPVTSLLLKDKTEWK
                     GMRLTGQVRHENNVPVPASKNSAYKKIEREELEFMPVKIPKALQAELPFADQIPVPRP
                     KKQDDLVNVTRKRAVILDDEEKKAVALLEKISTLKKAKEAKNAEKKRTKYEEKLKKLA
                     KEEEIKSDKDKQRKKDFFSKEGKKRSLGGESQSGARNGGKKRRN"
     gene            complement(<892887..>893536)
                     /locus_tag="PAS_chr1-1_0180"
                     /db_xref="GeneID:8196684"
     mRNA            complement(join(<892887..893440,893518..>893536))
                     /locus_tag="PAS_chr1-1_0180"
                     /product="GTPase; GTP-binding protein of the ARF family,
                     component of COPII coat of vesicles"
                     /transcript_id="XM_002489781.1"
                     /db_xref="GeneID:8196684"
     CDS             complement(join(892887..893440,893518..893536))
                     /locus_tag="PAS_chr1-1_0180"
                     /codon_start=1
                     /product="GTPase; GTP-binding protein of the ARF family,
                     component of COPII coat of vesicles"
                     /protein_id="XP_002489826.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0180"
                     /db_xref="EnsemblGenomes-Tr:CAY67545"
                     /db_xref="GeneID:8196684"
                     /db_xref="GOA:Q9P4C8"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006687"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR027417"
                     /translation="MWVLNWFQDVLASLGLWNKHAKLLFLGLDNAGKTTLLHMLKNDR
                     LATLQPTWHPTSEELSIGNVRFTTFDLGGHEQARRVWKDYFPEVDGIVYLVDIADPER
                     FEESRVELDALLKIEELSKVPVLVLGNKIDKSTAVSENELRHALGLMTTTGKDKVQLV
                     EGQRPLEVFTCSIYLRQGYGEGIRWLSQYI"
     gene            <894003..>896714
                     /locus_tag="PAS_chr1-1_0181"
                     /db_xref="GeneID:8196685"
     mRNA            <894003..>896714
                     /locus_tag="PAS_chr1-1_0181"
                     /product="Essential beta'-coat protein of the COPI
                     coatomer, involved in ER-to-Golgi and Golgi-to-ER
                     transport"
                     /transcript_id="XM_002489782.1"
                     /db_xref="GeneID:8196685"
     CDS             894003..896714
                     /locus_tag="PAS_chr1-1_0181"
                     /codon_start=1
                     /product="Essential beta'-coat protein of the COPI
                     coatomer, involved in ER-to-Golgi and Golgi-to-ER
                     transport"
                     /protein_id="XP_002489827.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0181"
                     /db_xref="EnsemblGenomes-Tr:CAY67546"
                     /db_xref="GeneID:8196685"
                     /db_xref="GOA:C4QWC3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR011048"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016453"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C4QWC3"
                     /translation="MRLDIKKTFSARSDRVKGIDFHPSEPWVLTTLYSGKAEIWSYET
                     STLVKTFDITNVPVRAGRFIARKNWVVLGSDDFQIRVYNYNTGEKVAQFEAHPDYIRA
                     IAVHPTLSYVLTCSDDSKIKLWNWDHNWKLEQVFEGHQHYVMSVAFNPKDPNTFASAS
                     LDRSVKIWSLGLSVPNFTLLAHETKGVNYVEYYAQSDKPYIITSSDDKTIKVWDYQTK
                     SCVAVLEGHISNVSFAVFHPELPLIVSGSEDATIKVWNANTYKLEKSLNYGLERAWSV
                     SFRKGSNLVAVGFDAGHVVLQLADDKPSVSMDSLGKLIYAKNTDIFTSVIKQSDSANT
                     PDGEVLPLSHKELGSVEIFPTSLTHSPNGRFVTVTGDGEYIIYTALAWRNKSYGSALD
                     FVWAHDSNLYAIRESVDSVKIFKNFQERTNNPIELVYSADKIFGGALLAVKSEGFVSF
                     FDWESGKLVRRVDVEATDVVWSESGELVLIISSESAYALRFDRDIFSEALASNNLDPE
                     EGCEESFEVLYDVNESIASGKWAGDVFIYTSATNRLNYLVGGAISNIAHFDKNVFLLG
                     YLPRDNKIYVVDKNANVVSYHLSLNVLEYETVVLRGDLEHANEILKTIPESELPQVVK
                     FLDKQGYKELALKITDNKDQKFDFAVQLKDLDTAYEIALQADSEQKWKVLGDASLAAW
                     NLKVAVEAFEKSSDHESLLLLYTSLNDTEGLKKLADLSKSVGKYNVSFSAYWAANDVK
                     GATQLLKESNRLPEASLFALTYTGDKTTINDCVELWKKSLVAEGKQSIAERICTPAVD
                     ADKFPLVGDNQEEKEEDLIDVSDNVDVSSGAPVTAPVAVEVPDHVEEELVQPTLTPAQ
                     VPPAFVPASTPEVAPEFQAEAIKPDELTDEEDDAYGENIDDELDNLV"
     gene            complement(<896767..>897723)
                     /locus_tag="PAS_chr1-1_0182"
                     /db_xref="GeneID:8196686"
     mRNA            complement(join(<896767..897000,897061..>897723))
                     /locus_tag="PAS_chr1-1_0182"
                     /product="Mitochondrial 2' O-ribose methyltransferase,
                     required for methylation of U(2791) in 21S rRNA"
                     /transcript_id="XM_002489783.1"
                     /db_xref="GeneID:8196686"
     CDS             complement(join(896767..897000,897061..897723))
                     /locus_tag="PAS_chr1-1_0182"
                     /codon_start=1
                     /product="Mitochondrial 2' O-ribose methyltransferase,
                     required for methylation of U(2791) in 21S rRNA"
                     /protein_id="XP_002489828.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0182"
                     /db_xref="EnsemblGenomes-Tr:CAY67547"
                     /db_xref="GeneID:8196686"
                     /db_xref="GOA:C4QWC4"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4QWC4"
                     /translation="MIQHPSVSLLRRQFARFVSLKVKGKSSSSRKWLERQSSDPFTKE
                     AHAKALKSRAAFKLLQIHEKFNIFRPGQNVVDLGFAPGAWSQVAADKVTSRGNILGID
                     ILACEPPKGVSSMQANILSKTTHEMIKTHFYQLNMDKDLRKLQEIEPIADGPSYFQAE
                     VDDNLEISNKQKQQFPVDVVMSDMCEPFFQSSGFGSAITNKPFHRMANTTGMAFKDHL
                     LSIDLCDAALILAIDILKVNGTFLCKFFQGKEDKLLEARLKKCFKVVQRYKPPASRKE
                     SKENYFICFQKLPNLDKIQVFS"
     gene            <897993..>898646
                     /locus_tag="PAS_chr1-1_0183"
                     /db_xref="GeneID:8196687"
     mRNA            <897993..>898646
                     /locus_tag="PAS_chr1-1_0183"
                     /product="60S ribosomal protein L1"
                     /transcript_id="XM_002489784.1"
                     /db_xref="GeneID:8196687"
     CDS             897993..898646
                     /locus_tag="PAS_chr1-1_0183"
                     /codon_start=1
                     /product="60S ribosomal protein L1"
                     /protein_id="XP_002489829.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0183"
                     /db_xref="EnsemblGenomes-Tr:CAY67548"
                     /db_xref="GeneID:8196687"
                     /db_xref="GOA:C4QWC5"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR016095"
                     /db_xref="InterPro:IPR023673"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:C4QWC5"
                     /translation="MSKISTTQVREHVKELLTFSNETKKRNFLETVELQVGLKNYDPQ
                     RDKRFSGSLRLPQVPRPNMNLCIFGDAFDVDRAKSLGIDAMSVDDLKKLNKNKKLIKK
                     LAKKYNSFIASDVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYSKVTDVKSTIKFQLK
                     KVLCLAVAVGNVEMEEDVLVNQIMMAVNFLVSLLKKNWQNVGSLVIKSSMGPSYRLY"
     gene            <898818..>900506
                     /locus_tag="PAS_chr1-1_0480"
                     /db_xref="GeneID:8196688"
     mRNA            <898818..>900506
                     /locus_tag="PAS_chr1-1_0480"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489785.1"
                     /db_xref="GeneID:8196688"
     CDS             898818..900506
                     /locus_tag="PAS_chr1-1_0480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489830.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0480"
                     /db_xref="EnsemblGenomes-Tr:CAY67549"
                     /db_xref="GeneID:8196688"
                     /db_xref="GOA:C4QWC6"
                     /db_xref="InterPro:IPR010347"
                     /db_xref="InterPro:IPR027415"
                     /db_xref="UniProtKB/TrEMBL:C4QWC6"
                     /translation="MSGKRSAASERAAAHWSKKSKVNVEGEVKWVEIGRSDGKPESIP
                     ILPKKSEAQGSKEQQVDAQEEPQKHSKTQKQEKEQVIDLTDDQDAEDRPAIDTTTVQS
                     PIRLFNSPAHKPQDNIDCISLKDLVSSPQLSKTYQFNFCINVDFFLKYITSDPLSTEI
                     YFINSAEYLVEMTQQNRMRFKLRHVDIQLERFATHHTKMMVNFFRDGTAQIVVMSANM
                     TEMDFVGNTQGLWMSPMLSKGNGRESSFKNDFLAYLKAYNKHDLDLLAEELKLYDFGN
                     VKAEFLSSVPGTFTIPEEDDRLKRSVQYGYGKLFQLLKLNNLFPKATESTDILAQVAT
                     IASPFDFRSSNIFTHLLAPLINGTKFPIAGGLEPLQKAINDDVHPFNPFLVFPTKNEV
                     FGSVLKEYTSGIFYNIDDSSHKVPFLTNQHNIIRKFMYRWTNSDPNLNQKAGRSNLAP
                     HVKTYCASNDGFQTFMWYLLTSANLSKQAWGYPLKGSNGLKYKISSYEAGIFIHPKLY
                     GEDYQLKPILSRDSFPNRDKDNVVPIRVPYAFPLEKYHDSDEPWQANIHQAVVE"
     gene            <900834..>902810
                     /locus_tag="PAS_chr1-1_0184"
                     /db_xref="GeneID:8197920"
     mRNA            <900834..>902810
                     /locus_tag="PAS_chr1-1_0184"
                     /product="Gamma glutamylcysteine synthetase catalyzes the
                     first step in glutathione (GSH) biosynthesis"
                     /transcript_id="XM_002489786.1"
                     /db_xref="GeneID:8197920"
     CDS             900834..902810
                     /locus_tag="PAS_chr1-1_0184"
                     /codon_start=1
                     /product="Gamma glutamylcysteine synthetase catalyzes the
                     first step in glutathione (GSH) biosynthesis"
                     /protein_id="XP_002489831.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0184"
                     /db_xref="EnsemblGenomes-Tr:CAY67550"
                     /db_xref="GeneID:8197920"
                     /db_xref="GOA:C4QWC7"
                     /db_xref="InterPro:IPR004308"
                     /db_xref="UniProtKB/TrEMBL:C4QWC7"
                     /translation="MGLLSLGTPYSWFESRSYCDHVKKNALEQLYHCFEAAKNRSDDK
                     YFWGDEVEYMVVHMDSKAKKAQLSIDEDHVFADLADEKICDERDVSYHPEYGRFMIEA
                     TPYRPYDGDSLSHYLYVQENMDTRRQLAQKYLKDPDAVLISLTTFPRMGTDDFTFPAA
                     IVGGPSAKSLFVPEEITNRHVRFPTLTANIRRRRGCKVAINIPLYKDKYTRKDDELDP
                     TIPFNRSKFPYSDAEAGQGAALPGHIYMDAMGFGMGSSCLQITMQAQDLKTARYLYDS
                     LMNIAPLALSASASAPIFRGFLADQDVRWNVISGAVDDRTPYERGVDPLPGHGAKGNI
                     KEGKPVIRIPKSRYDSVDQYLSDPSDSFNEESYNDLDSPINEEAYKTLLSYGFDSTLA
                     HHFAHLFIRDPIVIFNERVHQDNTKENDHFENIQSTNWQTLRFKPPTQFATPDQKDQP
                     GWRVELRPMEISITSFENAAYSVFFTLLSKAILLFRPNFYLPVSLIEENMVTAHRVDS
                     IIKDKFHFRVNTESVKSDAIIKELTIKEVFHGSSDFEGLISLVNKAIDSQSKLWSKEF
                     SSSQEFDHALGKLKVYIKFIGLRTSGEIPSTARFIRDFVIKHPEYKQDSVVSDSVSYD
                     LLEKLVKLTKYERDTVAEFFGPELTHDLEAFQFI"
     gene            complement(<902874..>903430)
                     /locus_tag="PAS_chr1-1_0185"
                     /db_xref="GeneID:8196689"
     mRNA            complement(join(<902874..903359,903422..>903430))
                     /locus_tag="PAS_chr1-1_0185"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489787.1"
                     /db_xref="GeneID:8196689"
     CDS             complement(join(902874..903359,903422..903430))
                     /locus_tag="PAS_chr1-1_0185"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489832.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0185"
                     /db_xref="EnsemblGenomes-Tr:CAY67551"
                     /db_xref="GeneID:8196689"
                     /db_xref="UniProtKB/TrEMBL:C4QWC8"
                     /translation="MTMPKAISDAQSLQTTHYTDAESNFSNNSRNIQDRDDSSSGTNS
                     ADRTQEVSTINSQPTVTDAPIYSPSNKTADRSKTDNMSDTSSSSSDEPQRTRSQIIRD
                     YRYQQRQGFKGYNEQNIAENSKSCLVQYIPCLGNLSCECIGSLCVNSFCNFGQVVKSA
                     TTIR"
     gene            <904477..>906480
                     /locus_tag="PAS_chr1-1_0186"
                     /db_xref="GeneID:8196690"
     mRNA            <904477..>906480
                     /locus_tag="PAS_chr1-1_0186"
                     /product="Putative GTPase involved in 60S ribosomal
                     subunit biogenesis"
                     /transcript_id="XM_002489788.1"
                     /db_xref="GeneID:8196690"
     CDS             904477..906480
                     /locus_tag="PAS_chr1-1_0186"
                     /codon_start=1
                     /product="Putative GTPase involved in 60S ribosomal
                     subunit biogenesis"
                     /protein_id="XP_002489833.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0186"
                     /db_xref="EnsemblGenomes-Tr:CAY67552"
                     /db_xref="GeneID:8196690"
                     /db_xref="GOA:C4QWC9"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QWC9"
                     /translation="MPPEKNAPKKWKPPKGPKPVHHKNKNIVGLGKTIASVRAKENQV
                     QYLPDGDIRFTTDKREADWVKLRSVTHENALEDFLNTAELADTDFTAEKRSTVKIIKV
                     DNRQNPYLLSKEEERKKHDLQKEHEVDLIIPRRPAWDTSMTKFQLERQEKEAFLKWRR
                     QLAALQENKDLLLTPFERNLEVWKQLWRVIERSDLVVQIVDARNPLLFRSKDLEKSVK
                     ELDPRKENLLLVNKADLLTKAQRVKWAEYFIKNNIRYTFFSAAKANELLLAEANEENA
                     EEDSSSDHDSEDEFEDTDEESIADSEEETDKENSLPSSSHVDSNEHENETTDDGEDED
                     EHTRIITINELEDLLLRAAPGPLTEPLEGQTQRLQIGLVGYPNVGKSSTINALVGSKK
                     VSVSSTPGKTKHFQTILLSDSVILCDCPGLVFPNFAYTNGELVCNGVLPIDQLREHTG
                     PVELVCQRIPKFFLEAVYGIAIPTKPVEEGGLGYPSPQELLNAYARARGYMTQGFGAA
                     DESRASRYILKDYVSGKLLYVRPPPNDDNTPITIEQGKDFNKELYTVDHLPESRRQQL
                     LQAAKEKHIDILDLQSDLSKLTFSGHVGSSSSKGAAYTGTNYGGKQAALFSASEELDK
                     EFFKMSSGKGIVSNPFHKLGAPSAGKKHNKKNKKKNVKNTEMY"
     gene            <906988..>907809
                     /locus_tag="PAS_chr1-1_0481"
                     /db_xref="GeneID:8196691"
     mRNA            <906988..>907809
                     /locus_tag="PAS_chr1-1_0481"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489789.1"
                     /db_xref="GeneID:8196691"
     CDS             906988..907809
                     /locus_tag="PAS_chr1-1_0481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489834.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0481"
                     /db_xref="EnsemblGenomes-Tr:CAY67553"
                     /db_xref="GeneID:8196691"
                     /db_xref="InterPro:IPR019150"
                     /db_xref="UniProtKB/TrEMBL:C4QWD0"
                     /translation="MNFDKLLNNISDQLSIVSNGSLKTASSDPQNDDLNTLAEQHQFQ
                     VEDGDSETFVKLLYLNSLASDCLYVRKQLIQNNYQSSSPTKAKLHNVSQRIDQDIFIN
                     TLKLEDSKTKFDEEQERLKSRRQSQLDKHAESHLEDIGQASSGDDFEALRKRLLSTNA
                     PSKLDEARSLEEQNVYHESIHQDIIFDISSLTSQLKESALSLQGKLKEDASILKEASE
                     QLEKNQWSLTNVGKLLGKYHKEGKLGFWFYVRVSFFVLLTFVLLLLFVFVLPGRR"
     gene            complement(<907810..>922662)
                     /locus_tag="PAS_chr1-1_0187"
                     /db_xref="GeneID:8197921"
     mRNA            complement(<907810..>922662)
                     /locus_tag="PAS_chr1-1_0187"
                     /product="Huge dynein-related AAA-type ATPase (midasin),
                     forms extended pre-60S particle with the Rix1 complex"
                     /transcript_id="XM_002489790.1"
                     /db_xref="GeneID:8197921"
     CDS             complement(907810..922662)
                     /locus_tag="PAS_chr1-1_0187"
                     /codon_start=1
                     /product="Huge dynein-related AAA-type ATPase (midasin),
                     forms extended pre-60S particle with the Rix1 complex"
                     /protein_id="XP_002489835.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0187"
                     /db_xref="EnsemblGenomes-Tr:CAY67554"
                     /db_xref="GeneID:8197921"
                     /db_xref="GOA:C4QWD1"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR012099"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QWD1"
                     /translation="MDNPIRLDLQDSLNKFKEYFNKLDLPLPAPFLLENESVPQTLNT
                     LAMLSLNDALTLPLLYGFKPIYIDIIGRLLSNQELENSFRTSRKRNIPGSDVLATSAR
                     VIQLLDGVTVLIDSFLNKHNPLNFISNQQISQEELQTILIAFHRLLVHDTHRFKKHID
                     PVILYQSLENQSTNEVNRYLLIQLLSSVLNFSEQVVDEMMISFNVQEAKGSLEGDIDV
                     SFRFLSILEANRLSRFTSIPEPEFKDGSFIVQQTHLSSNITSVGGILIPYSHVSKLNQ
                     VPDLVPIQKSLTALKNMAINVQQGSPFMIVGKPGSGKSFLVNELAKQLNMDTSKDIIK
                     VHLNEQTDSKMLLGTYTSGTTPGSFVWKDGILTTAVKQGKWILVEDIDKAPTEVLSIL
                     LSLLEKKELTIPSRGEVITATTGFQIISTIRQPANSSIIPDIIGMRLWKIVLLPQLET
                     EDLSSILTHKFPTVNRFLPQIINCFLRCTEIFSTRGFITMNKGHQLRILSLTDLVKLC
                     SRTERLLALAGITSSDDLIADDVYDSIFQEAVDCFCSSIPELPALEYIISEIGLCLNI
                     PSSKITLLLSKYVPVYQDLGDSLKIGRAHLSKTKTISMYKNNNSGSSSFAKTNHALRL
                     MEQISVAVSMAEPVLLVGETGTGKTTVVQHIAKQLNKKIVAINVSQQTEVGDLLGGYK
                     PVNTKLLAIPIQETFEELFYASFSVKKNARFLKLLAKCFNKSQWKNVFKLWKEAHKMA
                     KSLFDENTSSDDESGPTKKRKLNSTESRQLMDKWNLFLEQVSEFEKTSNQTENSFVFQ
                     FIEGTLVKAVRNGYWLLLDEINLASPETLECISDLLSTQTDDRNIVLAEKGSITPIKA
                     HPDFRLFGNMNPGNDVGKKNLPANFRSRWTELWVHSPDSDISDLLMIIDKYVGKYSLA
                     DEWVGNDIAQFYLEAKKLAEDNKLVDGANQKPHFSIRTLTRSLIYVTDIVSIYGLRRS
                     LYEAFCMSFLTLLDADSEKILRPLVIKYTISRVKNFRKLITQCPPNPSDVNNPDEYVQ
                     FRHYWMKHGPGEVRPQPHYIITPFVEKNMLNLVRATSIRRFPVLIQGPTSSGKTSMIK
                     YLANITGHKFVRINNHEHTDLQEYLGSYVSDDNGKLAFKEGVLVEALRKGYWIVLDEL
                     NLAPTDVLEALNRLLDDNRELFIPETQEFVTPHPDFMLFATQNPPGIYGGRKVLSRAF
                     RNRFLELHYDDIPQDELEIILKERCQIAPSYATKIVQVYQQLSLQRQSTRLFEQKNSF
                     ATLRDLFRWAEREAIGYEQLAANGYMLLAERVRRQEEKLVVKETLETVMKVRLDMDQY
                     YKELENPKILQMETPIVWTKAMRRLAVLVSTALKNHEPILLVGETGCGKTSICQLLAE
                     LLRKELIIVNAHQNTETGDLLGAQRPIRNRSELQTKVSKNITDLFNEAGISYHESATL
                     QDLLDIFDSINKFEGISEERIKSVEAQRASLNILFEWTDGPLVQAMKNGEFFLLDEIS
                     LADDSVLERLNSVLEPEKTLLLAEKGAENSFIQADKGFEFLATMNPGGDYGKKELSPA
                     LRNRFTEIFVPSMDDLEDVHRIVASKLIEEASQYVEAIVKFSEYYALKVGNGNRTNGV
                     ISLRDILAWVNFINTTVRKRNVSPEAALIHGCCLTFIDALGTNNTASFSENPDSLAKM
                     KLSFVKTISELSGMNLLPYYEEEVSVELLEDRVKFGQFYLPRVPLTQESVSFNLKAPT
                     TAKNAMRVTRALQVHKPILLEGSPGVGKTSLVTALAKVTGNLLTRINLSEQTDLLDLF
                     GSDAPAEGGQTGEFVWRDAPFLRAMKKGEWVLLDEMNLASQSVLEGLNACLDHRGEAY
                     IPELDKTFPCHPNFVVFAAQNPQYQGGGRKGLPKSFINRFTVVYVEMLSEQDLNLISQ
                     HLYPKIDPEISAKLIKFISSLESEIVLNRTWGSEGGPWEFNLRDTLRWLQLYSEPTVS
                     TTVTPGDYLDIVIGQRFRNEKDRTQVKKLFTSVFGEKPKRPSFFALSKTFVESGRIVS
                     RRRDLIHSVPNQKLYSLQCNYPILESLLICINHAWPVILTGATDSGKSAVIQYAAGLI
                     GSNVHQFSMNSDIDSMDILGGYEQVDLMRGVSSICNSINSLLLDLVAVSLKDRSVSTS
                     VASNILSLLQAISSNTVNTDNFNVFVQDLSTVAAVIASPEFDELIQECILFEKKIQDT
                     KTVKFEWFDGLLVKAVEQGDWLILDNANLCNASVLDRLNSLLEPNGVLVVNESSSVNG
                     EPRIIVPHKNFRLFITTNPKYGELSRAMRNRCIEIFLPSLEVRASKYDRTLLGDEYSK
                     EYNQAQTLEQEIAHLEISKANSVPISKFVNLLNSESMNFARLVDFIIQSSHQLISPAV
                     AFSLLQLATTHSFEKLSDTICSSLWFSRNVKANCNKISDYLSQFKLLGLMGNVFKIYD
                     SAIVPALNDKDAIDYQKTQYLNPTVNPFLLDSISRIYPYVDSVEANLIYVVGSFLVQA
                     ERTLSTLVSRSITKKLNDLNYLERSAAVNNGREVRNAPPINIFKFLKDIQIFLTNSFI
                     EAASSLFSTSDFYTDIFELQVIWIQLYELVQKQDEAKIRVFQQLVTSWFQKCSGNPVV
                     SSLAKDSTSDLNEFNSSLALTRGFSIEKIWESFRTTYPSSEVSWSSYEAVCKLSKDFD
                     SIAQEQFSENANMVQQLRLLLIELHSDSFNLDIESEDFDEMQKKLTEGIEKFQEVSSG
                     FINKRKHTYRSLFQSLLAMSKLPVTKDDAGPEFFRIAHEANMSTELLFKALSEDDLKP
                     FPRLFHFLWTDETGAKSHVSKLFTDELFREILTCSFTLTETEGKDVAQNLVDFSLLTQ
                     SLIKQSPSILEHKFSVVASLLRKWTFSIILSHTSKNSSEYQFVQSISTAPSLSEDDIS
                     KVAQIYSGFEHQEAQVFTEFIHPVLIALNSTLDSGSLGKAFVSFALGTIQLYVPSSPH
                     DPAITDHVIYDLYHEQLKLVSSICESLDTAAHVSGFDVNAFSEKNRVSIESSLVPSKP
                     QVYRPKCSIDALFEDWNSFVDSSAATHPVQRLVQSLEDSMELFSKKVDMFQRNASQFL
                     DRLQRNHSRYADLNDILAGYIYSLKFGFDLLNVHASVPSAPLDVLAPIDATVLSSATD
                     IVSFFDPINSYLKNRPLNESDVESVYVFFMKIYFSHADEALDDVLIKSFQGLYYRWSL
                     FNIKKKEEESLTNGVFKYAAPEFDGEEEYKTMFPDYEEVVDYQEKVNTDVSKDDVYYE
                     VASAYIEGFAGKRSDLNSLISEGSKISQLLNLGLNHSAGDISSSKLASLAVLVSNSLN
                     EFNKPAQFDNFYFGFSSSQTKLADSVIQKLQYSILPLLKQWPEHAVLQQIHSLCDDLL
                     SFPVKTPIAQLLQKVEHIYVAVAEWEKYAHSKISLKAHNADVINLVVSWRKLELSSWQ
                     SIFEDEDKKIEKNIGKWWFHLFELTILPIIKEEYVDLFSIVTALNVFLSQTTLGEFEL
                     RVRLIEAFANHANMMAPQSKLASTLNNMVTFYEQFLPNIRDQLAVKRRELEKKVKEMI
                     ILTSFKDVNVHALQQSSRHSHAKLFRIVKKYRELLAVGVSGVIESGLSANTKVVLNAP
                     VFSKKPFDRVIFEKAAQECLKIPSYNRRPEILKGTVVLDRVSSLIQTADEYGSFTLYE
                     YAKEILQEMERLKKQTPNEATEENKKIVGQLKSQKRKLLSDTLKEVRRLGLKLHVTPN
                     VSKELASVNQILSDATSFRKLEIAGTDGYFFRVLDLFPRLRASVAEMNEEVPVSDGQK
                     ALAAVENLMYHVLRSRNSLNALVNAKNEISSYQKEFQDMSSLDVINPASPCSASSFLA
                     SKSAIKSCFEWIPKILNFASTVLQSSTALTGLKSVDVFGSFGNEFEKFQLHNKNLLTT
                     EEISTVNLFNKKVDELHERLLLWKRENPLLAFVADLVIHCITSKKNIRLDTSDSFTTT
                     DLDTLQHLFSDLTKSLIVVFQKFMDLYKVPIVEDDDGSFKSTYQNVSKEVKLLHSSAI
                     LGKIRLLFEKLQSIGATDFKFATALNANICPLLTQYYNLILTLLNKQQELYVKNSHAL
                     FILTNCVYTLTKEGFCSPQSPDQTNDPGNMQDGTGLGDGDGATNSKDIDDDEDFSEQA
                     QEANKEKDDNNDDEAEDKEDDAVDIEGDMAGDLEESKEKDNDDEDNENSEDDEDKEMD
                     EELDDIDDLDPNAVDEKMWEDEAQEDSKEKDSDKMPDNSKNDDDNMEAMEEDTKDNQN
                     RENPNKQDENDSLEDKDEQEDNAQNEGEEQEEEEEEDVGEQEDEVKNDDGEKLDDFVP
                     DVETLELPDDLQLEGEDDKDDTENDNESQPDDAFDDPMNMDVELEENNHKDGDEEEEE
                     EEEEEDDEENGSEDEGNDEVEAPSMSEEKAEEEAQEEGDENMGEDKNQNIDEDPALDS
                     ETELNPIKDEEEQEETNDPAKEEEAVEGLDGVDEEGGQQDNIDDDAAVKQEAGISSEG
                     AEAAASEERDDMGASGGAAETQAQDEIEENADNTQDPSSNEAKESLKQLGDSLKEYHR
                     RRQEIKEANDVDDSTEQNTHNQPDEYQHLNGENTELETQALGAADKDQIQTIDDNMAI
                     DDEETMTENLDTEQEQNPDKENDTASAEDIDDHAADGNQDMEGDNRKATIGERKINDF
                     ELGELMEFSDNETEDEADKNEIEELNVLDMANEDDAAPRTLDEARDLWRHSDLATQDL
                     AANLCEQLRLILEPTVATKLRGDYKTGKRLNMKRIIPYIASQFRKDKIWLRRTKPSKR
                     QHQIMIAVDDSKSMSESKSVELAFHSIALVAKALTQLESGSLSVVRFGEDTKVVHPFN
                     RPFTPESGAHVFQWFDFQQTKTDIQKMCSQTLKLFNEVKADADDLWQLQIILSDGVCE
                     DHATVQRLVRRAREDKIMLVFVVIDGINSNESILDMSQVQYVPDANGNMQLKVERYLD
                     TFPFEFYVVVHNINELPEMLSLILRQFFSEIAGM"
     gene            complement(<923508..>924005)
                     /locus_tag="PAS_chr1-1_0189"
                     /db_xref="GeneID:8196692"
     mRNA            complement(<923508..>924005)
                     /locus_tag="PAS_chr1-1_0189"
                     /product="60S ribosomal protein L12"
                     /transcript_id="XM_002489791.1"
                     /db_xref="GeneID:8196692"
     CDS             complement(923508..924005)
                     /locus_tag="PAS_chr1-1_0189"
                     /codon_start=1
                     /product="60S ribosomal protein L12"
                     /protein_id="XP_002489836.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0189"
                     /db_xref="EnsemblGenomes-Tr:CAY67555"
                     /db_xref="GeneID:8196692"
                     /db_xref="GOA:C4QWD2"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="InterPro:IPR020785"
                     /db_xref="UniProtKB/TrEMBL:C4QWD2"
                     /translation="MPPKFDPSEVKFIYLRAVGGEIGASAALAPKIGPLGLSPKKIGE
                     DIAKATTKFKGIKVTVQLRIQNRQAVASVVPSASSLVITALKEPPRDRKKEKNVKHSG
                     NIPLEEIIDIARQMRDKSFGKNLASVTKEILGTAQSVGCRVDQKNPHDVIEAIDAGEI
                     DIPEN"
     gene            complement(<924624..>926897)
                     /locus_tag="PAS_chr1-1_0190"
                     /db_xref="GeneID:8196693"
     mRNA            complement(<924624..>926897)
                     /locus_tag="PAS_chr1-1_0190"
                     /product="Non-catalytic subunit of N-terminal
                     acetyltransferase of the NatC type"
                     /transcript_id="XM_002489792.1"
                     /db_xref="GeneID:8196693"
     CDS             complement(924624..926897)
                     /locus_tag="PAS_chr1-1_0190"
                     /codon_start=1
                     /product="Non-catalytic subunit of N-terminal
                     acetyltransferase of the NatC type"
                     /protein_id="XP_002489837.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0190"
                     /db_xref="EnsemblGenomes-Tr:CAY67556"
                     /db_xref="GeneID:8196693"
                     /db_xref="GOA:C4QWD3"
                     /db_xref="InterPro:IPR007244"
                     /db_xref="UniProtKB/TrEMBL:C4QWD3"
                     /translation="MSRHTNPAELNNLELDSWVDITQQFFETAKNVKHGNIVKLESLD
                     LMEGTDAKEILNPALDTGLIEDESYDCDRDLTLDETVRVVANITSCLVTWLDSSSLPV
                     TLFSCRYIEEILTRFSALLSSSTIVEKIFQVSNLQYSNKLDQSDSFTYRILRAYLIGV
                     LNFTAFVLNIPVLKDEEDLNRVSMDLNIDLLLQFPQKDVADLVNSAYSLLEKRDDKNS
                     KVLQLYFDILKRLQMLYPLSASVNQGDFQDTLFLHEATGFIDKLSEENDYIDSIPQIP
                     HLFTRGIQKRKNNIFPPRPIKMHSFTICISYLHYLFDDLKLAMDVLCFQDAADLRNRL
                     YIFGSKRNEKLPDQEHTSTHIVAALFLESILLRDGLILGAIPVSEFLKQDLSSLTAGE
                     SVVLSLLEDDKLTNDRAIKARASSLLQEMEKTYISWIQSFLQNPSKQRDFFLDSVVVW
                     DTIQVTADDLETSLPDDYGLEDTFKSIQPDGSLSELPVMPLSSYVYYMKLDSMVQVVF
                     RGIELEIYKPWEMYQMYWYGLYLLSTLESHIARMKDVAKYKLSKAEGESKDIWKKTLD
                     HINFLIQETIVFKTLAQAQQYTWTILDNLKLLKLPKYNRTTPQLLYQLRMKPFSSVGI
                     PQLPSIQHFQNFADEIAEGSLRFRTERERVQDICFRCSSAVRQLTTEVKTAASQLKKI
                     HPSRGRFKADYERGVDQILRSSIGVAVFSTKVNKKIKDAEFVTQCLKENPSNQAYDVS
                     LSRAQYHRFFRLRRLNI"
     gene            complement(<927249..>927866)
                     /locus_tag="PAS_chr1-1_0191"
                     /db_xref="GeneID:8196694"
     mRNA            complement(<927249..>927866)
                     /locus_tag="PAS_chr1-1_0191"
                     /product="Subunit 5 of the stator stalk of mitochondrial
                     F1F0 ATP synthase"
                     /transcript_id="XM_002489793.1"
                     /db_xref="GeneID:8196694"
     CDS             complement(927249..927866)
                     /locus_tag="PAS_chr1-1_0191"
                     /codon_start=1
                     /product="Subunit 5 of the stator stalk of mitochondrial
                     F1F0 ATP synthase"
                     /protein_id="XP_002489838.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0191"
                     /db_xref="EnsemblGenomes-Tr:CAY67557"
                     /db_xref="GeneID:8196694"
                     /db_xref="GOA:C4QWD4"
                     /db_xref="InterPro:IPR000711"
                     /db_xref="InterPro:IPR026015"
                     /db_xref="UniProtKB/TrEMBL:C4QWD4"
                     /translation="MFTRSFVRSMATAAKTVKPPVQLFGLDGTYATALYTASVKVSSV
                     DQAAGSLNKLKTYLDTDSTTSGIVSNPALSLNDRTFVVQTLNSKLSLDKSVSNLLEVL
                     AENNRLGLLGDIVKQFGVLTDAHNGVVEATVTSASPLDKKSLNRIQQAITGSEFVGQG
                     KSLKINNQVNPDILGGLIVEVADRTVDLSISAKIAKLNKVLTESL"
     gene            <928103..>929236
                     /locus_tag="PAS_chr1-1_0192"
                     /db_xref="GeneID:8196695"
     mRNA            <928103..>929236
                     /locus_tag="PAS_chr1-1_0192"
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /transcript_id="XM_002489794.1"
                     /db_xref="GeneID:8196695"
     CDS             928103..929236
                     /locus_tag="PAS_chr1-1_0192"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /protein_id="XP_002489839.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0192"
                     /db_xref="EnsemblGenomes-Tr:CAY67558"
                     /db_xref="GeneID:8196695"
                     /db_xref="GOA:C4QWD5"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR005880"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:C4QWD5"
                     /translation="MFNLPLRSLPRASWGKKLLQTHLFGSVSFFSTGARTLATEPTPR
                     ITQAAGDLTDLEKQHEIIARQTKLSKETVQLKKLKPTSPGLRWWRKPMYPYLWKGKPV
                     RALTKTRVSRSGRNHTGRIVVRHRGGGHQRRIRFIDYHRKEPGRQTVVRIEYDPNRTA
                     HIALLKHNDTGNLSYIIACQGLREGDIVESFRSGIPEYLMEEMGGRIDPAILNAKTAQ
                     KGNCLPISMIAVGTIVHNVSETVHGPAKYCRAAGANARIVNKIPEKRKAVVRLQSGEE
                     RYVSIDACATLGVTSNPDHQHESLGKAGRSRHRGIRPTVRGVAQNKCDHPMGGGRGKS
                     KSNKLSMSPWGVLAKGGFKTRRGKNINKQKVRDRPRGKLSQRN"
     gene            complement(<929287..>929838)
                     /locus_tag="PAS_chr1-1_0193"
                     /db_xref="GeneID:8196696"
     mRNA            complement(<929287..>929838)
                     /locus_tag="PAS_chr1-1_0193"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489795.1"
                     /db_xref="GeneID:8196696"
     CDS             complement(929287..929838)
                     /locus_tag="PAS_chr1-1_0193"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489840.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0193"
                     /db_xref="EnsemblGenomes-Tr:CAY67559"
                     /db_xref="GeneID:8196696"
                     /db_xref="UniProtKB/TrEMBL:C4QWD6"
                     /translation="MNDLVKSNIFVCSWLLKALNEVKDETVSKIPKFNRTPRVMKVLR
                     LITVSRDLIRLIICDSANSILAEVSADAIAEIEYNERQRFSKGIMNTEILVVESSLVF
                     TSLHQLMPWYGSYLPPRITKTNGEDYYISKYAVLEITKLSIFNRDQVKELVDIPLVYL
                     EKSYSWPKLVTSHVDDEPTFCSD"
     gene            complement(<929927..>931159)
                     /locus_tag="PAS_chr1-1_0194"
                     /db_xref="GeneID:8196697"
     mRNA            complement(<929927..>931159)
                     /locus_tag="PAS_chr1-1_0194"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002489796.1"
                     /db_xref="GeneID:8196697"
     CDS             complement(929927..931159)
                     /locus_tag="PAS_chr1-1_0194"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002489841.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0194"
                     /db_xref="EnsemblGenomes-Tr:CAY67560"
                     /db_xref="GeneID:8196697"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:C4QWD7"
                     /translation="MVKLISIIALVQLVSATIVPWNLQNVLSDVHHPSLHLLDYIQSL
                     KNEVMFDGDDRRIIKLGPQEYRIITEKEKYQLKTEGISFIDVTYQHGDNVELLYSSAP
                     VTVPDYLYPSNDTFHFKQVNSLIGEIDIGRMQAFLGRFSSFFTRFYKSDKGLQSSIWL
                     QGELVQLALKDPSRFNVTTVEHPWKQNSAIFTIYGENVDPSKGKGDIVVVGCHQDSIN
                     LLFPNILRAPGADDDGSGVTSNLEALRIIVESGLKFHNTVEFHFYSAEEGGLLGSQQI
                     FSSYRAAEETVVAMLQQDMTGYIQKALDHGESDHFGLITDHTNANLNSFLALLIDAYT
                     SIPYKETECGYACSDHSSALEHGYPSAMVFESSFAYTNPFIHSTQDTIDKINFPHMAE
                     HVKLVLGYVVELGLEHFR"
     gene            complement(<931372..>932326)
                     /locus_tag="PAS_chr1-1_0195"
                     /db_xref="GeneID:8196698"
     mRNA            complement(join(<931372..932227,932307..>932326))
                     /locus_tag="PAS_chr1-1_0195"
                     /product="Subunit D of the eight-subunit V1 peripheral
                     membrane domain of the vacuolar H+-ATPase (V-ATPase)"
                     /transcript_id="XM_002489797.1"
                     /db_xref="GeneID:8196698"
     CDS             complement(join(931372..932227,932307..932326))
                     /locus_tag="PAS_chr1-1_0195"
                     /codon_start=1
                     /product="Subunit D of the eight-subunit V1 peripheral
                     membrane domain of the vacuolar H+-ATPase (V-ATPase)"
                     /protein_id="XP_002489842.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0195"
                     /db_xref="EnsemblGenomes-Tr:CAY67561"
                     /db_xref="GeneID:8196698"
                     /db_xref="GOA:C4QWD8"
                     /db_xref="InterPro:IPR002699"
                     /db_xref="UniProtKB/TrEMBL:C4QWD8"
                     /translation="MSGSGNREQVFPTRMTLGLMKGKLKGAQQGYSLLKRKSEALTKR
                     FREITRRIDDAKRKMGRVMQTAAFSLAQVTYATGDNIGYSVQDSVKSARFQVKAREEN
                     VSGVRLPQFETHINEDINDFKMTGLGRGGLQVQKAAEVYTSSVETLVELASLQTAFII
                     LDEVIKVTNRRVNAIEHVVIPRTENTIAYINSELDELDREEFYRLKKVQEKKQQQTAL
                     QDAEAAAKKAQLLEKKANDKLEADQKAEENKDNEASEQAKAEYDPEEEARQVSKFIDE
                     PADDLTAQQEEDIIF"
     gene            <932568..>934997
                     /locus_tag="PAS_chr1-1_0196"
                     /db_xref="GeneID:8196699"
     mRNA            <932568..>934997
                     /locus_tag="PAS_chr1-1_0196"
                     /product="Component of the spliceosome complex involved in
                     pre-mRNA splicing"
                     /transcript_id="XM_002489798.1"
                     /db_xref="GeneID:8196699"
     CDS             932568..934997
                     /locus_tag="PAS_chr1-1_0196"
                     /codon_start=1
                     /product="Component of the spliceosome complex involved in
                     pre-mRNA splicing"
                     /protein_id="XP_002489843.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0196"
                     /db_xref="EnsemblGenomes-Tr:CAY67562"
                     /db_xref="GeneID:8196699"
                     /db_xref="GOA:C4QWD9"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C4QWD9"
                     /translation="MEKLITYEDLAYEESLLLDPYSLESWIAYYRHKEHSSPVDQQFY
                     VLFRAANALKRAPEIWILCLKTCVKLWEERKSELEEFDGLIKVFEQSLLYNGSSPIIW
                     ALYLKALVKYSCIPGITFVRRKSDQCLQTLPFAKHHLIWPFLLQFADDVGAITSLSIW
                     TRFYYYKKTCMPYVRLQDASSIEEETGFIPDQYKLENVTYQTILHKLTSQAHSDLSAY
                     TRTFQDLLDNTEFLATVELSELKLYTDYLNVLIKHPQESENIDYKSHDTKIEKLVQYL
                     IEKFPDQQASMIIHWTQYWINRGNFHKVREIFEVGITKSKTVKDFVVVYDTYLEFEET
                     VISTTLKDLELQGLETSPMLELRMHSFEQLMDRRELLMNDVLLRQDKNDVATWLDRVA
                     IFDKETQLQNVLATYVEAIRTIDPGTIEEPGVLPKLWLGYIDVYKSKGDLKTARKIYA
                     ATLKANFPFPEDLADLVISWAEMELENDDYPQAIDVMKTSLKEFALKKSTKLWSFYLD
                     LVESSGNIPDTIKLYDTVIDLKIATPLTILNYCNFLEEHQRYQECLRCYEKGVHLFRF
                     PVSFEIWNVYLSKMVNEQAKFKLTNEHIRDLFEQCIEQCPLNLVEPIYIGYAKFELDH
                     GFISKAFRIYEQAIEKLEDEKEKYNIFKIYIQVSLLNQEDQKTRKIYEQALESLPATL
                     YGFTESIVIPFVELEIKLKEISRARAIFHYAADLIVPTKKNPILWERWERFELHYGNE
                     DTFKSMLRYQRSIDDQAKLEDVETLVESNAPVQFVASSTGPQVGSATTNNMEKKINPD
                     AIDLEFDDLSD"
     gene            complement(<935036..>936538)
                     /locus_tag="PAS_chr1-1_0197"
                     /db_xref="GeneID:8196700"
     mRNA            complement(<935036..>936538)
                     /locus_tag="PAS_chr1-1_0197"
                     /product="Conserved protein that may act as a chaperone in
                     the degradation of cytochrome c oxidase subunits"
                     /transcript_id="XM_002489799.1"
                     /db_xref="GeneID:8196700"
     CDS             complement(935036..936538)
                     /locus_tag="PAS_chr1-1_0197"
                     /codon_start=1
                     /product="Conserved protein that may act as a chaperone in
                     the degradation of cytochrome c oxidase subunits"
                     /protein_id="XP_002489844.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0197"
                     /db_xref="EnsemblGenomes-Tr:CAY67563"
                     /db_xref="GeneID:8196700"
                     /db_xref="GOA:C4QWE0"
                     /db_xref="InterPro:IPR005654"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QWE0"
                     /translation="METRIYEQNYYIFIPLSMIASRGLLILRRSGLKYLSTSSIRFQL
                     SPLQRYDELVGNGKLRDDEFQRGIISNLEGLHSQLNQYHPPKVEAPDVESLKPAQGFS
                     RIFSIFGKSSKNSKKKSPDHITPNGVYLYGDVGCGKTMLMDLFYDTIPGHLTKKRLHF
                     HQFMQSLHKRSHQLKKQHGGHDIDVIPLLAWELAQQSTVLCFDEFQVTDVADAMLLRR
                     LLMLVLRNDHGLILFATSNRAPDDLYINGVQRESFIPCIQLIKERTSVIYLNSPTDYR
                     KIPKPISSNYYYPKPGVNFQSAASREQQKKHTEQWYSFFSQGHEIEKNVELSIWGRNL
                     VVPLCTPPYVARFTFNELCGKPLAAGDYLTLAETFSAFIITDIPYLSINVRDDVRRFI
                     TFLDAVYDAHGCIAVTAAANFQDLFVEPEDLSEGNFNLRDKKPEELENDSTFENDELV
                     SKHGFDKKIAKKASMFAVDEERFAFARALSRLSQMSTQDWIDNSRVHEKK"
     gene            complement(<936662..>938275)
                     /locus_tag="PAS_chr1-1_0198"
                     /db_xref="GeneID:8196701"
     mRNA            complement(<936662..>938275)
                     /locus_tag="PAS_chr1-1_0198"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489800.1"
                     /db_xref="GeneID:8196701"
     CDS             complement(936662..938275)
                     /locus_tag="PAS_chr1-1_0198"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489845.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0198"
                     /db_xref="EnsemblGenomes-Tr:CAY67564"
                     /db_xref="GeneID:8196701"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="UniProtKB/TrEMBL:C4QWE1"
                     /translation="MKLTVSSFVLPLVATLFETAKGDDTYLSRKDLNVPQWNITRYGD
                     VKPSEGYIFVTPYETTSSQPGAYIYDQDGDLVWSGFSYFGGTPFNFQVFNETQFYAWE
                     GSVNIRTGHGHGHFSFFDNSYKPIKQLHALEHRLGDIHELTIPKNSSSALIEIFEPTD
                     QYDLSPYGNGTWVNNAIIQDIDLETGELIFEWVSLDHISPAESVLSLESGLAGVGQNS
                     STAWDVFHFNSVDKNVEGDYLISARHSSTIYKVSGKTGEVLWRYSTSSSLSNFTIIDN
                     SAELEVDPEYLKFGFQHHARFLTQTPRGGKEIIKFFDNHAYSHGHTEAGHGSESSSVT
                     SSGKIVELDLTLGTAKVLEIFLPPTDHPLLAKSQGSLQLLQNHHAVINWGSAGSITEY
                     DSHHNPIFHAALDADSDDVQNYRAFKYPRWVGYSPEKIALFKQGSKVYISWNGDTETK
                     KWKLSTQGKEIGVFKRAKFETVIDLPLEFQDISTKSIEVQALSQDGEVLGSLNSAPKE
                     EASPRVPLLGALEDGFQNYFSWRAARTHD"
     gene            <938670..>940766
                     /locus_tag="PAS_chr1-1_0199"
                     /db_xref="GeneID:8196702"
     mRNA            <938670..>940766
                     /locus_tag="PAS_chr1-1_0199"
                     /product="Nucleolar protein, component of the small
                     subunit (SSU) processome containing the U3 snoRNA"
                     /transcript_id="XM_002489801.1"
                     /db_xref="GeneID:8196702"
     CDS             938670..940766
                     /locus_tag="PAS_chr1-1_0199"
                     /codon_start=1
                     /product="Nucleolar protein, component of the small
                     subunit (SSU) processome containing the U3 snoRNA"
                     /protein_id="XP_002489846.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0199"
                     /db_xref="EnsemblGenomes-Tr:CAY67565"
                     /db_xref="GeneID:8196702"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4QWE2"
                     /translation="MDIHRCRFVKYKPRTVTSLAFSHFSSNGFAPKNLRLAVGKSNGN
                     IEIWNPHKNFLLENVLQGGKDRVIEGLVWSTYDDYPPRLFSIGGSTVMTEWDIATGLP
                     LNNYDCNSGITWSISINTTQDKICVGCDNGTVVVIDISGGPGSLVHESILQRSNARVL
                     NLCWLNDKKIVSGCSDGRIRIWNYEEGPGRGQLISTLNVDKSTTESTLVWSVIPLEKR
                     SQFVSGDSTGAVKVWDAEKFVLLQTFDLHKADVLNICTNFEQTKIFSGSVDRKIYNLK
                     FVNDKWVNSCNRLVHGNDIRASVCYQSKDLDLLLSGASLSDIAVSKPESFQDCEIQRL
                     SVFPETYQTVLFNKSQKLVIMWQDQTIKVWKVLPQQGRKLLAKLVLSDEDNITHCDLT
                     SDGQFLVVARLSTVKVFKLAFNEDNKLQIQKVADEKLQEVGARLVKFNDQNNELIVVS
                     PDNELYIYKIKESLVEDSNGFVDQSGDSVQEVELNGTRIPQGQQTLLNNIYSLCLSKD
                     GKLASVLRVNGLIEIANLDTLKSSKLVKPSNLIALHSVFHEDHKLIVVNHDNSVAEYT
                     IDTEEGVVSDWSKRNTDFTRHALGGVLEKCLGLVLNGDNLWLYNTNWLAYINLANDLP
                     KIGSEVDRKRGADGEKITPSSKDIQVDNSQFWVVDKYQPLLYVDTFEPEANGLLVVET
                     PVTPTEAAFLVPRIYL"
     gene            <941041..>941709
                     /locus_tag="PAS_chr1-1_0482"
                     /db_xref="GeneID:8196703"
     mRNA            <941041..>941709
                     /locus_tag="PAS_chr1-1_0482"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489802.1"
                     /db_xref="GeneID:8196703"
     CDS             941041..941709
                     /locus_tag="PAS_chr1-1_0482"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489847.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0482"
                     /db_xref="EnsemblGenomes-Tr:CAY67566"
                     /db_xref="GeneID:8196703"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="InterPro:IPR028071"
                     /db_xref="UniProtKB/TrEMBL:C4QWE3"
                     /translation="MLQKIILLDLNKELCSLWQKEIQRISNLHPNNGIPFQVFNGTFD
                     QLRLDSPTTIVSPGNSFASFGGGIDVAIRELLQTDPGSLEPSFEECVAGALIKCNGYI
                     PVQHLNNITFSHATRGWRQLQCDTVVHIPTMRVPRHVYDGNEVHWKRFIFDIVWKALN
                     EVKTPNVIFPGLATGFGGLPVDLVAESMISSMVLHQHQGWNMRDRGVHVLKYLAEDPS
                     FLEL"
     gene            <942426..>943706
                     /locus_tag="PAS_chr1-1_0200"
                     /db_xref="GeneID:8197922"
     mRNA            <942426..>943706
                     /locus_tag="PAS_chr1-1_0200"
                     /product="Cytosolic aspartate aminotransferase; involved
                     in nitrogen metabolism"
                     /transcript_id="XM_002489803.1"
                     /db_xref="GeneID:8197922"
     CDS             942426..943706
                     /locus_tag="PAS_chr1-1_0200"
                     /codon_start=1
                     /product="Cytosolic aspartate aminotransferase; involved
                     in nitrogen metabolism"
                     /protein_id="XP_002489848.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0200"
                     /db_xref="EnsemblGenomes-Tr:CAY67567"
                     /db_xref="GeneID:8197922"
                     /db_xref="GOA:C4QWE4"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4QWE4"
                     /translation="MLASGKRFFSSSSLRQVSAWAKVEKAPADKILGLTVLYNQDTNP
                     SKINLGVGAYRDENGKPWILPSVRKAEEVLIKTEVNKEYVPITGSPKFNELIKQTLYG
                     NDPAGKQLLEQNRIVSSQSISGTGALKVLSEFIKYFHEGPKDVLVPNPTWANHIAILE
                     RSGLTTSKYRYYDFNTNQLDKKGLLEDLENAAEGQPVLLHACCHNPTGVDPTLEEFDE
                     IIDVLSRKKLLPVVDMAYQGFRSGNPIDDLSLLFRFNKAVVDGRLDNFVLSQSFAKNM
                     GLYGERVGSLSLITSDADESVRVKSQLEKVIRPIYSSPPSHGSKLVEIVLSDEAIYQQ
                     WLKDVKVMSDRLVSMRKLLYDTLKNKYNNPLDWSHLLQQKGMFCYTGLNPEQVAKLIE
                     RSVYLTSDGRISIAGIYEQNVDYLANAIHEVTTN"
     gene            complement(<943802..>944914)
                     /locus_tag="PAS_chr1-1_0201"
                     /db_xref="GeneID:8196704"
     mRNA            complement(<943802..>944914)
                     /locus_tag="PAS_chr1-1_0201"
                     /product="G protein beta subunit, forms a dimer with
                     Ste18p to activate the mating signaling pathway"
                     /transcript_id="XM_002489804.1"
                     /db_xref="GeneID:8196704"
     CDS             complement(943802..944914)
                     /locus_tag="PAS_chr1-1_0201"
                     /codon_start=1
                     /product="G protein beta subunit, forms a dimer with
                     Ste18p to activate the mating signaling pathway"
                     /protein_id="XP_002489849.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0201"
                     /db_xref="EnsemblGenomes-Tr:CAY67568"
                     /db_xref="GeneID:8196704"
                     /db_xref="InterPro:IPR001632"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016346"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C4QWE5"
                     /translation="MSDPQEQLKKLQVQITQSKRETKQLYFHLDRVLKSCQDSNLTTV
                     YRQQVPNGPPVRFDNFGLYHVLRGHFNKISQIRWGPADSYYLLSSSQDGFMIIWDTLT
                     GYKVKAIPLDVQWVLSCAYSPDGQLLASGGLSNRATIYNFESGTSKAVLKGHTCYISD
                     MGFLGPDKLITASGDMNCILWDVNRAIQVNTYVDHLGDVLSLAVDQKNGRFVSGASDG
                     YAKVWDCRSACPVYQYVVGHNEVTVVEQLTDHLFAAGTDDGTIKLFDMRSDGEINRYN
                     PPFLASTVPPALHQNHQGAADDSSVTSIAFSSSGRLMFATYADKGCVVWDLLANQLLG
                     ELSGHSNQVNQVRVNGQGNGVATSSWDSTIKIWGAT"
     gene            complement(<945238..>949854)
                     /locus_tag="PAS_chr1-1_0483"
                     /db_xref="GeneID:8196705"
     mRNA            complement(<945238..>949854)
                     /locus_tag="PAS_chr1-1_0483"
                     /product="hypothetical protein"
                     /transcript_id="XM_002489805.1"
                     /db_xref="GeneID:8196705"
     CDS             complement(945238..949854)
                     /locus_tag="PAS_chr1-1_0483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002489850.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0483"
                     /db_xref="EnsemblGenomes-Tr:CAY67569"
                     /db_xref="GeneID:8196705"
                     /db_xref="GOA:C4QWE6"
                     /db_xref="InterPro:IPR019035"
                     /db_xref="UniProtKB/TrEMBL:C4QWE6"
                     /translation="METNRASEHSIQVPPGVYPLNGHDSVNEGPKTELIYPDFKIWQH
                     SPQDDIIMTRYLQKGFFEAPVVQNESLSARSLMAVSLHENSNEPNASEEQTAKAPNPK
                     IKLLSDYIIQAIFQRRQLSKIHTKVIVRPPPRVTLTEHKREKWMENLANTRIPLSQLA
                     RAIPHGIKNRILLEQCCLYNVPVARAVWLVKCVAGNEVRVLRRKVQQSSTNALSTNAI
                     FNTWLSDWTDQVTNFLERFMISIFTPNQKDWRERSNYNLTLVGNLFMEDLLRQDKFLG
                     WIVSFLRQCLVKLSSGSKEEPDHVSQGLNLLTIHLVILRLFWFKILKSDHISKEASVV
                     LLQLHAKLVDKSTLQSGNSPSTFIIELKENINFLIKYLFYYSPDAFIIPNYWHDLKHT
                     LKKILDTSNNLVRTQFKLVTYRNESLIVNLPQSLNKPLNLNQDEPLQSNRDDLLKSLD
                     TFFSSSDSIGTLTSLVFEKIDEDEETEIKTFAPDIEPNEPEASETIEIDSPIKNSPIP
                     NNKEVSPPITTKKGNKKDTRKLWSYNFRLLLNWSISNYRNQSSSVVQVNLVVSILEQR
                     LREIYSNTTNLRAKKLKLEIELELLDWIFQINDSYNVLKQNNETEIVYKLETLEYLCA
                     RCYQSGLLTVSSYIRKLIASGVIYLPDCFKNSTIHSLVLKSLPVLKNNNLDNILRKLS
                     NKEEPYDSAKDILFFEEAKSSLLPFIEWIVSDFEINLDPVWNCLKSLDTKTAILVSEW
                     FMSETFRLLFERTANKNQVKVTEKKLSLITYALVEKLNCLPQFYVKLLQAFALELKSF
                     SIDKMTMIFISEIIQFHEQQAAVFSAKEETNAYTNMIKSLFQVVDEGKYLINWTVFKP
                     TLVNDKNVISELSKRIELSKKSYIKDLSNLYQLNLRSSSFLLHNMNSKVENLLNFNGL
                     VHNTHTLAGRLWDMVRKKSFTNTDIPPDQYERDLFQSLKLMKLERPNDLVKAVLAYTK
                     KNVLATLSLEYTSITTYILKLFLNEVLDLEQLWDLFSTVNDTFTDVSCQKFLKGLMFD
                     KYFSDIECIQLLSDFELLKLKMVRSKVKQTDFKSWCSRMRQCLLEIDSPETNNGRTNS
                     TPVSTELDQLPTSTTNNLPTPMQLMSTPTTVSNFDSMLSTTPFNSFLSRFKDEVMETC
                     KEMINVHTELSIKFFNGLTSSLQGEGMSIRILNQLLLQNDQVIVSCNDMSKVLQLLDP
                     LNLGVCQLLTKTLHEKAFQYKRKKNSMNHEEKSSLMADLTLCFLKDLMKMPKYQHSDH
                     KSLELVGELFRFLEPDLKLLLLHSCELFFLTSEMFPLVNSREDNPGDNTLDILYLIIN
                     SCTRYEDLFSLSSKYQNGIPIPDNLVFSLTVSLEKMIGKCARPKRKLDKHAEQKAIES
                     SILLVCRIILIHKGYLVGLILKRSTGNINKDSFLQNLVKLFNSKFIKSSSKLENLLYD
                     IIVSIKILIGEHIGSTNHEILNVSPPDYSNKLNYLLENVSFQDGLRMSNDSQELFVQN
                     TKTKTLSKFYIRPYELLPETTTKMEESCINLHLFNASTELKNPK"
     gene            complement(<950205..>951569)
                     /locus_tag="PAS_chr1-1_0202"
                     /db_xref="GeneID:8197923"
     mRNA            complement(<950205..>951569)
                     /locus_tag="PAS_chr1-1_0202"
                     /product="Subunit of the RNA polymerase II mediator
                     complex"
                     /transcript_id="XM_002489806.1"
                     /db_xref="GeneID:8197923"
     CDS             complement(950205..951569)
                     /locus_tag="PAS_chr1-1_0202"
                     /codon_start=1
                     /product="Subunit of the RNA polymerase II mediator
                     complex"
                     /protein_id="XP_002489851.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0202"
                     /db_xref="EnsemblGenomes-Tr:CAY67570"
                     /db_xref="GeneID:8197923"
                     /db_xref="GOA:C4QWE7"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:C4QWE7"
                     /translation="MSWKLTNQLRDKIYRYARFPPTGVSLRQMVQFGPKPSAGTLFHA
                     SQFVVEELPIRLAHRVKELEELPDDLNQMPSIQRVRDWYARSFDELTSLAAPDISDEL
                     RNLLYEDGHNHLYQPEMNEMPPNNIQVQHSDTSFDDDGLVISNRHHHSKATSASQNQS
                     SNKKKYYLSCPSNVVYPKEVYEYNKLVADTLKTIKKRHDATVPTVARGVQEWKHAKNQ
                     MSIESNIQSFLDRFYLSRIGIRILIGQTIALNQDIGNDNYVGIICLNTNVADVARDAI
                     DSARFTCEEHYGLFEAPKVQLYCPEDLTFMYVPGHLIHMLFETLKNSLRATVEHHIQL
                     NPGVDIEDIEFPPVKIIVAEGNEDITIKISDEGGGIPRSAISLIWTYLYTTVEEMPSL
                     DHDTDAKADFRAPMSGLGFGLPLSRLYARYFGGDLKLISMENYGTDVYLHLNRLSSSS
                     EPLP"
     gene            complement(<951929..>953710)
                     /locus_tag="PAS_chr1-1_0203"
                     /db_xref="GeneID:8196706"
     mRNA            complement(<951929..>953710)
                     /locus_tag="PAS_chr1-1_0203"
                     /product="General amino acid permease"
                     /transcript_id="XM_002489807.1"
                     /db_xref="GeneID:8196706"
     CDS             complement(951929..953710)
                     /locus_tag="PAS_chr1-1_0203"
                     /codon_start=1
                     /product="General amino acid permease"
                     /protein_id="XP_002489852.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0203"
                     /db_xref="EnsemblGenomes-Tr:CAY67571"
                     /db_xref="GeneID:8196706"
                     /db_xref="GOA:C4QWE8"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C4QWE8"
                     /translation="MLISSHLISPMKEQKEVKEKTKDLEADDVYHSIQGDVKQDSGYF
                     SRFIDSFKPMPSDENDSDMDTGLTDAQRTAIKTARNPMKQKLKSRHLQLITIGGSIGT
                     GLFIGTGSALHTGGPAAVLIAWTLTGTMLYCTIQALGELASTFPRVLGGFNTYTSRFV
                     DPALGFAVSWNYMLQWLVLLPLELVASSMTIKYWNTSVHPDIWVAIFYVFIVVVNLFG
                     VKGYAEVECAFSLLKIIAIVGFIILGIVLCAGGAPNGLNNGAKYYYDPGAFAAGFKGV
                     CSTFITSAFSLAGTEFIGLTATETLNPRKTLPSATKQVFWRILLFYMVSLTIITFLVP
                     SNDPRLLGASSDASVSPFAMAIEAGGISGLPSVINAVILISILGVANTSVYATSRVLL
                     GLSASGHAPKILSFVDRAGRPMAATAVTLVFGLLAFIAASEKEDEVFTWLLSISGMSA
                     IFTWLLICFSHIRFRSALKAQGHNVEDLTFVSQSGVIGSWYGVGVNVLIFVVTFWVAL
                     FPIGERANVESFFESYLGFVVFWACYFGYKLWRKDFSFSFVPVETMDIQSGRVDMDVE
                     LLKEEIRQEKEFIRSQPFYYRTYKFWC"
     gene            complement(<953823..>954729)
                     /locus_tag="PAS_chr1-1_0204"
                     /db_xref="GeneID:8196707"
     mRNA            complement(join(<953823..954561,954656..>954729))
                     /locus_tag="PAS_chr1-1_0204"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489808.1"
                     /db_xref="GeneID:8196707"
     CDS             complement(join(953823..954561,954656..954729))
                     /locus_tag="PAS_chr1-1_0204"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489853.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0204"
                     /db_xref="EnsemblGenomes-Tr:CAY67572"
                     /db_xref="GeneID:8196707"
                     /db_xref="GOA:C4QWE9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QWE9"
                     /translation="MENCLYITGFGNGVTKDELRDFFEGYGKIARVDILPSRDLESTP
                     YAFVQFQEAADFEAALAKKSHLCDLAVDPEKGLKVEKAKSAPNLKRDRMLASRRRYGS
                     GDGYRSYRGGYRDYYHDRYSDRGYHEYSRDPHPRYRPSDYDEGYHRNSYDHYYGPEPP
                     YDYRDGYYNERRSRPSSRDPRDYDPDYYRGYHPQDRHYYSSRDYSRDYQRDRKYEHPQ
                     DHEGKASTAYYRDRYPVRPSRKDEALPSTGPPSADGKSPVANEEQDSSIRNN"
     gene            complement(<954946..>955348)
                     /locus_tag="PAS_chr1-1_0205"
                     /db_xref="GeneID:8196708"
     mRNA            complement(join(<954946..955153,955206..>955348))
                     /locus_tag="PAS_chr1-1_0205"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002489809.1"
                     /db_xref="GeneID:8196708"
     CDS             complement(join(954946..955153,955206..955348))
                     /locus_tag="PAS_chr1-1_0205"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002489854.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr1-1_0205"
                     /db_xref="EnsemblGenomes-Tr:CAY67573"
                     /db_xref="GeneID:8196708"
                     /db_xref="InterPro:IPR013726"
                     /db_xref="UniProtKB/TrEMBL:C4QWF0"
                     /translation="MFNVSAIGIESTQRITNQRQLGKIFHYTVDLVLISIILAALRKN
                     TGLSLTASDLSSSNDGQTYIKKYLGFGEYSYNLLVSFARRSRWFKQRPIRDTNDLRDR
                     IKQEVNGFIDDTSK"
     gene            <955547..>956540
                     /locus_tag="PAS_chr1-1_0206"
                     /db_xref="GeneID:8196709"
     mRNA            join(<955547..955550,955564..>956540)
                     /locus_tag="PAS_chr1-1_0206"
                     /product="Subunit of the COMPASS (Set1C) complex, which
                     methylates histone H3 on lys 4"
                     /transcript_id="XM_002489810.1"
                     /db_xref="GeneID:8196709</